You are on page 1of 305

NokiaNetworks

WCDMARANFunctionalArea
Descriptions,Rel.RU50,
OperatingDocumentation,
Issue02

WCDMARANRRMHSUPA
DN70303923
Issue06B
ApprovalDate2014-08-27

WCDMARANRRMHSUPA

The information in this document applies solely to the hardware/software product (Product) specified
herein,andonlyasspecifiedherein.

ThisdocumentisintendedforusebyNokiaSolutionsandNetworks'customers(You)only,anditmaynot
beusedexceptforthepurposesdefinedintheagreementbetweenYouandNokiaSolutionsandNetworks
(Agreement) under which this document is distributed. No part of this document may be used, copied,
reproduced, modified or transmitted in any form or means without the prior written permission of Nokia
Solutions and Networks. If you have not entered into an Agreement applicable to the Product, or if that
Agreementhasexpiredorhasbeenterminated,YoumaynotusethisdocumentinanymannerandYou
areobligedtoreturnittoNokiaSolutionsandNetworksanddestroyordeleteanycopiesthereof.

The document has been prepared to be used by professional and properly trained personnel, and You
assumefullresponsibilitywhenusingit.NokiaSolutionsandNetworkswelcomeYourcommentsaspartof
theprocessofcontinuousdevelopmentandimprovementofthedocumentation.

This document and its contents are provided as a convenience to You. Any information or statements
concerningthesuitability,capacity,fitnessforpurposeorperformanceoftheProductaregivensolelyon
anasisandasavailablebasisinthisdocument,andNokiaSolutionsandNetworksreservestheright
tochangeanysuchinformationandstatementswithoutnotice.NokiaSolutionsandNetworkshasmadeall
reasonableeffortstoensurethatthecontentofthisdocumentisadequateandfreeofmaterialerrorsand
omissions, and Nokia Solutions and Networks will correct errors that You identify in this document. But,
NokiaSolutionsandNetworks'totalliabilityforanyerrorsinthedocumentisstrictlylimitedtothecorrection
ofsucherror(s).NokiaSolutionsandNetworksdoesnotwarrantthattheuseofthesoftwareintheProduct
willbeuninterruptedorerror-free.

NO WARRANTY OF ANY KIND, EITHER EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO
ANY WARRANTY OF AVAILABILITY, ACCURACY, RELIABILITY, TITLE, NON-INFRINGEMENT,
MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE, IS MADE IN RELATION TO THE
CONTENT OF THIS DOCUMENT. IN NO EVENT WILL NOKIA SOLUTIONS AND NETWORKS BE
LIABLE FOR ANY DAMAGES, INCLUDING BUT NOT LIMITED TO SPECIAL, DIRECT, INDIRECT,
INCIDENTAL OR CONSEQUENTIAL OR ANY LOSSES, SUCH AS BUT NOT LIMITED TO LOSS OF
PROFIT, REVENUE, BUSINESS INTERRUPTION, BUSINESS OPPORTUNITY OR DATA THAT MAY
ARISEFROMTHEUSEOFTHISDOCUMENTORTHEINFORMATIONINIT,EVENINTHECASEOF
ERRORSINOROMISSIONSFROMTHISDOCUMENTORITSCONTENT.

ThisdocumentisNokiaSolutionsandNetworksproprietaryandconfidentialinformation,whichmaynotbe
distributed or disclosed to any third parties without the prior written consent of Nokia Solutions and
Networks.

Nokia is a registered trademark of Nokia Corporation. Other product names mentioned in this document
maybetrademarksoftheirrespectiveowners,andtheyarementionedforidentificationpurposesonly.

Copyright2014NokiaSolutionsandNetworks.Allrightsreserved.

f ImportantNoticeonProductSafety
Thisproductmaypresentsafetyrisksduetolaser,electricity,heat,andothersourcesofdanger.

Only trained and qualified personnel may install, operate, maintain or otherwise handle this
productandonlyafterhavingcarefullyreadthesafetyinformationapplicabletothisproduct.

The safety information is provided in the Safety Information section in the Legal, Safety and
EnvironmentalInformationpartofthisdocumentordocumentationset.

Nokia Solutions and Networks is continually striving to reduce the adverse environmental effects of its
productsandservices.Wewouldliketoencourageyouasourcustomersanduserstojoinusinworking
towardsacleaner,saferenvironment.Pleaserecycleproductpackagingandfollowtherecommendations
forpoweruseandproperdisposalofourproductsandtheircomponents.

IfyoushouldhavequestionsregardingourEnvironmentalPolicyoranyoftheenvironmentalserviceswe
offer,pleasecontactusatNokiaSolutionsandNetworksforanyadditionalinformation.

2 DN70303923 Issue:06B
WCDMARANRRMHSUPA

TableofContents
Thisdocumenthas305pages

Summaryofchanges................................................................... 15

1 DescriptionofradioresourcemanagementofHSUPA................ 17
1.1 OverviewofHSUPA..................................................................... 17
1.2 IntroductiontoradioresourcemanagementofHSUPA............... 19
1.2.1 HSUPApowercontrol...................................................................20
1.2.2 HSUPAhandovers....................................................................... 20
1.3 ArchitectureofradioresourcemanagementofHSUPA............... 21
1.4 FeaturesrelatedtoradioresourcemanagementforHSUPA.......22
1.4.1 HSPAinter-RNCcellchange........................................................22
1.4.2 HSUPAwithsimultaneousAMRvoicecall..................................23
1.4.3 HSDPAinter-frequencyhandover................................................ 23
1.4.4 HSUPA60usersperBTS............................................................ 24
1.4.5 QoSawareHSPAscheduling.......................................................24
1.4.6 StreamingQoSforHSPA............................................................. 24
1.4.7 HSPAmultiNRTRABs.................................................................25
1.4.8 PSNRTRABreconfiguration....................................................... 26
1.4.9 HSUPAPre-emptionLight............................................................26
1.4.10 HSPAoverIur...............................................................................27
1.4.11 Continuouspacketconnectivity....................................................27
1.4.12 CSvoiceoverHSPA.................................................................... 28
1.4.13 F-DPCHandSRBsonHSPA....................................................... 29
1.4.14 HSUPA2msTTI.......................................................................... 29
1.4.15 HSUPA5.8Mbps......................................................................... 30
1.4.16 HSPA72userspercell................................................................. 30
1.4.17 FlexibleRLC.................................................................................30
1.4.18 Powersavingmode......................................................................31
1.4.19 Dual-cellHSDPA42Mbps............................................................ 31
1.4.20 LTEInterworking.......................................................................... 32
1.4.21 DirectResourceAllocationforHSPA........................................... 32
1.4.22 HSUPAInterferenceCancellationReceiver................................. 33
1.4.23 HSPA128UsersperCell............................................................. 34
1.4.24 HSUPA16QAM............................................................................ 35
1.4.25 Inter-AdapterServingCellChangecombinedRoleswitch........... 35
1.4.26 ExtensionofHSPAoverIur..........................................................35
1.4.27 DualBandHSDPA42Mbps.........................................................36
1.4.28 DynamicHSUPABLER................................................................36
1.4.29 HighSpeedCell_FACH................................................................37
1.4.30 SRVCCfromLTEandCSFBwithHO..........................................37
1.4.31 FlexibleULRLCinUL..................................................................38
1.4.32 MassEventHandler.....................................................................39
1.4.33 SatelliteIub.................................................................................. 39

Issue:06B DN70303923 3
WCDMARANRRMHSUPA

1.4.34 EnhancedHSUPAIC................................................................... 40
1.4.35 HSUPACompressedModeforLTEandinter-frequencyHandover
..................................................................................................... 41
1.5 Interactionwithotherfeatures......................................................42

2 MultiRABcombinationssupportedwithHSUPA..........................43

3 HSUPAconfigurationinthecell................................................... 45
3.1 SetupandreleaseofHSUPAconfigurationinthecell................. 45
3.2 AllocationandhandlingoftheHSUPAdownlinkcontrolchannels...
45

4 HSUPAchanneltypeselection.....................................................51
4.1 HSUPAULselection.................................................................... 58

5 BasicpacketschedulingandadmissioncontrolforHSUPA........ 63
5.1 Thresholdsforthepower-basedE-DCHschedulingintheBTS.. 63
5.2 RestrictionofsimultaneousE-DCHallocations............................64
5.3 RABmodificationhandlingforUEsusingHSUPAservicesin
Cell_DCHstate............................................................................ 68

6 AdmissiondecisionforRTservices............................................. 69
6.1 CelllevelmeasurementsusedbyPSstreamingandCSvoice... 69
6.2 LoadandinterferencebasedadmissiondecisionforPSstreaming
services........................................................................................ 70
6.3 LoadandinterferencebasedadmissiondecisionfortheCSvoice
establishment............................................................................... 75
6.4 RBsetupforinactivePSstreamingRABs................................... 83

7 RT-over-NRT,RT-over-RT,andRABpre-emption........................85
7.1 RT-over-NRT,RT-over-RT,andRABpre-emptionrelatedto
HSUPA......................................................................................... 85
7.2 RT-over-NRT,RT-over-RTandRABpre-emptionrelatedto
HSUPAforBTScongestion..........................................................92

8 Radiobearer,transportchannelandphysicalchannelparameters.
96
8.1 Radiobearer,transportchannelandphysicalchannelparameters
oftheHSUPA............................................................................... 96
8.2 E-DCHandE-TFCI.....................................................................118
8.3 Datadescriptionindicator...........................................................120
8.4 Servinggrantvalue.................................................................... 121
8.5 ConfigurationoftheMAClayer.................................................. 121
8.6 Maximumalloweduplinksymbolandbitrate.............................124
8.7 SelectionofHARQmethod........................................................ 137
8.8 SIRoftheDPCCHwhenE-DCHisconfiguredintheradiolink.138
8.9 BLERtargetsforE-DCHandDCH............................................ 140
8.9.1 DynamicHSUPABLER..............................................................140
8.10 E-DPDCHpowerinterpolation................................................... 142
8.11 DynamicHSUPApoweroffsets..................................................143

4 DN70303923 Issue:06B
WCDMARANRRMHSUPA

8.11.1 Selectionofhigh/lowbitrateoptimizedHSUPApoweroffset.... 143


8.11.2 AdditionalthresholdforDynamicHSUPAPowerOffsetsdueto
numberofHSPAusers...............................................................145
8.11.3 HSUPAdynamicpoweroffsetalgorithmtakesintoaccountRel99
loadofULDCH.......................................................................... 146

9 RLClayerconfiguration..............................................................147
9.1 RetransmissionparametersofAMRLC.....................................147
9.2 TransmissionandreceivingwindowsofRLC.............................156
9.3 DeliveryoftheRLCSDUstothehigherlayers.......................... 163

10 UEcapabilityrelatedtoE-DCH..................................................164

11 MinimumserviceforHSUPAusers............................................ 167
11.1 MinimumtotalE-DCHthroughputofthecell..............................167
11.2 BTSestimatesthetotaluplinkDCHthroughput.........................169
11.3 BTSdefinestheminimumtotalE-DCHthroughput....................172

12 SharinginterferencebetweenHSPAandNRTDCHusers........174
12.1 ReceivedE-DCHpowershare................................................... 175
12.2 DynamicinterferencetargetintheuplinkNRTDCHscheduling......
176
12.3 UplinkNRTDCHoverloadcontrolintheE-DCHcell................. 185
12.4 LoadbasedhandoveranddirectedRRCconnectionsetup.......189

13 PowercontrolforHSUPAdownlinksignalingchannels............. 190
13.1 SettingthepowersforHSUPAdownlinksignalingchannels..... 190

14 HSUPAhandovers..................................................................... 193
14.1 Softhandovers........................................................................... 193
14.1.1 E-DCHactiveset........................................................................193
14.1.2 Parametersetsinsofthandover................................................ 194
14.1.3 SRNCrelocation........................................................................ 195
14.1.4 Inter-RNCCellChange.............................................................. 195
14.1.5 SofthandoveroverIur................................................................196
14.2 Servingcellselectionandchange..............................................197
14.3 ChanneltypeswitchbetweenDCHandE-DCH........................ 197
14.3.1 Triggersforchanneltypeswitch.................................................198
14.3.2 ChanneltypeswitchfromDCHtoE-DCH..................................198
14.3.3 ChanneltypeswitchfromE-DCHtoDCH..................................203
14.3.4 Channeltypeswitchexecution...................................................207
14.4 Hardhandovers..........................................................................208
14.4.1 HSUPACompressedMode........................................................208
14.4.2 HSPAinter-frequencyhandover.................................................210
14.4.3 InteractionofHSUPACompressedModeforLTEandInter-
frequencyhandoverwithotherfeatures.....................................212

15 HandlingofinactiveE-DCHMAC-dflows.................................. 213
15.1 Preventiveoverloadcontrol........................................................216

Issue:06B DN70303923 5
WCDMARANRRMHSUPA


16 Continuouspacketconnectivity..................................................220
16.1 CPCactivation........................................................................... 221
16.2 CPCdeactivation....................................................................... 227

17 HSUPA16QAM.......................................................................... 229
17.1 HSUPA16QAMandE-DCHpowerboostingusage.................. 229
17.2 RLCPDUsize............................................................................ 230
17.3 BTScapabilityforHSUPA16QAMandE-DPCCHboosting......231

18 HighSpeedCell_FACH..............................................................232
18.1 HS-RACHfunctionality...............................................................233
18.1.1 SetupofHS-RACHconfigurationtothecell.............................. 233
18.1.2 UEcapabilityoftheHS-RACH...................................................235
18.1.3 ChannelizationcodeforHS-RACH............................................ 235
18.1.4 ThemaximumtotaluplinksymbolrateoftheHS-RACH........... 235
18.1.5 E-DCHuserbitrateswithHS-RACH......................................... 236
18.1.6 HARQmethodusedwithHS-RACH.......................................... 236
18.1.7 MaximumE-DCHresourceallocationforCCCH....................... 236
18.1.8 Maximumperiodforcollisionresolutionphase.......................... 236
18.1.9 ReleaseofCommonE-DCH...................................................... 237
18.1.10 PowercontrolalgorithmusedwithHS-RACH............................237
18.1.11 ServingGrantinformation.......................................................... 237
18.1.12 E-DCHResourceconfiguration..................................................237
18.1.13 PRACHpreamblecontrolforHS-RACH.................................... 239
18.1.14 CommonMACflows.................................................................. 241
18.1.15 RLCconfiguration...................................................................... 243
18.1.16 Measurementmanagement....................................................... 245

19 FlexibleRLCinUL..................................................................... 247
19.1 FlexibleULRLCusage.............................................................. 247
19.2 FlexibleULRLCfunctionalities.................................................. 247
19.3 Mobilityandchanneltypeswitch................................................249
19.4 RadioResourceManagementinFlexibleULRLC.................... 250

20 ManagementdataforHSUPARRM...........................................252
20.1 Alarms........................................................................................ 252
20.2 Counters.....................................................................................253
20.2.1 RAN826:BasicHSUPA.............................................................253
20.2.2 RAN973:HSUPAbasicRRM..................................................... 256
20.2.3 RAN970:HSUPAHandovers..................................................... 260
20.2.4 RAN974:HSUPAwithsimultaneousAMRvoicecall................. 260
20.2.5 RAN979:HSUPA2.0Mbps........................................................261
20.2.6 RAN1465:HSUPA60UsersperBTS........................................ 261
20.2.7 RAN1262-QoSawareHSPAscheduling..................................261
20.3 Keyperformanceindicators....................................................... 275
20.3.1 HSUPApacketschedulingandadmissioncontrolKPIs.............275

6 DN70303923 Issue:06B
WCDMARANRRMHSUPA

20.3.2 HSUPAmobilityKPIs................................................................. 277


20.3.3 MultiRABcombinationswithHSUPAKPIs................................ 278
20.3.4 HSUPAuserexperienceKPIs.................................................... 278
20.3.5 HSUPAqualityofservicemanagementKPIs.............................279
20.4 Parameters.................................................................................280
20.4.1 GeneralHSUPARRMparameters............................................. 280
20.4.2 HSUPApacketschedulingandadmissioncontrolparameters.. 283
20.4.3 HSUPAmobilityparameters.......................................................289
20.4.4 MultiRABcombinationswithHSUPAparameters..................... 293
20.4.5 HSUPAuserexperienceparameters......................................... 294
20.4.6 HSUPAqualityofservicemanagementparameters.................. 297

21 ManagementdataofFlexiDirect............................................... 305
21.1 Alarms........................................................................................ 305
21.2 Counters.....................................................................................305
21.3 Keyperformanceindicators....................................................... 305
21.4 Parameters.................................................................................305

Issue:06B DN70303923 7
WCDMARANRRMHSUPA

ListofFigures
Figure1 OverviewofHSUPA........................................................................... 18
Figure2 OverviewofWCDMAphysicalchannelswhenHSUPAisutilized......18
Figure3 LogicalworkingenvironmentofHSUPARRM....................................21
Figure4 HSPAchannelsforCSvoiceoverHSPA............................................28
Figure5 LTEInterworking.................................................................................32
Figure6 Principlesofinterferencesharingontheoriginalstream....................34
Figure7 TheEnhancedInterferenceCancellationprocedure.......................... 40
Figure8 Theresidualsignalstreamrelationship.............................................. 41
Figure9 Channeltypeselectionschemeofpacketscheduler......................... 51
Figure10 ChanneltypeselectionalgorithmbetweenE-DCHandDCH(part1)....
52
Figure11 ChanneltypeselectionalgorithmbetweenE-DCHandDCH(part2)....
53
Figure12 CPICHEcNovaluecalculation........................................................... 60
Figure13 ThresholdsforPSstreamingresourcerequest.................................. 70
Figure14 UplinkloadfactorforNRTRBstoeachSPIvalue............................. 72
Figure15 LoadfactorforstreamingradiobearersonE-DCH............................ 73
Figure16 Cell-specificE-DCHloadfactorforPSstreamingservices................ 73
Figure17 LoadfactorforinactivePSstreamingRBsonE-DCH....................... 73
Figure18 SPIspecificactivityfactorforE-DCHstreamingservices.................. 74
Figure19 CurrentlyuseduplinkactivityfactorforPSstreamingonE-DCH.......74
Figure20 UplinkloadfactoroftheE-DCHMAC-dflow......................................75
Figure21 LowerlimitforthesizeoftheMAC-ePDU......................................... 75
Figure22 ActivityfactoroftheSRBE-DCHMAC-dflow....................................76
Figure23 themaximumMAC-dbitratesoftheSRBs........................................76
Figure24 TheE-DCHMAC-dflowestablishedfortheCSAMRRAB................76
Figure25 themaximumE-DCHbitrateoftheCSAMRspeechRAB................77
Figure26 ActivityfactoroftheCSspeechE-DCHMAC-dflow..........................77
Figure27 MaximumMAC-dbitratesoftheCSvoicebearers........................... 77
Figure28 TheuplinkloadfactoroftheE-DCHMAC-dflowofCSvoicebearer....
78
Figure29 L1overheadoftheRTservicesoftheRRCconnection.................... 78
Figure30 HS-DPCCHpoweroffsetvalue.......................................................... 79
Figure31 Thenon-controllableloadfortheRRCconnections...........................79
Figure32 Theinstantaneousvaluefortheestimatedreceivedsemi-controllable
interference.........................................................................................79
Figure33 Theestimatedreceivednon-controllableinterferenceinthecellthat
hastheHSUPAconfigured................................................................. 80
Figure34 ResourcerequestfortheestablishmentoftheSRBorCSspeech
service................................................................................................ 80

8 DN70303923 Issue:06B
WCDMARANRRMHSUPA

Figure35 ValueofthemanagementparameterisOverridenotallowed............81
Figure36 ValueofthemanagementparameterisOverrideallowed..................81
Figure37 PowerincreaseestimationfortheRTserviceresourcerequest........ 82
Figure38 PowerincreaseestimationforthePSstreamingserviceresource
request................................................................................................82
Figure39 FirstcheckforRT-over-NRTpossibility(IftheRT-over-NRTisdonein
theassignmentphase)....................................................................... 87
Figure40 FirstcheckforRT-over-NRTpossibility(IftheRT-over-NRTisdonein
anyotherphasethanassignmentphase).......................................... 87
Figure41 Prx_target_PS_target_new................................................................ 88
Figure42 RT-over-NRTpowerontheEDCHside..............................................88
Figure43 RT-over-NRTpowerontheDCHside................................................ 88
Figure44 UnusedpoweronE-DCH................................................................... 89
Figure45 LoadfactoroflowpriorityusersonE-DCH........................................ 89
Figure46 AvailablepowerfromlowpriorityusersonE-DCH.............................89
Figure47 LoadfactorforhighpriorityuseronE-DCH....................................... 90
Figure48 AvailablepowerfromhighpriorityusersonE-DCH........................... 90
Figure49 AvailabilityofpoweronE-DCHsidefornewstreaminguser............. 90
Figure50 AvailableloadfactoronDCH............................................................. 90
Figure51 DCHloadfactorperSPI..................................................................... 91
Figure52 AvailablepoweronDCH.................................................................... 91
Figure53 PoweravailabilityonDCHsidefornewstreaminguser.....................91
Figure54 MaximumuserbitrateoftheULRBandTTIoftheE-DCHforMAC-
e/es...................................................................................................123
Figure55 MaximumuserbitrateoftheULRBandTTIoftheE-DCHforMAC-
i/is..................................................................................................... 123
Figure56 E-DCHmaximumbitrate..................................................................125
Figure57 Themaximumnumberofbits/2msTTIforfixedULRLCPDUsize. 126
Figure58 Themaximumnumberofbits/2msTTIforflexibleULRLCPDUsize....
126
Figure59 NumberofMAC-dPDUs.................................................................. 128
Figure60 MaximumnumberofbitsperMAC-ePDUfornon-scheduled
transmission..................................................................................... 128
Figure61 MaximumnumberofbitsperMAC-ePDUwithMAC-e/es...............129
Figure62 MaximumnumberofbitsperMAC-ePDUwithMAC-i/is................. 129
Figure63 MaximumnumberNmaxNST(voice)oftheNSTbitsperMAC-ePDUfor
MAC-e/es..........................................................................................130
Figure64 MaximumnumberNmaxNST(voice)oftheNSTbitsperMAC-ePDUfor
MAC-i/is............................................................................................ 131
Figure65 ThemaximumE-DCHbitrate.......................................................... 132
Figure66 NetbitrateofMAC-ePDU............................................................... 133
Figure67 Numberofcodeblocksandthesizeofeachcodeblock................. 133

Issue:06B DN70303923 9
WCDMARANRRMHSUPA

Figure68 ExpectedAMRLCstatusreportingperiodforE-DCH......................150
Figure69 MaximumE-DCHuserdatarateoftheAMRLCforMAC-es...........150
Figure70 MaximumE-DCHuserdatarateoftheAMRLCforMAC-is............150
Figure71 ValueofAMRLC#Poll_ByteforE-DCH.......................................... 151
Figure72 ValueofAMRLC#Poll_PDUforE-DCH.......................................... 151
Figure73 MaxPDUPayloadSize....................................................................... 151
Figure74 ValueofAMRLC_SDUforE-DCH................................................... 154
Figure75 TimerbasedSDUdiscardconfiguration........................................... 155
Figure76 AvailableUEbuffer........................................................................... 157
Figure77 PDCPPDUisoctetaligned.............................................................. 162
Figure78 Minimumuplinkowncellloadfactor.................................................167
Figure79 MinimumthroughputforE-DCHschedulinginBTS......................... 168
Figure80 UplinkDCHloadfactorofCCTrCH.................................................. 171
Figure81 UplinkDCHloadfactoroftheRRCconnection................................171
Figure82 UplinkDCHowncellloadfactor....................................................... 171
Figure83 MaintainingoftheuplinkDCHowncellloadfactor.......................... 171
Figure84 AvailableguaranteedE-DCHthroughput......................................... 173
Figure85 DynamicinterferencetargetfortheNRTDCHschedulinginRNC.. 175
Figure86 Totalreceivednon-EDCHscheduledtransmissioninterferencepower
ofthecell.......................................................................................... 175
Figure87 AveragedPrxNonEDCHST.....................................................................176
Figure88 InterferencecongestionofE-DCH....................................................178
Figure89 InterferencecongestionofNRTDCH............................................... 178
Figure90 MinimumDCHloadthresholdintheDCHcongestiondetection...... 178
Figure91 IdealinterferencetargetPrxTargetIdeal........................................... 179
Figure92 DecreaseofthePrxTargetPS........................................................... 180
Figure93 IncreaseofthePrxTargetPS.............................................................181
Figure94 RAB-specificweightsinDCHandE-DCHconfigurations................ 182
Figure95 CellleveluplinkDCHandE-DCHweightfactors............................. 183
Figure96 GeneralconditionsoftheuplinkDCHoverload................................185
Figure97 ExampleofenhancedoverloadcontrolfortheULNRTDCHradio
bearer,OCULNRTDCHGrantedMinAllocTandLoadControlPeriodPS
interactions....................................................................................... 188
Figure98 Exampleofloaddecreasealgorithm,DCHmodification.................. 188
Figure99 Exampleofloaddecreasealgorithm,DCHmodificationandrelease....
188
Figure100 EDCHTSwitchGuardTimer................................................................201
Figure101 E-DCHactivesetchangestoacceptable......................................... 201
Figure102 E-DCHactivesetchangestounacceptable..................................... 205
Figure103 ThroughputmeasurementoftheE-DCHNRTMAC-dflow.............. 214

10 DN70303923 Issue:06B
WCDMARANRRMHSUPA

Figure104 SettingoftimertoextendthetimeofinactiveuserinCell_DCHstate...
216
Figure105 Preventiveoverloadcontrol.............................................................. 217
Figure106 ULgating.......................................................................................... 220
Figure107 CPCactivation..................................................................................222
Figure108 CPCactivationfortheUE.................................................................223
Figure109 HSUPAchannelmappinginCELL_FACHstate............................... 232
Figure110 HSPAusageonCEL_FACHstatevs.HSPAusageonCELL_DCH
state..................................................................................................233
Figure111 HSPAusage..................................................................................... 234

Issue:06B DN70303923 11
WCDMARANRRMHSUPA

ListofTables
Table1 Supportedbandcombinations............................................................36
Table2 E-DCH-relatedparameterssignaledfromtheRNCtotheUEinthe
RRC....................................................................................................96
Table3 E-DCHrelatedparameterssignaledfromUEtoRNCinRRC......... 103
Table4 E-DCHrelatedparameterssignaledfromRNCtoNodeBinNBAP
andfromSRNCtoDRNCinRNSAP................................................103
Table5 E-DCHrelatedparameterssignaledfromRNCtoNodeBinprivate
NBAP.................................................................................................115
Table6 E-DCHrelatedparameterssignaledfromBTStoRNCinNBAPand
DRNCtoSRNCviaRNSAP..............................................................116
Table7 E-DCHrelatedparameterssignaledfromBTStoRNCinaprivate
NBAP.................................................................................................118
Table8 MaximumnumberofMAC-dPDUs(NMACd)forSRBandAMR,E-TTI
=2ms...............................................................................................130
Table9 MaximumnumberofMAC-dPDUs(NMACd)forSRBandAMR,E-TTI
=10ms.............................................................................................130
Table10 E-DPDCHslotformats......................................................................134
Table11 ExampleofrequiredE-DPDCH(s)spreadingfactor(s)foreachuserbit
rate................................................................................................... 134
Table12 InitialSIRofDPCCHwhenE-DCHisconfigured............................. 138
Table13 MinimumandmaximumSIRofDPCCHwhenE-DCHisconfigured.....
139
Table14 FixedtableDynPwrOffsetTable10.............................................. 144
Table15 FixedtableDynPwrOffsetTable2................................................ 145
Table16 FixedtableDynPwrOffsetTable10Mix........................................145
Table17 UsedpollingandstatusreportingtriggersfortheAMRLCsofthe
bearers............................................................................................. 148
Table18 SPDUandSAMDPDUsizesinflexibleULRLCcase............................153
Table19 TransportchannelparametersforSRBsonE-DCH.........................158
Table20 UMDPDUsizesfortheRBofCSAMR........................................... 162
Table21 UMDPDUsizesfortheRBCSAMRWB.........................................162
Table22 MAC-dPDUsizesfortheRBofCSAMR........................................ 162
Table23 MAC-dPDUsizesfortheRBCSAMRWB......................................162
Table24 FDDE-DCHphysicallayercategories............................................. 164
Table25 TotalRLCandMAC-hsparametersforFDDHS-DSCHandE-DCH
physicallayercategories.................................................................. 165
Table26 ContentsofthecellloadfactorIE.....................................................169
Table27 ContentsoftheloadDCHTable...................................................... 170
Table28 ContentsoftheloadDPCCHTable.................................................. 170
Table29 ExampleloadDCHtableforthePSinteractiveRABofTHP1........ 172
Table30 ExamplefortheDPCCHloadfactormapping.................................. 172
Table31 ContentsoftheSIRDPCCHoffsetIE.............................................. 173

12 DN70303923 Issue:06B
WCDMARANRRMHSUPA

Table32 ExamplemappingoftheRABspecificDCHandHSDPAweights... 183


Table33 AlarmsrelatedtoHSUPAradioresourcemanagement................... 252
Table34 CellresourcemeasurementsforbasicHSUPA................................ 253
Table35 ServicelevelmeasurementsforbasicHSUPA.................................254
Table36 RCPMOLPCmeasurementsforbasicHSUPA................................254
Table37 PacketcallmeasurementsforbasicHSUPA....................................255
Table38 CellthroughputmeasurementsforbasicHSUPA.............................256
Table39 CellresourcemeasurementsforHSUPAbasicRRM.......................256
Table40 TrafficmeasurementsforHSUPAbasicRRM.................................. 257
Table41 RRCsignallingmeasurementsforHSUPAbasicRRM.................... 259
Table42 RCPMOLPCmeasurementsforHSUPAbasicRRM...................... 260
Table43 HSUPAhandovercounters...............................................................260
Table44 HSUPAwithsimultaneousAMRvoicecallcounters........................ 260
Table45 HSUPA2.0Mbpscounters............................................................... 261
Table46 HSUPA60UsersperBTS................................................................ 261
Table47 CountersforQoSawareHSPAscheduling...................................... 261
Table48 CountersforHSUPAPre-emtionLight............................................. 264
Table49 CountersforHSUPA2msTTI.......................................................... 264
Table50 CountersforContinuousPacketConnectivity.................................. 266
Table51 CountersforCSVoiceoverHSPA................................................... 267
Table52 CountersforHSPA72UsersperCell.............................................. 270
Table53 CountersforFlexibleRLC(DL)........................................................ 272
Table54 CountersforFractionalDPCH..........................................................272
Table55 CountersforPowerSavingMode.....................................................273
Table56 CountersforMassEventHandler.................................................... 274
Table57 RAN968:HSUPABTSpacketschedulerKPIs................................. 275
Table58 RAN973:HSUPAbasicRRMKPIs...................................................275
Table59 RAN970:HSUPAhandoversKPIs................................................... 277
Table60 RAN1515:HSPAinter-RNCcellchangeKPIs..................................277
Table61 RAN285:HSPAmultiNRTRABsKPIs.............................................278
Table62 RAN979:HSUPA2.0MbpsKPIs..................................................... 278
Table63 RAN930:PSRABreconfigurationKPIs........................................... 279
Table64 RAN1004:StreamingQoSforHSPAKPIs....................................... 279
Table65 GeneralHSUPARRMparameters................................................... 280
Table66 RAN2302:DynamicHSUPABLERparameters............................... 281
Table67 RAN826:BasicHSUPAparameters................................................. 283
Table68 RAN973:HSUPAbasicRRMparameters........................................ 284
Table69 RAN2879:MassEventHandlerparameters.................................... 288
Table70 RAN970:HSUPAhandoversparameters......................................... 289
Table71 RAN1515:HSPAinter-RNCcellchangeparameters....................... 290

Issue:06B DN70303923 13
WCDMARANRRMHSUPA

Table72 RAN1470:HSUPA2msTTIparameters.......................................... 290


Table73 RAN1689:CSVoiceoverHSPA.......................................................290
Table74 RAN1644:ContinuousPacketConnectivityparameters.................. 292
Table75 RAN1645:HSUPA16QAMparameters........................................... 292
Table76 RAN2067:LTEInterworkingparameters.......................................... 292
Table77 RAN1231:HSPAoverIurparameters.............................................. 293
Table78 RAN2270:ExtensionofHSPAoverIurparameters......................... 293
Table79 RAN1910:FlexibleULRLCparameters...........................................293
Table80 RAN974:HSUPAwithSimultaneousAMRVoiceCallparameters.. 293
Table81 RAN285:HSPAmultiNRTRABsparameters.................................. 294
Table82 RAN979:HSUPA2.0Mbpsparameters........................................... 294
Table83 RAN1465:HSUPA60UsersperBTSparameters........................... 294
Table84 RAN2124:HSPA128UsersperCellparameters............................ 294
Table85 RAN1913:HighSpeedCell_FACHparameters............................... 295
Table86 RAN164:SatelliteIub....................................................................... 297
Table87 RAN930:PSRABReconfigurationparameters............................... 297
Table88 RAN1004:StreamingQoSforHSPAparameters............................ 297
Table89 RAN1262:QoSawareHSPAschedulingparameters...................... 303

14 DN70303923 Issue:06B

WCDMARANRRMHSUPA Summaryofchanges

Summaryofchanges
Changesbetweendocumentissuesarecumulative.Therefore,thelatestdocument
issuecontainsallchangesmadetopreviousissues.

g MulticontrollerRNCcontentisonmcRNC3.0level,andisnotvalidforRU50.

g FlexiDirectcontentisonFlexiDirectRU40level,andisnotvalidforRU50.

Changesbetweenissues06A(2014-06-04,RU50)and06B(2014-08-
27,RU50)

FeaturesrelatedtoradioresourcemanagementforHSUPA(1.4)

SectionSatelliteIubhasbeenadded.

RetransmissionparametersofAMRLC(9.1)

SectionAlgorithmtosetthedataratedependentpollingtriggershasbeenupdated.

TransmissionandreceivingwindowsofRLC(9.2)

SectionRetransmissionparametersfortheAMRLCentitiesoftheSRBsonHSUPA
aretransferredinE-DCH/DCHconfiguration(HSUPA2msTTI)hasbeenupdated.

Softhandovers(14.1)

SectionSofthandoveroverIurhasbeenupdated.

ChanneltypeswitchbetweenDCHandE-DCH(14.3)

SectionChanneltypeswitchfromDCHtoE-DCHhasbeenupdated.

Parameters(20.4)

Table86:RAN164:SatelliteIubhasbeenadded.

Changesbetweenissues06(2014-02-27,RU50)and06A(2014-06-04,
RU50)

HSUPAULselection(4.1)

SectionUE-specificentityselectstheULTTItobeusedforE-DCHbetween2ms
and10mshasbeenupdated.

Radiobearer,transportchannelandphysicalchannelparameters(8)

SectionAdditionalthresholdforDynamicHSUPAPowerOffsetsduetonumberof
HSPAusershasbeenadded.
SectionE-DPDCHpowerinterpolationhasbeenupdated.

Changesbetweenissues05E(2014-01-10,RU40)and06(2014-02-27,
RU50)
Hardhandovers

Issue:06B DN70303923 15

Summaryofchanges WCDMARANRRMHSUPA

TheinformationontheHSPAInter-Frequencyhandoverwasaddedtothe
chapterHSPAinter-frequencyhandover
TheinformationontheHSUPACompressedModewasaddedtothe
chapterInteractionofHSUPACompressedModeforLTEandInter-frequency
handoverwithotherfeatures
GeneralHSUPARRMparameters
TheRAN2302featurerelatedparameterswereadded
DynamicHSUPABLER
TheinformationregardingtheRU40_MAINT_14(002:2110)PRFILEparameterwas
added.
DynamicHSUPABLER
Theinformationregardingthefeaturelicencewasupdated.

16 DN70303923 Issue:06B

WCDMARANRRMHSUPA DescriptionofradioresourcemanagementofHSUPA

1 Descriptionofradioresourcemanagementof
HSUPA

g NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.

g NotethatlicenseinformationisrelevantonlytotheIPA-RNCsolution.In
FlexiDirectRNCtherearenolicensesassuch.Thelicensesaretrustbased
andallofthefeaturesgiveninthereleaseareactivebydefault.Theparameters
responsibleforenablingparticularfeaturesaremostlyOFFbydefault.To
enabletheuseofafeaturechangethevalueoftheparametertoON.

High-speeduplinkpacketaccess(HSUPA)isawidebandcodedivisionmultiple
access(WCDMA)keyfeature,whichprovideshighdataratetransmissiontosupport
multimediaservicesfortheWCDMAradioaccessnetwork(RAN).
HSUPAbringsbenefitstoboththeoperatorsandtheend-users.Inpractice,HSUPA
offershigherdataratestoendusers,largercoverageareasespeciallyforhighbitrates,
lowerdelayincaseoftransmissionfailures,largercapacityintheradionetwork,andthe
opportunityfortheoperatortodeliverservicestheexistingonesandthenewonesat
alowercostofbit.
Thisdocumentdescribestheradioresourcemanagement(RRM)-relatedpartsofthe
HSUPAimplementationfortheWCDMAradioaccessnetwork.

1.1 OverviewofHSUPA
HSUPAimprovesuplinkcapabilitiestomatchthosewithhigh-speeddownlinkpacket
access(HSDPA)capabilities.
HSUPAbringsthefollowingnewfunctionalitiestotheradioaccessnetwork:

Higheruplinkbitrates(multicode)
UplinkHybridautomaticrepeatrequest(HARQ)betweentheuserequipment(UE)
andthebasetransceiverstation(BTS)
FastBTS-controlledschedulinginuplinkdirectioninsteadofschedulingperformed
bytheradionetworkcontroller(RNC)
Newphysicallayer(L1)signalingbetweentheUEandtheBTS
NewIubsignalingbetweentheBTSandtheRNC

ThefigureFigure1:OverviewofHSUPAillustratesthebasicprinciplesofHSUPA.The
HSUPAfunctionisbasedonfastBTS-controlledscheduling.Itprovidescapacitygain
becauseofmoreoptimalutilizationoftheradiointerface,BTSHW,RNCHWandIub
transmissionresources,whichfacilitatemoreaggressiveschedulingofdatarates.Fast
HARQbetweentheUEandtheBTSresultsinhighercapacity,lowerdelay,and
improvedcellcoverage.

Issue:06B DN70303923 17

DescriptionofradioresourcemanagementofHSUPA WCDMARANRRMHSUPA

Figure 1 OverviewofHSUPA

NewNodeB functions: SetupofHSUPA,


Uplinkpacket datascheduling E-DCHallocation,
HARQcontrol: Ack/Nack parametrization,
release,OLPC,
Mac-e connectioncontrol,...
NewL1signalling

RNCRRM
Ack/Nack
+bitrategrants

Datapacket lub
UE +possible
retransmissions NodeB RNC
+bitrate requests
Newlubsignalling

ThefigureFigure2:OverviewofWCDMAphysicalchannelswhenHSUPAisutilized
illustratestheoverviewoftheWCDMAphysicalchannelswhenHSUPAisincludedin
additiontoHSDPA.Inthisscenario,theactivesetcontainsanenhanceddedicated
channel(E-DCH)servingcell,anE-DCHnon-servingcell,andaNon-E-DCHcell.

Figure 2 OverviewofWCDMAphysicalchannelswhenHSUPAisutilized

Scenario: Activeset contains E-DCH


serving cell,E-DCH non-serving cell
and Non-E-DCHcell

Non-E-DCHcell
E-DCH
serving cell
(also E-HICH(Ack/Nack) E-DCH
HS-DSCH E-RGCH DPDCH(DCH)/DPCCH non-serving
servingcell) (Up,Hold,Down) (TFCI, TPC) cell
E-AGCH(Maxpower
ratio,E-RNTI)
DPDCH(DCH)/DPCCH
(TFCI, TPC) E-HICH(Ack/Nack)
HS-PDSCH(HS-DSCH) E-RGCH(Hold,Down)
HS-SCCH DPDCH(DCH)/DPCCH
(TPRI,HARQ,UEid) (TFCI, TPC)

UE
E-DPDCH(E-DCH)/E-DPCCH(E-TFCI,RSN,Happy bit)
DPDCH(DCH)/DPCCH(TFCI, TPC,FBI)
HS-DPCCH(HARQ, Ack/Nack,CQI)

Theoperator'sbenefitsoftheHSUPAfeatureareasfollows:

HSUPAallowstheoperatortoprovidemorecapabilityandcost-efficientnon-real
timepriorityscanning(NRTPS)dataservicesfortheusers.Theuplinkcapabilities
matchthoseofdownlinkHSDPA.
Themaximumuplinkuserbitrateisincreasedfrom384kbit/sdedicatedtraffic
channel(DCH)upto5.440Mbit/sE-DCH(withoutusing16QAMmodulation)and
11.2Mbit/s(whenusingthe16QAMmodulation).

18 DN70303923 Issue:06B

WCDMARANRRMHSUPA DescriptionofradioresourcemanagementofHSUPA

E-DCHsresourceutilizationismoreefficientcomparedtoDCHs.
HARQbetweentheUEandtheBTSprovidespossibilitytousefastre-transmission
withincrementalredundancyorchasecombiningiftransmissionfails.Itallowslower
transmissiondelayiftransmissionfails,sincere-transmissionisperformedbetween
theUEandtheBTS,notbetweentheRLCpeers,thatistheUEandtheRNC.
HARQallowstheuseofhigherinitialblockerrorratio(BLER)andmakesitpossible
touselowerenergyperbit,whichmeansthatboththecapacityofthecellandthe
coverageofhighbitratesareincreased.Theincreasedbitratesincellborderareas
areespeciallyuseful.
TheHSUPAschedulerislocatedintheBTS,anditallowsmoreaggressive
schedulingbyusinghighercellinterferencelevelsasnosafetyoverheadisneeded
becauseofthedelaycausedbytheIub.This,aswellasfasterscheduling,increases
cellcapacity.

1.2 Introductiontoradioresourcemanagementof
HSUPA
TheHSUPARRMintheRNCestablishestheHSUPAconfigurationinthecellduringthe
cellsetupphase.TheRRMallocatesspreadingcodesanddefinespoweroffsetsforthe
HSUPAdownlinkcontrolchannels:E-DCHabsolutegrantchannel(E-AGCH),EDCH
relativegrantchannel(E-RGCH),andE-DCHHARQacknowledgmentindicator
channel(E-HICH).
Inuplink,acertainnoiseriseisreservedfortheBTSpacketscheduler.Thisallowsthe
admissionofDCHusersaccordingtothenormaladmissioncontrolprocedureinthe
RNC,whiletheremainingnoiserisemarginisefficientlyutilizedforHSUPA.
TheHSUPARRMintheRNCdecidesontheE-DCHallocation.Thedecisionbetween
DCHandE-DCHallocationforanUEisbasedontheserviceasindicatedbyradio
accessbearer(RAB)parameters,resourceavailability,multi-RABcombinationandthe
UEcapability.TheE-DCHtransportchannelcanbeusedforsignalingradiobearer
streaming,interactiveandbackgroundtrafficclasses.WithDirectResourceAllocation
supported,theE-DCHcanbeallocatedforinteractiveandbackgroundtrafficclass
duringaPSNRTservicesetup.ThesignalingradiobearercanuseE-DCHifE-TTI=2ms
orF-DPCHissupported.TheuplinkE-DCHtransportchannelcanonlybeallocatedin
conjunctionwiththedownlinkhigh-speeddownlinksharedchannel(HS-DSCH).
TheHSUPARRMalgorithmintheRNCcalculatesthemaximumE-DCHbitratethatthe
UEisallowedtousebytakingintoaccounttheBTScapability,theUEcapability,the
RABparametersandtheRNPparameters.BasedonthemaximumE-DHbitrate,the
HSUPARRMintheRNCconfiguresparametersandalgorithmssuchastheRLClayer,
radiobearer,transportchannel,andphysicalchannelconfigurationforanE-DCHuser.
RRMprovidescontrolparameterstotheBTSforE-DCHpacketscheduling.
TheHSUPARRMalgorithmintheRNCcontrolswhethertheUE'spossiblemulti-service
combinationisacceptable.
TheE-DCHisreleasedbasedonlowthroughputdetectioninbothuplinkanddownlink.
WiththeContinuousPacketConnectivityfeature,theE-DCHallocationcanbekeptfora
longerperiod,eventhoughlowthroughputismeasuredwithinthewholeperiod.
TheHSUPARRMalgorithminRNCsupportsmappingofPSinteractive,PSbackground,
PSstreamingandCSconversationalservicestotheE-DCH.

Issue:06B DN70303923 19

DescriptionofradioresourcemanagementofHSUPA WCDMARANRRMHSUPA

TheHSUPARRMalgorithminRNCperformsE-TTIselectionbetween2msand10ms
TTI.
TheHSUPARRMalgorithmintheRNCperformsacombinedpowerandthroughput-
based(hybrid)admissiondecisionandpacketschedulingforR99DCHswhenthereare
ortherearenoE-DCHusersinthecell.ItalsoprovidestheBTSwithmeanstoemploy
thecombinedpowerandthroughput-basedpacketschedulingfortheE-DCHresources.
HSUPARRMalgorithmintheRNCperformsdynamicsharingofreceivedinterference
betweenNRTDCHandE-DCHusers.
ThemaximumnumberofHSUPABTSsperRNCisdefinedwiththefollowinglicenses:

HSUPA
Basic 3/12/24 users per BTS.
Number of base station maximally 60 HSUPA users per BTS

ThemaximumnumberofE-DCHusersperaBTS-specificlocalcellgroupisdefinedwith
thefollowinglicenses:

HSUPA, Basic 3/12/24 users per BTS


Number of base station maximally 60 HSUPA users per BTS

AllactivelicensescanbeusedatthesametimewithintheRNC.Thelicense
managementsystemhandlesviatheHSUPAXUsersEnabledRNPparameter,which
licenseisinuseforanindividualBTS.Thus,theoverallnumberofthetotalnumberof
HSUPABTSsthatcanbeactivatedisthesumofcapacityinformationfieldvaluesofthe
activelicenses.
ModificationoftheHSUPAXUsersEnabledRNPparameterrequiresobjectlockingofall
cellswheretheHSUPAEnabledRNPparameterisenabled.Furthermore,modificationof
theradionetworkplanningparameterHSUPAEnabledrequiresobjectlocking.

1.2.1 HSUPApowercontrol
BecausetheWCDMAsystemisinterference-limited(thatis,thelessinterference,the
morecapacity),itisbeneficialtouseaslowtransmissionpoweratthetransmitting
entitiesaspossible.Thus,thetargetofthepowercontrol(PC)istoachievetheminimum
signal-to-interferenceratio(SIR)thatisrequiredforthesufficientconnectionquality.PC
worksonaconnectionbasis.
HSUPApowercontrolhastwomainfunctions;handlingthepoweroftheHSUPA-related
uplinkdedicatedchanneloftheUEandhandlingthepoweroftheHSUPAdownlink
commonchannels.HSUPARRMalgorithmintheRNCperformsHSUPAouterloop
powercontrol.
NotethatHSDPAandHSUPAcompeteinthesameradioresources,andHSUPAisthe
returnchannelforHSDPAwhenHSUPAisinuse,soHSUPAPCmustworkproperly.

1.2.2 HSUPAhandovers
Thefollowingintra-frequencysoft/softerhandoversaresupportedforE-DCH:

Intra-BTSintra-RNCsofterhandoverbetweencellswhichbelongtothesameLCG
Intra-BTSintra-RNCsofthandoverbetweencellswhichbelongtodifferentLCGs
Inter-BTSintra-RNCsofthandover

20 DN70303923 Issue:06B

WCDMARANRRMHSUPA DescriptionofradioresourcemanagementofHSUPA

Inter-RNCsoft/softerhandover(IfHSPA over Iurfeatureisenabled)

Incaseofasofthandover,theactivesetforDCHcanbedifferentfromtheactivesetfor
E-DCH.ThisallowsaddingacellnotsupportingE-DCHintotheactiveset.Also,incase
ofaninter-BTSinter-RNCsofthandover,E-DCHisnotconfiguredtoasofthandover
branchunderthedriftRNCifHSPA over Iurisdisabled.
TheservingE-DCHcellfollowstheservingcellforHS-DSCHoftheUE,thusthe
algorithmsofHSDPAarefollowed.TheHS-DSCHandE-DCHservingcellisalwaysthe
samecell.E-DCHtoDCHchanneltypeswitchingiscarriedoutifthereisaneedto
changetheservingE-DCHcellintoacellnotsupportingE-DCHoracellunderthedrift
RNC(HSPA over Iurdisabled).E-DCHtoDCHchanneltypeswitchingisalsoneeded
beforethecompressedmodeisactivatedforinter-frequencyorinter-system
measurements.
HSPAinter-RNCcellchangefeatureisdescribedinthecustomerdocumentWCDMA
RAN RRM HSDPA.

1.3 Architectureofradioresourcemanagementof
HSUPA
HSUPARRMfunctionalitiesintheRNCbelonglogicallytoadmissioncontrol(AC),
packetscheduler(PS),handovercontrol(HC)andloadcontrol(LC)logicalentities.
ThefigureFigure3:LogicalworkingenvironmentofHSUPARRMillustratesthelogical
workingenvironmentoftheHSUPARRM.

Figure 3 LogicalworkingenvironmentofHSUPARRM

UE RNC
MAC-e,MAC-d, HC LC
RLC,RRC,PC

User plane AC/PS


cell#1
BTS Control
plane
MAC-e UEspecific AC/PS
ACandPS Uptothreecell
cell#2
specificPSs
NBAP
AC/PS
cell#3
PC
L2
MAC-es,MAC-d,
FP PC,FP,RLC
User plane

TheentitiesandfunctionsinthefigureFigure3:LogicalworkingenvironmentofHSUPA
RRMarepresentedfromtheHSUPARRMpointofview,sonotalltherelationsbetween
theentitiesandfunctionsareshown.
DCHandE-DCHactivesetinformationisproducedbyHC.HCalsoselectsHS-
DSCH/E-DCHservingcellandconstructspreliminaryandminimumE-DCHactivesets.

Issue:06B DN70303923 21

DescriptionofradioresourcemanagementofHSUPA WCDMARANRRMHSUPA

LCperformstheautotuningofthereceivednoiselevel(PrxNoise).LCalsocontrols
HSUPARRMrelatedmeasurementsandprovidesmeasurementresultstoACandPS.
Cell-specificACandPSentitiesmakeE-DCHallocationdecisionsineachcellofthe
preliminaryE-DCHactiveset,theyalsoprovidecell-specificconfigurationinformationto
theUE-specificACandPS.
UE-specificACandPSmakefinalE-DCHallocationdecisionsbasedontheinformation
receivedfromthecell-specificACandPSentitiesandHC.UE-specificACandPS
providealsopowercontrol(PC),mediumaccesscontrolprotocol(MAC)andradiolink
control(RLC)specificconfigurationinformationtotheLayer2(L2)whenE-DCHis
allocatedorreconfigured.PCoftheRNCislocatedintheL2;itperformsouterloop
powercontroloftheconnection.
UE-specificACandPStakecareofLayer3(L3)signalingbetweentheRNCandthe
UE.L3RRCsignalingneededbyACandPSincludesuplinkcapacityrequestsand
channelallocationproceduresinbothdirections.MACproducesradiobearerspecific
downlinkcapacityrequeststoACandPSaccordingtotheRLCbufferlevelsintheRNC.
MACalsosendslowandnormalthroughputindicationsontheradiobearer(RB)basisto
theUEspecificACandPS,whichmakethefinaldecisiontoreleaseE-DCH.

1.4 Featuresrelatedtoradioresourcemanagementfor
HSUPA

g NotethatlicenseinformationisrelevantonlytotheIPA-RNCsolution.

Thissectioncontainsinformationaboutfeaturesthatprovideadditionalfunctionalityto
HSUPARRMintheRNC,ontopofthefunctionsofferedbythefollowingbasicfeatures:

BasicHSUPA
HSUPABTSPacketScheduler
HSUPAHandovers
HSUPABasicRRM
HSUPAwithSimultaneousAMRVoiceCall
HSUPA2.0Mbps

1.4.1 HSPAinter-RNCcellchange
The HSPA Inter-RNC Cell Changefeatureimprovesenduserperformanceby
maintaininghighdatarateHSPAserviceduringintra-frequencyinter-RNCmobility.
CapacitygainisachievedatthecellsoftheRNCborderareawhenHSPAinsteadof
DCHcanbeutilized.
ForCSAMRspeechmulti-services,directswitchtoDCHisappliedinordertoguarantee
strictqualityanddelayrequirementsforthespeech.
Whenintra-frequencymeasurementsindicatethatthestrongestcellintheactivesetis
locatedundertheDRNC,anHSPAintra-frequencyinter-RNCcellchangeisexecuted.
Theindividualtriggeringpointfortheinter-RNCcellchangecanbespecifiedbythe
operator.

22 DN70303923 Issue:06B

WCDMARANRRMHSUPA DescriptionofradioresourcemanagementofHSUPA

TheHSPAintra-frequencyinter-RNCcellchangeutilizesSRNSrelocationwithUE
involvement.ThustheUEisreconfiguredaccordingtotheresourcesofthetargetRNC
duringSRNSrelocation.ThetargetRNCallocatesresourcesonbesteffortbasis,thatis
eventhoughHSPAisprimarilyallocatedDCH/DCHcanbeallocatedwhenHSPAisnot
availableinthetargetcell.ThesourceRNCdeletestheoldconfigurationaftera
successfulSRNSrelocation.AnHSPAservingcellchange(servingHS-DSCH/E-DCH
cellchange)iscombinedwithaninter-RNCcellchange.
HSPAdataflowisnotestablishedfortheIurinterfacebutHSPAresourcesarereserved
andallocatedundertheDRNCinconjunctionwiththeSRNSrelocation.AssociatedDCH
(signalinglink)anduplinkDCHreturnchannelcanbesetupfortheIurinterfacewhereas
HS-DSCHandE-DCHarenotallowedovertheIurinterface.
HSPAInter-RNCcellchangeissupportedalsowhentheIurinterfaceisdisabled,
congestedornotexisting.

1.4.2 HSUPAwithsimultaneousAMRvoicecall
PSdataconnectionoverE-DCHissupportedsimultaneouslywithAMRvoicecallover
DCH.
HSUPAwithSimultaneousAMRVoiceCallfeaturedefinestheswitchthatcontrols
whetherAMRisallowedwhenE-DCHisallocatedfortheUE.
TheAMRcodecmodeisselectedaccordingtoFeatureRAN830:AMRCodecSets
(12.2,7.95,5.90,4.75)and(5.90,4.75).
TheHSUPA with a simultaneous AMR voice callisanoptionalfeature.Whetherthe
HSUPAcanbeusedsimultaneouslywiththeAMRiscontrolledbythelicenseHSUPA
with simultaneous AMR voice call'.

1.4.3 HSDPAinter-frequencyhandover
Basedoninter-frequencyhandover(IFHO)triggers,theRNCorderscompressedmode
onHSDPAsothatinter-frequencymeasurementscanbeperformedonHSDPAwithout
channeltypeswitchingtoDCH.Thus,highHSDPAthroughputcanbeexperienced
duringcompressedmodeandthetotalhandoverexecutiontimeisreducedupto1.5s.
ThefollowingchangesinthechanneltypearesupportedduringHSDPAinter-frequency
handover:

DCH/HSDPAtoDCH/HSDPA
DCH/HSDPAtoHSUPA/HSDPA
DCH/HSDPAtoDCH/DCH
DCH/DCHtoDCH/HSDPA
DCH/DCHtoHSUPA/HSDPA

Inter-frequencyhandoveristriggeredbecauseofcoverageandqualityreasons,butalso
anIMSI-basedhandoverandanHSPAcapabilitybasedhandovercanbeinitiated.The
RNCselectsthetargetcellaccordingtothemeasurementresultsandperformsaninter-
frequencyhandoveralongwithanHSDPAservingcellchange.Thetargetcellcanbean
intra-orinter-RNCcelldependingonthedefinedneighboringcells.

Issue:06B DN70303923 23

DescriptionofradioresourcemanagementofHSUPA WCDMARANRRMHSUPA

Thisfeatureenablesalsointer-frequencyhandoverdirectlytoHSUPA/HSDPA,evenif
thehandoverisstartedfromDCH.IftheHSDPAallocationisnotpossibleinthetarget
cell,handoverisperformedtoDCH.ChanneltypeswitchingtoDCHorFACHmaybe
performedduringcompressedmode,forexampleiftheactivesetisupdatedorif
inactivityisdetected.
HSDPA Inter-frequency Handoverisanoptionalfeature.Theoperatorcanactivateand
deactivatethisfunctionalitywiththeBTSlevelRNPparameter
BTSSupportForHSPACM.

1.4.4 HSUPA60usersperBTS
Bythisfeature,theRNCallowstheadmissionofupto60simultaneousHSUPAusers
perBTS.ThemaximumnumberofHSUPAusersperBTSisdefinedbytheHSUPA x
users enabled (HSUPAxUsersEnabled)RNPparameter.Fordetailedinformation
onthemaximumnumberofsimultaneousE-DCHallocations,seeRestrictionof
simultaneousE-DCHallocations.

1.4.5 QoSawareHSPAscheduling
Thisfeatureallowsserviceandsubscriberdifferentiationandsupportsdifferenttariff
plansforNRTtrafficclasses,thatispremiumservicesandsubscriberscanhavehigher
prioritythanlowtariffbroadbandHSPAdatatraffic.PrioritizationofRABswithinteractive
andbackgroundtrafficclassesthataremappedtoHSPAtransportchannelsisbasedon
thefollowingRABparametersreceivedfromthecorenetwork:

TrafficClass(TC)
TrafficHandlingPriority(THP)
AllocationRetentionPriority(ARP)

Theparametersmentionedabovearemappedaccordingtooperator-definedmapping
rulestoaprioritizationvalueusedinsidetheRNCtoprioritizeconnectionsand,forHS-
DSCHandE-DCH,sentasSPIvaluetotheBTS.TheQoSprioritizationmechanismis
usedbyallfunctionsthatneedtoprioritizePSRABs.TherelatedRNPparameteris
calledQoSPriorityMapping.
QoS Aware HSPA Schedulingisanoptionalfeatureavailableifallofthefollowing
conditionsarevalid:

TheHSDPADynamicResourceAllocationfeatureisactiveandthe
HSDPADynamicResourceAllocationmanagementparameterissettoEnabled.
TheQoSAwareHSPASchedulingfeatureisactiveandtheHSPAQoSEnabledRNP
parameterissetto1(QoSprioritizationisusedforHSNRTchannels).
HSDPAisenabledinthecellbytheHSDPAenabledmanagementparameter.

1.4.6 StreamingQoSforHSPA
ThisfeatureintroducesQoS-basedprioritizationforPSstreamingservicesaccordingto
theQoSPriorityMappingRNPparameter.Basedonoperator-definedrules,PSstreaming
servicesarehandledaccordingtotheirprioritizationvalue.LoadcausedbyPS
streamingservicesisspecifiedassemi-controllableloadinthiscontextbecauseitis
handledsimilarlytocontrollableload,butcannotbecontrolledasfreelyastheNRTload.

24 DN70303923 Issue:06B

WCDMARANRRMHSUPA DescriptionofradioresourcemanagementofHSUPA

AstreamingclassRABisoriginatedinthePScorenetwork.Theradioaccessnetwork
supportsstreamingRABsandcreatesthecorrespondingRBs.Thisfeatureenables
streamingtrafficclassradiobearermappingonDCH/HS-DSCHandE-DCH/HS-DSCH.
Non-scheduledtransmission(NST)isusedforthestreamingtrafficclassonE-DCH.
StreamingRABsareprioritizedbytheRNC,basedontheAllocationRetentionPriority
(ARP)andthestreamingtrafficclassreceivedfromthecorenetwork.TheRNCusesthis
prioritizationinternally,andsendsittotheBTSusingtheSchedulingPriorityIndicator
(SPI)value.
TheGuaranteedBitRate(GBR)issupportedforthestreamingtrafficclassinHSPA.
Admissionofanewusercanbedeniediftheguaranteedbitratecannotbeprovidedto
theuser,oriftheguaranteedQoSofexistinguserswouldbeaffected.Anewstreaming
user,however,cantakeresourcesfromHSPANRTorDCHNRTusersbytheRT-over-
NRTprocedure.Furthermore,theGBRisusedbytheschedulerintheBTS.UponHS-
DSCHPF-RAD,theschedulerfirstfulfillstheGBRrequirementsofrealtimeusersinthe
orderoftheirSPI.
Inuplinkdirection,astreamingclassRTRABusingGBRandmappedtoE-DCHisnot
congestion-controlledontheIubinterface,thatistheHSUPA Congestion Controlfeature
isnotappliedtoNSTonE-DCH.Indownlinkdirection,theoperatorcanchoosewhether
downlinkstreamingbearersusingRTRABaretakenintoaccountbyHSDPAcongestion
control.
TheStreaming QoS for HSPAfeatureincludesthemulti-RABsupportrequiredbythe
streamingtrafficclass,thatis1RT+1NRTPSRAB.Thiscombinationissupportedwith
andwithoutAMR.IftheHSPA Multi NRT RABsfeatureisinuse,13NRTPSRABsare
availablewithAMRandPSstreamingservices.
Inaddition,thisfeaturemakestheNominalBitRate(NBR)availableforNRTtraffic
classes.Thenominalbitratecanbeusedasthetargetminimumbitrate,forexample
basedonsubscription.Inthescheduler,NBRusershaveahigherprioritythanbesteffort
usersbutlowerprioritythanrealtimeGBRusers.TheoperatorcandefinetheNBR
basedonthetrafficclass,theTHP,andtheARP.TheNBRissenttotheBTSbyusing
theGBRinformationelement.Scheduledtransmission(ST)isusedfortheNBRonE-
DCH.Thus,theuplinkdirectionofNBRtrafficiscongestion-controlledontheIub
interfaceaccordingtotheQoS-awareHSUPAcongestioncontrolmechanismintroduced
bytheQoS Aware HSPA Schedulingfeature.
Streaming QoS for HSPAisanoptionalfeaturethatisavailableifallofthefollowing
conditionsarevalid:

TheHSDPADynamicResourceAllocationfeatureisactiveandthe
HSDPADynamicResourceAllocationmanagementparameterissettoEnabled.
TheQoSAwareHSPASchedulingfeatureisactive.
TheStreamingQoSforHSPAfeatureisactiveandtheHSPAQoSEnabledRNP
parameterissetto2(HSPAstreamingisinuse).

1.4.7 HSPAmultiNRTRABs
Withthisfeature,uptothreesimultaneousNRTPSRABscanbeallocatedonHS-DSCH
andE-DCH.ThismeansthatthreesimultaneousPDPcontextscanutilizetheHSPA
service.

Issue:06B DN70303923 25

DescriptionofradioresourcemanagementofHSUPA WCDMARANRRMHSUPA

TheRABsaremultiplexedanddemultiplexedintheMAC-hsandMAC-eentitiesofthe
BTSandtheUE.ThereareseparatepriorityqueuesforeachRABintheMAC-hsand
MAC-eentities.InDL,theBTSpacketschedulerschedulesdatatotheUEfromeach
non-emptyqueueinturns.InUL,theUEsMAC-eentitymultiplexesdatafromseveral
priorityqueuesintoE-DCH.IfHSUPAisnotsupported,RABsaremappedtoDCHinUL.
Duringthemultiplexingprocess,theRABsmaybeprioritizedbasedontheirScheduling
PriorityIndicator(SPI)value.TheSPIisderivedfromtheRABQoSparametersreceived
fromthecorenetwork.MappingbetweenSPIandRABQoSparametersiscarriedoutin
theRNCbasedonoperator-definedmappingrules.WiththeHSPA Multi NRT RABs
feature,RABcombinationswithuptothreeNRTRABsonHSPAaresupported,withor
withoutAMRservices.IftheStreaming QoS for HSPAfeatureisenabled,alsostreaming
RABscanbecombinedwithNRTRABsonHSPA.
HSPA Multi NRT RABsisanoptionalfeature.Theavailabilityofthefeatureisspecified
bytheHspaMultiNrtRabSupportmanagementparameter.

1.4.8 PSNRTRABreconfiguration
WiththePSNRTRABreconfigurationfeature,theSGSNortheUEcanrequestto
modifythecharacteristicsofaRABservicebyusingtheRABreconfigurationprocedure.
IntheRAN,thecorenetworktriggersthereconfigurationofanexistingRABwitha
RANAP:RABASSIGNMENTREQUESTmessage.ThefollowingQoSparameterscan
bechangedforinteractiveandbackgroundtrafficclassRABs:

TrafficClass(TC)interactiveorbackground
MaximumBitRate(MBR)forULandDL
TrafficHandlingPriority(THP)ofaninteractiveRAB
AllocationandRetentionPriority(ARP)

FormoreinformationonthePSNRTRABreconfigurationmechanism,seeSectionRAB
modificationhandlingforUEsusingHSUPAservicesinCell_DCHstateinWCDMA RAN
RRM HSUPAdocumentandSectionPSNRTRABreconfigurationinWCDMA RAN
Packet Scheduler.
ThePS NRT RAB ReconfigurationfeatureisanoptionalfeaturecontrolledbyanRNC
licensekey.TheRNClevelparameterNodeBRABReconfigSupportdefineswhethera
BTSsupportsthisfeature.

1.4.9 HSUPAPre-emptionLight
BTSbasebandresourcesareallocatedinparticularresourcestepsforHSUPAusers.In
caseofscarceBTSresources,thiscanleadtoblockingofR99voiceusers.Toavoidit,
andtocomplywiththestrategyofRT-over-NRT/RTtraffic,theRNCisabletoreleasethe
allocatedBTSHSUPAresourcestoadmitthevoiceusers.HSUPAresourcescanbe
releasedbyRT-over-NRT/RTandpre-emptionprocedureswhenR99trafficisblocked.
HSUPAusersthathaveSRBsonDCHcanbetargetsofsuchreleases.
Theoperatorsbenefitsaretheenhancedenduserexperienceduetotheabilitytoadmit
voiceusersintheeventofscarceBTSresources.

26 DN70303923 Issue:06B

WCDMARANRRMHSUPA DescriptionofradioresourcemanagementofHSUPA

1.4.10 HSPAoverIur
TheHSPA over Iurfeatureimprovestheend-userperformancebymaintaining
continuoushighdatarateHSPAserviceduringinter-RNCmobility.Capacitygainis
achievedintheRNCbordercellswhentheservingcellchangeisperformed,andwhen
HSPAinsteadofDCHcanbeutilized.
TheHSPA over IurfeatureissupportedonlyforsingleNRTRAB.
WhentheUE'sintra-frequencymeasurementsindicatethatthestrongestcellinthe
activesetisundertheDRNC,aHSDPAandHSUPAservingcellchangeoverIuris
performed.Aftertheservingcellchange,HSDPA(HS-DSCHMAC-dflow)andHSUPA
(E-DCHMAC-dflow)dataistransmittedovertheIur-interface.
HSPA over Iurfeatureenablesthefollowingfunctions:

SRNCsetuptheHS-DSCHandE-DCHradiolinkoverIur
SRNCservingcellchange(SCC)fromtheSRNCcelltotheDRNCcell
SRNCservingcellchange(SCC)fromtheDRNCcelltotheDRNCcellinsideone
RNCandbetweentwodifferentRNCs
SRNCservingcellchange(SCC)fromtheDRNCcelltotheSRNCcell
DRNCacceptanceofaradiolinkovertheIur-interfacecontainingHS-DSCHandE-
DCHMAC-dflowinformation

WhenthelastactivesetcellintheSRNCisdeleted,aUE not involvedSRNSrelocation


istriggeredwhileHSPAserviceisinuse.Also,aUE involvedSRNSrelocationis
supportedifIur-interfaceiscongested.
TheRAN1231: HSPA over IurfeatureiscontrolledbythesamelicenseasRAN1515:
HSPAInter-RNCCellChangefeature.Theoperatorcanactivateanddeactivatethe
featurewiththeIur-objectHSPAOverIurparameter.

1.4.11 Continuouspacketconnectivity
3GPPRel-7introducescontinuouspacketconnectivity(CPC).Discontinuousuplink
DPCCHtransmission,discontinuousdownlinkreceptionoperations,MACDTXandCQI
reportingreductionarethesupportedpartsofthecontinuouspacketconnectivityfeature.
CPCisanoptionalfeatureforRel-7UEs,andCPCcapabilityissignaledbytheUEto
theRNCintheRRCconnectionsetup.CPCisusedonlyincaseofanHSPA-only
configuration,thatis,HSUPAinULandHSDPAandF-DPCHinDL.Also,theSRBsare
alwaysonHSPA.NoDCHsinUL/DLareallowedwithCPC.CPCisactivatedperUE.
TheRNCcommandstheUEtostartthediscontinuousuplinkDPCCHtransmissionand
discontinuousdownlinkreceptionoperations,andconfigurestheDTX/DRXparameters
whenenablingtheCPCoperations.RelevantparametersoftheUEDTX/DRX
configurationsaresignaled(bytheRNC)alsototheBTSsintheactiveset.
DiscontinuousuplinkDPCCHtransmissionanddiscontinuousdownlinkreception
operationscanbeenabledwheneverallBTSsintheactivesetandtheUEsupportit.
CPCmaybetemporarilyswitchedoffbytheRNCduringsomeprocedures,suchasHO
proceduresandRTTmeasurements.ULDTX/DLDRXoperationscanbede-activated
andactivatedalsobytheservingBTSwithfastL1/L2signaling,forexample,ifradio
conditionsaredeteriorating.

Issue:06B DN70303923 27

DescriptionofradioresourcemanagementofHSUPA WCDMARANRRMHSUPA

CPCmakestheCell_DCHstatemoreaffordablefromtheairinterfacecapacityandUE
batteryconsumptionpointsofviewforlowactivity/non-continuoustransmission.
BetteruserexperiencecanbeofferedtoCPC-capableUEsbykeepingthemlongerin
theCell_DCHstate.Statetransitionisnotneededfortemporaryinactiveuserswith
interactiveandbackgroundRAB(s).
Continuous packet connectivityfeatureisappliedpercellifthefollowingconditionsare
effective:

LicenseoftheCPCexistsandthestateisON
ManagementparameterFDPCHEnabledissettoEnabled
ManagementparameterCPCEnabledissettoEnabled

ThereisapossibilitytouseCPCsimultaneouslywithRAN2124: HSPA 128 users per


cellfeature.TheusageofCPCsimultaneouslywithHSPA128userspercellfeatureis
controlledbytheCPC for 128 HSPA Users LK RNClicensekey.Thelicensekeyison/off
license.ThelicenseisusedinparallelwiththelegacyCPClicense.

1.4.12 CSvoiceoverHSPA
CSVoiceoverHSPAusesHSPAtransportchannelstocarryCSvoicetraffic.Mapping
theCSvoicetoHSPAtakesplaceintheRNC,andisnotvisibletotheCoreNetwork.
ThustheR99orR4CScorenetworkcanbeusedastoday.UsedtogetherwiththeCPC,
thefeatureincreasestheairinterfacecapacityandUEbatterylife.

Figure 4 HSPAchannelsforCSvoiceoverHSPA

A B C IuUP

PDCP
RRC
PDDP
header A B C

SRB SRB SRB SRB RB


#1 #1 #1 #1 AMR
(UM) (AM) (AM) (AM) (UM)

RLC-UM PDDP
header header A B C

MAC-d MAC-ehs MAC-d


flows MAC-es/e flow
SRB AMR

MAC-es/e
or RLC-UM PDDP
MAC-ehs header header A B C
header

28 DN70303923 Issue:06B

WCDMARANRRMHSUPA DescriptionofradioresourcemanagementofHSUPA

CSvoiceoverHSPAisanoptionalfeature,anditsuseiscontrolledonacelllevelbythe
operator.
TheCS voice over HSPAfeatureiscontrolledbylicensekey.Typeofthelicensekeyis
ON/OFFlicense.ManagementparameterHSPAQoSEnabledisaparameterthat
enablesCSvoiceoverHSPAinallcellsoftheactiveset.TheactivationoftheCSVoice
overHSPAfeaturewiththeHSPAQoSEnabledRNPparameterrequiresCDSP-DHcards
inthecontroller.

1.4.13 F-DPCHandSRBsonHSPA
FractionalDPCHsharestheDLdedicatedcodechannelcarryingL1signaling(TPCbits)
ofHSDPAusers.DLL1signalingofupto10HSDPAusersaretime-multiplexedonthe
sameSF256DLcodechannelandL1controloverheadisreduced.Bysharingthe
SF256channelwithF-DPCH,thenumberofHS-PDSCHcodes(andDPCHcodes)can
beincreased.FractionalDPCHisusedonlyforRel-7andlaterUEs.Networksupports
onlyRel-7versionofF-DPCH.
F-DPCHisonlysupportedwiththeSRBsonHSPA.Inthiscase,HSUPAuseseither2
ms(itrequiresfeatureRAN1470: HSUPA 2ms TTI)or10msTTI.Switchingbetween
mappingofSRBsonDCHandHSPAissupported.Rel-7improvesF-DPCHgainsinsoft
handovercomparedtoRel-6F-DPCHbyallowingmoreSHOuserstobemultiplexedto
thesameSF256codechannel.HSDPAaveragecellthroughputisincreasedthanksto
improvedspreadingcodeefficiencyandreducedL1controloverheadincaseofahigh
numberofHSDPAusers.
TheRAN1201: Fractional DPCH(F-DPCH)iscontrolledbytheCPClicense.The
operatorcanactivateanddeactivatethefeaturewiththeWCEL-objectFDPCHEnabled
parameter.

1.4.14 HSUPA2msTTI
The HSUPA 2 ms TTIfeatureenablestheuseofshorterTTI(2msvs.10ms)onE-DCH.
ShorterTTIimprovesaveragelatencyinradiointerfaceby12msforthefirst
transmission.FasterretransmissionsalsoreducevarianceoftheRTT.Immediatedata
processingintheIubandtheRNCuserplanealsoshortenstheroundtriptime.Thusthe
lowerlatencyimprovesapplicationlevelperformanceandtheend-userHSPA
experience.
ULsignalingradiobearers(SRBs)arealwaysmappedonHSUPAwhenthe2msTTIis
assignedtotheUE.Non-scheduledtransmission(NST)isalwaysusedforSRBson
HSUPAifE-TTIis2ms.
InDL,SRBscanbemappedonDCHorHS-DSCH(requiresRAN1201,F-DPCH).
HSUPA2msTTIisusedfortheUEwhoseE-DCHphysicallayercategoryis2,4,6or7.
MappingtheSRBstoHSUPAwithE-TTI2msenablesspreadingcodeallocationof
2xSF2+2xSF4inuplink,whichisneededif5.8Mbpsbitrate(RAN981,HSUPA5.8M)is
used.
TheHSUPA 2ms TTIfeatureiscontrolledbythelicensekey.TheRNCcontrolsthe
licenseoftheHSUPA2msTTIfeature.Thehandlingofthelicensekeyandtheenabling
oftheHSUPA2msTTIfeatureiscontrolledwithcelllevelHSUPA2MSTTIEnabledradio
networkplanningparameter.

Issue:06B DN70303923 29

DescriptionofradioresourcemanagementofHSUPA WCDMARANRRMHSUPA

1.4.15 HSUPA5.8Mbps
TheHSUPA 5.8 MbpsfeatureenablespeakbitrateonE-DCHforasingleuserupto5.8
Mbps.
Fourparallelcodesarerequiredforcategory6and7.Whenfourcodesaretransmitted
inparallel,twocodesaretransmittedwithspreadingfactortwo(2xSF2),andtwowith
spreadingfactorfour(2xSF4).Also,intermediatebitratesaresupportedwith2msTTI.
Inordertoactivatethisfeature,HSUPA2msTTIisrequired.
HSUPA 5.8 Mbpsfeatureiscontrolledbythelicensekey.TheRNCcontrolsthelicense
oftheHSUPA 5.8 Mbpsfeature.Thehandlingofthelicensekeyandtheenablingofthe
HSUPA 5.8 MbpsfeatureiscontrolledwithMaxTotalUplinkSymbolRateradio
networkplanningparameter.

1.4.16 HSPA72userspercell
Thisfeaturemakesitpossibletosupportupto72simultaneousHSPAusers(HSDPA
andHSUPA)percellontheFlexiRel2HWSystemModuleandEUBB(Enhanced
UltrasiteBaseBand).ThefeatureRAN1686consistsofRNCandBTSfunctionsanda
BTSHardwarepart.
ThisfeaturedealsmainlywiththeBaseBandcapacityenhancementsenabledbythe
newHWandSWinRU20.TheBTSprovidesresourcesandhandlesanincreased
numberofusers.TheRNCtakescareofenhancedadmissioncontrolandadditional
downlinkHSPAcontrolchannelstosupporthighnumberofHSPAusers.
WiththeincreasednumberofHS-SCCHchannels,moreHSDPAuserscanbecode-
multiplexedinasingle2msTTI.Similarly,withtheincreasednumberofE-RGCH/E-HICH
channels,moreHSUPAuserscanbesupportedinacell.Also,theRNCallocatesE-
RGCH/E-HICHchannelsdynamically,forexample,afterthecellsetup,numberofE-
RGCH/E-HICHisincreased/decreasedbasedonthenumberofHSUPAusersinthecell.
InthecaseofHS-SCCH,theRNCallocatesthecodesforHS-SCCHonlyonceand
sendsthosetotheBTSatcellsetuptime.ButtheBTSdecidesonthenumberofHS-
SCCHactuallyrequiredatthemomentbasedonthenumberofHSDPAuserspercell.
Thiskindofdynamiccodeallocationhelpsinsavingcodespace.
Thefeatureiscontrolledbylicense.ThelicensecontrolisintheRNC.Thelicensetype
ison/offlicense.

1.4.17 FlexibleRLC
ThemainpurposeofthefeatureRAN1638: Flexible RLCistoachievehigherHSDPA
peakratesprovidedbythe64QAMmodulationscheme.Thisimpliesreducingthe
overheadinRLClayerindownlinkbyallowingusageofFlexibleRLCPDUsize.
TheFlexibleRLCischaracterizedbythefollowing:

SizeofdownlinkRLCPDUsisdeterminedautonomouslybytheRLClayerwithinthe
limitsgivenbyupperlayers.
TheupperlimitfortheRLCPDUpayloadsizefordownlinkis696bytes,whenthe
flexibleRLCPDUisused.
ThereisnoneedtousepaddingtoreachacertainpredefinedPDUsize.

30 DN70303923 Issue:06B

WCDMARANRRMHSUPA DescriptionofradioresourcemanagementofHSUPA

ThefeatureisapplicableonlyforRBsusingAMRLCthataremappedonHS-DSCH
transportchannelandE-DCHtransportchannel.
ThefeatureisnotunderlicensecontrolanditbelongstotheRNCBSW.
TheRNC-specificmanagementparameterFRLCEnabled(switchoftheFlexibleRLC
feature)enables/disablestheuseoftheFlexibleRLCfeatureintheRNC.

1.4.18 Powersavingmode
TheHSPA05reconfigurationduringcellshutdownandcellactivationproceduresin
powersavingmode(PWSM)ismadeintherestrictedenvironment.TheWCDMA RAN
RRM admission controldescribestheenvironment,thatiscriteriawhentheHSPA05
reconfigurationcanbemade.ThepurposeofHSPA05reconfigurationistoswapthe
HSPAservicesfromHSPAlayercellstoDCHcellsbyreconfiguringcellswithoutlocking
cellsandlosingcalls.TheHSUPAconfigurationissuesrelatedtoHSPA05
reconfigurationatPWSMaredescribedinWCDMA RAN RRM HSDPA.

1.4.19 Dual-cellHSDPA42Mbps
In3GPPRel-8Dual-cell HSDPAfeatureusestwoadjacentWCDMAcarrierstotransmit
dataforasingleUE.Thisallowsdoublingthedataratefortheterminal.Togetherwith
64QAM,thepeakbitrateis42Mbit/s.
TheUEsendstheChannelQualityIndicator(CQI)informationandL1acknowledgments
(HARQ)forbothcarriersonthecommonHS-DPCCH.ThustheBTSschedulertakes
intoaccountdifferencesinfadingconditionsbetweenthecarriers,improvingthespectral
efficiencyofthesystem.Dual-cellHSDPAisonlysupportedwithNRTservices.IfRT
servicesareneeded,dynamicswitchingbetweenDual-cellHSDPAandSingle-cell
HSDPAmodeisperformed.
Whenitispossible,Dual-cellHSDPAisallocatedinsteadoftheSingle-cellHSDPA.
Dual-cellHSDPArequirestheHSUPA,HSDPA15codes,HSDPA14Mbpsperuser,and
FlexibleRLCfeatures.Dual-cellHSDPAissupportedwithSRBsonHSPA,SRBs
HSUPA,orSRBsonDCH.IfboththeUEandnetworksupporttheenhanced(Rel-7)F-
DPCH,thenSRBsonHSPAwithenhancedF-DPCHisused.Theuseof64QAMis
supportedbutnotrequired.Indual-carriermode,themobilityproceduresarebasedon
thecarrierfrequencyoftheprimaryservingHS-DSCHcell.Dual-cellHSDPAprovides:

doublepeakrateforsingleuser
higheraveragethroughputduetostatisticalmultiplexing
bettercoverageduetofrequencyselectivity

Dual-cellHSDPAissupportedwithCDSP-DHcard.TheCDSP-DHcardprovidesfull
HSDPApeakrate(42Mbit/s).TheCDSP-DHcardisalwaysattemptedtobeallocated
first.Dual-cellHSDPAissupportedwithIurinvolved,onlywhenSRBsareonDCH/DCH
andtheservingcellisinSRNC.
TheRAN1906: Dual-Cell HSDPA 42 MbpsiscontrolledbytheDCHSDPAlicense.The
operatorcanactivateanddeactivatethefeaturewiththeWCEL-object
DCellHSDPAEnabledparameter.

Issue:06B DN70303923 31

DescriptionofradioresourcemanagementofHSUPA WCDMARANRRMHSUPA

1.4.20 LTEInterworking
TheRAN2067: LTE Interworkingfeatureenablescellreselectionfrom3GtoLTEand
providessupportforPSISHOfromLTEto3G.
LTEInterworkingisanoptionalfeatureintheRNCandiscontrolledbythecapacity
license(numberofcells).
InLTErolloutphaseforthecoverageistypicallylimited,andUEseasilyrunoutofthe
LTEcoverage,especiallyintheidlemode.ThisfeatureenablestheLTEcellreselection
whentheUEisintheidlemode,Cell_PCH,orURA_PCHstateinWCDMAlayer.The
operatorsetsprioritiesforeachLTEfrequencyfortheLTE-capableUEs.TheUEcan
then,dependingontheoperatorspreference,selecttocamponLTEoncethecoverage
isavailable.
Intheidlemode,inURA_PCH,andCell_PCHstates,theUEcampedinWCDMA
periodicallymeasuresallhigherpriorityRATs.AlsolowerpriorityRATsaremeasured
whenWCDMAqualitycriteriafallbelowathreshold.Withthisfeaturetheoperatorcan
definetheabsolutepriorityforeachLTEfrequency.LTElayerprioritiescanbethesame
ordifferentbetweenthedifferentLTElayers,andtheUEcomparestheseprioritiestothe
WCDMAown-cellabsolutepriority(servingcellabsolutepriority)thatisprovided.Ifthe
LTEabsolutepriorityishigherthantheWCDMAown-cellabsolutepriority,UEprefers
LTElayerovertheservingWCDMAlayer.
LTEsystemsupportsinter-RAThandovertoUTRANforqualityandcoveragereasonsfor
PScalls.HenceasapartofLTEInterworkingfunctionalityUTRANmusthandlethe
incomingPSISHOfromLTE.UponreceivingtheRelocationRequestfromPSCN,the
targetRNCallocatestheresourcesforincomingRABsanduponasuccessfulresource
allocationsendstheRelocationRequestAcknowledgetotheCoreNetwork.

Figure 5 LTEInterworking

LTE

Cellreselectiontohigher
priorityLTElayerwhen
coverageavailable
Cellreselectionto
lowerpriorityRAT
duetocoverage

LTElayerpriority:high
WCDMA layerL1 Owncell priority:medium

1.4.21 DirectResourceAllocationforHSPA
WiththeRAN1762: Direct Resource Allocation for HSPAfeaturetheHS(D)PAtransport
channelsaredirectlyallocatedintheRABsetupphaseinCell_DCHandCell_FACH
state.

32 DN70303923 Issue:06B

WCDMARANRRMHSUPA DescriptionofradioresourcemanagementofHSUPA

Theoperator,usingthisfeature,canselectthedirectresourceallocationforthenew
enteringPSRABsofinteractiveandbackgroundtrafficclasses.Operatorcanalsodefine
whetherthedirectresourceallocationisappliedinCell_FACHstate.
TheRAN1762: Direct Resource Allocation for HSPAfeatureiscontrolledbythe
RABDRAEnabledparameter.TheparameterdefineswhetherDirectResourceAllocation
forHSPAisusedornot.TheparameteralsodefineswhetherDirectResourceAllocation
forHSPAisusedinCell_FACHstate.OnlinemodificationoftheRABDRAEnabled
parameterisallowed.

1.4.22 HSUPAInterferenceCancellationReceiver
TheRAN1308: HSUPA Interference Cancellation Receiverfeatureimprovestheuplink
peakdatarateavailabilityinthenetwork.Thisimprovementcanbeachievedby
cancelingtheinterferencecausedbyusersmappedtoE-DCHwith2msTTI.The
cancellationisperformedintheBTS.
InRNCtheRRMalgorithmsbringaboutanincreaseinthepeakdatarateorthetotalcell
throughputofNRTusersmappedtoE-DCHwith2msTTItransportchannel.Theyalso
keepthecoverageandperformanceofadmittedRTusersmappedtoDCHorE-DCH
with10msTTIatthesamelevelasitwaswithouttheinterferencecancellation.
Inordertogaintheimprovement,thePrxMaxTargetBTStargetvalueisincreased.That
allowshigherthroughputforNRTE-DCHusers.
Thefollowingpicturedescribestheprinciplesofinterferencesharingontheoriginal
streamincaseofHSUPAInterferenceCancellationReceiver.

Issue:06B DN70303923 33

DescriptionofradioresourcemanagementofHSUPA WCDMARANRRMHSUPA

Figure 6 Principlesofinterferencesharingontheoriginalstream

Theoriginalstreamisthereceivedsignalbeforeapartoftheinterferenceiscancelled.
The RAN1308: HSUPA Interference Cancellation Receiveriscontrolledbylicenseinthe
BTS.TheoperatorcanactivateanddeactivatethefeaturewiththeWCEL-object
AdminPICStateparameter.TheWCEL-objectPICStateparameterindicateswiththe
activeorautomaticvaluewhetherthefeatureisapplied.ThePICStateparameterhas
threevaluesEnabled,Disabled,andAutomatic.IfthevalueisDisabledthentheRNC
assumesthatthefeatureisnotapplied.Otherwise,theRNCassumesthatthefeatureis
applied.

1.4.23 HSPA128UsersperCell
TheRAN2124: HSPA 128 Users per Cellfeatureincreasesthenumberofuserspercell
intheCELL_DCHstateto128.ForUL,asopposedtooldcapacityfeatures,onlyserving
usersarecountedandcheckedwiththisfeature.ThemaximumnumberofHS-DSCH
MAC-dflowsis1024peronecell.Formoredetailsonthefeature,seeWCDMA RAN
RRM HSDPA.
TheRAN2124: HSPA 128 Users per Celliscontrolledbylicensekey.Theoperatorcan
activateanddeactivatethefeaturewiththeHSPA128UsersPerCellWCELparameter.
TheusageofCPCsimultaneouslywithHSPA128userspercellfeatureiscontrolledby
theCPC for 128 HSPA Users LK RNClicensekey.

34 DN70303923 Issue:06B

WCDMARANRRMHSUPA DescriptionofradioresourcemanagementofHSUPA

1.4.24 HSUPA16QAM
TheRAN1645: HSUPA 16QAMfeatureincreasestheHSUPApeakdatarateto11.5
Mbit/sforHSUPAterminalcategory7supporting16QAM.16QAMmodulates4bitsper
symbol.ThefeatureisoptionalfortheUE.
The16QAMcapabilityissignaledtotheRNCinaRRCConnectionSetupComplete
message.11.5Mbit/sisamaximumtheoreticalthroughput.Practicalthroughput
achievablewiththisfeatureislimitedbyradiochannel,interference,allowednoiserise,
andbothreceiverandtransmitterimperfections.Maximumtheoreticalthroughputwould
requiretheuseofcodingratecloseto1,thatis,itwouldrequireerror-freereception.
Targetingsuchreceptionreducesthesystemefficiencyandcapacity.

1.4.25 Inter-AdapterServingCellChangecombinedRoleswitch

g ThisisFlexiDirectRNCsolutionspecificfeature.

WhenUEinCELL_DCHRRCStateisallocatedwithHSDPAorHSPAresources,the
mobilitybetween2adaptersispossiblein2ways:

withoutusingIur(nouseofIurSHO)
usingIur(SHOoverIurandthenServingCellChangewithcombinedRelocation)

IncasetheSource-FlexiDirectRNChasactivelinksoverIurwithRNCorwhennoIur
exitsbetweentheAdapters,theSource-FlexiDirectRNCwillinitiatetheHandoverto
Target-FlexiDirectRNC(orTarget-RNC)asperHSPAInter-RNCCellChange
(RAN1515,HSCECH)feature.

IASCCRoleSwitchwithcombinedChanneltypeswitch
ThisprocedureisapplicablewhenIurInterfaceexistsbetweentheAdapters.The
purposeofroleswitchprocedureistoenableinter-FlexiDirectRNCrelocation,andalso
retainingthe(originalsource)sourceFlexiDirectRNCradiolinkevenafterthe
relocation.ThismeansthattheoriginalsourceFlexiDirectRNCbecomesDrift,and
originalDriftFlexiDirectRNCbecomesthenewServingFlexiDirectRNC(Adapter).
Thisissynchronizedonapre-calculatedCFN.Thisisadeviationfromthe3GPP
specificationforrelocationandneedsspecialRNSAPextensions.TheUEactiveset
beforeandaftertheroleswitchdoesnotchange.

1.4.26 ExtensionofHSPAoverIur
RAN2270: Extension of HSPA over IurfeatureisanextensionoftheRAN1231: HSPA
over Iurfeature.Thisfeature:

extendsRAN1231: HSPA over IursupportformcRNCandFlexiDirectRNCproducts


supportCSAMRonDCH+1PSNRTonHS(D)PAmulti-RABcombinationoverIur
supportanchoringforsinglePSNRTRABwithorwithoutCSAMRonDCHwhenall
theactivesetcellsoftheUEareinDRNC

ThefeatureiscontrolledbythesamelicenseasRAN1515: HSPA Inter-RNC Cell


Changefeature.

Issue:06B DN70303923 35

DescriptionofradioresourcemanagementofHSUPA WCDMARANRRMHSUPA

1.4.27 DualBandHSDPA42Mbps
TheRAN2179: Dual Band HSDPA 42 Mbpsfeatureisbasedon3GPPRel-9.
TheRAN2179: Dual Band HSDPA 42 Mbps(DB-DC-HSDPA)isbasedontheRAN1906:
Dual Cell HSDPA 42 Mbpsfeature(DC-HSDPA).Two5MHzWCDMAcarriersareused
simultaneouslyinDLforasingleUEsothatboth5MHzfrequenciesareondifferent
UMTSbands.Inpractice,theDB-DC-HSDPAuserisaDC-HSDPAuser,whichuses
carriersoftwodifferentfrequencybands.NBAPandRRCsignalingfortheDB-DC-
HSDPAisexactlythesameasfortheDC-HSDPAapartfromtheUEandBTScapability
information.
WhenusingtheDB-DC-HSDPA,theDC-HSDPAbenefitscanbeobtainedevenwhenno
contiguous10MHzfrequencyallocationisavailable.Highervaluefromadditional
frequencybandisobtained.Lowerbandprovidescoverage,whilehigherbandprovides
increasedcapacityandpeakrate.Thefollowingthreedualbandcombinationsare
supportedbyDB-DC-HSDPA(bandnumbersinthetablerefertothefrequencyband
definitions):

Table 1 Supportedbandcombinations


DB-DC-HSDPA
ULBand DLBand
configuration

1 IorVIII IandVIII

2 IIorIV IIandIV

3 IorV IandV

TheDB-DC-HSDPAschedulesdataforcapableUEontwodistinctfrequencybandsin
theDL.Themaximumpeakrateis42Mbit/swhen64QAMisenabledand15codesare
availableonbothfrequencies.
The3GPPRel-9limitsthefeaturesothatthetwofrequenciescannotbenon-adjacent
frequencieswithinthesamefrequencyband.MIMOisnotsupportedsimultaneouslywith
DB-DC-HSDPA.
Dual-CellHSDPAfunctionsdescribedinthisdocumentarevalidalsoincaseofDual
BandHSDPAunlessotherwisestated.DualBandHSDPAcanbeconsideredasa
specialcaseofDual-CellHSDPA.SinglecarrierHSUPAissupportedinuplinkwithDual
BandHSDPA.
TheRAN2179: Dual Band HSDPA 42 MbpsfeatureiscontrolledbythelicenceDB
HSDPA.TheoperatorcanactivateanddeactivatethefeaturewiththeWCEL-object
DBandHSDPAEnabledparameter.

1.4.28 DynamicHSUPABLER
TheRAN2302: Dynamic HSUPA BLERfeaturedynamicallyadjuststheBlockErrorRate
(BLER)targetforvariousconditionsintheRNC.
ThisfeaturebenefitsoperatorbydefiningvariousBLERtargetsforthefollowing
conditions:

36 DN70303923 Issue:06B

WCDMARANRRMHSUPA DescriptionofradioresourcemanagementofHSUPA

HSUPApeakrates
HSUPAcellcapacity
HSUPAuserthroughputatcelledge

HSUPABLERtargetinouterlooppowercontrolintheRNCisdynamicallyadjustedto
optimizetheoperatingpointforthevariousconditionslistedabove.BLERtargetis
automaticallyadjustedtoachievethebestHSUPApeakdataratesandoptimizeHSUPA
cellthroughputandcoverage.
EnabledHSUPAisrequiredbeforetheRAN2302: Dynamic HSUPA BLERfeaturecanbe
activated.
TheoperatorusestheRNCHSUPADynBLEREnabledconfigurationparametertocontrol
theactivation/deactivationoftheDynamicHSUPABLERfeature.Modificationofthe
HSUPADynBLEREnabledparametercanbeperformedonline.

1.4.29 HighSpeedCell_FACH
WiththeRAN1913: High Speed Cell_FACHfeature,theHSPAusageisenabledinthe
Cell_FACHstate.Thelogicalchannels(CCCH/DCCH/DTCH)mappedinprevious
releasestotheRACHtransportchannelcanbemappedtoE-DCHforimprovingtheUL
performance.WithHighSpeedCell_FACH,moreuserscanbesupportedinthe
Cell_FACHstate,andsmoothdatatransmissioncanbeprovidedforusersnotrequiring
largedatavolumes.
Thisfeatureutilizesthe3GPPenhancedCell_FACHstatefordownlink(Rel7)anduplink
(Rel8).InthedownlinkdirectionthelogicalchannelsmappedtoFACHtransportchannel
inpreviousreleasescanbemappedtoHS-DSCHtransportchannel,whileintheuplink
directionthelogicalchannelsmappedtoRACHtransportchannelinpreviousreleases
canbemappedtoE-DCHtransportchannel.
TheRAN1913: High Speed Cell_FACHfeatureiscontrolledwiththesamelicensekeyas
RAN1637: High Speed Cell_FACH DLfeature.Thelicencenameis'High Speed
Cell_FACH'.TheoperatorcanactivateanddeactivatethefeaturewiththeWCEL-
HSRACHEnabledparameter.
TheradionetworkplanningparameterHSRACHEnabledcanbesettoONonlyif:

High Speed Cell_FACH'licensestateisON.


HSUPAisenabledinthecellwiththeHSUPAEnabledRNPparameter.
TheuseofFlexibleRLCinULdirectionisenabledintheRNCwiththe
FlexULRLCEnabledRNPparameter.
RAN1637: High Speed Cell_FACH DLfeatureisenabledinthecellwiththe
HSFACHEnabledRNPparameter.

1.4.30 SRVCCfromLTEandCSFBwithHO
TheRAN2435: SRVCC from LTE and CSFB with HOfeaturesupportstwocasesto
movetheUEfromtheLTEsystemtoWCDMA:

SRVCCwhenVoIPissupportedinLTE
CSFBwhenVoIPisnotsupportedinLTE

Issue:06B DN70303923 37

DescriptionofradioresourcemanagementofHSUPA WCDMARANRRMHSUPA

LTEtoWCDMASingleRadioVoiceCallContinuity(SRVCC)functionalityenablesvoice
service(VoIP)continuitytotheCSdomainwhenchangingfromaLTEcelltoaWCDMA
cell.Allnon-voiceserviceswillbehandedovertothePSdomain.Incaseofanexisting
voicecallintheLTE,thisfunctionalityappearsforUTRANasanincominginter-RAT
relocationrequestfromLTEtoWCDMAintheCSdomainorinCS+PSdomains.Multi-
RABhandover(CS+PSRABs)fromLTEtoWCDMAissupportedwithSRVCC.
CSFallback(CSFB)isinitiatedintheLTElayerwhen:

UEisinconnectedmode.
CScallneedstobeestablished.
UEhasPSconnection.
VoIPisnotsupportedthere.

RNCseesCSFBasPSISHOfromLTE.AftertheUEchangesitsRATfromEUTRAN
toUTRAN,theUEcaninitiateCSservice.CSFallbackallowsLTEdeploymentasadata
onlynetwork.
IftheUEisinidlemodeintheLTEwheninitiatingaCSvoicecall,theLTEmayperform
redirectiontoWCDMAwithRRCConnectionReleasemessagesenttotheUE.ThenCS
voicecallisanewcallstartingfromidlemodeinWCDMA,butCSFBoperationisnot
indicatedtotheRNC.

1.4.31 FlexibleULRLCinUL
ThemainpurposeoftheRAN1910: Flexible RLC in ULfeatureistoachievethehigher
HSUPApeakrates.ThefeatureisreducingtheoverheadinRLClayerinuplinkby
allowingtheusageofflexibleRLCPDUsize.
TheFlexibleRLCischaracterizedbythefollowing:

ThesizeofuplinkRLCPDUscanbesignificantlylargerthanintheRU20
implementationanditisdeterminedautonomouslybytheRLClayerwithinthelimits
givenbyupperlayers.
ThereisnoneedtousepaddingtoreachacertainpredefinedPDUsize.

Thefeatureisapplicablefor:

RBsusingAMorUMRLCandmappedonE-DCHtransportchannelusingMAC-i/-is
and
SRBsusingAMorUMRLCandmappedonE-DCHtransportchannelusingMAC-i/-
is.

ThefeatureissupportedonmcRNC,FlexiDirectRNC,andIPA-RNC(CDSP-DHonly).
ThefeatureisnotunderlicensecontrolanditbelongstotheRNCBSW.Thefollowing
featuresmustbeenabledinordertotheFlexibleRLCinULtowork:

RAN1638: Flexible RLC (DL)


RAN826: Basic HSUPA

TheoperatorcanactivateanddeactivatethefeaturewiththeFlexULRLCEnabled
RNFCparameter.

38 DN70303923 Issue:06B

WCDMARANRRMHSUPA DescriptionofradioresourcemanagementofHSUPA

1.4.32 MassEventHandler
TheRAN2879: Mass Event Handlerfeatureimprovestheaccesstothenetworksduring
masseventsorsuddentrafficburstsanddecreasestheULloadcausedbythe
sequentialservicerequests.Thefeatureintroducesanautomaticcontrolofthetraffic
loadonhighloadednetworkstopreventthecellcollapsesandimprovesthe
performanceofthehighloadedcellsbydecreasingtheULinterference.
RAN2879: Mass Event Handlerincludesthefollowingsub-features:

1. IncreasedTVMpendingtime
Formoreinformation,seeWCDMA RAN Packet Scheduler.

2. TemporarymaximumbitrateforULDCH
Formoreinformation,seeWCDMA RAN Packet Scheduler.

3. TemporarymaximumnumberofHSUPAusers
TemporarymaximumnumberofHSUPAusersisinuseduringthehighloadstate
inordertoreduceULinterference.

4. IncreasedCQIfeedbackcycle
Formoreinformation,seeWCDMA RAN RRM HSDPA.

5. LoadbasedE-DCH2msTTIprevention
E-DCH10msTTIisinuseifthenumberofHSUPAusersinthecellexceedsa
pre-definedthresholdinordertolimitULinterferencecausedbyE-DCH2msTTI
users.

6. ULloadbasedACforHSPA+features
WhentheULloadbasedACthresholdisexceededorthemasseventloadstate
istriggeredinthecell,theusageoftheHSPA+features:MIMOandDC-HSDPA
onthecelllevelisrestricted.
Formoreinformation,seeWCDMARANRRMHSDPA.

RAN2879: Mass Event HandleriscontrolledbythelicencesandMassEventHandler


WCELparameter.

1.4.33 SatelliteIub
SatelliteIubsupportsR99voiceanddataconnectionsaswellasHSPAwhenBTSis
connectedtoRNCoverahighdelaysatellitelink.
Thedelayintroducedbyageostationarysatellitehopisapproximately240-280ms.Thus
thetwo-waydelaybetweenBTSandRNCmaybearound600-700ms(delayvariations
arenotexpectedtoclearlyincrease).
Thedelayofthesatellitelinksalsoaffectstheround-triptime(RTT)asseenbytheend-
userandthushasimpactontheperceivedservicequality.Examplesofthedelay
consequencesare:

increasedcallsetuptimes
reducedachievabledatarates

Issue:06B DN70303923 39

DescriptionofradioresourcemanagementofHSUPA WCDMARANRRMHSUPA

degradedvoicequality(audibledelay)
reducednumberofsuccessfulhandovers

TheaimoftheSatelliteIubfeatureistoimprovethespeechqualityandperformanceof
thesignalingradiobearersandthePSbearerswhichusetheAMRLCsandare
transferredoverthesatelliteIub.Withthisfeatureend-user'sQoSisimproved.

1.4.34 EnhancedHSUPAIC
Thealgorithmwhichisintroducedwiththisfeatureispresentedonthepicturebelow,and
describedinthefollowingparagraph.

Figure 7 TheEnhancedInterferenceCancellationprocedure
Originalstreampower(cell-specific)
Prx_total,orig = Prx_total
non-PIC Symbolsof
r(k) usersinset
DEM
non-PIC
Usersinset
Secondstage
PIC PIC detected
(0) (1)
r(k) r(k) symbolsof
usersinset
DEM REM RSR DEM
PIC

Individualresidualstream
powerafterinterference
Commonresidualstreampower
cancellationandresidual
(cell-specific)
Prx_total,res,common streamconstruction
(UE/service-specific
Prx_total,res,k

Where:

DEM-thedemodulationstage
REM-theremodulationstage
RSR-theResidualSignalReconstructionstage

Thecell-specificsignalismarkedwithther(k)andthepowerofthisstreamismarked
withthePrx_total,original.
Inthefirstphasepartoftheprocessthealgorithmgeneratesthecommon residual
signal,bysubtractingthedemodulatedandre-modulatedsignalsofall2msTTIE-DCH
users)fromtheoriginalstream.Onthepicture,thecreatedsignalisnamedas
Prx_total,res,common.

Inthesecondphase,foreach2msTTIE-DCHuser,the individual signal for user


kPrx_total,res,k(wherethekistheindicateduser)iscreated.Thisisachievedbyadding
theowndetectedsignaltothecommon residual signalPrx_total,res,common.Thisprocessis
calledRSR.
presentsthebasicACconsiderationwithandwithouttheRAN2250: Enhanced HSUPA
ICfeature.ThepowerlevelsonthecommonresidualsignalstreamandtheUE-specific
residualstreamsignificantlydifferwhatshowsthebenefitsofusingtheRAN2250:
Enhanced HSUPA ICfeature.

40 DN70303923 Issue:06B

WCDMARANRRMHSUPA DescriptionofradioresourcemanagementofHSUPA

Figure 8 Theresidualsignalstreamrelationship

Originalstream Commonresidual ExampleUE-specific


stream residualstreamafter
residualstream
Prx_total = reconstruction
UE-specificRXpowerfrom
Prx_total,orig Pres,k residualstreamreconstruction
Prx_total,res,common

PEDCH,orig = Prx_total,res,common
otherHSUPA Pres,k
L EDCH,rx,IC /(1=)... (1-) RSR
(2ms TTIonly) k Pres,k
.Prx_total,res,common
PEDCH,res,IC =
otherHSUPA PEDCH,res,IC =LEDCH,res,IC * otherHSUPA .LEDCH,res,IC *...
(2ms TTIonly) .Prx_total,res,common
(2ms TTIonly) .Prx_total,res,common

PDCH = PEDCH,res =LDCH * PEDCH,res = LDCH *


PDCH,res DCH DCH .Prx_total,res,common DCH
Prx_total,res,common

noise+other noise+other noise+other


interference interference interference

Interferencereductionfactor(IRF), Totalinterferencereduction: TIR=Prx_total /Prx_total,res,common

1.4.35 HSUPACompressedModeforLTEandinter-frequency
Handover
TheRAN1668: HSUPA Compressed Mode for LTE and Inter- frequency Handover
featureintroducesHSUPAcompressedmode(CM)forLTEandinter-frequency
measurements,withoutULchanneltypeswitchingtoDCH.
HSUPACMconfigurationforinter-frequencymeasurementsisachievedusingasingle-
framemethodwith7(orless)-slottransmissiongappattern(TGP).HSUPACM
configurationforLTEmeasurementsisachievedusingadouble-framemethodwith7(or
more)-slotTGP.InNSNimplementationtheTGPforsingleframemethodisalwaysfixed
to7slotsandfordoubleframemethod,theTGPisfixedto10slots.
CompressedmodeissupportedwhiletheradiobearersaremappedtoE-DCHinuplink
andSRBsaremappedonDCHorE-DCH.ThisalsoincludesthecasewhereDLSRBis
mappedtoDCHorHSDPA.
Avoidingthechannel-typeswitchtoULDCHreducesthetotalhandoverexecutiontime
upto1.5s.Also,thehighHSUPAthroughputcanbeexperiencedduringcompressed
mode.
Forinter-systemhandovertoLTE,onlythebasicHSUPAcompressedmodesupportis
coveredinthisfeature.HSUPAcompressedmodeforLTEisusedbytheRAN2980:
Measurement based LTE LayeringfeatureandtheRAN2264: Smart LTE Handover
feature.Allthecontrol,signaling,andRRMdecisionmakingofmeasurement-based
redirectionandPSHOtoLTEareincludedinthosefeatures.

Issue:06B DN70303923 41

DescriptionofradioresourcemanagementofHSUPA WCDMARANRRMHSUPA

g InNSNimplementationHSUPACMisneverenabledindependently.Itisalways
doneintandemwithHSDPACM,thatisCMisalwaysenabledinboth
directionstogether

g NotethatHSUPAcompressedmodeisnotsupportedoverIur.

1.5 Interactionwithotherfeatures
HSDPA
TheHSUPAconfigurationcanbesetuptothecellonlyiftheHSDPAissetuptothecell
simultaneously.
TheE-DCHallocationrequiresthattheHS-DSCHisallocated,orisallocated
simultaneouslywiththeE-DCHallocation.
TheHS-DSCHreleasecausesanE-DCHrelease.
TheE-DCHservingcellisalwaysthesameastheHS-DSCHservingcell.

HSDPAdynamicresourceallocation
TheHSUPAconfigurationcanbesetuptothecellonlyifHSDPAdynamicresource
allocationisenabled.
StartingDCH->HS-DSCHchanneltypeswitchtriggersaDCH->E-DCHchanneltype
switchsimultaneously.

LoadandservicebasedhandoveranddirectedRRCconnection
setup
TheHSUPAloadisexcludedfromtheload;theservicebasedhandoveranddirected
RRCconnectionsetupfeaturesdecision-making.

AveragePrxNonEDCHmeasurementisusedinsteadofthePrxTotalmeasurement.
PrxTargetPSMaxparameterisusedinsteadofthePrxTargetparameter.

42 DN70303923 Issue:06B

WCDMARANRRMHSUPA MultiRABcombinationssupportedwithHSUPA

2 MultiRABcombinationssupportedwith
HSUPA

g NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.

UptothreesimultaneousNRTPSRABscanbeallocatedonHS-DSCHandE-DCH.
ThismeansthatthreesimultaneousPDPcontextscanutilizetheHSPAservice.
TheE-DCHcanbeusedsimultaneouslywiththeAMRwhenallofthefollowing
conditionsaretrue:

HSUPAwithsimultaneousAMRvoicecallisenabledbytheAMRWithEDCH
parameter
UsageofAMRservicewithHS-DSCHisenabledbytheAMRWithHSDSCHparameter

IfAMRWithEDCHisdisabled,anewAMRcallfortheE-DCHusertriggersachanneltype
switchfromE-DCHtoDCH.
ThefollowingRABcombinationsaresupportedwithE-DCH/HS-DSCH:

13Interactive/Background(UL:HS,DL:HS)PSRAB
Streaming(UL:HS,DL:HS)PSRAB
Streaming(UL:HS,DL:HS)PSRAB+13Interactive/Background(UL:HS,DL:HS)
PSRAB
SpeechCSRAB+13Interactive/Background(UL:HS,DL:HS)PSRAB
SpeechCSRAB+Streaming(UL:HS,DL:HS)PSRAB
SpeechCSRAB+Streaming(UL:HS,DL:HS)PSRAB+13
Interactive/Background(UL:HS,DL:HS)PSRABHSPA

MultiNRTRABsareprovidedbytheHSPA Multi NRT RABfeatureandHSPAstreaming


servicesareenabledbytheStreaming QoS for HSPAfeature.
ThefollowingadditionalRABcombinationsaresupportedwithE-DCH/HS-DSCH:

SpeechCSRAB(UL:HS,DL:HS)
SpeechCSRAB(UL:HS,DL:HS)+13Interactive/Background(UL:HS,DL:HS)
PSRAB
SpeechCSRAB(UL:HS,DL:HS)+Streaming(UL:HS,DL:HS)PSRAB
SpeechCSRAB(UL:HS,DL:HS)+Streaming(UL:HS,DL:HS)PSRAB+13
Interactive/Background(UL:HS,DL:HS)PSRAB

ThefollowingRABcombinationsaresupportedoverIurinthefollowingcases:

HSPAoverIurisactivated:
1Interactive/Background(UL:DCH/E-DCH,DL:HS-DSCH)PSRAB

ExtendedHSPAoverIurisactivated:
1Interactive/Background(UL:DCH/E-DCH,DL:HS)PSRAB

Issue:06B DN70303923 43

MultiRABcombinationssupportedwithHSUPA WCDMARANRRMHSUPA

AMRspeechCSRAB(UL:DCH,DL:DCH)+1Interactive/Background(UL:
DCH/E-DCH,DL:HS)PSRAB

ThesupportedAMRandAMRWBcodecsetsare:

AMR(12.2,7.95,5.9,4.75),(5.9,4.75)and(12.2)
AMR-WB(12.65,8.85,6.6)

WhentheCSvoiceRABisestablishedovertheHSPA,thecell-specificadmission
controlusesthealgorithmintroducedintheWCDMA RAN RRM Admission Controlinthe
selectionbetweentheAMRcodecsetsconfiguredinthecell.FeatureRAN580: Load
Based AMR Codec Mode SelectionisnotappliedfortheCSvoiceRABestablishment
overHSPA.IfSRBsorSpeechCSRABcannotbemappedtoE-DCH/HS-DSCH
transportchannels,thentheSRBsandSpeechCSRABaremappedtoDCHtransport
channel,andotherRABsarelikeinthepreviousreleases.
TheAMRcodecmodeisselectedaccordingtothefeatureAMR Codec Sets(12.2,7.95,
5.90,4.75)and(5.90,4.75).Also,thefeatureWideband AMR Codec Set(12.65,8.85,
6.6)canbeused.
ForanAMRvoicecall,thecell(s)whicharenotintheE-DCHactivesetbutareinthe
DCHactivesetcanbeusedtobringsofthandovergain.
Fromthefunctionalitypointofview,thereisonlyonedifferencecomparedtoHSDPA
withthesimultaneousvoicecallfeature.WhenanAMRspeechcallisallocated
simultaneouslywiththeE-DCH,anewHSPA-specifichandovermeasurementparameter
setisusedintheintra-frequencymeasurementcontrol(FMCS)
(RTWithHSPAFmcsIdentifier).
FormoreinformationonHSDPAwithsimultaneousvoicecallfeature,seetheSection
CountersforradioresourcemanagementofHSDPAinWCDMA RAN RRM HSDPA.
Additionally,allPSNRTRABsthatareconfiguredonHSPAwillalsobereconfiguredto
DCH.

44 DN70303923 Issue:06B

WCDMARANRRMHSUPA HSUPAconfigurationinthecell

3 HSUPAconfigurationinthecell

g NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.

HSUPAconfigurationissetuptothecellimmediatelyinthecellsetupphaseusingthe
NBAP:PhysicalSharedChannelReconfigurationprocedureand/ortheproprietary
privateNBAP:ConfigurationDataprocedure.

3.1 SetupandreleaseofHSUPAconfigurationinthe
cell
TheactivationanddeactivationofHSUPAiscontrolledwiththeHSUPAEnabled
parameter.TheHSUPAEnabledparametercanbeadjustedonlywhenthecellislocked.
HSUPAmustbeactivatedatthesametimetoallthecellsthatusethesamefrequency,
thatis,theUTRAabsoluteradiofrequencychannelnumber(UARFCN)inthisBTS.
HSUPAcanbeactivatedonlyifHSDPAisenabledinthecell,andtheHSDPAdynamic
resourceallocationmustalsobeenabled.
CapacitylicensesHSUPA Basic 3/12/24 users per BTSand'Number of base station
maximally 60 HSUPA users per BTS'indicatehowmanyBTSscanbeconfiguredwith
HSUPA.ThischeckingisperformedwhennewcellsareactivatedtouseHSUPA.
NotethatifHSDPAmobilityisdisabled,itispossibletosetupHSUPAconfigurationto
thecell,butitisnotpossibletoallocateE-DCHusersinthiscell.

3.2 AllocationandhandlingoftheHSUPAdownlink
controlchannels
Cell-specificpacketschedulerallocatesdownlinkscramblingcode
andspreadingcodesfortheE-AGCHandE-RGCH/E-HICHchannels
DownlinkscramblingcodeforE-AGCHandE-RGCH/E-HICHistheprimaryscrambling
codeofthecell.DownlinkchannelizationcodenumberfortheE-AGCHisdefinedbythe
cell-specificpacketscheduler.Thespreadingfactorofthechannelisfixedat256.Ifthe
HSUPA2msTTIfeatureisenabledinthecellandthecellsupportsE-TTI=2ms,thecell-
specificpacketschedulerdefinesanadditionalchannelcodeforE-AGCH.Thatmeans
that,duringHSUPAsetup,theRNCconfiguresatleasttwoE-AGCHstoBTS.The
downlinkchannelizationcodenumberfortheE-RGCH/E-HICHisdefinedbythecell-
specificpacketscheduler.Thespreadingfactorofthechannelisfixedat128.OneE-
AGCHandoneE-RGCH/E-HICHareconfiguredtoeachcellthatutilizesHSUPA.Cell-
specificPSdoesnotchecktheBTScapabilitywhenitmakespre-reservationfroma
codetree.TheBTScapabilityischeckedbeforeE-AGCHandE-RGCH/E-HICHcodes
aresignaledtotheBTSwiththePhysical Shared Channel Reconfigurationprocedure.
WhentheE-AGCHandE-RGCH/E-HICHcodesaresignaledtoBTSbecauseofHSUPA
setup/modificationandiftheRNPWCELHSRACHEnabledparameterhasvalue
'Enabled',theinformationaboutnumberofHS-RACHsignaturesissignaledalongwith

Issue:06B DN70303923 45

HSUPAconfigurationinthecell WCDMARANRRMHSUPA

HSUPAsetup/modificationinformation.NumberofHS-RACHsignaturesisthesameas
numberofCommonE-DCHResourcesdefinedbyRNPWCEL
HSRACHCommonEDCHResparameter.BTSisinformedaboutthenumberofHS-RACH
signatureswiththePrivateNumberofsignaturesreservedforHS-RACHIE.

RRMdecidesthenumberofE-RGGCH/E-HICHcodes
Inordertouse4E-RGCH/E-HICHcodes,the HSPA 72 users per cell(RAN1686)feature
needstobeenabledandHSPA 128 Users per Cellfeaturedisabled.Ifthevalueofthe
HSPA128UsersPerCellparameter(RAN2124: HSPA 128 Users per Cell)issetto
Enabled,theamountofE-RGCH/E-HICHcodesisnotlimited.Anewcodecanbe
reserved(ifthereissuchneed)unlesstheabsolutemaximumamountof32codesis
exceeded.IfthevalueoftheHSPA128UsersPerCellparameterissettoDisabled,
thenthemaximumamountofE-RGCH/E-HICHcodesislimitedtofour.Whenvaluesof
bothHSPA128UsersPerCellandHSPA72UsersPerCellparametersaresetto
Disabled,thenthemaximumamountofE-RGCH/E-HICHcodesislimitedtoone.
TheRRMdecidesonthenumberofE-RGCH/E-HICHcodesbasedonthenumberof
HSUPAusers,TTI(2msor10ms)andwhetherthecellisaservingE-DCHcelloranon-
servingcelltotheUE.
Inthecellsetuptime,onlyoneE-RGCH/E-HICHcodeisallocated.Afterthecellsetup,a
checkisperformedwhenE-DCHisreservedorreleasedtodecidewhetherthereare
newcodestobeallocatedorexistingcodestobereleased.Inbothcases,forexample,
allocationorde-allocation,thelatestcodesissentbytheRNCtotheBTSthrougha
PHYSICALSHAREDCHANNELRECONFIGURATIONmessagealongwithHS-PDSCH
codesinthesamewayasinRN4.0.OneE-RGCH/E-HICHcodehas40signatures.Only
oneoftheminacellisreservedfornon-servingE-RGCH.So,theremaining39canbe
utilizedforthoseUEsforwhichthecellactsasaservingE-DCHcell.OneUEneedsone
ortwodedicatedsignatures,andallthesignaturesforaUEhavetobeallocatedfrom
thesameE-RGCH/E-HICHSF128code.
TheRRMkeepstrackofthenumberofusersusingthe2msandthe10msE-DCHTTI
respectively,anddecidesonthenumberofE-HICH/E-RGCHusingthefollowingfigures:

ServingE-DCHRLS(aRLinservingBTS)using10msTTI:
ScheduledTransmission(ST):E-HICH+E-RGCH-twosignatures/UE
Non-ScheduledTransmission(NST)(forexampleCSvoice):E-HICH-one
signature/UE(NotethatwithNST,theE-RGCHisnotrequired)

ServingE-DCHRLS(aRLinservingBTS)using2msTTI:
All(NSTandST)RBsE-HICH-onesignature/UE(Notethatwith2msE-DCH
TTI,theE-RGCHisnotusedontheservingRLS)

Non-servingRL(aRLinanon-servingBTS)usingboth10msand2msTTI:
E-HICH+E-RGCH(onlyonecommonnon-servingE-RGCHisneededpercell)-
onesignature/UE

Whenonly10msE-DCHTTIandScheduledTransmissionareused,eachE-RGCH/E-
HICHcansupportamaximumof19HSUPAusersinthecell.Whereas,in10msE-DCH
TTI,ifNSTisalsousedbyHSUPAusers,eachE-RGCH/E-HICHcansupportmorethan

46 DN70303923 Issue:06B

WCDMARANRRMHSUPA HSUPAconfigurationinthecell

19HSUPAusersinthecell.Also,whenboth10msE-DCHTTIand2msE-DCHTTIare
used,eachE-RGCH/E-HICHcansupportmorethan19users.Thishappensbecause
onlyonesignatureperUEisrequiredin2msTTIasindicatedabove.
NotethatNon-ScheduledTransmissionisusedforSRBsandGBRservices.

AllocationofadditionalE-RGCH/E-HICHchannel(s)
Themaximumamountofcodesdependsonactivecapacityfeatures,seeRRMdecides
thenumberofE-RGGCH/E-HICHcodes.EverytimetheE-DCHisallocatedtoanUE,
theRRMchecksifthereisaneedforanewE-RGCH/E-HICHcode.Theconditionto
initiatethecodeupgradeisthefollowing:

WhenthenumberoffreesignaturesislowerorequaltotheRsrvdSignaturesOffset
parametervalueandthemaximumamountisnotexceeded,thenthereisaneedanda
newcodeisattemptedtobereserved.Iftherearenofreecodesavailable,theactions
areperformedinthefollowingorder(nextstepisperformedifthepresentcannotbe
doneordoesnothelp):

1. Preventiveoverloadactionsaretriggered.
Itisperformedtosuchnumberofusersthatthecodeupgradeisnottriggered
againortoallexistinginactiveusers(ifthatnumberissmallerthantheneeded
number).
Usersforreleaseareselectedwithprinciplesusedinthepreviousrelease.

2. HS-PDSCHcodesaredowngraded.
Thiscanbeperformedonlywhenthecodenumberisnotalreadyinitsminimum
value(setbytheHSPDSCHCodeSetparameter).

3. Pre-emptionandRT-over-(N)RTactionsareusedagainsttheexistingPSDCHusers
togettheneededsignature(s).
ThetargetPSDCHuserisselectedintheQoSprioritizationorder.
ActionsagainstPSDCHusersareperformedwithstandardRT-over-(N)RT
principles(downgradefirst,releaseifdowngradecannotbeperformed).

DeallocationofE-RGCH/E-HICHchannel(s)
EverytimetheE-DCHisreleasedfromaUE,theRRMchecksifthereisaneedfora
newE-RGCH/E-HICHcode.Theconditiontoinitiatethecodedowngradeisthe
following:

Onecodeisreleasediftheaboveconditionistrue.Thecodewiththeworstlocation(the
mostrightcode)isreleased.
Phasesofcodede-allocation:

Issue:06B DN70303923 47

HSUPAconfigurationinthecell WCDMARANRRMHSUPA

1. Deallocationisinitiated.
2. Signaturesoftheselectedtobereleasedcodearemovedtootherexistingcodes.
3. Codeisreleased.

Thecodedeallocationcannotbeinitiatedwhenthecodetreeoptimizationisbeing
performedforE-RGCH/E-HICHcode.

PositionsofE-RGCH/E-HICHcodesincodetree
TheRNCmakesafixedcodetreeallocationSF128,7fortheE-RGCH/E-HICHphysical
channel.Ifthatcodeisnotfree,thenthenextoneisallocatedandcontinueduntilafree
codeisfound(SF128,8;SF128,9;).
ThefirstE-RGCH/E-HICHcodeisattemptedtobeallocatedinthepositionSF128,7.
Otherwise,thenextpossible(startingfromtheleft)isallocatedforthefirstE-RGCH/E-
HICH.
TheremainingcodesareallocatedfromthenextrightSF16branches,whichdependon
theavailabilityofafreecode.Itisnotnecessarythatthesecodesbeallocated
consecutively.

ImpactofcodetreeoptimizationprocedureonE-RGCH/E-HICH
codes
WhenthefeatureHSPA 72 user per cellisapplied,thecodetreeoptimizationprocedure
maychangethepositionsoftheE-RGCH/E-HICHcodesasfollows.
ThepositionofthefirstcodeE-RGCH1/E-HICH1shouldnotbechangedbycodetree
optimization.ButtheremainingE-RGCH/E-HICHcodescanberelocatedtootherbest
possiblelocationsbythecodetreeoptimizationprocedure.Thereasonisthatthecodes
forE-RGCH/E-HICHchannelscanbeallocatedanywhereinthecodetree(ascloseas
toleftsideofthecodetree),andthismayblocktheincreaseofthenumberoftheHS-
PDSCHcodes.So,ifrequired,codetreeoptimizationchangesthepositionofE-
RGCH/E-HICHcodesotherthanthefirstone,andhencetheallocatedcodes,inleftside
ofthecodetree,areascompactaspossible.
ThecodeusedforE-RGCH/E-HICHisattemptedtobemovedwhenthecodetree
optimizationisinitiatedandthefollowingconditionisfulfilled:

TheE-RGCH/E-HICHcodeislocatedinthecodetreeinawaythatispartofacode
blockandcouldbetakenintousewhenthenextHS-PDSCHcodeupgradeis
performed.

WhenaE-RGCH/E-HICHcodeisselectedformoving,theprocedureisperformedas
follows:

1. anewE-RGCH/E-HICHcodeisreserved
2. themechanismusedincodede-allocationmovesthesignaturesandreleasesthe
code

Thecodede-allocationisstartedrightafterthereservationofthenewcode.

48 DN70303923 Issue:06B

WCDMARANRRMHSUPA HSUPAconfigurationinthecell

RNCstartsPhysicalsharedchannelreconfigurationprocedurefor
dynamicE-RGCH/E-HICHcodeallocation
TheRRMcalculatestherequirednumberofE-RGCH/E-HICHcodesasdescribedin
AllocationofadditionalE-RGCH/E-HICHchannel(s)andDeallocationofE-RGCH/E-
HICHchannel(s)sections.
OncethenumberofE-RGCH/E-HICHcodesisdecided,andwhenitisknownwhether
thenumberofcodesshouldbeincreasedordecreased,thelatestsetofE-RGCH/E-
HICHcodesaresentbytheRNCtotheBTSthroughaPHYSICALSHAREDCHANNEL
RECONFIGURATIONREQUESTmessage(optionalIEslikeHS-PDSCHFDDCode
InformationandHS-SCCHFDDCodeInformationshouldbeomitted)andtheRNC
receivesthePHYSICALSHAREDCHANNELRECONFIGURATIONRESPONSE
message.
NotethatthePhysicalsharedchannelreconfigurationprocedurementionedinthis
requirementisdedicatedfordynamicE-RGCH/E-HICHcodeallocation,thatis,notthe
samethatisusedinHS-PDSCHdynamiccodeallocation.

RNCreceivesE-DCHFDDDLControlChannelInformationfrom
BTS/DRNC
Informationisreceivedin:

NBAP:RadioLinkSetupResponse,
NBAP:RadioLinkSetupFailure,
NBAP:RadioLinkAdditionResponse,
NBAP:RadioLinkAdditionFailure,
NBAP:RadioLinkReconfigurationReady,
NBAP:RadioLinkReconfigurationResponse,
RNSAP:RadioLinkSetupResponse,
RNSAP:RadioLinkSetupFailure,
RNSAP:RadioLinkAdditionResponse,
RNSAP:RadioLinkAdditionFailure,
RNSAP:RadioLinkReconfigurationReadymessages.

ThefollowingUE-specificinformationcanbereceivedfromtheBTS:

E-AGCHandE-RGCH/E-HICHScramblingCode.Theprimaryscramblingcodeis
used.
E-AGCHChannelizationCode.TherecanbeseveraldependingonwhichBTS
allocatesacodefortheUE,butonlyoneisused.
E-RGCH/E-HICHChannelizationCode.Therecanbeseveraldependingonwhich
BTSallocatesonefortheUE,butonlyoneisused.
PrimaryE-DCHradionetworktemporaryidentifier(E-RNTI).Theservingcellis
allocatedforeachUEanditisusedfordecodingtheabsolutegrant(AG).
SecondaryE-RNTI.TheservingcellisallocatedforeachUEanditisusedfor
decodingtheabsolutegrant.
E-RGCHSignatureSequence.E-DCHcellisallocatedforeachUEorseveralUEs
andusedfordecodingtherelativegrant(RG).
E-HICHSignatureSequence.E-DCHcellisallocatedforeachUEorseveralUEs
andusedfordecodingHARQacknowledgements.
ServingGrantValue.ItindicatestheE-DCHservinggrantindex.

Issue:06B DN70303923 49

HSUPAconfigurationinthecell WCDMARANRRMHSUPA

Primary/SecondaryGrantSelector.ItindicateswhethertheServingGrantValueis
grantedwithaprimaryE-RNTIorasecondaryE-RNTI.Bothoptionsaresupported.
E-RGCHReleaseIndicator.ItindicatesthattheE-RGCHisreleased.

RRMmonitorstheE-RGCHandE-HICHsignaturesallocatedbyBTS
duringRLsetup/reconfiguration/additionprocedures
TheRRMkeepstrackofthesignaturesallocatedundereachE-RGCH/E-HICHcodeby
readingthemessagesmentionedintheprevioustopic(E-RGCHSignatureSequence,
E-HICHSignatureSequence).Foreveryallocatedsignature,theRRMmarksitasused.
InservingtheE-DCHcell,themaximumnumberofsignatures(E-RGCHsignatures+E-
HICHSignatures)underoneE-RGCH/E-HICHcodeis39.SothevalueofE-RGCH
signatureandE-HICHsignaturethatareundersameE-RGCH/E-HICHcodecannotbe
thesameatanypointoftime.
Notethatinthecaseoffailuremessages,signaturescorrespondingtosuccessfully
setuplinksneedtobetakenintoaccount.

RRMmonitorsthesignaturesdeletedduringRLdeletionprocedures
WhentheRNCreceivesanNBAP:RADIOLINKDELETIONRESPONSEmessage,the
RRMreleasesE-HICHandE-RGCHsequencescorrespondingtodeletedradiolink(s)
basedontheRLsspecifiedinanNBAP:RADIOLINKDELETIONREQUESTmessage.
Inthiscase,theRRMmarksthereleasedsignaturesasfree.

RNCtransmitsE-DCHFDDControlChannelInformationtotheUE
TheRNCtransmitsallinformationreceivedfromtheWBTSinE-DCHFDDDLcontrol
channelinformationIEtotheUE.Inaddition,theRNCsignalsanE-RGCH-relatedRG
combinationindexinformationelementinthesamemessagestotheUE.Theinformation
isupdatedwhentheactivesetupdates.PartoftheinformationisallocatedbytheBTS,
andtheinformationmustbetransmittedtoUE.

50 DN70303923 Issue:06B

WCDMARANRRMHSUPA HSUPAchanneltypeselection

4 HSUPAchanneltypeselection

g NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.

TheHSUPAchanneltypeselectionfeaturedeterminestheoptimaluplinktransport
channelfortheuser(RACH,DCHorE-DCH).ThefigureFigure9:Channeltype
selectionschemeofpacketschedulerillustratesthechanneltypeselectionschemeof
thepacketscheduler.

Figure 9 Channeltypeselectionschemeofpacketscheduler

PSchannel
typeselection
inuplink

Selection
betweenRACHand
DCH/E-DCH

Selection
betweenDCHand
E-DCH

Datatransfer Datatransfer Datatransfer


onRACH onDCH onE-DCH

Thepacketscheduler(PS)performsthechanneltypeselection.Themaininputforthe
channeltypeselectionisthetrafficvolumemeasurement,whichtheMAClayerofthe
RNCortheUEperformsforeachNRTRB.Theresultofthetrafficvolumemeasurement
ishandledinthePSasacapacityallocationrequest(forexample,asarequestforDCH
orE-DCH,whichistherelevantcasehere).Fordetailsontrafficvolumemeasurements
andrelatedparameters,seetheSectionTrafficvolumemeasurementsinWCDMA RAN
RRM Packet Scheduler.
ThesignalingradiobearerdoesnotuseE-DCH.

ChanneltypeselectionbetweenDCHandE-DCH
TheuplinkchanneltypeselectionbetweenDCHandE-DCHisperformedbytheUE-
specificpacketscheduler,handovercontrolandcell-specificpacketschedulers.There
canbeseveralcell-specificpacketschedulersasaresultofasofthandover.
TheUE-specificpacketscheduler,handovercontrol,andthecell-specificpacket
scheduleralsoperformstheE-TTIselectionbetween2msand10ms.WhentheE-TTI=
2msisselectedthenULSRBsismappedonE-DCH.
ItispossibletoallocateuplinkE-DCHonlyinconjunctionwithdownlinkHS-DSCH.Ifthe
allocationofHS-DSCHindownlinkisnotpossible,thepacketschedulertriestoallocate
theDCHinbothuplinkanddownlink.

Issue:06B DN70303923 51

HSUPAchanneltypeselection WCDMARANRRMHSUPA

ThefigureFigure10:ChanneltypeselectionalgorithmbetweenE-DCHandDCH(part
1)definesthechanneltypeselectionalgorithmbetweenuplinkDCHandE-DCH.The
procedureisruntogetherwiththedownlinkchanneltypeselectionalgorithm(DCH/HS-
DSCH),anditisintroducedintheSectionHSDPAchanneltypeselectioninWCDMA
RAN RRM HSDPA.HS-DSCHavailabilitychecksarepassedifHS-DSCHisalready
selected.

Figure 10 ChanneltypeselectionalgorithmbetweenE-DCHandDCH(part1)

52 DN70303923 Issue:06B

WCDMARANRRMHSUPA HSUPAchanneltypeselection

Figure 11 ChanneltypeselectionalgorithmbetweenE-DCHandDCH(part2)

ThefollowinglistexplainsthechanneltypeselectionalgorithmbetweenE-DCHand
DCH.E-DCHisselectedifallofthefollowingconditionsaremet:

1. E-DCHisnotallocatediftheradiobeareriscurrentlymappedtoDCH>0kbps,andif
acapacityrequesttoupgradeDCHisreceived.ItmeansthatDCH>0kbpsisnot
allowedtoupgradebasedonthecapacityrequesttoE-DCH.However,DCHis
allowedtoswitchtoE-DCH,forexample,ifanE-DCHactivesetbecomes
acceptable.
2. E-DCHcanbeselectedonlyifUEcapabilitysupportsit.
3. E-DCHcanbeallocatedonlyifthecurrentRABcombinationallowsitsuse.
4. TheRNCconfigurationparameterEDCHQOSClassesdefineswhetherE-DCHcan
beallocatedforacertaintrafficclassandtraffichandlingpriority.E-DCHtransport
channelcanbeallocatedforstreaming,interactiveandbackgroundtrafficclasses.If
oneNRTRABofamultiserviceNRTRABcombinationisnotallowedtouseE-DCH,
aswitchtoasupportedDCHRABcombinationisneededforalltheRABstoensure
thatallRABsaremappedtothesametransportchannel.Suchsituationmayoccur

Issue:06B DN70303923 53

HSUPAchanneltypeselection WCDMARANRRMHSUPA

duringthesetupofabackgroundRAB,whenanactiveHSPAstreamingserviceis
reconfiguredtoDCH.Itcanbeavoidedbyadjustingthevaluesofthe
EDCHQOSClassesparameter.
5. E-DCHcanbeselectedonlyifHSDPAmobilityisenabled,andifHS-DSCHcanbe
allocatedindownlinkdirection.
6. E-DCHisnotallocatedifaninter-systemorinter-frequencyhandovermeasurement
isrunning.
7. E-DCHcanbeselectedonlyifHS-DSCHcanbeallocatedindownlinkdirection.At
thesametime,aHS-DSCHandaE-DCHservingcellisselected,andapreliminary
E-DCHactivesetisconstructed.
8. E-DCHcanbeallocatedonlyifthepreliminaryE-DCHactivesetisacceptable.Atthe
sametime,handovercontrolconstructsalsoaminimumE-DCHactiveset,which
includesallthecellsthatmustbeintheacceptableE-DCHactiveset.
9. E-DCHcanbeselectedonlyifHS-DSCHcanbeallocatedindownlinkdirection.Itis
validonlyinHSPAservingcell.
10. ThemaximumnumberofE-DCHallocationsinthecellandtheBTS-specificlocalcell
groupisdefinedintheSectionRestrictionofsimultaneousE-DCHallocations.E-
DCHmustbepossibletoallocateatleastinHSPAservingcell.Otherwise,E-DCH
allocationisnotpossible.
NotethatsimilarcheckingagainstRNPparametersMaxNumberEDCHCell,
HSUPAXUsersEnabled,MaxNumberEDCHLCGandBTS Resource Status
informationisperformedalsoinothercellsbelongingtothepreliminaryE-DCH
activesetasinHSPAservingcell,buttherejectioninthisphasedoesnotprevent
thepossibilityofanE-DCHallocation.Forstreamingservices,RT-over-NRTcanbe
usedtoreleaseE-DCHNRTusers,andtomakeE-DCHstreamingservices
available.
11. TheTemporary maximum number of HSUPA usersfunctionoftheRAN2879:
MassEvent HandlerfeaturemightrestrictE-DCHallocationsinthecell.Formore
information,seeTemporarymaximumnumberofHSUPAuserschapter.
12. ForstreamingtrafficclassRB,admissionisdecidedbasedontheULinterference.If
admissioncannotbegranted,RT-over-NRTisattempted.IftheRT-over-NRT
procedurecannotfreetheresources,theDCHisnotallocated,andRABassignment
isrejectedorthestatetransitionisignored.
ULinterference-basedadmissiondecisioncanbeperformedoptionallyalsoforthe
PSNRTbearer.Ifadmissiondecisionisnegative,thentheULDCHallocationis
attempted.AdmissiondecisionforPSNRTonE-DCHisdescribedinInterference
basedadmissiondecisionfortheE-DCHMAC-dflowsetupofthePSNRTbearer.
13. E-DCHisallocatedifthefinalE-DCHactivesetisacceptable.ThefinalE-DCH
activesetcanbesmallerthanthepreliminaryone,becauseitispossiblethatallthe
cellsfromwhichE-DCHisrequestedcannotallocateit.TheUE-specificpacket
schedulercheckswhetherthefinalE-DCHactivesetisacceptable.ThefinalE-DCH
activesetmustbeequalto,orbiggerthan,theminimumE-DCHactivesetthatis
constructedbythehandovercontrol.

Points15and11areperformedbytheUE-specificpacketscheduler.Points68are
performedbythehandovercontrol.Points910areperformedbythecell-specific
packetscheduler(s).
TheminimumE-DCHactivesetcontainsallthecellsthatmustbeintheacceptableE-
DCHactiveset.HSPAservingcellalwaysbelongstotheminimumE-DCHactiveset.
ThepreliminaryE-DCHactivesetcontainsallthecellsthatsupportE-DCH.E-DCHis
attemptedtoallocatetocellsthatbelongtothepreliminaryE-DCHactiveset.

54 DN70303923 Issue:06B

WCDMARANRRMHSUPA HSUPAchanneltypeselection

ThefinalE-DCHactivesetcontainsallthecellswhereallocationofE-DCHhas
succeeded.Itcanbeacceptableornot.
ForE-DCHNRTswithanominalbitrate,thecurrentradiointerfaceloadisnotchecked.
ThismeansthatnominalbitrateNRTRBsarehandledinthesamewayasNRTswithout
anominalbitrateduringthechanneltypeselection.
WhenanNRTradiobearerisaddedwhileastreamingradiobearerisalreadyallocated,
thesamechanneltypeisattemptedtobeallocatedasforthestreamingradiobearer.
ThefollowinghandlingappliesiftheE-DCHcannotbeselected:

TheNRTradiobearerismappedtoDCH0/0kbpsifthecapacityislimitedortheE-
DCHactivesetisnotacceptable.
Thestreamingradiobearer(andanyotherexistingradiobearers)areswitchedfrom
E-DCHtoDCH,andthechanneltypeofthenewNRTRBisDCHinuplink,ifthe
RABcombinationisnotsupported,orthetrafficchannelandtraffichandlingpriority
isnotactivatedforHSUPAbytheEDCHQoSClassesparameter.

TheCSvoicebearercanbetransferredintheHSPAconfigurationonlyifallRBsand
SRBsoftheRRCconnectionquestionaretransferredintheHSPAconfiguration(full
HSPAconfiguration).IffullHSPAconfigurationisnotinuse,thentheDCHtoHSPA
switchcanbetriggered.Iftheswitchispossible,thenHSPAcanbeselected.
IftheUEhasradiolinkoverIur,thentheCSvoicecannotbemappedtoHSPA,butonly
theDCHtransportchanneltypecanbeused.
TheDRNCdoesnotaccepttheCSvoiceoverHSPAifitisrequestedoverIur,butthe
requestisrejectedwiththecausecoderequested configuration not
supported.
Power-basedadmissiondecisionismadeintheuplinkdirectionbothintheDCHandthe
E-DCHMAC-dflowsetupsfortheCSvoiceRAB.IftheCSvoicebearerisnotadmitted,
apre-emptionattempttakesplace.Ifitdoesnotsucceed,theCSRABsetupattemptis
rejectedwithoutanykindofchannel-typeswitching.

Multi-RABconfigurationoftheUEsupportedwithULSRBsonE-
DCHTTI2msandDLSRBsonDCH3.4kpbs
WhenHSUPA2msTTIisactivated(bytheHSUPA2MSTTIEnableparameter)inallthe
activesetcells,themaximumsupportedmulti-RABconfigurationscanbethreeNRTPS
Interactive/BackgroundTCRABswiththeconfigurationofULSRBsonE-DCHTTI2ms,
andDLSRBsonDCH3.4kpbs.Themaximumpossiblemulti-RABconfigurationwith
SRBsonHSUPAisoneNRTRAB,ifsimultaneouslymorethanoneNRTPSRABisnot
enabledbytheHspaMultiRapSupportparameter.TheSRBsonHSUPAarenot
configuredtotheUEhavingmultiRABsincludingtheRTRABs.Ifthemulti-RAB
configurationoftheUEisunsupported,thentheSRBsonHSUPAconfigurationisnot
used.Iftheunsupportedmulti-RABcombinationsbecomevalidbecauseofnewRAB,
theSRBsonHSUPAarereconfiguredtoDCHandtheE-DCHTTI=10msisusedforthe
RBifpossible.

ChanneltypeselectionforPSstreamingRB
ForPSstreamingRBthechanneltypeisspecifiedasdescribedintheSectionChannel
typeselectionbetweenDCHandE-DCH.
ChanneltypeselectionforPSstreamingRBscanbeperformedinthefollowingphases:

Issue:06B DN70303923 55

HSUPAchanneltypeselection WCDMARANRRMHSUPA

aRABassignmentrequestisreceivedfromthecorenetwork.
thePSstreamingRBchangesthestatusfrominactivetoactive.

IntheRABassignmentrequestphase,theUEusuallyhasNRTRBallocated.Whenthe
UEalreadyhasaDCHwithabitrateotherthan0,orE-DCHallocatedforanULNRT
RB,achanneltypeselectionisperformedforthePSstreamingRB.Iftheselected
channeltypediffersfromtheonecurrentlyallocatedforNRTRB,acheckisperformed
whetherthechanneltypeoftheNRTRBcanbechanged.Ifthisispossible,theNRT
channeltypeisswitchedsimultaneouslywiththePSstreamingRBallocation.
IftheadmissiondecisionfortheE-DCHisnegativebecauseoftheradiointerference
load,thestreamingRBallocationisrejectedwithoutanattempttoallocatethestreaming
serviceonDCHinthefollowingsituations:

RABassignment:AnRABASSIGNMENTREJECTmessageissenttothecore
network.
aPSstreamingRBwasinactiveandbecomesactive:Thestatusiskeptinactiveand
anewcapacityrequestisawaited.

RNCchecksthatE-DCHactivesetisacceptable
E-DCHactivesetisacceptableifthefollowingequationistrueforallthenon-E-DCH
activesetcellsamongtheDCHactivesetcells:
CPICHEcNoNonEDCHNCell<CPICHEcNoEDCHServingCell+EDCHAddEcNoOffset
Where,

CPICHEcNoNonEDCHN istheCPICHEcNomeasurementresultofthenon-E-DCH
Cell cellinquestion,

CPICHEcNoEDCHServi istheCPICHEcNomeasurementresultoftheservingE-
ngCell DCHcell,

EDCHAddEcNoOffset istheradionetworkplanningparameterthatdefines
additionoffsetforCPICHEcNomeasurementresults.The
parameteroftheservingE-DCHcellisused.

ThischeckisperformedsimilarlyforallthecellsthatbelongtotheDCHactiveset,but
whichcannotbeincludedinthepreliminaryE-DCHactiveset.
InordertotransfertheCSvoiceRABintheHSPAconfiguration,allcellsintheactiveset
mustsupporttheCSvoiceoverHSPA.WBTScelliscapableoftheCSvoiceoverHSPA
ifitisindicatedinNBAP:ResourceStatusIndicationorinNBAP:AuditResponse
messageswithHS-DSCH MAC-d PDU Size CapabilityIE(FlexibleSizeCapable).
SupportoftheCSvoiceoverHSPAismanagedwiththeRNPparameter(WCELor
VCEL)HSPAQoSEnabled.WithSRBsonE-DCH(E-DCH/DCH)andSRBsonHSPA(E-
DCH/HS-DSCH)configuration,theE-DCHactivesetshouldequaltheDCHactiveset.
TheminimumE-DCHactiveisalsoconstructedusingthisequation.Itcontainsallthe
cellsthatmustbeintheE-DCHactivesetforittobeacceptable.

56 DN70303923 Issue:06B

WCDMARANRRMHSUPA HSUPAchanneltypeselection

QualitychecksincaseoftheRRCconnectionre-establishmentwith
CSvoiceoverHSPA
IftheRRCconnectionre-establishmentisbeingperformedwhentheUEhasCSvoice
overHSPA,thennoqualitychecksareperformed,andthetryisperformedonlytoacell
wheretheUEiscampedto.However,theneededresourcesarecheckedinACin
normalway(likeinRABsetup),andRT-over-(N)RTandpre-emptioncanbeusedtoget
missingresources.

ChanneltypeselectionincaseoftheRRCconnectionre-
establishmentforCSvoiceoverHSPA
IncaseoftheRRCconnectionre-establishment,usuallyallchanneltypeselection
checks(includingqualitychecks)mustbepassedbeforetheHSPAcanbeusedforthe
UEwithCSvoiceoverHSPA.IfHSPAcannotbeused,thentheDCHisselected
(meaningchanneltypeswitchduringRRCconnectionre-establishment).
IftheoriginalHSUPATTIisnotsupportedbythenewcell,thentheotherTTIisused.
IftheUEdoesnotacceptDCHconfiguration(whenchanneltypewasattemptedtobe
switched),thepossibleRRCconnectionre-establishmentreattemptisperformedwith
theHSPAconfiguration(ifallotherthanqualitychecksarepassed).Resourcesarestill
checkedinAdmissionControlinanormalway(likeinRABsetup)andRT-over-(N)RT
andpre-emptioncanbeusedtogetmissingresources.IfitisnotpossibletouseHSPA,
oritisnotpossibletodotheretry,thentheUEisdropped.

ProcessingofcapacityrequesttoallocateE-DCH
Thecell-specificpacketschedulerprocesseseachreceivedrequesttoallocatedownlink
HS-DSCH,anduplinkE-DCHoruplinkE-DCH,immediatelywithoutqueuingitinthe
capacityrequestqueue.AllocationofHS-DSCHandE-DCHdoesnotincrease
interferenceinthecell,whichiswhyqueuingofinterferencecapacityisnotneeded.
TheUE-specificpacketschedulercombinesthefinalE-DCHactivesetthatincludesall
thecellsthathaveanallocatedHS-DSCHdownlink,anduplinkE-DCHoruplinkE-DCH,
asrequested.Afterthat,theUE-specificpacketschedulercheckswhetherthefinalE-
DCHactivesetisacceptable.Ifitisacceptable,theUE-specificpacketschedulerstarts
toallocatedownlinkHS-DSCHanduplinkE-DCHfortheUE.Ifitisnotacceptable,the
UE-specificpacketschedulerstartstheHS-DSCH/DCHortheDCH/DCHscheduling
procedure.
TheUE-specificpacketschedulerre-attemptstheHS-DSCH/E-DCHallocationwitha
lowermaximum allowed E-DCH user bit rate,ifsuchisavailable,iftheHS-DSCH/E-DCH
allocationattemptfacesRNCsDSPcongestion.TheMAClayerinformsthepacket
scheduleraboutthehighestavailablemaximum allowed E-DCH user bit rateatthe
momentinthemessagesenttothepacketschedulertoindicatecongestion.Thepacket
schedulerutilizesthisinformationwhenselectingtheE-DCHbitratetobetriedatthe
nextattempt.TheUE-specificpacketschedulerstartsaHS-DSCH/DCHorDCH/DCH
schedulingprocedureevenifthelowestmaximum allowed E-DCH user bit rateis
congested.TheDCHisallocatedwiththecorrespondinginitialbitrate.TheMaximum
allowedE-DCHuserbitratecorrespondstothemaximumallowedtotaluplinksymbol
rate.UE-specificpacketschedulerdoesnotre-attemptHS-DSCH/E-DCHallocationwith
lowermaximum allowed E-DCH user bit rateincasetheHS-DSCH/E-DCHallocation
facesDSPcongestion.

Issue:06B DN70303923 57

HSUPAchanneltypeselection WCDMARANRRMHSUPA

TheUE-specificpacketschedulerre-attemptstheE-DCH10msTTIresourceallocation
oftheDSPifcongestionoccursbecauseoflackofresourcesfortheE-DCH2msTTI
configuration.IfDSPcongestionisnotspecifiedbecauseofE-DCH2msTTI,thenaUL
DCHallocationisattemptedinsteadofare-attemptedE-DCHallocationwithalower
maximum allowed E-DCH user bit rate,orwiththeconfigurationofE-DCH10msTTI.If
theE-DCH2msTTIallocationfacesBTSorTRScongestion,theUE-specificpacket
schedulertriestoallocateULDCHresourcesinsteadofE-DCH10msTTIallocation.
TheUE-specificpacketschedulerstartstheHS-DSCH/DCHorDCH/DCHscheduling
procedureiftheHS-DSCH/E-DCHallocationfacesBTSorTRScongestion.Are-attempt
withalowermaximumallowedE-DCHuserbitrateisnotperformedastheE-DCHbit
ratehasnoeffectonthereservedcapacity.Forstreamingservices,however,theRT-
over-NRTprocedureisattempted.
TheDCHisallocatedwiththecorrespondinginitialbitrate.TheDCH/DCHscheduling
proceduredoesnotstartiftheUEalreadyhasDCH/DCHallocatedwithabitrategreater
than0kbps.Forstreamingservices,DCHswiththeguaranteedbitrateorthenext
higheravailablebitrateareallocated.
HSUPA2msTTIandHSUPA5.8MbpsfeaturesarenotsupportedoverIur.Incaseofa
setupofanewbranchoverIur,theSRNCtriggersULSRBmappingfromSRBson
HSUPAtoDCHbeforeaddinganewbranchoverIur.

4.1 HSUPAULselection

g NotethatlicenseinformationisrelevantonlytotheIPA-RNCsolution.

UE-specificentityselectstheULTTItobeusedforE-DCHbetween2
msand10ms
TheUE/cell-specificentityselecttheULE-DCHTTItobeusedfortheE-DCHbetween2
and10ms.
ThedecisionbetweentheULE-DCHTTI2msand10msismadewhen:

TheULchanneltypeselectionalgorithmhasbeentriggeredbetweentheDCHand
theE-DCH.
CPICHRSCPmeasurementresults(periodicaloreventbased)havebeenreceived,
andtheE-DCHallocationexists(itmaytriggertheE-DCHTTIreconfiguration
between2msand10ms).WhenthetransportchannelsforUL/DLSRBsareE-
DCH/DCHorE-DCH/HS-DSCH(incaseF-DPCHisused),thePeriodicalCPICH
EcNomeasurementisstartedwithCPICHRSCPmeasurementquantityalsowhen
activesetsizeisone.
AnewRABestablishmenthasbeentriggeredortheexistingoneisreleased
(supportedRABcombinationwiththeE-DCHTTI2ms).

TheE-DCHTTI2msisusedifthefollowingconditionsaremet:
TheHSUPA2msTTIisenabledintheactivesetcellsoftheUEbythe
HSUPA2MSTTIEnabledparameter.
ThereisnoDRNCcellintheAS.
Thecurrentmulti-RABcombinationoftheUEissupportedwithSRBsonE-
DCH/DCHorwithSRBsonE-DCH/HS-DSCH.

58 DN70303923 Issue:06B

WCDMARANRRMHSUPA HSUPAchanneltypeselection

TheUEsupports2msTTIforE-DCH.Thatis,theUEE-DCHcategoryis2,4,6,or
7.
IftheUEisinCell_DCHstate,theCPICHRSCPmeasurementresultoftheHSPA
servingcellhasbeenreceivedfromtheUEandthemeasurementresultmeetsthe
followingCPICHRSCPresultoftheHSPAservingcellmeetsthefollowingcondition:
CPICH_Tx_POWER-MEAS_CPICH_RSCP<
CPICH_RSCP_COVERAGE_HSPA_CELL+MAX(0,P_MAX-
UE_Tx_Power_MAX_Ref)

g Thereisafixedtimer(6s)definedtoavoidping-pongeffectbetweenE-TTI
2msand10ms.ThetimerisstartedwhentheE-TTIischangedfrom2ms
to10ms.However,iftheSRBsonHSPAarechangedtoSRBson
DCH/DCHatthesametime,thetimerdefinedforF-DPCHisusedinsteadof
thisfixedtimerusedforE-TTIchange.

TheCPICH_Tx_POWERisthedownlinktransmissionpowerofthePrimaryCPICHof
theHSPAservingcell.IftheHSPAservingcelliscontrolledbytheservingRNC,the
downlinktransmissionpoweriscontrolledwiththePtxPrimaryCPICH,MHAand
CableLossRNPparameters.CPICH_Tx_POWERisderivedinthefollowingway:

IfthevalueoftheRNPparameterMHAisOFF,thenCPICH_Tx_POWERisequalto
thevalueoftheRNPparameterPtxPrimaryCPICH.
IfthevalueoftheRNPparameterMHAisON,thenCPICH_Tx_POWERisequalto
thevalueoftheRNPparameterPtxPrimaryCPICHsubtractedwiththevalueofthe
RNPparameterCableLoss.

MEAS_CPICH_RSCPisthereportedCPICHRSCPvalueoftheHSPAservingcell.In
caseofDirected RRC connection setup,Directed RRC connection setup for HSDPA
layer,HSDPA layering for UEs in common channels,Blind IFHO in RAB setup phase
(MBLB)andLayering in state transition to Cell_DCH state(MBLB),
MEAS_CPICH_RSCPistheCPICHRSCPmeasurementresultofthesourcecell.
IfBit0inthe002:2111RU40_MAINT_15PRFILEparameterissettovalue1and
Directed RRC connection setup,Directed RRC connection setup for HSDPA layer,
HSDPA layering for UEs in common channels,Blind IFHO in RAB setup phase(MBLB)
orLayering in state transition to Cell_DCH state(MBLB)takesplacebetweenfrequency
bands,ascaledRSCPvalueofthesourcecellisusedinsteadofthemeasuredone.The
scalingformulaisdefinedinWCDMARANRRMHandoverControl.
TheCPICH_RSCP_COVERAGE_HSPA_CELL(pathloss)indicatesthecoveragearea
oftheHSUPA2msTTIoftheHSPAservingcelldeterminedbythe
CPICHRSCPThreEDCH2MSRNPparameter.
TheUE_Tx_Power_MAX_Referenceisthemaximumtransmissionpowerlevelofthe
referenceintheUE.Thevalueofthemaximumtransmissionpowerlevelreferenceof
theintheUEisdeterminedbytheRNPparameterUETxPowerMaxRef.
TheP_MAXindicatesthemaximumRFoutputpowercapabilityoftheUE(dBm)in
WCDMA.IfHSPAallocationdoesnotyetexist,thentheselectedHSPAservingcellmust
meettherequirementsofCPICHRSCPforHSUPA2msTTI,otherwiseHSUPA10ms
TTIisattempted.

Issue:06B DN70303923 59

HSUPAchanneltypeselection WCDMARANRRMHSUPA

InthecaseofstatetransitionfromCell_FACH,Cell_PCHorURA_PCHstateto
CELL_DCHstate,themeasurementresultofCPICHECNOisusedifthe
measurementresultCPICHRSCPdoesnotexist.TheE-DCH2msTTIcanbe
selectedif:
MEAS_CPICH_ECNO>CPICH_ECNO_COVERAGE_HSPA_CELL
TheMEAS_CPICH_ECNOisthereportedCPICHECNOofthecell.
CPICH_ECNO_COVERAGE_HSPA_CELLindicatesthecoverageareaofthe
HSUPA2msTTIofthecelldeterminedbytheCPICHECNOThreEDCH2MSRNP
parameter.
Inthecaseofinter-RAThandovertoUTRANfromLTEorincaseofstatetransition
fromCELL_FACH,CELL_PCH,orURA_PCHstatetotheCELL_DCHstate,the
measurementresultofCPICHECNOisnotavailable.TheE-DCH2msTTIis
selectedif:
CALC_CPICH_ECNO>LOAD_BASED_CPICH_ECNO_COVERAGE_HSPA_CELL
CALC_CPICH_ECNOisCPICHEcNovalueiscalculatedforthetargetcellwiththe
useofthefollowingequation:
Figure 12 CPICHEcNovaluecalculation

where:
Ptx,CPICHisthecodepowerofthePrimaryCPICHand isthetransmitted
carrierpower.TheirvaluesaredefinedinWCDMA RAN RRM Admission Control.
LOAD_BASED_CPICH_ECNO_COVERAGE_HSPA_CELLindicatesthecoverage
areaoftheHSUPA2msTTIofthecelldeterminedbythe
LoadBasedCPIHEcNoThreEDCH2MSWCELparameter.
TheLoadBasedCPIHEcNoThreEDCH2MSparameterisalsousedintheCTSfrom
theCell_FACH,Cell_PCH,andURA_PCHtoCell_DCHscenarioswhentheCPICH
EcNomeasurementresultoftheservingcellisnotreportedbytheUE.Thisisa
genericchangefortheE-DCHTTI2msfeatureandisnotaffectedbytheLTE
Interworkinglicensestate.
SpecialhandlingofUEinCell_DCH.ThelatestCPICHECNOmeasurementresultis
usediftheRNChasnotyetreceivedthefirstmeasurementreportfromtheUEin
Cell_DCHstate,andCPICHRSCPresultisnotavailablebeforetheRABsetupthat
leadstoresourceallocationofE-DCH.
ThecelloftheBTSisHSUPA2msTTIcapable.
TheallocationofE-DCH2msTTIissuccessfulinallactivesetcells.
IftheallocationofE-DCH2msTTIfailsinanyactivesetcellandtheactivesetsize
ismorethanone,thenanewattemptofE-DCH2msTTIallocationisnottried
beforeoldactivesetcellshavebeenremovedfromtheactiveset.

g NotethatifHSUPAresourcecongestionisfacedduringPS-NRTuserplane
creationwhenULSRBaremappedonE-DCH,theHSUPAresource
allocationisretriedwithSRBbeingmappedonDCH.Thisretried
configurationdoesnotrequireallthatallactivesetcellsbelongtothefinal
E-DCHactiveset.ThatmeansthefinalE-DCHactivesetisacceptableas
describedinE-DCHactivesetchangestoacceptablechapter.Ifthis
configurationalsofailsbecauseoftheHSUPAresourcecongestion,orthe
requirementofminimumE-DCHactivesetcellsisnotmet,thenextlower
configurationforPSNRTisattempted(thatisHSDPA).

60 DN70303923 Issue:06B

WCDMARANRRMHSUPA HSUPAchanneltypeselection

IftheallocationofE-DCH2msTTIfailswiththeactivesetsizeofone,afixedtimeof
sixsecondselapsesbeforeanewattemptofE-DCH2msTTIallocationforthecell
wheretheresourceallocationhasfailed.

IfatleastoneoftheaboverulesrestrictstheuseofE-EDCH2msTTI,E-DCH2msTTI
isreconfiguredbacktoE-TTI=10ms.IfthelastrestrictiontotheuseofE-DCH2msTTI
isremoved,thenanattemptismadetoreconfigureE-TTI=10mstoE-TTI=2ms.Ifthe
samemeasurementreporttriggersHSPAservingcellchangeandthecelltargetofthe
servingcellchangemeetstheE-DCH2msTTIrequirements,butthecurrentservingcell
doesnot,anattemptismadetochangetheservingcellbeforeanE-DCHTTI10ms
changetoTTI=2ms.
E-DCH2msTTIdoesnotchangetheselectionoftheHSPAservingcell.HSPAserving
cellchangefollowstheexistingsolutionifthefeatureFractionalDPCH(RAN1201)isnot
activatedinalltheactivesetcells.
IncaseofHSPAoverIurandextensionofHSPAoverIur,onlyE-DCH10msTTIis
supportedoverIurinDRNC.

E-TTIreconfigurationfrom10msto2msforbiddeninnotfully3GPP
compliantUEs
SomespecificUEsarenotabletohandleE-TTIreconfigurationfrom10msto2msandin
suchasituationthecallisdropped.
TheE-TTIchangefrom10msto2msisforbiddenwhenthecallisstartedwithE-TTI=10
ms.SuchafunctionalityiscontrolledviaPRFILE,andbydefaultitisdisabled.
TheactivationofthisworkaroundismanagedbyPRFILEparameter(002:1686)ofthe
RNC.PRFILEparameter(002:1686)andthefollowingvaluesareused:

0(notactivated),defaultvalue
1(activatedforRel6andnewerUEs),E-TTIreconfigurationfrom10msto2ms
forbiddenforRel6andnewerUEs
2(activatedforRel6UEs),E-TTIreconfigurationfrom10msto2msforbiddenfor
Rel6UEs

LoadbasedE-DCH2msTTIprevention
TheRAN2879: Mass Event HandlerfeatureincludestheLoad based E-DCH 2 ms TTI
preventionfunction.ThefunctionlimitstheE-DCH2msTTIallocationsduringthehigh
loadinordertoreduceULinterference.TheE-DCH10msTTIisallocatedinsteadofthe
E-DCH2msTTI.
ThefunctioniscontrolledbytheMassEventHandlerWCELparameter.
Thecell-specificpacketschedulerprohibitstheE-DCH2msTTIallocationbasedonthe
numberofservingandnon-servingHSUPAusersinthecell.TheE-DCH2msTTIusage
ispreventedifthenumberofHSUPAusersinthecellisequalorhigherthanthevalue
definedbytheMEHHSUPAUserNbr2msTTIWCELparameter.
Acheck,ifthereisaneedforE-DCH2msTTIpreventionisperformed,whenHSUPA
userplane(thefirstE-DCHMAC-dflow)isallocatedfortheuserinthecell.Both,the
servingandnon-servingradiolinksareconsideredduring:

StatetransitiontoCell_DCH
UserplanesetupinCell_DCH

Issue:06B DN70303923 61

HSUPAchanneltypeselection WCDMARANRRMHSUPA

Directresourceallocation(RBsetup)
SHO,SCC
CTStoHSUPA,CTSto2msTTI
HHO

E-DCHTTIswitchbetween2msand10msofexistingHSUPAusersisnotinitiated:

whenthenumberofHSUPAuserschangesinthecellor,
whenthevaluesofcontrollingparametersarechanged.

62 DN70303923 Issue:06B

WCDMARANRRMHSUPA Basicpacketschedulingandadmissioncontrolfor
HSUPA

5 Basicpacketschedulingandadmission
controlforHSUPA

g NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.

Cell-specificadmissioncontrolandpacketschedulingentitiesdecideonE-DCH
allocationineachcellofthepreliminaryE-DCHactiveset;theyalsoprovidecell-specific
configurationinformationtotheUE-specificadmissioncontrolandpacketscheduling.
UE-specificadmissioncontrolandpacketschedulingdecideonthefinalE-DCH
allocationbasedontheinformationreceivedfromcell-specificadmissioncontrol,packet
schedulingentities,andhandovercontrol.

5.1 Thresholdsforthepower-basedE-DCHscheduling
intheBTS
TheBTSutilizesthemaximumtargetlevelforthereceivedwidebandpowerintheE-
DCHschedulingasatargetpointintheBTSpacketscheduling.TheRNCsendsthe
referencereceivedtotalwidebandpowertotheBTS(cell)whenneeded.Theinitialvalue
forsystemnoiseisdefinedwiththePrxNoiseRNPparameter.

Maximumtargetlevelforthereceivedwidebandpower
ThePrxMaxTargetBTSRNPparameterdefinesthemaximumtargetlevelforthe
receivedwidebandpowerintheE-DCHscheduling.TheBTSutilizesthisasatarget
pointinBTSPacketScheduling.
ThePrxMaxOrigTargetBTSRNPparameterdefinesthemaximumtargetlevelfor
receivedwidebandpowerinE-DCHschedulingwhenHSUPAInterferenceCancellation
Receivedisapplied.TheBTSutilizestheparametervalueasthetargetpointinBTS
PacketScheduling.
ThevalueoftheparameterPrxMaxTargetBTS/PrxMaxOrigTargetBTSisrelativeto
thesystemnoise(PrxNoise).
TheparameterissignaledfromtheRNCtotheBTSusinganNBAP:PhysicalShared
ChannelReconfigurationRequestmessageandaMaximum Target Received Total Wide
Band PowerIE.Thepowerissignaledasanabsolutevalue.Thesignaledvalueis
updatedeverytimesystemnoiseadjustmentalgorithmproducesanewvalueforthe
systemnoise(PrxNoise).
TheRNCsignalsanewparametervaluetotheBTSwhenthevalueoftheparameteris
changed.Atthesametime,theRNCalsosignalsalltherelatedparametersthatare
calculatedfromthePrxMaxTargetBTSRNPparameter.
SetvalueofthisparameterabithigherthanPrxTarget + PrxOffsetlevelbecause
schedulingfunctionalitylocatesintheBTS,andanysecurityoverheadisnotneeded
becauseofIubdelays

Issue:06B DN70303923 63

Basicpacketschedulingandadmissioncontrolfor WCDMARANRRMHSUPA
HSUPA

Maximumtargetlevelforresidualreceivedtotalwidebandpower
ThePrxMaxTargetBTSRNPparameterdefinesthemaximumtargetlevelforresidual
receivedtotalwidebandpowerinE-DCHschedulingwhenHSUPAInterference
CancellationReceivedisapplied.TheparameterissentinanNBAPprivatemessage
(ConfigurationData:IEResidualPowerTargetoverThermalNoise).TheBTSutilizesthe
parametervalueasthetargetpointinBTSPacketScheduling.Theresidualreceived
totalwidebandpoweristhereceivedinterferencepowerafterinterferencecancellation
hasbeenperformed.

Referencereceivedtotalwidebandpower
TheRNCsendstheReferenceReceivedTotalWideBandPower(PrxNoise)totheBTS
(cell)whenneeded.InitialvalueforsystemnoiseisdefinedwiththePrxNoiseRNP
parameter.
Everytimethesystemnoiseadjustmentalgorithmupdatesanewvalueforthesystem
noise,theRNCupdatesittotheBTSandtheRNCalgorithms.However,theRNCdoes
notupdatetheresultofPrxNoise autotuningalgorithmmoreoftenthanonceaminute.
ThislimitationisvalidonlywhenHSUPAisinuseinthecell.Oneminuteisthefixed
minimuminterval,anditcannotbecontrolledwiththeconfigurationparameter.
ThesystemnoiseissignaledtotheBTSusinganNBAP:PhysicalSharedChannel
ReconfigurationRequestmessage.TheinformationistransmittedinReference
Received Total Wide Band PowerIEasanabsolutevalue.

5.2 RestrictionofsimultaneousE-DCHallocations

g NotethatlicenseinformationisrelevantonlytotheIPA-RNCsolution.

ThemaximumnumberofsimultaneousE-DCHusersiscontrolledinRNCwiththe
activatedcapacityfeaturesandbyRNPparameters.Thelimitingvalueisdefinedbythe
valuethatlimitsuseramountfirst.

MaximumnumberofsimultaneousE-DCHallocations
TheUEiscountedasaHSUPAuserintheBTSifithasatleastoneRLE-DCH
configuredwithintheBTS.ADCHSDPA-SCHSUPAuseriscountedintheuplink
directiononlyintheprimarycell.TheRNCtakesallthecellsoftheBTSintoaccountas
onelocalcellgroup,iftheRNCdoesnotreceivethelocalcellgroupinformationinthe
NBAP:RESOURCESTATUSINDICATIONorAUDITRESPONSEmessagesfromthe
BTS.
ThemaximumnumberofE-DCHallocationsinthecellandtheBTS-specificlocalcell
groupcanmomentarilybelowerthanwhatisdefinedintheRNC.Therelevant
informationisreceivedperiodicallyfromtheWBTSintheNBAP:RADIORESOURCE
MEASUREMENTREPORTmessage.
Capacityfeatures
TheabsolutemaximumvalueformaximumnumberofE-DCHallocationsintheBTS-
specificlocalcellgroupisdefinedbytheHSUPA x users enabled
(HSUPAXUsersEnabled)RNPparameter.Possiblevaluesare0,3,12,24,or60
HSUPAusersperBTS.ThisparameterhasnoeffectiftheHSPA 72 users per cellorthe
HSPA 128 users per cellfeatureisactivatedinthecell.AllcellswithintheBTScanbe

64 DN70303923 Issue:06B

WCDMARANRRMHSUPA Basicpacketschedulingandadmissioncontrolfor
HSUPA

configuredwithHSUPA.Ifnewcellsareconfigured,thelicenseischeckedbasedonthe
HSUPAxUsersEnabledparameter.Iftheresultofthischeckisnegative,thenitisnot
possibletosettheHSUPAEnabledparametertoEnabled.
Therearethefollowingfourlicensekeys,andthelicensekeyincludesacapacityfield
thattellsthenumberofBTSs,indicatedbytheexamplenumbersinbrackets:

'HSUPABasic3usersperBTS(40)
'HSUPABasic12usersperBTS(50)
'HSUPABasic24usersperBTS(100)
'Numberofbasestationmaximally60HSUPAusersperBTS'(20)

Withthevaluesspecifiedabove,therecanbe40BTSswithamaximumnumberof3
HSUPAusers,50BTSswithamaximumnumberof12HSUPAusers,andsoon.
Thenumberofservingandnon-servingHSUPAusersislimitedbytheactivatedinacell
HSPA 72 Users per Cellfeature.ThefollowingrulesarefollowedwhentheHSPA 72
Users per Cellfeatureistakenintoaccount:

WhentheHSPA 72 Users per Cellfeatureisnotactivated,themaximumnumberof


HSUPAusersisdefinedbyotheractivatedcapacityfeatures(3/12/24/60HSUPA
usersperBTS/LCG).
WhentheHSPA 72 Users per Cellfeatureisactivated,theallowednumberof
servingandnon-servingHSUPAusersis72andallowednumberofHSUPAusers
perLCGis480.

ThenumberofservingHSUPAusersislimitedbytheHSPA 128 Users per Cellfeature,


activatedinacell.Thenumberofnon-servingHSUPAusersisnotlimitedbythefeature.
ThefollowingrulesarefollowedwhentheHSPA 128 Users per Cellfeatureistakeninto
account:

WhentheHSPA 128 Users per CellfeatureisnotactivatedortheBTSdoesnot


indicatetheusageofRel2BBHW,themaximumHSUPAuseramountisdefinedby
otheractivatedcapacityfeatures(72HSPAuserspercell,3/12/24/60HSUPAusers
perBTS/LCG).Thiscasereferstobothservingandnon-servingusers.
WhentheHSPA 128 Users per CellfeatureisactivatedandtheBTSindicatesusage
ofRel2BBHW,theallowedamountofservingHSUPAusersis128(non-serving
usersarenotcounted).

RNPparameters
ThemaximumnumberofE-DCHallocationsinthecellisdefinedwiththe
MaxNumberEDCHCellRNPparameter.Thislimitisvalidalsoforsoftandsofter
handoverbranchadditions.
TheTemporary maximum number of HSUPA usersfunctionoftheRAN2879: Mass
Event HandlerfeaturemightrestrictE-DCHallocationsinthecell.Formoreinformation,
seeTemporarymaximumnumberofHSUPAuserschapter.
ThemaximumnumberofE-DCHallocationsintheBTS-specificlocalcellgroupis
definedwiththeMaxNumberEDCHLCGRNPparameter.Thislimitisvalidalsoforsoft
handoverbranchadditions.Incaseofthesofterhandover,onlyoneradiolinkperUE
contextiscountedtothelocalcellgroupspecificcounter.
TheNumberEDCHReservedSHOBranchAdditionsRNPparameterdefinesthe
numberofE-DCHallocationsreservedonlyforsoftandsofterhandoverbranchadditions
inthecell,andforsofthandoverbranchadditionsintheBTS-specificlocalcellgroup.To

Issue:06B DN70303923 65

Basicpacketschedulingandadmissioncontrolfor WCDMARANRRMHSUPA
HSUPA

achievethemaximumnumberofnewE-DCHallocationsinthecellandtheBTS-specific
localcellgroup,thevalueoftheNumberEDCHReservedSHOBranchAdditionsRNP
parameterissubtractedfromboththemaximumnumberofE-DCHallocationsinthecell
andtheBTS-specificlocalcellgroup.WhentheHSPA 128 Users per Cell featureis
activatedinacellwiththeHSPA128UsersPerCellRNPparameter,thenthe
NumberEDCHReservedSHOBranchAdditionsRNPparameterisignoredinthatcell
(handledasvaluesetto0).
ThevaluesoftheseparametersarecheckedonlyinE-DCHallocationandE-DCH
branchadditionphases.Thatis,changingthevaluesoftheseparametersdoesnotaffect
theexistingE-DCHallocations.

TemporarymaximumnumberofHSUPAusers
TheRAN2879: Mass Event HandlerfeatureincludestheTemporary maximum number of
HSUPA users(TMHU)function.ThefunctionlimitsthemaximumnumberofHSUPA
usersinthecellduringthehighloadstateinordertoreduceULinterference.
ThefunctioniscontrolledbytheMassEventHandlerWCELparameter.
Thecell-specificpacketschedulersetsthetemporarymaximumnumberofHSUPAusers
inthecelliftheLoad_State=High.Detectionoftheloadstateisbasedonthenumber
ofinitialbitraterequestsintheNRTschedulingqueue.Thenumberofinitialbitrate
requestsintheNRTschedulingqueuereflectsoncongestioninair-interface,transport,
orontheBTS(Ifcapacityrequestcannotbeservedbecauseofthecongestion,
occupancyofNRTschedulingqueuestartstoincrease).Formoredetailsaboutthe
detectionandcontroloftheloadstate,seeWCDMA RAN RRM Packet Scheduler.
MEHMaxHSUPAUsersWCELparameterdeterminesthetemporarymaximumnumberof
HSUPAusers(TMHU).
ThetemporarymaximumnumberofHSUPAuserscannotbehigherthanthecurrently
allowedvalueinthecell,whichisdeterminedbytheMaxNumberEDCHCellWCEL
parameter.TMHUisusedfornewHSUPAallocations.TheTMHUdoesnotinitiate
HSUPAreleasesorchanneltypeswitchestoULDCH.Intermsofmobility,theTMHU
followsthesamelegacyprinciplesasMaxNumberEDCHCellparameter.
Thecell-specificpacketschedulerrestorestheoriginalmaximumnumberofHSUPA
usersiftheLoad_State=Normal.Therestorationcanbeperformedimmediatelyor
gradually.ThemodeofrestorationischosenbyusingtheMEHHSUPAUserIncr
RNHSPAparameter.
TheoriginalvalueisrestoredimmediatelywhenthevalueoftheMEHHSUPAUserIncr
RNHSPAparameterissetto0.Ifanyothervalueisset,thecell-specificPSrestoresthe
originalvaluegradually,whichtakesplaceasfollows:

AfterLoad StatechangestoNormal,TMHUisincreasedbytheIncrement.
TheIncrementisdeterminedMEHHSUPAUserIncrRNHSPAparameter.
AfterTMHUincrease,1secondtimerisset.
After1secondtimerexpires,TMHUisincreasedagain.
GradualincreaseisstoppedwhenTMHUreachestheoriginalmaximumnumberof
HSUPAusers.

66 DN70303923 Issue:06B

WCDMARANRRMHSUPA Basicpacketschedulingandadmissioncontrolfor
HSUPA

Operatorisabletocontrolwhetherapriorityconversationalcallcan
betransferredintheHSPAconfiguration
ThemanagementparameterFDPCHSetupECdefineswhetherapriorityconversational
callcanbetransferredintheHSPAconfiguration.Aconversationalcallishandledasa
prioritycallifthePre-emptionCapabilityindicatoroftheRABattribute
Retention/allocationpriorityissettothevalue'cantriggerpre-emption'.Iftheuseofthe
HSPAisdisabled,thenjusttheDCHtransportchannelcanbeusedforthecall.Ifthe
useoftheHSPAisenabled,thenthechanneltypeselectionisdoneasforthegeneral
conversationalcall.Ifthevalueoftheparameterischanged,thenthenewvalueisused
onlyforthoseRABsthatareestablishedafterthechange.InDRNCthisparameterisnot
checked.

WBTSrestrictionsforthemaximumnumberofsimultaneousE-DCH
allocations
TheRNCreceivesfromtheWBTSinprivateanNBAP:RADIORESOURCE
MEASUREMENTREPORTmessageinformationaboutthecurrentHSUPA-related
resourcereservationsituation.ThenameoftheinformationelementisHSUPAResource
Status.Theinformationelementisoptional,itisreceivedperiodically,anditislocalcell
groupspecific.
Thefollowingstatusvaluescanbereceived:

1. HSUPAisnotconfiguredandtheconfiguringofHSUPAalwayssucceeds.
ThisinformationisnotvalidbecauseHSUPAconfigurationissetupincellsetup
phase.
2. HSUPAisnotconfiguredanditsconfiguringwouldsucceedwithhighprobability.
ThisinformationisnotvalidbecauseHSUPAconfigurationissetupincellsetup
phase.
3. HSUPAisnotconfiguredanditsconfigurationdoesnotsucceed.
ThisinformationisnotvalidbecauseHSUPAconfigurationissetupincellsetup
phase.
4. HSUPAisconfiguredandfreeE-DCHcapacityisavailable.
TheRNCsetsupnewE-DCHallocationsifneeded.
5. HSUPAisconfiguredbutE-DCHcapacityislimited.
TheRNCsetsupnewE-DCHallocationsifneeded.
6. HSUPAisconfigured,butnofreeE-DCHcapacityisavailable.
TheRNCdoesnotsetupnewE-DCHallocationsexceptforsofterhandoverbranch
additionsifneeded.RT-over-NRTcanbedoneifneeded.
7. HSUPAisconfiguredandfreeE-DCHcapacityisavailablefromBTSHWcapacity
pointofview,likeinthestatusvalue4.
ThereisaHSUPAuserlimitationintheBTSsetwiththeHSUPAuserlicense.Inthis
casetheRNCdoesnotsetupnewE-DCHallocations.
8. HSUPAisconfigured,butE-DCHcapacityislimitedfromBTSHWcapacitypointof
view,likeinthestatusvalue5.
ThereisaHSUPAuserlimitationintheBTSsetwiththeHSUPAuserlicense.Inthis
casetheRNCdoesnotsetupnewE-DCHallocations.
9. HSUPAisconfigured,butnofreeE-DCHcapacityisavailablefromBTSHWcapacity
pointofview,likeinthestatusvalue6.
ThereisaHSUPAuserlimitationintheBTSsetwiththeHSUPAuserlicense.Inthis
casetheRNCdoesnotsetupnewE-DCHallocations.

Issue:06B DN70303923 67

Basicpacketschedulingandadmissioncontrolfor WCDMARANRRMHSUPA
HSUPA

Values13.arespecifiedforfutureuse.Theywillbeappliedinthefuturereleasesif
thereisatechnicalneedforit.
Theextendedresourcereservationstatusvalues7-9mustbeseparatelyenabledinthe
WBTS.
FordetailsonHSUPAHWcongestionstatusdetectionalgorithm,whichusesthe
resourcereservationstatusvalues,seeWCDMA RAN RRM Packet Scheduler.

5.3 RABmodificationhandlingforUEsusingHSUPA
servicesinCell_DCHstate
WhentheRABmodificationisrequestedforQoSparametersofaUEthatusesHSPA
serviceswhileitisintheCELL_DCHstate,thenewRABparametersaretakenintouse
immediately.
RNCmapstheseQoSparameterstotheQoSprioritybasedonthe
QoSPriorityMappingmanagementparameter.
Thecellspecificpacketscheduleractsaccordingtothevalueofthe
NodeBRABReconfigSupportmanagementparameter:

IftheparameterissettoDisabled,thecell-specificpacketschedulerdoesnotuse
thenewQoSpriorityvalue,thatistheRABparametersarenottakenintouse
immediately.
Otherwise,thecell-specificpacketschedulerusestheQoSpriorityvaluetoprioritize
NRTRBs,anddefinesSchedulingPriorityIndicator(SPI)forE-DCHandHS-DSCH
connectionsbasedontheQoSpriorityvalue.TheSPIisspecifiedbythe
HSPAQoSEnabledmanagementparameter.

TheusageofHS-DSCHandE-DCHforindividualservicesintermsoftrafficclassand
thetraffichandlingpriorityisspecifiedbytheHSDSCHQoSclassesand
EDCHQOSClassesmanagementparameters.IftheUEusesHSUPAservicesandthe
usageofHSUPAisnotallowedwiththenewRABparameters(TC),thechanneltypeis
switchedtoDCH/HS-DSCH.IftheUEusesHSDPAorHSUPAservices,andtheusage
ofHSDPAisnotallowedwiththenewRABparameters(TC),thechanneltypeis
switchedtoDCH>0/>0kbit/s.
IftheSpeechCSRABcannotbemappedtoE-DCHtransportchannels,thentheSRBs
andSpeechCSRABaremappedtoDCHsinuplinkanddownlink,andtheotherRABs
aretreatedasinthepreviousreleases.Additionally,theEDCHQOSClassesconfiguration
parametercanlimittheuseofE-DCHwithSRBsonHSPAforacertaintrafficclass.
IftheRAN1004: Streaming QoS for HSPAfeatureisenabled,thebasestationradio
resourcemanagerdeterminestheNominalBitRates(NBR)forNRTconnections
mappedtoHSPAtransportchannelsbyusingtheHSPANBRValuesmanagement
parameter.ForHSPAtransportchannels,nominalbitratescanbespecifiedinULand
DLdirectionforpriorityvalues0...12.IfthemaximumbitrateofthenewRABissmaller
thantheconfigurednominalbitrate,theRNCmodifiestheNBRequaltothenewRAB's
maximumbitrate.

68 DN70303923 Issue:06B

WCDMARANRRMHSUPA AdmissiondecisionforRTservices

6 AdmissiondecisionforRTservices

g NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.

AbasestationmeasurestheE-DCHprovidedbitrateforeachsignalingpriorityindicator
(SPI),andreportsthevaluetotheRNC.Thecell-specificpacketschedulerchecksifUL
interferencepowerandloadforanewPSstreamingRBisavailable.

6.1 CelllevelmeasurementsusedbyPSstreamingand
CSvoice
AbasestationmeasurestheE-DCHprovidedbitrateforeachsignalingpriorityindicator
(SPI),andreportsthevaluetotheRNCinanNBAP:RADIORESOURCE
MEASUREMENTREPORT[aNokiaprivatesubmessage].TheRNCsendsthehigher
layerfilterintheMeasurement Filter CoefficientIEtotheBTS.Thevalueofthefilter
coefficientisspecifiedbythePrxMeasFilterCoeffmanagementparameterinthe
NBAP:RADIORESOURCEMEASUREMENTINITIATION[aNokiaprivatesub]
message.ThereportingiscontrolledbytheRRIndPeriod/PrxTotalReportPeriod
parameterthattheBTSreceivesintheNBAP:RADIORESOURCEMEASUREMENT
INITIATION[Nokiaprivatesub]message.
ThemeasurementisonlyinitiatedifHSUPAisactivatedwiththeHSUPAEnabledRNP
parameter,andHSPAstreaming,CSvoiceoverHSPA,HSPA72UsersperCell,or
HSPA128UsersperCellisactivatedwiththeHSPAQoSEnabledRNPparameter.
TheE-DCHprovidedbitratemeasurementresultsarenotaveragedintheRNC.Asthe
measurementperiodcanbequitelong,estimatedvalueswouldbeneededtoaverage
themeasurementresults.AstheschedulingisdoneintheBTS,theRNCcannot
estimatevalues.
TheRNCsupportsfilteringofthemeasuredE-DCHprovidedbitrate.Filteringthresholds
aresenttotheWBTSinaprivateNBAPmessage.Themaximumnumberofconsecutive
filteredmeasurementreportsissettothefixedvalueof9.Ifthereisnonew
measurementresultreceivedfromtheBTS,thepreviouslyreceivedresultisused.
WhenQoS-awareschedulingisused,theTrafficClass(TC),theTrafficHandlingPriority
(THP),andtheAllocationRetentionPriority(ARP)aremappedtotheSPI.Formore
information,seeWCDMA RAN RRM HSDPA.
IntheeventofPSNRTRABreconfigurationonE-DCH,changesinthevalue(s)ofthe
parametersARP,THPandTCresultinachangeoftheSPI,astheSPIiscalculatedby
thevaluesofARP,THPandTC.Pleasenotethattrafficchannelreconfigurationisonly
allowedforinteractiveandbackgroundtrafficclasses.
TheSPIandthetrafficclasstobeupdatedbytheu-planearereceivedintheE-DCH
MAC-dflowreconfigurationmessagefromL3;thismessageindicatesthatthebitrateof
aE-DCHMAC-dflowistobeupgradedordowngraded.TheSPIisusedtocalculatethe
HSUPAcongestioncontrolthresholdparametersforE-DCHMAC-dflows.Basedonthe
newSPIvalue,theIubcongestioncontrolthresholdparametersDelayThresholdMin
andDelayThresholdMidandtheHWcongestioncontrolthresholdareadjustedand

Issue:06B DN70303923 69

AdmissiondecisionforRTservices WCDMARANRRMHSUPA

re-calculatedintheE-DCHframeprotocolforallthebranchesoftheMAC-dflow.PS
NRTRABreconfigurationusesthereceivedSPIvalueswhileQoS-awareHSPA
schedulingcalculatestheseparametersduringtheconfiguration.
TheSPIvaluefortheMAC-dflowofSRBsonE-DCHisalwaysreadfromthe
PriForSRBsOnHSPAchildparameteroftheQoSPriorityMappingRNPparameter
whethertheQoSAwareHSPASchedulingfeatureisactivatedornot.

6.2 Loadandinterferencebasedadmissiondecision
forPSstreamingservices
Thecell-specificpacketschedulerchecksifULinterferencepowerandloadforanew
PSstreamingRBisavailable.Thisprocedureisperformedwhentheavailablepower
andloadneedstobecheckedduringtheadmissiondecisionforthefollowing:

RABassignment
Cell_FACH->Cell_DCHstatetransition
DCH0/0->DCHX/XorDCHX/HS-DSCHorE-DCH/HS-DSCH
channeltypeswitchfromE-DCHtoDCH

ThePSstreamingresourcerequestisadmittedforaDCH/E-DCHifoneofthefollowing
conditionistrue:

Figure 13 ThresholdsforPSstreamingresourcerequest

where
LDCH,CELListheowncellloadfactoroftheearlierDCHusers.

LncEDCH,CELListheowncellloadfactorofthenon-controllableE-DCHloadinthecell.

LEDCH_Streaming,CELListheowncellloadfactoroftheE-DCHstreamingusers.

ListhechangeintheowncellloadfactorofthePSstreamingusersrepresentingthe
PSstreamingresourcerequestalsoincludinginactiveRTDCHandPSstreamingRBs.
LminDCHistheminimumULloadthresholdfortheDCHallocation.

LmaxDCHisthemaximumULloadthresholdfortheDCHallocation.

Prx_scistheestimatedreceivedpowerincreasecausedbynewPSstreamingusers
includingalsoinactiveRTDCHandPSstreamingRBs.
Prx_target_PSisthedynamicallyadjustedtargetforreceivednon-EDPCHinterference
powerusedforNRTDCHscheduling.Ifdynamicresourceallocationiscurrentlynotin
useinUL(butdynamicresourceallocationfeatureisinuse),Prx_targetisused.

70 DN70303923 Issue:06B

WCDMARANRRMHSUPA AdmissiondecisionforRTservices

PrxNonEDPCHSTistheestimatedaveragedtotalreceivednon-EDPCHscheduled
transmissioninterferencepower.
IfthereisnoavailableULpowerforPSstreaming,theRT-over-NRTprocedureis
triggered.

InterferencebasedadmissiondecisionfortheE-DCHMAC-dflow
setupofthePSNRTbearer
Whenthecell-specificadmissioncontrol(AC)receivesanuplinkresourcerequestforthe
establishmentofthePSNRTbearerintheHSUPAconfiguration,thenitperformsthe
admissiondecisionunderthefollowingconditions:

AtthePSHSPAcallsetuprequest,theACoftheCRNCchecksthecurrentlevelof
theaveragedestimatedinterferencePrxNonEDCHST.Formoreinformation,seethe
ReceivedE-DCHpowersharechapter.Ifitexceedsthelimitvalue,definedasthe
maximumofthevaluesofthemanagementparametersPrxTarget,
PrxTargetMaxandPrxMaxTargetBTS,thentheACdoesnotadmittheHSPAcall
setuprequest.ThenthePSNRTcallsetupattemptcontinuesastheHSDPAorR99
callsetupattempt.
TheACoftheCRNCbeginstoadmitthePSHSUPAcallsoncemorewhenthe
PrxNonEDCHSTparameterdecreasesby1dBbelowthelimitvaluementionedinthe
previouspoint.

TheACpreventsthenewPSNRTHSUPAcallsetupsonlyifthePrxNonEDCHSTexceeds
thelimitvalue.NooverloadcontrolactionsareperformedfortheHSUPAcalls
establishedearlier.TheACisappliedforallkindofPSHSPAcallsetupattemptsexcept
thesofthandovers.Thesofthandoversareadmittedbecausetheirinterferenceis
alreadypresentinthechannel.
PRFILEcontrolwithBit14ofthePRFILEparameter007:0283isdefinedforthe
activationofthefunction:

TheACofthePSHSUPAcallsisactivatedifBit14=1.
Thefunctionisswitchedoffbydefault(Bit14=0).

Totalreceivednon-EDPCHscheduledtransmissioninterference
power
PSstreamingRBsarepartofthetotalreceivednon-EDPCHscheduledtransmission
interferencepowerPrxNonEDPCHSTthatisusedforULadmissioncontrolandpacket
schedulerdecisions.PrxNonEDPCHSTisachievedfromthecelltotalinterferencepowerby
excludingthescheduledtransmissiononE-DCHasshowninthefollowingequation:
PrxNonEDPCHST=Prx_total*(1-LEDCH_ST,Cell)

wherePrx_totalistotalreceivedinterferencepowerreportedbytheBTSandLEDCH_ST,Cell
istheE-DCHowncellloadfactorforscheduledtransmission.Thevalueof
PrxNonEDPCHSTisestimatedandtheestimatedvalueiscorrected.Averagingof
PrxNonEDPCHSTisperformedinthesamewayasforPrx_total.Formoreinformation,see
WCDMA RAN RRM Admission Control.

Issue:06B DN70303923 71

AdmissiondecisionforRTservices WCDMARANRRMHSUPA

Increase/decreaseofthecellloadfactorcausedbyPSstreaming
First,theloadfactorchangefortheradiolinkiscalculated.Theloadfactoroftheradio
linkdependsontheallocatedchanneltype.
Notethatsignalinglinksareonlytakenintoaccountiftheyarereconfigured.Otherwise
theycanbeignored.
IfthechanneltypeisE-DCH,old(Signaling(DCH))representsthesignalinglinkonDCH,
andold(Streaming(E-DCH))representsthestreamingservicesonE-DCHbeforethe
change.Afterthechange,new(Signaling(DCH))representsthesignalinglinkonDCH,
andnew(Streaming(E-DCH))representsthestreamingservicesonE-DCH.Inthis
scenario,PSstreamingresourcescanbeallocatedorreleasedbutnotreconfigured.
ThechangeLRLintheRRCconnectionloadfactoris:

LRL=Lnew(Streaming(E-DCH))-Lold(Streaming (E-DCH))+Lnew(Signaling(DCH))-Lold(Signaling(DCH))

IfthechanneltypeisswitchedfromE-DCHtoDCH,theold(Streaming(E-DCH))
representsPSstreamingservicesonE-DCHbeforethechanneltypeswitchhasbeen
triggered,andnew(Streaming(DCH))representsPSstreamingservicesonDCHafterthe
channeltypeswitch.
ThechangeLRLintheRRCconnectionloadfactoris:

LRL=MAX(Lnew(Streaming(DCH))-Lold(Streaming (E-DCH)),0)

IfthechanneltypeisswitchedfromDCHtoE-DCH,theold(Streaming(DCH))represents
PSstreamingservicesonDCHbeforethechanneltypeswitch,andnew(Streaming(E-
DCH))representsPSstreamingservicesonE-DCHafterthechanneltypeswitch.
ThechangeLRLintheRRCconnectionloadfactoris:

LRL=MIN(Lnew(Streaming(E-DCH))-Lold(Streaming(DCH)),0)

Finally,thechangetocellloadfactorisdefinedbythefollowingequation:
L=LRL+LinactiveStreaming,CELL+LinactiveDCH_RT,CELL

whereLinactiveStreaming,CELListheloadfactorofinactivePSStreamingRBsand
LinactiveDCH_RT,CELListheloadfactorofinactiveDCHRTradiobearers.

UplinkloadfactorsforNRTRBsonE-DCH
Thecell-specificpacketschedulercalculatestheuplinkloadfactorforNRTRBstoeach
SPIvaluewiththefollowingequation:

Figure 14 UplinkloadfactorforNRTRBstoeachSPIvalue

where:
Wisachiprate3.84Mc/s.
(EbNo)E-DCHaretheplannedEbNovaluesfortheE-DCH.

72 DN70303923 Issue:06B

WCDMARANRRMHSUPA AdmissiondecisionforRTservices

RSPIistheE-DCHprovidedbitrateforspecificSPImeasuredbytheBTS.

nisthenumberofNRTE-DCHMAC-dflowsinthespecificSPI.

UplinkloadfactorsforPSstreamingRBsonE-DCH
TheloadfactorforstreamingradiobearersonE-DCHisestimatedwiththefollowing
equation:

Figure 15 LoadfactorforstreamingradiobearersonE-DCH

where:
Wisachiprate3.84Mc/s.
(Eb/No)E-DCHaretheplannedULEb/NovalueforE-DCH.

RE-DCHisthemaximumULE-DCHbitrate,thatisthemaximumbitrateallocatedfor
non-scheduledtransmission.
vE-DCHistheactivityfactoroftheE-DCHstreamingservice.

Thecell-specificE-DCHloadfactorforPSstreamingservicesisthesumofthePS
streamingRBsonE-DCH:

Figure 16 Cell-specificE-DCHloadfactorforPSstreamingservices

QuantityLDPCCH(str)representstheL1overheadforthePSstreamingE-DCHMAC-d
flowwhenalsotheSRBsoftheRRCconnectionhavetheE-DCHMAC-dflow.Ifthe
SRBsareontheDCH,theDPCCHoverheadisconsideredtobelongtotheuplinkDCH
load.
TheuplinkloadfactorforactivePSstreamingRBsonE-DCHLactiveEDCH_Streaming,CELLis
calculatedbytakingintoaccountonlyactiveusers.
APSstreamingRBisinactivefromthetimeresourcesarereservedtothetimewhenthe
activityindicationisreceived.TheloadfactorforinactivePSstreamingRBsonE-DCHis
calculatedinthesamewayasforLEDCH_Streaming,CELL,butonlyinactivePSstreaming
RBsonE-DCHaretakenintoaccount:

Figure 17 LoadfactorforinactivePSstreamingRBsonE-DCH

NotethattheDPCCHloadfactorLDPCCHiscalculatedinthesamewayasforDCH
streaming.

Issue:06B DN70303923 73

AdmissiondecisionforRTservices WCDMARANRRMHSUPA

UplinkactivityfactorforPSstreamingonE-DCH
Thecell-specificpacketschedulercalculatestheuplinkactivityfactorforPSstreaming
onE-DCH.
Beforethefirststreamingradiobearerinthecellbecomesactive,theuplinkactivity
factorforPSstreamingonE-DCHvEDCH_Streaming,CELListakenfromthe
RRMULDCHActivityFactorPSStreamparameter,whichdefinestheactivityfactorforDCH
streaming.
WhentheE-DCHprovidedbitratemeasurementisreceived,thecellspecificpacket
schedulercheckswhetherthemeasurementresultcanbeusedtoupdatetheuplink
activityfactorforPSstreamingonE-DCH.Themeasurementreportisusedtoupdate
theactivityfactorifallofthefollowingchecksaresuccessful:

E-DCHprovidedbitrateforSPI>0
ThereneedstobeatleastoneactivestreamingRBonE-DCHinthesameSPI
whichE-DCHprovidedbitrateforSPI>0

IfthemeasurementreportcanbeusedtoupdatetheactivityfactorforsomeSPI,the
activityfactorforthismeasurementperiodiscalculatedwiththefollowingequation:

Figure 18 SPIspecificactivityfactorforE-DCHstreamingservices

RSPIistheE-DCHprovidedbitrateforspecificSPImeasuredbytheBTS.

RE-DCHisthemaximumULE-DCHbitrate.TheE-DCHmaximumbitrateisthe
maximumbitrateallocatedfornon-scheduledtransmission.
ThecurrentlyuseduplinkactivityfactorforPSstreamingonE-DCHiscorrectedas
follows:

Figure 19 CurrentlyuseduplinkactivityfactorforPSstreamingonE-DCH

wherenistheconstantvalue100.
Afterthefirstupdate,theupdatedvalueofvEDCH_Streaming,CELLisusedwhentheuplink
activityfactorforPSstreamingonE-DCHisneededforE-DCHstreamingloadfactor
calculations.StreamingcanbeallocatedtothreedifferentSPIsand,becauseofthat,
onemeasurementreportcancausethreeupdatestotheactivityfactor.Thechangeof
theactivityfactordoesnotaffectactivityfactorsandloadfactorsofexistingconnections.

CalculationoftheEbNovalueforE-DCH
TheEbNoforE-DCHiscalculatedfromtheplannedE-DCHEbNoandRxdiversitygain
withfollowingequation:
EbNoE-DCH=EbNoEDCH_Streaming+EbNoCell

74 DN70303923 Issue:06B

WCDMARANRRMHSUPA AdmissiondecisionforRTservices

whereEbNoEDCH_StreamingistheplannedEb/NoforE-DCHstreamingservices.Itis
configuredaccordingtothechildparameteroftheEbNoEDCHOfPSStrparameter
structure,whichdefinestheEb/NoforthespecificbitrateinE-DCHorthenexthigher
one.
EbNoCellis:

equalto0dBifthevalueoftheRxDivIndicatormanagementparameterequals'1
antenna'.
readfromtheEbNoDCHRxDiv2managementparameterifthevalueofthe
RxDivIndicatormanagementparameterequals'2antenna'.
readfromthemanagementparameterEbNoDCHRxDiv4ifthevalueofthe
RxDivIndicatormanagementparameterequals'4antenna'.

TheparametersEbNoEDCHOfPSStr,EbNoDCHRxDiv2andEbNoDCHRxDiv4areread
fromtheWRABobjectthatisidentifiedbytheEbNoSetIdentifiermanagement
parameter.

6.3 Loadandinterferencebasedadmissiondecision
fortheCSvoiceestablishment
Cell-specificadmissioncontrolproducestheuplinkloadfactoroftheE-DCHMAC-dflow
establishedfortheSRBwiththeformula:

Figure 20 UplinkloadfactoroftheE-DCHMAC-dflow

SFDPCCHisthespreadingfactoroftheuplinkDPCCH.

ThevalueofthereadingparameterMaximum Set of E-DPDCHsisdefinedassuming


thatSRBonlyhadtheE-DCHMAC-dflow,andE-TTI=2mswasused.Considerthat
NMACdisthemaximumnumberoftheMAC-dPDUs,whichtheE-DCHMAC-dflow
transferstheSRBduringtheE-TTIperiodof2ms.LowerlimitforthesizeoftheMAC-e
PDUisthen:

Figure 21 LowerlimitforthesizeoftheMAC-ePDU

SMACdisthesizeoftheMAC-dPDUofthesignalingradiobearer:144bits.

NDDI=6bitsfortheDatadescriptionindicator(DDI).

NPDU=6bitsfortheNumberofMAC-dPDUs.

NTSN=6bitsfortheTransmissionSequenceNumber(TSN).

Issue:06B DN70303923 75

AdmissiondecisionforRTservices WCDMARANRRMHSUPA

POEDPDCHistheE-DPDCHpoweroffsetvalue(ed/c)2.ThevaluesoftheE-
DPDCH/DPCCHamplituderatioed/caredefinedwiththeE-TFCIvaluethatconforms
totheMAC-ePDUsizeandtheMaximum Set of E-DPDCHsdefinedabove.TheE-
DPDCHsymbolrateisderivedfromtheMaximum Set of E-DPDCHs.
slEDCHistheactivityfactoroftheSRBE-DCHMAC-dflow;itsvalueisdefinedusingthe
E-DCHprovidedbitratemeasurement:

Figure 22 ActivityfactoroftheSRBE-DCHMAC-dflow

TheinitialvalueofslEDCH,issettothevalueslDCHofthemanagementparameter
RRMULDCHActivityFactorSRB.Variablenvalueequals100.
ifapositivePBR(sISPI)resultoftheE-DCHprovidedbitratemeasurementforthe
schedulingpriorityvaluesISPI,whichhasanE-DCHMAC-dflowestablishedforaSRB,
hasbeenreceivedfromtheBTS,thentheactivityfactorvalue slEDCHiscorrectedusing
thelatterequationoftheequationpairabove.QuantitiesRslMACd(SPI)representthe
maximumMAC-dbitratesoftheSRBs,whichhavetheE-DCHMAC-dflowestablished
withtheschedulingpriorityvalueSPI:

Figure 23 themaximumMAC-dbitratesoftheSRBs

ETTIequalstheE-TTIvalueof2ms.ItisassumedthatoneHARQprocessisallocated
fortheE-DCHMAC-dflow.QoSprioritizationishandledwiththestructuredRNC-level
RNPparameterQoSPriorityMapping.OneQoSpriority(SPI)valueissetforHSPA
conversationalserviceswiththeparameterPriForIntSignaling.Formore
information,seeWCDMA RAN RRM HSDPA.

TheE-DCHloadfactoroftheCSspeechbearers
Cell-specificadmissioncontrolproducestheuplinkloadfactoroftheE-DCHMAC-dflow
establishedfortheCSAMRRABwiththeformula:

Figure 24 TheE-DCHMAC-dflowestablishedfortheCSAMRRAB

Wisachiprate3.84Mcps.

76 DN70303923 Issue:06B

WCDMARANRRMHSUPA AdmissiondecisionforRTservices

EbNoamrEDCHistheplanneduplinkEb/N0valueoftheCSspeechRABwhichhasitsE-
DCHMAC-dflowestablished.
RamrEDCHisthemaximumE-DCHbitrateoftheCSAMRspeechRABwithaparticular
allocatedcodecset;thebitrateisachievedfromtheequation:

Figure 25 themaximumE-DCHbitrateoftheCSAMRspeechRAB

NUMDisthesizeoftheMAC-dPDUoftheradiobearer.Itsvalueiscalculatedforthe
maximummodeofthecodecsetoftheCSvoicebearer.
TTIAMR=20ms.

NDDI=6bitsfortheDatadescriptionindicator(DDI).

NPDU=6bitsfortheNumberofMAC-dPDUs.

NTSN=6bitsfortheTransmissionSequenceNumber(TSN).

amrEDCHistheactivityfactoroftheCSspeechE-DCHMAC-dflow;itsvalueisdefined
usingtheE-DCHprovidedbitratemeasurement:

Figure 26 ActivityfactoroftheCSspeechE-DCHMAC-dflow

TheinitialvalueofamrEDCHissettothevalueamrDCHofthemanagementparameter
RRMULDCHActivityFactorCSAMR.Variablenvalueequals100.
IfapositivePBRresultoftheE-DCHprovidedbitratemeasurementforthescheduling
priorityvalueamrSPI,whichhasanE-DCHMAC-dflowestablishedforaCSspeech
RAB,hasbeenreceivedfromtheBTS,thentheactivityfactorvalueamrEDCHis
correctedusingthesecondequationoftheequationpairabove.QuantitiesRamrMACd
(SPI)representthemaximumMAC-dbitratesoftheCSvoicebearers,whichhavethe
E-DCHMAC-dflowestablishedwiththeschedulingpriorityvalueSPI:

Figure 27 MaximumMAC-dbitratesoftheCSvoicebearers

QoSprioritizationishandledwiththestructuredRNClevelRNPparameter
QoSPriorityMapping.OneQoSpriority(SPI)valueissetforHSPAconversational
serviceswiththeparameterPriForConvOnHSPA.Formoreinformation,seeWCDMA
RAN RRM HSDPA.

Issue:06B DN70303923 77

AdmissiondecisionforRTservices WCDMARANRRMHSUPA

PlannedEb/N0fortheE-DCHMAC-dflowoftheCSvoicebearer
Whenthecell-specificadmissioncontrolproducestheuplinkloadfactoroftheE-DCH
MAC-dflowofCSvoicebearer,itusestheEb/N0ofthefollowingformula:

Figure 28 TheuplinkloadfactoroftheE-DCHMAC-dflowofCSvoicebearer

EbNoEDCHisthevalueofthemanagementparameterEbNoEDCHCSAMR.

EbNoCellis

equalto0dB,ifthevalueofthemanagementparameterRxDivIndicatorequals
1antenna,
readfromthemanagementparameterEbNoDCHRxDiv2,ifthevalueofthe
managementparameterRxDivIndicatorequals2antenna,
readfromthemanagementparameterEbNoDCHRxDiv4,ifthevalueofthe
managementparameterRxDivIndicatorequals4antenna.

ParametersEbNoDCHRxDiv2andEbNoDCHRxDiv4arereadfromtheWRABobject
identifiedwiththemanagementparameterEbNoSetIdentifier.EbNoamrEDCHis
applicabletobothE-TTIvalues2msand10ms.ItisalsoapplicabletoallAMRand
AMRWBcodecsets.

LoadfactorsfortheuplinkL1overheadoftheRTserviceswhenall
bearersoftheRRCconnectionaretransferredintheHSPA
configuration
Cell-specificadmissioncontrolcalculatestheloadfactorsfortheL1overheadoftheRT
servicesoftheRRCconnectionwiththefollowingformula,whenallitsbearers,including
SRBs,aretransferredintheHSPAconfiguration:

Figure 29 L1overheadoftheRTservicesoftheRRCconnection

SFDPCCHisthespreadingfactoroftheuplinkDPCCH.

DPCCHistheactivityfactoroftheuplinkDPCCH,anditsvalueisdefinedasfollows:

IftheuplinkDPCCHloadfactorisproducedfortheSRBtransferredintheHSPA
configuration,thenDPCCHequalstheactivityfactorslEDCHoftheSRBE-DCH
MAC-dflow
IftheuplinkDPCCHloadfactorisproducedfortheCSspeechRABtransferredin
theHSPAconfiguration,thenDPCCHequalstheactivityfactoramrEDCHoftheE-
DCHMAC-dflow
IftheuplinkDPCCHloadfactorisproducedforthePSstreamingRABtransferredin
theHSPAconfiguration,thenDPCCHequalstheactivityfactor
EDCH_Str_meas,CELLofthePSstreamingRABE-DCHMAC-dflowproduced

78 DN70303923 Issue:06B

WCDMARANRRMHSUPA AdmissiondecisionforRTservices

E-DPCCHpoweroffsetvaluesPOEDPCCHaredefinedbysettingitequalto(hs/c)2,
wherehs/cisthevalueofthemanagementparameterAmplitudeRatioEDPCCH.HS-
DPCCHpoweroffsetvaluesPOHSDPCCHaredefinedinthefollowingway:

Figure 30 HS-DPCCHpoweroffsetvalue

Theowncellloadfactorofthenon-controllableE-DCHloadinthe
cell
Cell-specificadmissioncontrolcalculatestheuplinkowncellloadfactorofthenon-
controllableloadfortheRRCconnectionswhosebearers,includingtheSRBs,are
transferredintheHSPAconfiguration:

Figure 31 Thenon-controllableloadfortheRRCconnections

QuantityLamrEDCHistheE-DCHloadfactoroftheCSspeechbearer.

QuantityLslEDCHistheE-DCHloadfactoroftheSRB.

QuantitiesLDPCCH(amr)and LDPCCH(srb)representtheL1overheadsfortheCSspeech
andtheSRB,whenalsotheSRBistransferredintheHSPAconfiguration.

Thevaluefortheestimatedreceivedsemi-controllableinterference
powerofthePSstreamingbearers
Cell-specificpacketschedulercalculatestheinstantaneousvaluefortheestimated
receivedsemi-controllableinterferenceinthecellthathastheHSUPAconfiguredwith
theformula:

Figure 32 Theinstantaneousvaluefortheestimatedreceivedsemi-controllable
interference

PrxNonEDCHSTistheestimatedreceivedwidebandpower.
LactiveStreaming,CELListheuplinkowncellloadfactoroftheactivePSstreamingbearers.
ItsvalueisthesumofloadfactorsLactiveEDCH_Streaming,CELLandLactiveDCH_Streaming,CELL.

Issue:06B DN70303923 79

AdmissiondecisionforRTservices WCDMARANRRMHSUPA

Thevaluefortheestimatedreceivednon-controllableinterference
power
Thecell-specificpacketschedulercalculatestheinstantaneousvaluefortheestimated
receivednon-controllableinterferenceinthecellthathastheHSUPAconfiguredwiththe
formula:

Figure 33 Theestimatedreceivednon-controllableinterferenceinthecellthathasthe
HSUPAconfigured

PrxNonEDCHSTistheestimatedreceivedwidebandpower.
LactiveStreaming,CELListheuplinkowncellloadfactoroftheactivePSstreamingbearers.
ItsvalueisthesumofloadfactorsLactiveEDCH_Streaming,CELLand LactiveDCH_Streaming,CELL.

LnrtDCH,CELListheuplinkowncellDCHloadfactorofthePSNRTbearers.

QuantityLHSDPCCH,CELLisproduced,withtheexceptionthatonlythoseRRCconnections
areincludedthathaveHSDPAconfiguredwithDCHastheuplinkreturnchannel.

Theuplinkadmissiondecisionsregardingtheresourcerequestsfor
theestablishmentoftheE-DCHMAC-dflowsfortheSRBandCS
AMRspeechbearers
Whenthecell-specificadmissioncontrolreceivesanuplinkresourcerequestforthe
establishmentoftheSRBorCSspeechserviceintheHSUPAconfiguration,andit
requiresthepower-basedadmissiondecision,itusesthefollowingconditions:

Figure 34 ResourcerequestfortheestablishmentoftheSRBorCSspeechservice

PrxTargetisthevalueofthemanagementparameterPrxTarget.
PrxTargetAMRisthedynamicinterferencepowertargetintroducedintherequirementin
WCDMA RAN RRM Admission Control.
LDCH,CELListheowncellloadfactoroftheearlierDCHusers.Formoreinformation,see
WCDMA RAN RRM Admission Control.
LDCH_Streaming,CELListheowncellloadfactoroftheDCHstreamingusers.Formore
information,seeWCDMA RAN RRM Admission Control.

80 DN70303923 Issue:06B

WCDMARANRRMHSUPA AdmissiondecisionforRTservices

LnrtDCH,CELListheowncellloadfactoroftheearlierNRTDCHusers.Formore
information,seeWCDMA RAN RRM Admission Control.
LncEDCH,CELListheowncellloadfactorofthenon-controllableE-DCHloadinthecell.

Listhechangeintheowncellloadfactor.IftheresourcerequestisfortheSRB,then
L=LslEDCH+LDPCCH(SL).IftheresourcerequestisfortheCSspeech,thenL=
LamrEDCH+LDPCCH(AMR).Iftheresourcerequestisforbothbearers,thenListhesum
ofthebearerspecificloadfactors.NotethatintheseformulasLrepresentsonlythe
loadfactoroftheresourcerequest.
LminDCHistheminimumULloadthresholdfortheDCHallocation.Formoreinformation,
seeWCDMA RAN RRM Admission Control.
LmaxDCHisthemaximumULloadthresholdfortheDCHallocation.Formoreinformation,
seeWCDMA RAN RRM Admission Control.
Prx_ncistheaverageoftheestimatedreceivednon-controllableinterferenceproducedas
describedinWCDMA RAN RRM Admission Control.
Prx_ncistheestimatedchangeinthereceivednon-controllableinterferencepower.If
theresourcerequestconcernsthesignalinglink,thenPrx_nc=0.IfitconcernstheCS
speech,thenPrx_ncisproducedwithpowerestimationformulas.

ThevalueofRTWPisdefinedbyapplyingthemanagementparameter
VoiceOverrideSTHSUPAintheHSUPAcell:

IfthevalueofthemanagementparameterisOverridenotallowed,then:
Figure 35 ValueofthemanagementparameterisOverridenotallowed

IfthevalueofthemanagementparameterisOverrideallowed,then:
Figure 36 ValueofthemanagementparameterisOverrideallowed

PrxTotalisthelastvalueofthewidebandinterferencepowermeasurementresult
receivedfromBTSforthecell.PrxNonEDCHSTistheaverageestimatedreceivedtotalnon-
scheduledE-DCHpower.Itisaveragedatthemomentoftheadmissiondecision,using
theaveragingwindowsizedefinedwiththemanagementparameter
WinACRABsetupUL.
Thismethodisusedintheinterferencebaseduplinkadmissiondecisionwhenthecell
hastheHSUPAconfigured:

FortheestablishmentofthesignalinglinkintheHSPAconfiguration
FortheestablishmentoftheCSvoicebearerintheHSPAconfiguration
Fortheinter-frequencyhardhandoveroftheCSvoice,inthetargetcellofthe
handover

IfthecelldoesnothavetheHSUPAconfigured,oriftheR99resourceisallocatedtothe
CSvoicebearer,thentheadmissiondecisionismadeasdescribedinWCDMA RAN
RRM Admission Control.

Issue:06B DN70303923 81

AdmissiondecisionforRTservices WCDMARANRRMHSUPA

Thechangeintheestimatedreceivednon-controllablewideband
power
ThepowerincreaseestimationPrx_ncfortheRTserviceresourcerequest,otherthan
PSstreaming,isobtainedfromthefollowingformulawhenL>0(PIE):

Figure 37 PowerincreaseestimationfortheRTserviceresourcerequest

Thevalueofthequantityisdefinedwiththemanagementparameter
UlLoadEstimationFactorAC.
If(1--L)<0.05,thenthevalueofthequantityissetto1despitethevalueofthe
managementparameterUlLoadEstimationFactorAC.
PowerincreaseestimationforthePSstreamingserviceresourcerequestisobtained
fromthefollowingformulawhenL>0(PIE):

Figure 38 PowerincreaseestimationforthePSstreamingserviceresourcerequest

If(1--L)<0.05,thenthevalueofquantityissetto1despitethevalueofthe
managementparameterUlLoadEstimationFactorAC.Listhechangeintheown
cellloadfactorofthebearers,whichtheserviceoftheresourcerequestrepresents.L
includes:

theuplinkTrCH-DCHorE-DCH-loadfactorsoftheRTresourcerequest,
theuplinkloadfactorsoftheresourcerequests,whichwereadmittedearlierandare
significantfortheuplinkresourceallocationoftheRTresourcerequestbutwhich
havenotbecomeyetactive,
theuplinkTrCHs,whicharesignificantfortheuplinkresourceallocationoftheRT
resourcerequestbutareinactivecurrently.

ServiceissignificantincalculatingLvalueifthepartoftheloadfactortowhichthe
servicebelongsisnotsubtractedfromthefractionalloadoftheappliedpower
estimationformula.
QuantityRTWPisthevalueofthereceivedinterferencepowerdefinedinthefollowing
way:

IfthecelldoesnothavetheE-DCHconfigured,thenRTWPissetequaltothe
Prx_total,whichadmissioncontrolhasproducedfromthesamplesoftheestimated
receivedinterferencepowerPrx_totalprovidedbyloadcontrol,asdefinedin
WCDMA RAN RRM Admission Control.
isthevalueofthefractionalloadandisdefinedwiththeequation:

82 DN70303923 Issue:06B

WCDMARANRRMHSUPA AdmissiondecisionforRTservices

wherePrxNoiseisthecurrentnoisepowerlevel.
IfthecellhastheE-DCHconfigured,thenRTWPissetequaltothemaximumofthe
quantitiesPrxNonEDCHSTandthelastvaluereportedbytheBTSforthereceivedtotal
widebandpowerinacommonmeasurementreport.TheformerquantityAChas
producedfromthesamplesoftheestimatedreceivedinterferencepower
PrxNonEDCHSTprovidedbyLC.
isthevalueofthefractionalloadandisdefinedwiththeequation:

wherePrxNoiseisthecurrentnoisepowerlevel.

LactiveStreaming,CELListheuplinkowncellloadfactoroftheactivePSstreamingbearers.
ItsvalueisthesumoftheloadfactorsLactiveEDCH_Streaming,CELLand
LactiveDCH_Streaming,CELL.Formoreinformation,seeWCDMA RAN RRM Admission
Control.
LactiveNRTistheowncellloadfactoroftheactiveULPSNRTbearersintroducedin
WCDMA RAN RRM Admission Control.
Quantity LHSDPCCH,CELLisproducedasspecifiedintheWCDMA RAN RRM Admission
Control,withtheexceptionthatonlythoseRRCconnectionsareincludedthathavethe
HSDPAconfiguredwithDCHastheuplinkreturnchannel.

Theuplinkadmissiondecisionsoftheresourcerequestsforthe
establishmentoftheWPScall
Whenthepowerandloadbasedadmissiondecisionismadefortheuplinkresource
requestoftheWPSvoicecall(Formoreinformation,seeWCDMA RAN RRM Admission
Control),thentheconditionsofthefunctionalityareappliedwiththefollowing
modifications:

PrxTargetisreplacedwiththesumofthequantitiesPrxTargetandPrxOffsetWPS,
and
PrxTargetAMRisreplacedwiththequantityMIN(PrxTargetAMR+PrxOffsetWPS,
PrxTargetMax),and
MaximumthroughputthresholdLmaxDCHisreplacedwiththethresholdLWPS(maxDCH).
ItsvalueisdefinedinWCDMA RAN RRM Admission Control.

PrxOffsetWPSisthevalueofthemanagementparameterPrxOffsetWPSand
PrxTargetMaxisthevalueofthemanagementparameterPrxTargetMax.Formore
information,seeWCDMA RAN RRM Admission Control.

6.4 RBsetupforinactivePSstreamingRABs
TrafficvolumemeasurementsareperformedinuplinkdirectionbytheUEandin
downlinkdirectionbytheMAClayer.Thesemeasurementstriggertherequestfor
capacity.

Issue:06B DN70303923 83

AdmissiondecisionforRTservices WCDMARANRRMHSUPA

MAC-dandframeprotocolentitiessendtheirindicationstoadmissioncontrolandpacket
schedulerwhendatatransferstartsintheestablishedRTHS-DSCHandE-DCH.
AdmissioncontrolandpacketschedulerconsidertheHS-DSCHandE-DCHasactive
afterthenextcompletecommonmeasurementreportingperiodthatfollowsthereceived
activityindication.Forestimatedmeasurements,theRTPSRABisconsideredactive
immediatelywhentheactivityindicationisreceived.

84 DN70303923 Issue:06B

WCDMARANRRMHSUPA RT-over-NRT,RT-over-RT,andRABpre-emption

7 RT-over-NRT,RT-over-RT,andRABpre-
emption

g NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.

7.1 RT-over-NRT,RT-over-RT,andRABpre-emption
relatedtoHSUPA
RT-over-NRT,RT-over-RT,andRABpre-emptionactionscanbetriggeredtogetfreeE-
DCHresourcesforRTservicesinthefollowingphases:

RABassignmentrequestreceived
PSstreamingRBinactivitychangesfrominactivetoactive
SofterhandoverbranchadditionforPSstreamingRB
E-DCHactivesetupdatescausedbyE-DCHactivesetbecomeunacceptable.

RT-over-NRT,RT-over-RT,andRABpre-emptionactionsonE-DCHcanbetriggered
becauseof:

MaximumnumberofE-DCHallocations
BTSHWcongestion(seeRT-over-NRT,RT-over-RTandRABpre-emptionrelatedto
HSUPAforBTScongestionchapter)
Radiointerfaceload(onlyforPSstreamingservice)
Transportresourcecongestion

RT-over-NRT,RT-over-RT,andRABpre-emptionactionscausedbytheRTDCHarenot
tobetargetedtoE-DCHsandE-DCHrelatedtransportchannelsincaseofuplink
interference,downlinkpower,downlinkspreadingcode,BTSandRNCcongestion.An
exceptionisPSstreaminginthecaseofuplinkinterference.Furthermore,IubAAL2
transmissionusedbyE-DCHscanbetargetofsuchactionsiftheyusethesame
transportresourcesasthenewservice,seeWCDMA RAN RRM HSDPA.
ForBTScongestioncases,seeexceptionsinWCDMA RAN RRM Admission Control.
NotethatthereleaseofthedownlinkchannelHSDPAMAC-dflowcausesthereleaseof
thecorrespondinguplinkE-DCH.
Notethatareal-timeCSservicescantriggerRT-over-RTactionswherePSstreamingis
atarget.Formoreinformation,seeWCDMA RAN RRM Admission Control.Pre-emption
isnotperformedtoPSservicesbecauseresourcesusedbyPSservicescanbereleased
withoutreleasingtheRAB.
RT-over-NRTcanbetriggeredinDCHsideinthechanneltypeswitchfromE-DCHto
DCHphasebecauseofradiointerfaceload.
Allpossiblecombinationsofphasesandtriggersaresupportedexcepttofollowingones:

Issue:06B DN70303923 85

RT-over-NRT,RT-over-RT,andRABpre-emption WCDMARANRRMHSUPA

DuringchanneltypeswitchfromDCHtoE-DCH,theRT-over-NRT,RT-over-RT,and
RABpre-emptionactionsarenottriggered.Notealsothattheradiointerfaceloadis
notcheckedbecauseitcannotincreaseinestimations.
InthecaseofbranchadditionforPSstreamingRB,theradiointerfaceloadisnot
checkedanditisalwaysadmitted.
WhentheE-DCHactivesetisupdatedbecausetheE-DCHactivesetbecomes
unacceptable,RT-over-NRTisonlytriggeredwhentheE-DCHactivesethas
becameunacceptableasthemaximumnumberofE-DCHallocationshasbeen
reached.

TheRT-over-NRTprocedurefortransportresourcesisperformediftransportresources
arenotfoundforRTservices.
IntargetNRTselection,firstlytheinactiveusersareselected.Theselectionisdescribed
inWCDMA RAN RRM HSDPA.Thenumberoftargetedinactiveusersisdefinedwiththe
parameterInacUserNbrXXXOverNRT.Cell-specificpacketschedulerchoosesthis
numberofinactiveusersfromthecell,theBTSlocalcellgrouportheBTS(depending
oncongestion)basedontheprioritydescribedinWCDMA RAN RRM HSDPA.Ifthe
numberofinactiveusersissmallerintheBTSlocalcellgroup,allinactiveusersare
chosen.Iftherearenoinactiveusersinthecell,theBTSlocalcellgrouportheBTS,the
selectionproceedsasdefinedintheRT-over-NRTfeature(anactiveuseristargeted).
IfRT-over-NRTorRT-over-RTcannotbeused(noPSservices),thenapossibilityfor
pre-emptionischecked.Pre-emptionisperformedbythesamerulesasinthecaseof
servicesmappedtotheDCH(pre-emptionvulnerability,ARPlevel).Formore
information,seeWCDMA RAN RRM Admission Control.Ifpre-emptiondoesnot
succeed,thenallocationtoDCHsideisattemptedusingtheexistingDCHprinciples.If
theuserhasmorethanoneRBmappedtoHSPA,thenthepriorityoftheuseristhe
sameasthepriorityofthehighestpriorityRABmappedtotheHSPA.Incaseoffull
HSPAconfiguration,areleaseofanHSPAusermeansalsothattheSRBsareswitched
totheDCH(becausealltheHS-DSCHMAC-dflowsofthatusermustbereleased).Pre-
emptionactionscanbecarriedoutasmanytimesasisdefinedinthe
MaxNumberOfReAttemptsCongRNPparameter.

RT-over-NRT,RT-over-RT,andRABpre-emptionactionsduetothe
maximumnumberofE-DCHallocation
Thecell-specificpacketschedulertriggerstheRT-over-NRT,RT-over-RT,andRABpre-
emptionactionsifitattemptstoallocateE-DCHforRTRB,andifanyofthefollowing
limitsisreached:

ThemaximumnumberofE-DCHallocationsatthecelllevel(MaxNumberEDCHCell)
TheTemporary maximum number of HSUPA usersfunctionoftheRAN2879:
MassEvent Handler featuremightrestrictE-DCHallocationsinthecell.Formore
information,seeTemporarymaximumnumberofHSUPAuserschapter.
ThemaximumnumberofE-DCHallocationsattheBTSlocalcellgrouplevel
(MaxNumberEDCHLCG)
ThemaximumnumberofHSUPAusersattheBTSlocalcellgrouplevel
(HSUPAXUsersEnabled)
ThemaximumnumberofE-DCHallocationsattheBTSlevel
(HSUPAXUsersEnabled)
Activatedcapacityfeature

86 DN70303923 Issue:06B

WCDMARANRRMHSUPA RT-over-NRT,RT-over-RT,andRABpre-emption

Ifthecelllevellimitation(s)is(are)reached,thecell-specificpacketschedulerselectsthe
suitablecandidatefromthesamecell.IftheBTSlocalcellgrouplevellimitationis
reached,thecell-specificpacketschedulerselectsthesuitablecandidatefromthesame
localcellgroupunderthisBTS.IftheBTSlevellimitationisreached,thecell-specific
packetschedulerselectsthesuitablecandidatefromthesameBTS.Formore
informationontheselectionofNRTRB,seeWCDMA RAN RRM HSDPA.
IncaseofmultiRABs,allRBsofanindividualuserneedtobereleasedtogetfree
capacityforthenewRB.ThehighestpriorityRABoftheuserdefinesthepriorityofthe
activeuser.
Whenthesuitabletargetisselected,thecell-specificpacketschedulersendsan
indicationtotheUE-specificpacketschedulertoreleaseE-DCHresourcesfromthisUE.
Thus,aDCH0/0kbit/sisallocatedorastatetransitiontoCell_FACHoraRABreleaseis
performed.Assoonaspossible,theUE-specificpacketschedulercontinuesRB
allocationonE-DCH.Resourcesarefreezedduringtheoperation.Ifnosuitable
candidateisfound,theRBallocationiscontinuedtoDCH.
TheNumberEDCHReservedSHOBranchAdditionsparameteristakenintoaccountin
theradiobearersetupforanyservice.

Pre-emptionandRT-over-(N)RTactionsforsignaturesarenot
initiatedbysignaturecongestion
TheRRMkeepstrackonlyofthesignaturesreservedbytheBTS.Iftherearenot
enoughsignatures,thentheBTSrejectstheradiolinkanditishandledasageneralBTS
congestion.

RT-over-NRTcausedbynotenoughloadand/orpoweravailablein
caseofPSstreaming
Thissectionliststhestepsthatthecell-specificpacketschedulerperformstocheckif
thereisenoughpoweravailableforRT-over-NRT.AllstepsareperformediftheRT-over-
NRTprocedureisperformedintheassignmentphase.Steps1,2and5areperformedif
theRT-over-NRTprocedureisperformedinanyotherphasethantheassignmentphase.

1. Acheckisexecutedtodetermineifthenewstreaminguserdoesnotexcessively
increaseinterferencepower(excludingscheduledE-DCHload).Itischeckedwith
thefollowingequation:
Figure 39 FirstcheckforRT-over-NRTpossibility(IftheRT-over-NRTisdonein
theassignmentphase)

Figure 40 FirstcheckforRT-over-NRTpossibility(IftheRT-over-NRTisdonein
anyotherphasethanassignmentphase)

Prx_targetistheplannedtargetforthereceivedtotalwidebandinterferencepowerin
thecell.

Issue:06B DN70303923 87

RT-over-NRT,RT-over-RT,andRABpre-emption WCDMARANRRMHSUPA

Prx_ncistheaveragetotalnon-controllablereceivedinterferencepower.
Prx_scistheaveragetotalsemi-controllablereceivedinterferencepower.
Prx_scistheestimatedreceivedpowerincreasecausedbynewPSstreamingusers
includingalsoinactiveRTDCHandPSstreamingRBs.
2. ThenewPrx_target_PS_targetvalue(Prx_target_PS_target_new)iscalculatedwiththe
followingequation:
Figure 41 Prx_target_PS_target_new

NotethatifdynamicresourceallocationisnotcurrentlyinuseinUL(butdynamic
resourceallocationfeatureisinuse),Prx_target_PS_target_newisnotcalculated.
3. AnevaluationisperformedtodeterminehowmuchpowerthenewstreamingRB
takesfromtheE-DCHandDCHside.TheE-DCHsideiscalculatedwiththe
followingequationbycomparingthecalculatedtargettothevaluecurrentlyused:
Figure 42 RT-over-NRTpowerontheEDCHside

NotethatifdynamicresourceallocationisnotcurrentlyinuseinUL(butdynamic
resourceallocationfeatureisinuse),thetargetcannotbechanged,whichmeans
thatnopowercanbetakenfromE-DCHside.
TheDCHsideiscalculatedwiththefollowingequation:
Figure 43 RT-over-NRTpowerontheDCHside

NotethatifdynamicresourceallocationisnotcurrentlyinuseinUL(butdynamic
resourceallocationfeatureisinuse),Prx_targetisusedinsteadof
Prx_target_PS_target_new.
4. Anevaluationisperformedtodetermineiftherequiredpowerforthenewstreaming
RBcanbetakenfromtheE-DCHandtheDCHside:
ifpowerisavailablefrombothsides,theRT-over-NRTisperformed.
ifpowerisnotavailablefrombothsides,theRABassignmentisrejected.

5. IfRT-over-NRTisperformed,thePrx_target_PSisadjustedbasedonthenew
calculatedPrx_target_PS_target_newvalue.Thisadjustmentisanextraadjustmentand
doesnotaffecttheperiodicallyadjustments.Resourcesarenotreleased,but
overloadcontroltakescareofthatifneeded.
NotethatifdynamicresourceallocationisnotcurrentlyinuseinUL(butdynamic
resourceallocationfeatureisinuse),Prx_target_PSisnotadjusted.

Interactivesignalingusersarenotconsideredinthecalculationasthispowerisnot
takenbyotherstreamingusers.Parameterschecksverifythatthe
PriForIntSignalingparameteralwayshasagreatervaluethanthe
RTOverNRTPriThresholdARP1,RTOverNRTPriThresholdARP2,and
RTOverNRTPriThresholdARP3parameters.

88 DN70303923 Issue:06B

WCDMARANRRMHSUPA RT-over-NRT,RT-over-RT,andRABpre-emption

EstimationoftheNRTRBspoweronE-DCHthatcanbefreedforPS
streamingRB
ThepowerthatcanbetakenfromE-DCHNRTusersduringtheRT-over-NRTprocedure
consistsofthefollowing:

unusedpower(Punused)
powerusedbynon-NBRusers(partofPlow_pri)
powerusedbyNBRuserswhosepriorityislowenoughforRT-over-NRT(partof
Plow_pri)
extrapoweroverNBRusedbyNBRusers(Pextra_high_pri)

1. UnusedpowerPunusediscalculatedwiththefollowingequation:
Figure 44 UnusedpoweronE-DCH

Where:
Prx_target_EDCHisthevalueofthePrxMaxTargetBTSparameter.
Prx_totalisthereceivedtotalwidebandpowerinacommonmeasurementreport.
Prx_scistheestimatedreceivedpowerincreasecausedbynewPSstreamingusers
(includingalsoinactiveRTDCHandPSstreamingRBs)
2. PowerPlow_pri(andloadfactorLlow_pri)usedbynon-NBRusersandNBRusers
whosepriorityislowenoughforRT-over-NRTiscalculatedwiththefollowing
equations:
Figure 45 LoadfactoroflowpriorityusersonE-DCH

LEDCH_SPIistheE-DCHloadfactorcalculatedperSPI.TheRT-over-NRTthresholdis
definedwiththeRTOverNRTPriThresholdARP1,
RTOverNRTPriThresholdARP2orRTOverNRTPriThresholdARP3parameter
dependingontheARPofthePSstreamingRB.
Theavailablepoweriscalculatedby
Figure 46 AvailablepowerfromlowpriorityusersonE-DCH

3. TheextrapoweroverNBRusedbyNBRusers(Phigh_pri_extra)iscalculatedwiththe
followingequations:
First,thebitrateoverNBRiscalculatedperSPI.ThisisperformedforallSPIs
whichhavetheirNBRdefinedinUL,andSPIgreaterthanthethresholddefined
withtheRTOverNRTPriThresholdARP1,RTOverNRTPriThresholdARP2or
RTOverNRTPriThresholdARP3parameterdependingontheARPofthePS
streamingRB.
RSPI=MAX(0,RPBR,SPI-RNBR,SPI)
where
RPBR,SPIistheprovidedbitrateforaspecificSPImeasuredbytheBTS.
RNBR,SPIisthenominalbitrateforaspecificSPIwithparameters.
Thentheloadfactoriscalculated.

Issue:06B DN70303923 89

RT-over-NRT,RT-over-RT,andRABpre-emption WCDMARANRRMHSUPA

Figure 47 LoadfactorforhighpriorityuseronE-DCH

LEDCH_SPIistheE-DCHloadfactorcalculatedperSPI.TheRT-over-NRT
thresholdisdefinedwiththe
RTOverNRTPriThresholdARP1,RTOverNRTPriThresholdARP2or
RTOverNRTPriThresholdARP3parameterdependingontheARPofthePS
streamingRB.TheHighest_SPI_with_NBRisthehighestSPIvaluethatthe
operatorhasdefinedfortheNBRinULwiththeHSPANBRValuesparameter
structure.
Theavailablepoweriscalculatednext.
Figure 48 AvailablepowerfromhighpriorityusersonE-DCH

4. Thepowerandtheloadfactorarefinallyaddedandcomparedtoseeifenough
powerfortheRT-over-NRTprocedureisavailable.
Pavailable,EDCH=Punused+Plow,pri+Phigh,pri,extra
Lavailable,EDCH=Llow,pri+Lhigh,pri,extra
Thepowerisavailableiffollowingequationistrue:
Figure 49 AvailabilityofpoweronE-DCHsidefornewstreaminguser

PRT-over-NRT,EDCHisthepowertheE-DCHNRTsideneedsforRT-over-NRT

TheNRTRBspoweronDCHthatcanbefreedforthePSstreaming
connection
ThepowerthatcanbetakenfromDCHNRTusersduringtheRT-over-NRTprocedure
consistofpowerusedbyNRTuserswhosepriorityislowenoughforRT-over-NRT
Availablepower(andloadfactorLavailable DCH)iscalculatedwiththefollowingequations:

Figure 50 AvailableloadfactoronDCH

TheRT-over-NRTthresholdisdefinedwiththeRTOverNRTPriThresholdARP1,
RTOverNRTPriThresholdARP2orRTOverNRTPriThresholdARP3parameter
dependingontheARPofthePSstreamingRB.
LDCH_SPIistheDCHloadfactorcalculatedperSPI.Itiscalculatedwiththefollowing
equation:

90 DN70303923 Issue:06B

WCDMARANRRMHSUPA RT-over-NRT,RT-over-RT,andRABpre-emption

Figure 51 DCHloadfactorperSPI

LDCH_NRT_activeistheloadfactorofactiveNRTDCHs.Formoreinformation,see
WCDMA RAN RRM Admission Control.
Theavailablepoweriscalculatednext:

Figure 52 AvailablepoweronDCH

PrxNonEDPCHSTistheestimatedaveragedtotalreceivednon-EDPCHST(scheduled
transmission)interferencepower.Itincludesallinterferencepowerexceptscheduled
transmissiononE-DCH.
Thepowerisavailableifthefollowingequationistrue:

Figure 53 PoweravailabilityonDCHsidefornewstreaminguser

PRT-over-NRT,DCHisthepowertheDCHNRTsideneedsforRT-over-NRT.

LDCH,CELListheowncellloadfactoroftheearlierDCHusers

LEDCH_Streaming,CELListheowncellloadfactoroftheE-DCHstreamingusers

LnrtDCH,CELListheowncellloadfactoroftheearlierNRTDCHuser

ListhechangeintheowncellloadfactorofthePSstreamingusersrepresentingthe
PSstreamingresourcerequest(includingalsoinactiveRTDCHandPSstreamingRBs)
LmaxDCHisthemaximumULloadthresholdfortheDCHallocation

RT-over-NRT,RT-over-RT,orRABpre-emptioncausedby
unsuccessfultransportresourcereservation
IftransportresourcereservationisunsuccessfulfortheE-DCH,acheckisperformedto
determineiftherearelowerpriorityusersthatcanbereleased.Ifenoughresourcesare
found,thoseRBsarereleased,andanewreservationattemptforthetransport
resourcesiscarriedout.Ifnotenoughresourcescanbefreedup,areservationattempt
fortheDCHisperformed,andallocationcontinuesalongitsprinciples.
IftheCSvoicemappedtotheHSPAfacestransportcongestion,andtransportresources
areattemptedtobereleasedwiththepre-emption,theRT-over-RT,ortheRT-over-NRT,
thenafixedactivityfactorof100%isusedfortheCSvoicebearerwhencalculatingthe
amountofnecessarytransportresources.

Issue:06B DN70303923 91

RT-over-NRT,RT-over-RT,andRABpre-emption WCDMARANRRMHSUPA

InthetargetNRTselectioninactiveusersarefirstselected,andafterthatactiveusers
areselected.TheselectionisdescribedinWCDMA RAN RRM HSDPA.

RT-over-NRTduetoE-DCHactivesetisunacceptableforUEwithPS
streamingRBonE-DCH
WhentheE-DCHactivesetupdatefailsandtheE-DCHactivesetisunacceptablefora
UEthathasPSstreamingradiobearerallocatedonE-DCH,RT-over-NRTistriggered.If
RT-over-NRTdoesnotsucceed,thechanneltypeswitchisperformedfromE-DCHto
DCH.IfthechanneltypeswitchtoDCHfails,RT-overNRTcanbetriggered.IfRT-over
NRTdoesnotsucceed,DCH0/0kbit/sisallocatedtoallPSradiobeareroftheUE.

RT-over-(N)RTand/orpre-emptionisusedinresourceproblemsof
conversationalservicesmappedtoHSPA
RT-over-NRTand/orRT-over-RTareappliedinallothercongestionsthanthepowerand
interferencecongestion.Thelastcasesarehandledwithconventionaloverloadactions
targetedtothePSNRTandPSstreamingservices.AllresourcesusedbythePS
servicescanbetakenintheorderoftheQoSpriorityvalues.RT-over-NRTand/orRT-
over-RTactionscanbemadeasmanytimesasitisdefinedwiththe
MaxNumberOfReAttemptsCongRNPparameter.Formoreinformation,seeWCDMA
RAN RRM Admission Control.
IfRT-over-(N)RTcannotbeused,thenapossibilitytousethepre-emptionischecked.
Pre-emptionisperformedwiththesamerulesasincaseoftheservicesmappedto
DCH.Pre-emptionactionscanbeperformedasmanytimesasitisdefinedinthe
MaxNumberOfReAttemptsCongRNPparameter.Formoreinformation,seeWCDMA
RAN RRM Admission Control.
Ifthepre-emptionisnotpossibleordoesnothelp,andtheinterferencedoesnotcause
theblocking,thentheallocationofDCHresourcesmightbeattemptedusingtheexisting
DCHprinciples.
Ifthereasonfortheblockingisthereceivedwidebandinterferenceorthetransmitted
carrierpower,theCSvoicecall,whichmaytriggerthepre-emption,isadmitted.This
happenseventhoughnocandidateforforcedreleaseisfound.

7.2 RT-over-NRT,RT-over-RTandRABpre-emption
relatedtoHSUPAforBTScongestion
BTSindicatescongestionforE-DCHwithHSUPAresourcestatusindication,orby
rejectingtheRLsetuporthereconfigurationrequest.Thiscanbeperformedforsignaling
linkand/orradiobearer.NormalwaytohandletheBTScongestionistoinitiateRT-over-
NRT,RT-over-RT,and/orRABpre-emptionprocedures.

RT-over-NRT,RT-over-RT,andpre-emptionoftheBTSHSPA
resourcesforthesignalinglinksetup
IftheestablishmentofthesignalinglinkfailsfortheBTSHWcongestioninthecellofthe
SRNC,theconditionsforinitiatingtheRT-over-NRT/RTarefulfilledwhenthe
establishmentcauseisoneofthefollowing:

OriginatingConversationalCall
TerminatingConversationalCall

92 DN70303923 Issue:06B

WCDMARANRRMHSUPA RT-over-NRT,RT-over-RT,andRABpre-emption

OriginatingStreamingCall
TerminatingStreamingCall
EmergencyCall
Inter-RATcellre-selection
Inter-RATcellchangeorder
Registration
Detach
OriginatingHighPrioritySignaling
OriginatingLowPrioritySignaling
TerminatingHighPrioritySignaling
Terminating-causeunknown

DRNCcaninitiatetheRT-over-NRT/RTandthepre-emptionproceduresinitscell.The
significanceoftheIurPrioritymanagementparameterispreservedtobetraffic-type-
specificfortheCSservices,PSRTservices,andPSNRTservicesasdescribedin
WCDMA RAN RRM HSDPA.
ForinformationonhowtargetsforstandalonesignalinglinksonHSPAareselectedin
caseofBTScongestion,seeWCDMA RAN RRM HSDPA.
TheRNCreceivestheHSUPA configured and no free EDCH capacityindicationfromthe
WBTS,andthecell-specificadmissioncontrolinitiatestheRT-over-NRT/RTorthepre-
emptionprocedureforreleasingtheHSPAresourcesasdescribedinRT-over-NRT,RT-
over-RT,andpre-emptionoftheBTSHSPAresourcesforthesignalinglinksetup.
IftheRT-over-NRT/RTdoesnotsucceed,andtheestablishmentcauseisEmergency
Call,thentheACinitiatesthepre-emptionprocedureforreleasingaHSUPAresource.
ThetargetRRCconnectionisselectedwiththemethodsbasedonthe
Allocation/RetentionPrioritiesofthebearersthataredescribedin WCDMA RAN RRM
HSDPA.AfterreleasingoftheHSPAresources,thesignalinglinkisestablishedinthe
HSPAconfiguration.
IftheBTShasindicatedtheDL radio resources not availableasthefailurecause,the
cell-specificACconsidersitasanexceededmaximumnumberofHSDPAusers,and
indicatestheBTSHSDPAschedulercongestion.Inthatcase,intheadditionofthe
HSPAusers,alsotheHSDPAuserscanbetargetsoftheRT-over-NRT/RTandpre-
emptionwhilethealgorithmdescribedaboveisapplied.Formoreinformation,see
WCDMA RAN RRM HSDPA.
Ifthereleasingoftheresourcesfails,orthesetupofthesignalinglinkstillfailsinthe
HSPAconfiguration,theUE-specificACattemptstosetuptheradiolinkofthesignaling
linkintheR99configuration.

SignalinglinksetupfailsforthecongestionoftheR99resourcesin
BTS
IncaseofRel1BTSHW,HSPAuserscanbetargetsofRT-over-NRT/RTwhenitis
necessarytoreleasebasebandresourcesforR99signalingandCSvoicetrafficflows.
Thisso-calledpre-emptionlightfunctionalitycomesintoplaywhenthesignalinglinkor
CSvoicefailstobeestablishedintheHSPAconfigurationand,asaresult,anattemptis
madetoallocateR99instead.ThefunctionisdescribedintheWCDMA RAN RRM
Admission Control.

Issue:06B DN70303923 93

RT-over-NRT,RT-over-RT,andRABpre-emption WCDMARANRRMHSUPA

RT-over-NRTduetoBTSHWcongestionforE-DCHincaseofPS
streaming
RT-over-NRTistriggeredduringtheresourceallocationforPSstreamingRBifBTSHW
congestionisforE-DCH.
WhentheRNCreceivesanegativeacknowledgmentfortheallocationofPSstreaming
RBtoE-DCH,itchecksthelatestHSUPAresourcestatusthatithasreceivedfromthe
BTS.IfthelatestresourcestatusreceivedfromtheBTSisno free E-DCH resource
available,orthecausecodereceivedfromtheBTSisUL radio resources not available,
thecongestioniscausedbyE-DCH.Inthiscase,thecell-specificPSattemptstoselecta
suitabletargetE-DCHNRTRABforRT-over-NRTfromthesameHSPApool(Formore
information,seeWCDMA RAN RRM HSDPA).
IfnosuitableNRTRBcandidateisfound,thePSstreamingRBallocationiscontinuedto
DCH.TheselectionofNRTRBsisdescribedinWCDMA RAN RRM HSDPA.
IfthecongestionisnotcausedbytheE-DCH,theRNCassumesthatthecongestionis
HSPAcongestion,andnoE-DCH-specifichandlingispossible.TheselectionofNRT
RBsisdescribedinWCDMA RAN RRM HSDPA.WhenasuitableNRTRBisselected,
thecell-specificPSsendsanindicationtotheUE-specificPStoreleaseE-DCH
resourcesfromthisUE.ThatmeansaDCHwith0/0kbit/sisallocated,orastate
transitiontoCell_FACHisperformed.Assoonaspossible,theBTSacknowledgesthe
release,andtheUE-specificPScontinuesstreamingRBallocationonE-DCH.Ifno
suitableNRTRBcandidateisfound,thePSstreamingRBallocationiscontinuedto
DCH.

CSvoicesetupfailsforthecongestionoftheHSUPAresourcesin
BTS
TheRNCusestheHSUPA configured and no free EDCH capacityindicationfromthe
WBTSinthenormalway(RT-over-NRT/RTorthepre-emptionprocedureasdescribedin
RT-over-NRT,RT-over-RT,andRABpre-emptionoftheBTSHSPAresourcesfortheCS
speechsetup).
WhenBTSindicatescongestionduringCSvoiceonHSPAsetupwithPSalreadyon
HSPA,theCSvoiceissetuptoDCH/DCHandPSisswitchedtoDCH/HS-DSCH.
IfthesetupoftheCSspeechfailsintheHSPAconfigurationfortheBTSbaseband
congestion,theUE-specificACinitiatestheRT-over-NRT/RTorthepre-emption
procedureforreleasingtheHSPAresourcesasdescribedinRT-over-NRT,RT-over-RT,
andRABpre-emptionoftheBTSHSPAresourcesfortheCSspeechsetup.Formore
informationonhowtargetsareselected,seeWCDMA RAN RRM HSDPA.
IfthereleasingoftheHSPAresourcesfails,orthesetupoftheCSspeechstillfailsinthe
HSPAconfiguration,theUE-specificACattemptstosetuptheradiolinkofthecallinthe
R99configuration.
IftheCSvoicesetupfailsalsointheR99configurationforthecongestioninthebase
bandresources,theACinitiatestheRT-over-NRT/RTorpre-emptionprocedurefor
releasingtheR99resources.

RT-over-NRT,RT-over-RT,andRABpre-emptionoftheBTSHSPA
resourcesfortheCSspeechsetup
RT-over-NRT/RTorthepre-emptionprocedureisinitiatedwhencongestionisdetected
intheHSPAbasebandresourcesoftheBTS.

94 DN70303923 Issue:06B

WCDMARANRRMHSUPA RT-over-NRT,RT-over-RT,andRABpre-emption

DRNCcaninitiatetheRT-over-NRT/RTandthepre-emptionproceduresinitscell.The
significanceoftheIurPrioritymanagementparameteristraffic-type-specificas
specifiedin WCDMA RAN RRM HSDPAfortheCSservices,PSRTservices,andPS
NRTservices.
ForinformationonhowtargetsforCSvoiceonHSPAareselectedincaseofBTS
congestion,see WCDMA RAN RRM HSDPA.
IftheRT-over-NRT/RTdoesnotsucceed,andtheCSbearertriggersthepre-emption,
thentheACinitiatesthepre-emptionprocedureforreleasingtheresourcedescribedin
the WCDMA RAN RRM HSDPA.ThetargetRRCconnectionisselectedwith
conventionalmethodsbasedontheAllocation/RetentionPrioritiesofthebearers.
IftheBTShasindicatedtheDL radio resources not availableasthefailurecause,the
cell-specificACconsidersitasanexceededmaximumnumberofHSDPAusers,and
indicatestheBTSHSDPAschedulercongestion.Inthatcase,intheadditionofthe
HSPAusers,alsotheHSDPAuserscanbetargetsoftheRT-over-NRT/RTandpre-
emptionwhilethealgorithmdescribedaboveisapplied.Formoreinformation,see
WCDMA RAN RRM HSDPA.

Issue:06B DN70303923 95

Radiobearer,transportchannelandphysicalchannel WCDMARANRRMHSUPA
parameters

8 Radiobearer,transportchannelandphysical
channelparameters

g NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.

8.1 Radiobearer,transportchannelandphysical
channelparametersoftheHSUPA
TheHSUPAconfiguration,thatis,E-DCHcapability,issetuptothecellwhenthecellis
setup.DownlinkE-DCHrelatedparametersaresignaledfromtheBTStotheRNCusing
thecellsetupprocedure.
WhentheE-DCHchanneltypeisselected,thepacketschedulerderivestheradio
bearer,transportchannelandphysicalchannelparametersneededforE-DCH.E-DCHis
setupusingtheradiolinksetuporreconfigurationprocedures.
ThefollowingtablessummarizetherelevantHSUPA-relatedRRCandNBAP
parameters.

Table 2 E-DCH-relatedparameterssignaledfromtheRNCtotheUEintheRRC

InformationElement/Groupname Source Description

E-DCHcellIndicator HSUPAEnabledRNCconfigurationparameter E-DCHCapableCellmeansthat


theUEcanconsiderthiscellaspart
oftheE-DCHcoverageareafor
displayindicationonly.This
indicationcannotbeusedforany
otherpurpose.IncludedinSIB5.

E-DPCCH/DPCCHpoweroffset Determinedinternallyasfollows: ItdefinestheamplituderatioofE-


DPCCHrelativetotheamplitude
E-TTI AmplituderatioforE- ratioofDPCCHforeachRxdiversity
DPCCH mode.Seequantizationofthepower
offsetin3GPPTS25.213.
10ms 12/15

2ms 24/15

Happybitdelaycondition HappyBitDelayConditionEDCHRNC Itisusedwhendeterminingthe


configurationparameter. settingofthehappybit.Happybit
(NotHappy/Happy)isincludedinE-
DPCCH.See3GPPTS25.321.

ReferenceE-TFCI/ReferenceE- ReferenceE-TFCIsandrelatedpoweroffsets Itdefinesthereferenceamplitude


TFCIPO aredeterminedinternallyasfollows: ratioofE-DPDCH(s)relativetothe
amplituderatioofDPCCHforcertain
E-TFC(s).Seequantizationofthe

96 DN70303923 Issue:06B

WCDMARANRRMHSUPA Radiobearer,transportchannelandphysicalchannel
parameters

Table 2 E-DCH-relatedparameterssignaledfromtheRNCtotheUEintheRRC
(Cont.)

InformationElement/Groupname Source Description

AmplituderatiosforE-TTI=10mswithused poweroffsetin3GPPTS25.213.
table1
ULE-DPDCHmaximumallowedsymbolrate
960ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
HighbitrateLowbitrate
3.....21/15121/15
11...34/15
37...75/15
ULE-DPDCHmaximumallowedsymbolrate
1920ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
HighbitrateLowbitrate
3.....17/15121/15
11...27/15
38...60/15
ULE-DPDCHmaximumallowedsymbolrate
3840ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
HighbitrateLowbitrate
11...24/15121/15
38...53/15
39...38/15
AmplituderatiosforE-TTI=10mswithused
table0
ULE-DPDCHmaximumallowedsymbolrate
960ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
HighbitrateLowbitrate
28....21/151221/15
54...34/15
90...75/15
ULE-DPDCHmaximumallowedsymbolrate
1920ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
HighbitrateLowbitrate

Issue:06B DN70303923 97

Radiobearer,transportchannelandphysicalchannel WCDMARANRRMHSUPA
parameters

Table 2 E-DCH-relatedparameterssignaledfromtheRNCtotheUEintheRRC
(Cont.)

InformationElement/Groupname Source Description

28.....17/151221/15
54.....27/15
90.....60/15.

ULE-DPDCHmaximumallowedsymbolrate
3840ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
HighbitrateLowbitrate
54...24/151221/15
90...53/15
92...38/15
AmplituderatiosforE-TTI=2mswithused
table0
ULE-DPDCHmaximumallowedsymbolrate
960ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
HighbitrateLowbitrate
25.....47/152547/15
ULE-DPDCHmaximumallowedsymbolrate
1920ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
HighbitrateLowbitrate
38...53/152547/15
ULE-DPDCHmaximumallowedsymbolrate
3840ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
HighbitrateLowbitrate
45...42/152547/15
69...47/15
80...60/15
ULE-DPDCHmaximumallowedsymbolrate
5760ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
HighbitrateLowbitrate
39.....38/152547/15
101...47/15

98 DN70303923 Issue:06B

WCDMARANRRMHSUPA Radiobearer,transportchannelandphysicalchannel
parameters

Table 2 E-DCH-relatedparameterssignaledfromtheRNCtotheUEintheRRC
(Cont.)

InformationElement/Groupname Source Description

125...84/15
126...119/15
127...134/15
AmplituderatiosforE-TTI=2mswithused
table2
ULE-DPDCHmaximumallowedsymbolrate
5760kspswithHSUPA16QAM.
E-TFCIvalue...AmplituderatioforE-DPDCH
842/15
30...60/15
69...75/15
103...60/15
124...168/15
127...212/15

E-TFCItableindex Determinedinternallyasfollows: ItindicateswhichstandardizedE-


TFCITBsizetableshouldbeused.
Tables0,TTI=10ms(usedbydefaultwith
Therelatedtablesarespecifiedin
FDPCHinDL)
3GPPTS25.321.Thistableis
Tables1,TTI=10ms(usedwithF-DPCH optimizedforRLCPDUsizeslike
whenBTSSWisWN7.0) 336and656.

Table0,TTI=2ms

E-DCHminimumsetE-TFCI EDCHMinSetETFCIparameterisusedwhen AminimumsetofE-TFCs,whichis


E-TTI=10msandTable1isused. thelargestE-TFCthatcanbeused
EDCHMinSetETFCIT0parameterisused bytheUE,independentoftheUE
whenE-TTI=10msandTable0isused. powersituation,giventhatavalid
WhenE-TTI=2msisused,alwaysfixed (absolute)grantisavailableand
value32isused. thereisnotransmissiononDCH.

Maximumchannelisationcodes DeterminedbytheRNCRRMalgorithm. Itdefinesthemaximum


Absolutemaximumis2*SF2and2*SF4 channelizationcodeorsetof
channelizationcodestheUEis
allowedtouse.

PLnon-max Determinedinternallyas0.68forE-TTI=10 Itlimitstheamountofpuncturing


ms. thatcanbeappliedinorderto
minimizethenumberofdedicated
Hardcodedas0.6forE-TTI=2ms.
physicalchannels.

E-DCHMAC-dflowidentity SetbyRNCRRM TheE-DCHMAC-dFlowIDisthe


uniqueidentifierforoneMAC-dflow
onE-DCH.

Issue:06B DN70303923 99

Radiobearer,transportchannelandphysicalchannel WCDMARANRRMHSUPA
parameters

Table 2 E-DCH-relatedparameterssignaledfromtheRNCtotheUEintheRRC
(Cont.)

InformationElement/Groupname Source Description

DDI DeterminedbytheRNCRRMalgorithm TheDataDescriptionIndicator(DDI)


fieldidentifiesauniquecombination
oflogicalchannelID,MAC-dflowID
andsizeoftheMAC-dPDUs
concatenatedintotheassociated
MAC-esPDU.

RLCPDUsize Determinedinternally.AMDPDUsize336bit SizeoftheRLCPDUinbits


isused.VariablesideUMDPDUisused.SRB
RLCPDUsizeis144bits.

E-DCHMAC-dflowpoweroffset SetbyRNCRRM. Itallowsdifferentiatingqualityof


MAC-dflows.

E-DCHMAC-dflowmaximum EDCHMaxNumberOfHARQReTx(forNRT Itdefinestheupperboundaryfor


numberofretransmissions RAB)orEDCHMaxHARQReTxStr(for HARQretransmissionsforasingle
streamingRAB)RNCconfigurationparameter MAC-dflow.Whenbothstreaming
andNRTRABsareallocatedand
thevaluesforstreamingRBand
NRTRBdiffer,theUEandBTSuse
thegreatervalue.

E-DCHMAC-dflowmultiplexinglist RNCconfigurationparameterforHSCSvoice ItindicateswhichE-DCHMAC-d


andSRBs. flowsareallowedtobemultiplexed
withinaMAC-ePDUwiththeMAC-d
flowitisassociatedto.

CHOICEtransmissiongranttype E-DCHNon-ScheduledTransmissionGrant E-DCHNon-Scheduled


forCSvoiceandSRBsE-TTI=10mswithout TransmissionGrantorE-DCH
GBRservicesSTusedforSRBs. ScheduledTransmissionGrant
(transmissionofMAC-dPDUsfor
logicalchannelsbelongingtothis
MAC-dflowshouldbeinaccordance
withthereceivedscheduledgranton
E-AGCH/E-RGCH).

E-DCHTransmissionTimeInterval E-TTIs2msand10msused. ItindicatestheTransmissionTime


IntervalforE-DPCHoperation.

HARQRVConfiguration HARQRVConfigurationRNCconfiguration ItdefinestheHARQmethodtobe


parameter used.ThepossibleoptionsareIR
CombiningandChaseCombining.

ServingE-DCHradiolinkindicator RNCRRMalgorithmselects ThevalueTRUEindicatesthatthis


radiolinkistheservingE-DCHradio
link.

E-AGCHChannelisationCode ReceivedfromtheBTS E-AGCHInfo.Itincludesthe


configurationfortheE-DCH-related
AbsoluteGrantChannel.

100 DN70303923 Issue:06B


WCDMARANRRMHSUPA Radiobearer,transportchannelandphysicalchannel
parameters

Table 2 E-DCH-relatedparameterssignaledfromtheRNCtotheUEintheRRC
(Cont.)

InformationElement/Groupname Source Description

ChannelisationCode ReceivedfromtheBTS E-HICHInfo.Itincludesthe


configurationfortheE-DCH-related
HARQAcknowledgementIndicator
Channel.

SignatureSequence ReceivedfromtheBTS E-HICHInfo.

E-HICHreleaseindicator RNCRRMalgorithmselects Theoptionisselectedifacellis


removedfromtheE-DCHactiveset.

SignatureSequence ReceivedfromtheBTS E-RGCHInfo.


Itincludestheconfigurationforthe
E-DCH-relatedRelativeGrant
Channel(E-RGCH).TheE-RGCH
usesthesamechannelizationcode
asconfiguredfortheE-HICH
channel.

RGcombinationindex RNCRRMalgorithmsets Cellswithanindexequaltothe


indexoftheServingE-DCHcell
belongtotheServingE-DCHRLS.
TheE-RGCHfromthesecellshave
RGcommands,which,fortheUE,
areknowntobethesameastheRG
commandsfromtheServingE-DCH
cell.

E-RGCHreleaseindicator ReceivedfromtheBTS TheoptionisselectediftheBTShas


signaledNBAP/RNSAP:E-RGCH
ReleaseIndicatorinformation
elementtotheRNC.

PeriodicityforSchedulingInfo-no PeriodicityForSIRNCconfigurationparameter Itdefinestheperiodicityfor


grantandgrant (servingcellWBTS). schedulinginfo(SI).
TheBTStypeisidentifiedbasedonthe
NBAPCommModeRNPparameter.
InformationelementsareupdatediftheBTS
typechangesinaservingcellchange.

PowerOffsetforSchedulingInfo PowerOffsetForSIRNCconfiguration Itdefinesthepoweroffsetfor


parameter schedulinginfo(SI).Itisonlyused
whennoMACdPDUsareincluded
inthesameMACePDU.

MaxMAC-ePDUcontentssize SetbyRNCRRMforHSCSvoiceandSRBs.

2msnon-scheduledtransmission SetbyRNCRRMforHSCSvoiceandSRBs. ItindicatesthoseHARQprocesses


grantHARQprocessallocation thatareallowed.

Issue:06B DN70303923 101


Radiobearer,transportchannelandphysicalchannel WCDMARANRRMHSUPA
parameters

Table 2 E-DCH-relatedparameterssignaledfromtheRNCtotheUEintheRRC
(Cont.)

InformationElement/Groupname Source Description

2msscheduledtransmissiongrant NotusedasvalidonlyforTTI=2ms. ItindicatesthoseHARQprocesses


HARQprocessallocation thatareallowed.

ServingGrantValue ReceivedfromBTS ItispossibletodefineinitialSGfor


UE.

Primary/SecondaryGrantSelector Determinedinternallyasprimary ItindicateswhethertheSGis


receivedwithaPrimaryE-RNTIor
SecondaryE-RNTI.

3-Index-StepThreshold Determinedinternallyasfollows: Thisparameterdefinesthreeindex


stepthresholds.Itreferstoanindex
WhenTTI=10msandtable1isused:
intheSG-Table.See3GPPTS
E-DCHmaximumallowedsymbolrate...2- 25.321.
index-StepThreshold
960ksps............12
1920ksps..........12
3840ksps..........10
WhenTTI=10msandtable0isused:
E-DCHmaximumallowedsymbolrate...2-
index-StepThreshold
960ksps............23
1920ksps..........23
3840ksps..........16
WhenE-TTI=2msisusedthefixedvalueis
12.

2-Index-StepThreshold Determinedinternallyasfollows: Thisparameterdefinestwoindex


stepthresholds.Itreferstoanindex
WhenTTI=10msandtable1isused:
intheSG-Table.See3GPPTS
E-DCHmaximumallowedsymbolrate...2- 25.321.
index-StepThreshold
960ksps............17
1920ksps..........16
3840ksps..........14
WhenTTI=10msandtable0isused:
E-DCHmaximumallowedsymbolrate...2-
index-StepThreshold
960ksps............26
1920ksps..........26
3840ksps..........20

102 DN70303923 Issue:06B


WCDMARANRRMHSUPA Radiobearer,transportchannelandphysicalchannel
parameters

Table 2 E-DCH-relatedparameterssignaledfromtheRNCtotheUEintheRRC
(Cont.)

InformationElement/Groupname Source Description

WhenE-TTI=2msisusedthefixedvalueis
16.

IncludeinSchedulingInfo Setto'yes'forSTRB.Setto'no'forNSTRB. Itindicateswhetherthislogical


channelistobeconsideredwhen
performingschedulinginforeporting,
asper3GPPTS25.321.Notethat
schedulinginfoofSRBMAC-dflow
maychangebetweenSTandNST
dependingonwhichE-TTIisused
andifactiveRABsexistwithRB
allocation-0/0DCH.

MAC-es/eresetindicator MAC-es/eresetisusedwhentheE-TTIhas TRUEIndicatestheMAC-es/eentity


beenchangedbetween10msand2ms. needstobereset.

Table 3 E-DCHrelatedparameterssignaledfromUEtoRNCinRRC

InformationElement/Groupname Source Description

SupportofE-DCH UE ItdefineswhetherUEsupportsE-DCH.

E-DCHphysicallayercategory UE ItdefinesUEsE-DCHphysicallayer
category.

Table 4 E-DCHrelatedparameterssignaledfromRNCtoNodeBinNBAPand
fromSRNCtoDRNCinRNSAP

InformationElement/Groupname Source Description

MaximumTargetReceivedTotalWide PrxMaxTargetBTSRNCconfiguration ItindicatesthemaximumtargetUL


BandPower parameter interferenceforacertaincellunder
CRNC,includingreceivedwide
bandpowerfromallsources.The
mappingisaccordingto3GPPTS
25.133.

ReferenceReceivedTotalWideBand PrxNoiseRNCconfigurationparameterand TheReferenceReceivedTotal


Power(PrxNoise) systemnoiseadjustmentalgorithm WideBandPowerindicatesthe
referenceULinterference
(receivednoiselevel)foracertain
cellunderCRNC.Thisvaluemay
beusedforE-DCHschedulingin
theNodeB.Thevaluemappingis
accordingtothemappingfor

Issue:06B DN70303923 103


Radiobearer,transportchannelandphysicalchannel WCDMARANRRMHSUPA
parameters

Table 4 E-DCHrelatedparameterssignaledfromRNCtoNodeBinNBAPand
fromSRNCtoDRNCinRNSAP(Cont.)

InformationElement/Groupname Source Description

measurementtypeReceivedTotal
WideBandPowerin3GPPTS
25.133.

HS-PDSCH,HS-SCCH,E-AGCH,E- Notused Itisthemaximumtransmission


RGCHandE-HICHTotalPower powertobeallowedforHS-
PDSCH,HS-SCCHandE-AGCH,
E-RGCHandE-HICHcodesover
cellportion.

ULDPDCHIndicatorforE-DCH SetUL-DPDCHnotpresent,whentheSRBs TheULDPDCHIndicatorForE-


Operation mappedtoE-DCH. DCHOperationparameter
indicateswhethersomeULDPCH
HardcodedbyRNCRRMincaseof
parametersshouldbeignoredor
RNSAP: Signalling DCHisalwayspresent
notinthemessageinwhichtheUL
andthusUL-DPDCHpresentisset.
DPDCH Indicator For E-DCH
OperationIEwasincluded.

MaximumSetofE-DPDCHs DeterminedbytheRNCRRMalgorithm. Itdefinesthemaximum


Absolutemaximumisv2xN2+2xN4 channelizationcodeorasetof
channelizationcodestheUEis
allowedtouse.

PunctureLimit Determinedinternallyas0.68forE-TTI=10 Itlimitstheamountofpuncturing


ms(ThisvalueisalsovalidforHS-RACH). thatcanbeappliedinorderto
minimizethenumberofdedicated
0.60forE-TTI=2ms
physicalchannels.

E-TFCITableIndex Determinedinternallyasfollows: ItindicateswhichstandardizedE-


TFCITBsizetableshouldbeused.
Tables0,TTI=10ms(usedbydefaultwith
Therelatedtablesarespecifiedin
F-DPCHinDLandwithHS-RACH)
3GPPTS25.321.Thistableis
Tables1,TTI=10ms(usedwithF-DPCH optimizedforRLCPDUsizeslike
whenBTSSWisWN7.0) 336and656.

Table0,TTI=2ms.

E-DCHMinimumSetE-TFCI EDCHMinSetETFCIparameterisused AminimumsetofE-TFCs,whichis


whenE-TTI=10msandTable1isused. thelargestE-TFCthatcanbeused
EDCHMinSetETFCIT0parameterisused bytheUEindependentoftheUE
whenE-TTI=10msandTable0isused. powersituation,giventhatavalid
WhenE-TTI=2msisused,alwaysfixed (absolute)grantisavailableand
value32isused thereisnotransmissiononDCH.

ReferenceE-TFCI/ReferenceE-TFCI ReferenceE-TFCIsandrelatedpower Itdefinesthereferenceamplitude


PowerOffset offsetsaredeterminedinternallyasfollows: ratiosofE-DPDCH(s)relativeto
theamplituderatioofDPCCHfor
AmplituderatiosforE-TTI=10mswithused
certainE-TFC(s).Seequantization
table1
ofthepoweroffsetin3GPPTS
25.213.

104 DN70303923 Issue:06B


WCDMARANRRMHSUPA Radiobearer,transportchannelandphysicalchannel
parameters

Table 4 E-DCHrelatedparameterssignaledfromRNCtoNodeBinNBAPand
fromSRNCtoDRNCinRNSAP(Cont.)

InformationElement/Groupname Source Description

ULE-DPDCHmaximumallowedsymbolrate
960ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
HighbitrateLowbitrate
3.....21/15121/15
11...34/15
37...75/15
ULE-DPDCHmaximumallowedsymbolrate
1920ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
HighbitrateLowbitrate
3.....17/15121/15
11...27/15
38...60/15
ULE-DPDCHmaximumallowedsymbolrate
3840ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
HighbitrateLowbitrate
11...24/15121/15
38...53/15
39...38/15
AmplituderatiosforE-TTI=10mswithused
table1,withinterpolationmethod.
ULE-DPDCHmaximumallowedsymbolrate
120ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
121/15
938/15
ULE-DPDCHmaximumallowedsymbolrate
240ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
121/15
934/15
1753/15
ULE-DPDCHmaximumallowedsymbolrate
480ksps.

Issue:06B DN70303923 105


Radiobearer,transportchannelandphysicalchannel WCDMARANRRMHSUPA
parameters

Table 4 E-DCHrelatedparameterssignaledfromRNCtoNodeBinNBAPand
fromSRNCtoDRNCinRNSAP(Cont.)

InformationElement/Groupname Source Description

E-TFCIvalue...AmplituderatioforE-DPDCH
121/15
1542/15
2967/15

ULE-DPDCHmaximumallowedsymbolrate
960ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
121/15
1542/15
4975/15
ULE-DPDCHmaximumallowedsymbolrate
1920ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
121/15
1542/15
4947/15
9375/15
ULE-DPDCHmaximumallowedsymbolrate
3840ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
121/15(11)
1542/15(17)
5347/15(18)
AmplituderatiosforE-TTI=10mswithused
table0
ULE-DPDCHmaximumallowedsymbolrate
960ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
HighbitrateLowbitrate
28....21/151221/15
54...34/15
90...75/15
ULE-DPDCHmaximumallowedsymbolrate
1920ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH

106 DN70303923 Issue:06B


WCDMARANRRMHSUPA Radiobearer,transportchannelandphysicalchannel
parameters

Table 4 E-DCHrelatedparameterssignaledfromRNCtoNodeBinNBAPand
fromSRNCtoDRNCinRNSAP(Cont.)

InformationElement/Groupname Source Description

HighbitrateLowbitrate
28.....17/151221/15
54.....27/15
90.....60/15

ULE-DPDCHmaximumallowedsymbolrate
3840ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
HighbitrateLowbitrate
54...24/151221/15
90...53/15
92...38/15
AmplituderatiosforE-TTI=10mswithused
table0,withinterpolationmethod.
ULE-DPDCHmaximumallowedsymbolrate
120ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
119/15
1221/15
4938/15
ULE-DPDCHmaximumallowedsymbolrate
240ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
1221/15
4934/15
6453/15
ULE-DPDCHmaximumallowedsymbolrate
480ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
1221/15
6142/15
8167/15
ULE-DPDCHmaximumallowedsymbolrate
960ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
1221/15

Issue:06B DN70303923 107


Radiobearer,transportchannelandphysicalchannel WCDMARANRRMHSUPA
parameters

Table 4 E-DCHrelatedparameterssignaledfromRNCtoNodeBinNBAPand
fromSRNCtoDRNCinRNSAP(Cont.)

InformationElement/Groupname Source Description

6142/15
9975/15
ULE-DPDCHmaximumallowedsymbolrate
1920ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
1221/15
6142/15
9947/15
11875/15

ULE-DPDCHmaximumallowedsymbolrate
3840ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
1221/15
6142/15
10247/15
AmplituderatiosforE-TTI=2mswithused
table0
ULE-DPDCHmaximumallowedsymbolrate
960ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
HighbitrateLowbitrate
25.....47/152547/15
ULE-DPDCHmaximumallowedsymbolrate
1920ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
HighbitrateLowbitrate
38...53/152547/15
ULE-DPDCHmaximumallowedsymbolrate
3840ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
HighbitrateLowbitrate
45...42/152547/15
69...47/15
80...60/15

108 DN70303923 Issue:06B


WCDMARANRRMHSUPA Radiobearer,transportchannelandphysicalchannel
parameters

Table 4 E-DCHrelatedparameterssignaledfromRNCtoNodeBinNBAPand
fromSRNCtoDRNCinRNSAP(Cont.)

InformationElement/Groupname Source Description

ULE-DPDCHmaximumallowedsymbolrate
5760ksps.
E-TFCIvalue...AmplituderatioforE-DPDCH
HighbitrateLowbitrate
39.....38/152547/15
101...47/15
125...84/15
126...119/15
127...134/15

AmplituderatiosforE-TTI=2mswithused
table2
ULE-DPDCHmaximumallowedsymbolrate
5760kspswithHSUPA16QAM.
E-TFCIvalue...AmplituderatioforE-
DPDCH
842/15
30...60/15
69...75/15
103...60/15
124...168/15
127...212/15
AmplituderatiosforE-TTI=2ms,with
interpolationmethod.
ULE-DPDCHmaximumallowedsymbolrate
480ksps.
942/15
2360/15
3867/15
4575/15
ULE-DPDCHmaximumallowedsymbolrate
960ksps.
011/15
942/15
2360/15
3767/15

Issue:06B DN70303923 109


Radiobearer,transportchannelandphysicalchannel WCDMARANRRMHSUPA
parameters

Table 4 E-DCHrelatedparameterssignaledfromRNCtoNodeBinNBAPand
fromSRNCtoDRNCinRNSAP(Cont.)

InformationElement/Groupname Source Description

5175/15
6795/15
ULE-DPDCHmaximumallowedsymbolrate
1920ksps.
011/15
942/15
2360/15
7975/15
ULE-DPDCHmaximumallowedsymbolrate
3840ksps.
011/15
942/15
2360/15
7975/15

ULE-DPDCHmaximumallowedsymbolrate
5760ksps.
942/15
3560/15
5175/15
7975/15
11860/15
12795/15

E-TTI DeterminedinternallyasE-TTIs2msand ItindicatestheTransmissionTime


10msareused. IntervalforE-DPCHoperation.
IncaseofRNSAPonly10msisused.

E-DPCCHPowerOffset Determinedinternallyasfollows: ItdefinestheamplituderatioofE-


DPCCHrelativetotheamplitude
E-TTI AmplituderatioforE- ratioofDPCCHforeachRx
DPCCH diversitymode.Seequantizationof
thepoweroffsetin3GPPTS
10ms 12/15 25.213.
2ms 24/15

ServingE-DCHRL DeterminedbytheRNCRRMalgorithm ItindicateswhetheranRLisa


servingE-DCHRL.

110 DN70303923 Issue:06B


WCDMARANRRMHSUPA Radiobearer,transportchannelandphysicalchannel
parameters

Table 4 E-DCHrelatedparameterssignaledfromRNCtoNodeBinNBAPand
fromSRNCtoDRNCinRNSAP(Cont.)

InformationElement/Groupname Source Description

E-DCHRLIndication DeterminedbytheRNCRRMalgorithm ItindicateswhetheranRLisanE-


DCHRL.

MaximumNumberofRetransmissions EDCHMaxNumberOfHARQReTxRNC Itdefinestheupperboundaryfor


forE-DCH configurationparameter HARQretransmissionsforasingle
MAC-dflow.

MAC-esGuaranteedBitRate SetbyRNCRRM. TheMAC-esGuaranteedBitRate


IEindicatestheguaranteed
NotusedincaseofRNSAP.
numberofbitspersecondtobe
deliveredovertheairinterface
undernormaloperatingconditions
(providedthereisdatatodeliver),
forwhichtheNodeBshould
providesufficientULresources.

E-DCHMAC-dFlowID SetbyRNCRRM. TheE-DCHMAC-dFlowIDisthe


uniqueidentifierforoneMAC-d
flowonE-DCH.

Allocation/RetentionPriority NotusedbytheBTS Itdefinesrelativepriorityofthe


RAB.

TNLQoS Notsent ALCAPisusedinRNCandthus


notsent.

PayloadCRCPresenceIndicator DeterminedinternallyasCRCisincluded ItindicateswhetherFPpayload16


bitCRCisusedornot.

BundlingModeIndicator Notused TheBundlingModeIndicator


indicateswhetherthebundling
shouldbedoneorshouldnotbe
doneforIub.ThevalueBundling
isapplicableonlywhenE-TTI
indicates2ms.Bundlingmeans
thatNodeBbundlesdataof52ms
TTIstoone10msTTI.

E-DCHHARQPowerOffsetFDD SetbyRNCRRM. Itallowsdifferentiatingqualityof


MAC-dflows.
NotusedincaseofRNSAP.

E-DCHMAC-dFlowMultiplexingList RNCconfigurationparameterforHSCS TheE-DCHMAC-dFlow


voiceandforSRB. MultiplexingListindicateswhichE-
DCHMAC-dflowsareallowedto
bemultiplexedwithinaMAC-e
PDUwiththeMAC-dflowitis
associatedto.

Issue:06B DN70303923 111


Radiobearer,transportchannelandphysicalchannel WCDMARANRRMHSUPA
parameters

Table 4 E-DCHrelatedparameterssignaledfromRNCtoNodeBinNBAPand
fromSRNCtoDRNCinRNSAP(Cont.)

InformationElement/Groupname Source Description

E-DCHGrantType(Choice) E-DCHNon-ScheduledTransmissionGrant E-DCHNon-Scheduled


forCSvoiceandforSRBsE-TTI=10ms TransmissionGrantorE-DCH
withoutGBRservicesSTusedforSRBs. ScheduledTransmissionGrant.

MaximumNumberofBitsperMAC-e SetbyRNCRRM. ItisvalidonlyincaseofE-DCH


PDUforNon-scheduledTransmission Non-ScheduledTransmission
NotusedincaseofRNSAP.
Grant.Itindicatesthenumberof
bitsallowedtobeincludedina
MAC-ePDUperE-DCHMAC-d
flowconfiguredfornon-scheduled
transmissions.

HARQProcessAllocationFor2ms NotusedsincevalidonlyforTTI=2ms ItindicatesthoseHARQprocesses


ScheduledTransmissionGrant thatareallowed.

HARQProcessAllocationFor2ms SetbyRNCRRMforHSCSvoice, ItindicatesthoseHARQprocesses


Non-ScheduledTransmissionGrant streamingandSRBs. thatareallowed.

E-DCHDDIValue DeterminedbytheRNCRRMalgorithm TheDataDescriptionIndicator


(DDI)fieldidentifiesaunique
combinationoflogicalchannelID,
MAC-dflowIDandsizeofthe
MAC-dPDUsconcatenatedinto
theassociatedMAC-esPDU.

MAC-dPDUSize Determinedinternally.RLCPDUsize336bit ThesizeoftheRLCPDUinbits.


isused.BasedonvariablesideUMDPDU.
144bitsforSRBs.

SchedulingPriorityIndicator(SPI) RNCconfigurationparameter. Itindicatestherelativepriorityof


theHS-DSCHorE-DCHdata
Fixedas0incaseofRNSAP.
frame.ItisusedbytheNodeB
whenschedulingHS-DSCH/E-
DCH.

E-AGCHandE-RGCH/E-HICHFDD Determinedinternallyasprimaryscrambling ThescramblingcodeonwhichE-


ScramblingCode codeisused AGCH,E-RGCHandE-HICHare
transmitted.

E-AGCHCodeFDDInformation Determinedinternally Itdefinesthecodesthatare


assignedforE-AGCH.

E-RGCH/E-HICHCodeFDD Determinedinternally Itdefinesthecodesthatare


Information assignedforE-RGCHandE-HICH.

TargetNon-servingE-DCHtoTotalE- TargetNSEDCHToTotalEDCHPRRNC Thisparameterdefinesthetarget


DCHPowerratio configurationparameter ratioofthepowerfromUEsfor
whichthiscellisanon-serving
radiolinkandthetotalreceivedE-
DCHpower.Ifthistargetis

112 DN70303923 Issue:06B


WCDMARANRRMHSUPA Radiobearer,transportchannelandphysicalchannel
parameters

Table 4 E-DCHrelatedparameterssignaledfromRNCtoNodeBinNBAPand
fromSRNCtoDRNCinRNSAP(Cont.)

InformationElement/Groupname Source Description

exceededandtheexperienced
totalRTWPisalsohigherthanthe
targetRTWPsignaledfromCRNC,
theBTSisallowedtosend'RG
Downcommandtonon-serving
radiolink.

Framehandlingpriority DeterminedinternallybyRNCRRM Itindicatesthepriorityleveltobe


algorithm usedduringthelifetimeoftheDCH
fortemporaryrestrictionofthe
allocatedresourcesdueto
overloadreason.RNCusesFrame
handlingprioritytodifferentiate
servicesfortheBTSscheduling.

E-RGCH3-Index-StepThreshold Determinedinternallyasfollows: Itdefines3indexstepthresholds.


ItreferstoanindexintheSG-
WhenTTI=10msandtable1isused:
Table.See3GPPTS25.321.
E-DCHmaximumallowedsymbolrate...2-
index-StepThreshold
960ksps............12
1920ksps..........12
3840ksps..........10
WhenTTI=10msandtable0isused:
E-DCHmaximumallowedsymbolrate...2-
index-StepThreshold
960ksps............23
1920ksps..........23
3840ksps..........16
WhenE-TTI=2msisusedthefixedvalueis
12.

E-RGCH2-Index-StepThreshold Determinedinternallyasfollows: Itdefines2indexstepthresholds.


ItreferstoanindexintheSG-
WhenTTI=10msandtable1isused:
Table.See3GPPTS25.321.
E-DCHmaximumallowedsymbolrate...2-
index-StepThreshold
960ksps............17
1920ksps..........16
3840ksps..........14
WhenTTI=10msandtable0isused:
E-DCHmaximumallowedsymbolrate...2-
index-StepThreshold

Issue:06B DN70303923 113


Radiobearer,transportchannelandphysicalchannel WCDMARANRRMHSUPA
parameters

Table 4 E-DCHrelatedparameterssignaledfromRNCtoNodeBinNBAPand
fromSRNCtoDRNCinRNSAP(Cont.)

InformationElement/Groupname Source Description

960ksps............26
1920ksps..........26
3840ksps..........20
WhenE-TTI=2msisusedthefixedvalueis
16.

PowerOffsetofE-AGCH RNCconfigurationparameter. ItindicatesthePoweroffset


relativetothepilotbitsontheDL
NotusedincaseofRNSAP.
DPCCH,exceptwhenF-DPCHis
configured.WhenF-DPCHis
configured,theE-AGCHPower
OffsetIEindicatesthePoweroffset
relativetothepoweroftransmitted
TPCbitsontheF-DPCH.

PowerOffsetofE-RGCH RNCconfigurationparameter. ItindicatesthePoweroffset


relativetothepilotbitsontheDL
NotusedincaseofRNSAP.
DPCCH,exceptwhenF-DPCHis
configured.WhenF-DPCHis
configured,theE-RGCHPower
OffsetIEindicatesthePoweroffset
relativetothepoweroftransmitted
TPCbitsontheF-DPCH.

PowerOffsetofE-HICH RNCconfigurationparameter. ItindicatesthePoweroffset


relativetothepilotbitsontheDL
NotusedincaseofRNSAP.
DPCCH,exceptwhenF-DPCHis
configured.WhenF-DPCHis
configured,theE-HICHPower
OffsetIEindicatesthePoweroffset
relativetothepoweroftransmitted
TPCbitsontheF-DPCH.

SchedulingInformation Setto'Included'forSTRBandSTSRB.Set Itindicateswhetherthescheduling


to'Notincluded'forNSTRBandNSTSRB. informationisincludedfortheE-
DCHlogicalchannelornot.

E-DCHMaximumBitRate DeterminedinternallybyRNCRRM ItindicatestheMaximumBitRate


algorithm foranE-DCH.

E-DCHProcessingOverloadLevel Notused Itdefinesthethresholdthat


determineswhentheNodeB
shouldindicateprocessingissue
problemstotheRNC.

E-DCHReferencePowerOffset Notused TheE-DCHReferencePower


OffsetisusedtoestimatetheE-
DPDCHpowerfromE-TFCI
withoutdecodingMAC-ePDUs.

114 DN70303923 Issue:06B


WCDMARANRRMHSUPA Radiobearer,transportchannelandphysicalchannel
parameters

Table 4 E-DCHrelatedparameterssignaledfromRNCtoNodeBinNBAPand
fromSRNCtoDRNCinRNSAP(Cont.)

InformationElement/Groupname Source Description

HS-DSCHConfiguredIndicator DeterminedinternallybyRNCRRM TheindicatoroftheHS-DSCHfor


algorithm configurationoftheE-DPDCHsIQ
branchmapping.See3GPPTS
25.213.

MAC-eResetIndicator RNCalgorithm ItindicatestheMAC-eResetis


performedinUE.

HARQInfoforE-DCH HARQRVConfigurationRNCconfiguration Itindicatestheuseofredundancy


parameter version(RV)fortheEDCHHARQ
transmissions.

Table 5 E-DCHrelatedparameterssignaledfromRNCtoNodeBinprivateNBAP.

InformationElement/Groupname Source Description

E-AGCHPowerOffset RNCconfigurationparameter TheE-AGCH Power OffsetIEindicates


thePoweroffsetrelativetothe
transmissionpowerofprimaryCPICH.
NBAP:PrivateCellConfigurationData
message.

E-RGCHPowerOffset RNCconfigurationparameter TheE-RGCH Power OffsetIEindicates


thePoweroffsetrelativetothe
transmissionpowerofprimaryCPICH.
NBAP:PrivateCellConfigurationData
message.

E-HICHPowerOffset RNCconfigurationparameter TheE-HICHPowerOffsetIEindicates


thePoweroffsetrelativetothe
transmissionpowerofprimaryCPICH.
NBAP:PrivateCellConfigurationData
message.

DCHloadfactortable Determinedinternally NBAP:PrivateCellConfigurationData


message

Cellloadfactor RNCconfigurationparameter NBAP:PrivateCellConfigurationData


message

SIRDPCCHinitialEDCH Determinedinternally SIREDCHtableincludestheinitialSIR


targetvaluesofDPCCHwhentheradio
linkhastheE-DCHconfigured.NBAP:
PrivateCellConfigurationData
message.

DPCCHloadfactortable RNCconfigurationparameters NBAP:PrivateCellConfigurationData


message

Issue:06B DN70303923 115


Radiobearer,transportchannelandphysicalchannel WCDMARANRRMHSUPA
parameters

Table 5 E-DCHrelatedparameterssignaledfromRNCtoNodeBinprivateNBAP.
(Cont.)

InformationElement/Groupname Source Description

SIRDPCCHoffset RNCconfigurationparameter NBAP:PrivateCellConfigurationData


message

Table 6 E-DCHrelatedparameterssignaledfromBTStoRNCinNBAPandDRNC
toSRNCviaRNSAP.

InformationElement/Groupname Source Description

E-DCHMAC-dFlowID StartedinRNC.BTS/DRNCsignalsthe TheE-DCHMAC-dFlowIDisthe


IEbackasack. uniqueidentifierforoneMAC-dflowon
E-DCH.

BindingID BTS/DRNC(temporaryidentifier) TheBindingIDistheidentifierofauser


datastream.

TransportLayerAddress BTS/DRNC TransportLayerAddressisauser


planeid,andisusedinrouteanalysis
inRNC.

E-DCHCapability BTS ItdefinestheE-DCHcapabilityfora


cell.

E-DCHTTI2msCapability BTSTTI10msisused.AlsoTTI2ms ItdefinestheE-DCHSFCapabilityfora


isused. cell.

E-DCHCapacityConsumptionLaw Notused ItindicatestotheCRNChowthe


CapacityCreditisconsumedbyNBAP
setofprocedures,dependingonthe
RL/RLSsituationandthenumberof
uplinkE-DPDCHsandtheirspreading
factors.

E-DCHHARQCombiningCapability BTS ItdefinestheE-DCHHARQCombining


capabilityforacell.

ResourceOperationalState BTS TheResourceOperationalStateis


usedtoindicatethecurrentoperational
stateoftheassociatedresource
followingaNodeBfailure.

E-AGCHAndE-RGCH/E-HICHFDD BTS/DRNC ItisthescramblingcodeonwhichE-


ScramblingCode AGCH,E-RGCHandE-HICHare
transmitted.Theprimaryscrambling
codeisused.

116 DN70303923 Issue:06B


WCDMARANRRMHSUPA Radiobearer,transportchannelandphysicalchannel
parameters

Table 6 E-DCHrelatedparameterssignaledfromBTStoRNCinNBAPandDRNC
toSRNCviaRNSAP.(Cont.)

InformationElement/Groupname Source Description

E-AGCHChannelisationCode BTS/DRNC ItissignaledtoUEassuch.BTS


allocatesanE-AGCHforeachE-DCH
user.ThereisonlyoneE-AGCH.

PrimaryE-RNTI BTS/DRNC ItissignaledtoUEassuch.TheE-


RNTIisneededfortheUE(orUE
group)specificCRCinE-AGCH.See
3GPPTS25.309.

SecondaryE-RNTI BTS/DRNC SignaledtoUEassuchifpresent


Notused

E-RGCH/E-HICHChannelisationCode BTS/DRNC ItissignaledtoUEassuch.TheBTS


allocatesE-RGCH/E-HICHforeachE-
DCHuser.ThereisonlyE-RGCH/E-
HICH.

E-RGCHSignatureSequence BTS/DRNC ItissignaledtoUEassuch.

E-HICHSignatureSequence BTS/DRNC ItissignaledtoUEassuch.

ServingGrantValue BTS/DRNC ItissignaledtoUEassuch.

Primary/SecondaryGrantSelector BTS/DRNC ItissignaledtoUEassuch.Itindicates


whethertheServingGrantValueis
grantedwithaprimaryE-RNTIora
secondaryE-RNTI.OnlyPrimaryGrant
Selectorisused.

E-RGCHReleaseIndicator BTS/DRNC ItissignaledtoUEassuch.Itindicates


thattheE-RGCHisreleased.

E-DCHProvidedBitRateValue BTS TheE-DCH Provided Bit Rate ValueIE


indicatestheE-DCHProvidedBitRate
asdefinedin3GPPTS25.321.

E-DCHRLSetID BTS/DRNC ForallRLshavingacommon


generationofE-RGCHandE-HICH
relatedinformationwithanotherRL,the
NodeBshouldassigntoeachRLthe
samevaluefortheE-DCHRLSetID
IE,includedintheRADIOLINKSETUP
RESPONSEmessage,touniquely
identifytheseRLsasmembersofthe
sameE-DCHRLSetwithintheNodeB
CommunicationContext.

Issue:06B DN70303923 117


Radiobearer,transportchannelandphysicalchannel WCDMARANRRMHSUPA
parameters

Table 6 E-DCHrelatedparameterssignaledfromBTStoRNCinNBAPandDRNC
toSRNCviaRNSAP.(Cont.)

InformationElement/Groupname Source Description

E-DCHMaximumRateIndication Notused TheE-DCHMaximumRateIndication


IEcontainsamaximumbitratewhich
NodeBestimatesitcanhandlewithout
processingissues,giventhecurrent
resourcesituation.

E-DCHNon-servingRelativeGrant Notused ItindicateshowmanyDown


DownCommandsValueInformation Commandsaresentpersecond.

Table 7 E-DCHrelatedparameterssignaledfromBTStoRNCinaprivateNBAP.

InformationElement/Groupname Source Description

PrxEDCH Notused ItindicatesthepowerusedforallE-


DCHusersinthecell.

BTSResourceStatus BTS ItindicatesHSUPA-relatedresource


statusinformationoftheBTStothe
RNC.

E-DCHloadfactor BTS Own-cellE-DCHloadfactor.

DCHloadfactor BTS ULown-cellDCHloadfactor.

E-DCHloadfactorforICuserson BTS Itindicatesthefractionalloadofall2ms


OriginalStream TTIUEsthatthescheduledcellhasina
cellwhereHSUPAinterference
CancellationReceiverisapplied.

8.2 E-DCHandE-TFCI
Theuplinkenhanceddedicatedchannel(E-DCH)isatransportchannelbetweenL2and
L1.
TheattributesoftheE-DCHtransportchannelare:

TransportBlockSize.ThetransportblockisthebasicunitexchangedbetweenL1
andMAC.E-DCHtransportblocksizeisvariable,anditspossiblevaluesaredefined
intheE-TFCItable.Thetransportblocksizeisdefinedasanumberofbitsina
transportblock.
TransportBlockSetSize.TheE-DCHtransportblocksetsizeisthemaximumone.
TransmissionTimeInterval(TTI).Transmissiontimeintervaldefinestheperiodicityat
whichatransportblockistransferredbythephysicallayer.Thetransmissiontime
intervalforTrCHsofE-DCHtypeis2msor10ms.RNCsupportsbothavailableE-
TTIs(10msand2ms).

118 DN70303923 Issue:06B


WCDMARANRRMHSUPA Radiobearer,transportchannelandphysicalchannel
parameters

Typeofchannelcoding.E-DPCHusesturbocoding.
Codingrate.Itisthree.
SizeofCRC.Itis24bitwhenE-DCHisconfigured.

E-DCHtransportchannelhasthefollowingcharacteristics:

E-DCHandDCHuseseparateCCTrCHs.
ThereisonlyoneCCTrCHofE-DCHtypeperUE.
ThereisonlyoneE-DCHperCCTrCHofE-DCHtype.
Thereisonlyonetransportblockperatransmissiontimeinterval.

E-TFCItabledefinesthemappingbetweenthechosenE-TFCIvalueandthe
correspondingE-DCHtransportblocksize.E-TFCItablesaredefinedinthe3GPPTS
25.321.
TheRNCsignalstheE-TFCItableindextoBTS/DRNCusingtheNBAPprotocol,andto
theUEusingtheRRCprotocol.
TheTBindexisequaltotheE-TFCIvalue,whichtheBTSreceivesintheE-DPCCHin
everyTTI.
3GPPTS25.321standarddefinessixE-TFCItables:

E-TFCITable0forTTI=2ms.ItisusedwhentheE-DCHMAC-dflowissetupfor
SRBS.
E-TFCITable1forTTI=2ms.Itisnotused.
E-TFCITable2forTTI=2ms.ItisusedinHSUPA16QAM.
E-TFCITable3forTTI=2ms.Itisnotused.
E-TFCITable0forTTI=10ms.ItisusedbydefaultwhentheE-DCHMAC-dflowis
establishedforSRBsinthenetworkswhereF-DPCHisused.
E-TFCITable1forTTI=10ms.ItisusedwhentheE-DCHMAC-dflowis
establishedforSRBsinthenetworkswhereF-DPCHisusedandtheBTSSW
WN7.0.TheuseofE-TFCItable1canbeactivatedbyusingthePRFILEparameter
(002:1886 RN60_MAINT_10).
E-TFCITable1forTTI=10ms.ItisusedwhentheULSRBconfigurationisDCH.

ContentsoftheE-TFCItablesareintroducedinthe3GPPstandard.
ActivationanddeactivationoftheusageofE-TFCItable1innetworkswhereF-DPCHis
usedforwith10msTTIisperformedbyusingthePRFILEparameter(002:1886
RN60_MAINT_10).Defaultvalueofthisparameteris0H,thatmeanschangeisnot
active.
Activation:
UseofE-TTItable1canbeactivatedbysettingthePRFILEparametervalueto1H:

InIPA-RNCwithMMLcommand:
ZWOC:2,1886,1;
InmcRNCandFlexiDirectRNCwithSCLIcommand:
set app-parameter configuration-parameter class 2 number 1886
value 1

Afterparametervaluehasbeenchanged,changefunctionalityisactivatedwithin10
minutes.

Issue:06B DN70303923 119


Radiobearer,transportchannelandphysicalchannel WCDMARANRRMHSUPA
parameters

Deactivation:
UseofE-TTItable1canbedeactivatedbysettingthePRFILEparametervaluebackto
defaultvalue0H:

InIPA-RNCwithMMLcommand:
ZWOC:2,1886,0;
InmcRNCandFlexiDirectRNCwithSCLIcommand:
set app-parameter configuration-parameter class 2 number 1886
value 0

Afterparametervaluehasbeenchanged,defaultE-TFCItable0(useofE-TFCItable1
deactivatedwithF-DPCHand10msE-TTI)isinusewithin10minutes.
Interrogateactivatestatus:
Statusofchangeactivationcanbechecked:

InIPA-RNCwithMMLcommand:
ZWOI:2,1886;
InmcRNCandFlexiDirectRNCwithSCLIcommand:
show app-parameter configuration-parameter class 2 number 1886

Table0sareoptimizedformiscellaneousMAC-d/RLCPDUsizes,andtable1sare
optimizedforMAC-d/RLCPDUsizeslike320and640bit.

g ActivatetheusageofE-TFCItable1innetworkswhereF-DPCHisusedfor
with10msTTIandBTSSWisWN7.0.

8.3 Datadescriptionindicator
TheDataDescriptionIndicator(DDI)fieldidentifiesauniquecombinationoflogical
channelID,MAC-dflowIDandsizeoftheMAC-dPDUsconcatenatedintothe
associatedMAC-esPDU.
TheDDIvaluesaredefinedforeachlogicalchannelthathasanestablishedE-DCH
MAC-dflow.IfmorethanoneMAC-dPDUsizesareconfiguredforthelogicalchannel,
thedifferentPDUsizesusesthesubsequentDDIvaluesstartingfromthefirstDDIvalue
assignedtothelogicalchannel.ThefollowingalgorithmsareusedintheDDImapping
whentheE-DCHMAC-dflowsareestablishedforthelogicalchannels:

FreeDDIvaluesareassignedtothelogicalchannelsandtheE-DCHMAC-dflowsin
orderoftheirestablishments.
ThenumberoffreeconsecutiveDDIvaluesinthelogicalchannelequalsthenumber
ofdifferentsizesofMAC-dPDUsthatthelogicalchannelhas.
PropersetoftheDDIvaluesisselectedintheascendingorder,startingfromthe
lowestpossiblevalue.
LogicalchannelisassignedthelowestvalueoftheallocatedDDIset.

ThelogicalchannelidentityisusedtodistinguishlogicalchannelsmultiplexedbyMAC
onatransportchannel.Thevalueofthelogicalchannelvariesfrom1to15.

120 DN70303923 Issue:06B


WCDMARANRRMHSUPA Radiobearer,transportchannelandphysicalchannel
parameters

8.4 Servinggrantvalue
ByusingServingGrant(SG)Valueinformationelement,itispossibletodefinetheinitial
ServingGrantfortheUE.ThePrimary/SecondaryGrantSelectorinformationelement
indicateswhethertheSGValueisgrantedwithaprimaryE-RNTIorasecondaryE-
RNTI.Thisisdeterminedinternallyasprimary.
TheRNCreceivesSGValueandPrimary/SecondaryGrantSelectorinformation
elementsfromtheBTS/DRNCintheNBAP/RNSAPsignaling.Theseinformation
elementscanbereceived,forexample,inNBAP/RNSAP:RadioLinkSetupResponse.
TheRNCbypassestheseinformationelementswithoutmodifyingthemtotheUEusing
theRRCsignaling.Theycanbeincluded,forexample,inanRRC:RadioBearerSetup
message.TheideaisthattheRRCmessageisalwaysthenextavailablemessage
generated,otherwise,nodedicatedmessageisusedforthedeliveryofthisinformation.

8.5 ConfigurationoftheMAClayer
TheUE-specificpacketschedulersignalsmaximumallowedE-DCHuserbitrate
informationtotheMAClayerintheE-DCHallocationrequest.MACutilizesthis
informationwhenallocatingDSPresourcesfortheE-DCHNRTMAC-dflow.
UE-specificpacketschedulerdefinesthemaximumallowedE-DCHuserbitratetobe
theminimumvalueofthefollowingvalues:

ThemaximumallowedE-DCHuserbitratewhenE-TTI=10mswithfixedULRLC
PDUsizeis:
64kbit/sifthemaximumallowedtotaluplinksymbolrateis120kbit/s.
(correspondstospreadingfactorSF32andmaximumE-DCHbitrate69kbit/s).
160kbit/sifmaximumallowedtotaluplinksymbolrateis240kbit/s(corresponds
tospreadingfactorSF16andmaximumE-DCHbitrate169.8kbit/s).
320kbit/sifmaximumallowedtotaluplinksymbolrateis480kbit/s(corresponds
tospreadingfactorSF8andmaximumE-DCHbitrate337.8kbit/s).
672kbit/sifthemaximumallowedtotaluplinksymbolrateis960kbit/s
(correspondstospreadingfactorSF4andmaximumE-DCHbitrate711kbit/s).
1376kbit/sifthemaximumallowedtotaluplinksymbolrateis1920kbit/s
(correspondstospreadingfactorset2*SF4andmaximumE-DCHbitrate1448.4
kbit/s)
Otherwise,itis1888kbit/s(correspondstospreadingfactorset2*SF2and
maximumE-DCHbitrateis1986kbit/s).

ThemaximumallowedE-DCHuserbitratewhenE-TTI=2mswithfixedULRLCPDU
sizeis:
160kbit/sfor1*SF8ifmaximumallowedtotaluplinksymbolrateis480kbit/s
(correspondstospreadingfactorset1*SF8andmaximumE-DCHbitrate200
kbit/s).
640kbit/sfor1*SF4ifmaximumallowedtotaluplinksymbolrateis960kbit/s
(correspondstospreadingfactorset1*SF4andmaximumE-DCHbitrate680
kbit/s).

Issue:06B DN70303923 121


Radiobearer,transportchannelandphysicalchannel WCDMARANRRMHSUPA
parameters

1280kbit/sfor2*SF4ifmaximumallowedtotaluplinksymbolrateis1920kbit/s
(correspondstospreadingfactorset2*SF4andmaximumE-DCHbitrate1384
kbit/s).
1920kbit/sfor2*SF2ifmaximumsymbolrate5760kbit/sisnotenabledwith
MaxTotalUplinkSymbolRateparameterthatis,bitrateshigherthan2Mbps
arenotallowed(maximumE-DCHbitrate2056kbit/s).
2720kbit/sfor2*SF2ifmaximumsymbolrate5760kbit/sisenabled,
(correspondstospreadingfactorset2*SF2andmaximumE-DCHrate2896
kbit/s)
5440kbit/sfor2*SF2+2*SF4ifmaximumsymbolrate5760kbit/sisenabled
withQPSK(correspondstospreadingfactorset2*SF2+2*SF4andmaximumE-
DCHrate5752.5kbit/s).
11200kbit/sfor2*SF2+2*SF4ifmaximumsymbolrate5760kbit/sisenabled
with16QAM(correspondstospreadingfactorset2*SF2+2*SF4andmaximum
E-DCHrate11520kbit/s).

ThemaximumallowedE-DCHuserbitratewhenE-TTI=10mswithflexibleULRLC
PDUsizeis:
692.8kbit/sfor1*SF4ifmaximumallowedtotaluplinksymbolrateis960kbit/s
(correspondstospreadingfactorset1*SF4andmaximumE-DCHbitrate705.6
kbit/s).
1439.2kbit/sfor2*SF4ifmaximumallowedtotaluplinksymbolrateis1920kbit/s
(correspondstospreadingfactorset2*SF4andmaximumE-DCHbitrate1455.2
kbit/s).
Otherwise,itis1993.6kbit/s(correspondstospreadingfactorset2*SF2and
maximumE-DCHbitrate2009.6kbit/s).

g NotethatFlexibleRLCinULisnotsupportedwith2*SF2whenE-TTIis
10ms.

ThemaximumallowedE-DCHuserbitratewhenE-TTI=2mswithflexibleULRLC
PDUsizeis:
684kbit/sfor1*SF4ifmaximumallowedtotaluplinksymbolrateis960kbit/s
(correspondstospreadingfactorset1*SF4andmaximumE-DCHbitrate703
kbit/s).
1348kbit/sfor2*SF4ifmaximumallowedtotaluplinksymbolrateis1920kbit/s
(correspondstospreadingfactorset2*SF4andmaximumE-DCHbitrate1412
kbit/s).
1980kbit/sfor2*SF2ifmaximumsymbolrate5760kbit/sisnotenabledwith
MaxTotalUplinkSymbolRateparameter,thatisthebitrateshigherthan2
Mbit/sarenotallowed(maximumE-DCHbitrate2044kbit/s).
2868kbit/sfor2*SF2ifmaximumsymbolrate5760kbit/sisenabled
(correspondstospreadingfactorset2*SF2andmaximumE-DCHrate2932
kbit/s).
5732kbit/sfor2*SF2+2*SF4ifmaximumsymbolrate5760kbit/sisenabledwith
QPSK(correspondstospreadingfactorset2*SF2+2*SF4andmaximumE-
DCHrate5796kbit/s).
11468kbit/sfor2*SF2+2*SF4ifmaximumsymbolrate5760kbit/sisenabledand
HSUPA16QAMisallowed(correspondstospreadingfactorset2*SF2+2*SF4
andmaximumE-DCHrate11548kbit/s).

122 DN70303923 Issue:06B


WCDMARANRRMHSUPA Radiobearer,transportchannelandphysicalchannel
parameters

TheRNCmightdefineE-DCHMaximumBitRatedeliveredtotheBTSusingNBAP
signaling.ThedefinedE-DCHMaximumBitRateisfirstconvertedtothemaximum
E-DCHuserbitratebysubtractingallheaders.Afterthat,themaximumE-DCHuser
bitrateRMaxUserBRiscalculatedfromroundedmaximumE-DCHbitrateusingthe
followingequations:
Figure 54 MaximumuserbitrateoftheULRBandTTIoftheE-DCHforMAC-
e/es

where:
SPDUisthepayloadsizeoftheULAMDPDU.
RMaxUserBRisthemaximumuserbitrateoftheULRBandTTIthetransmissiontime
intervaloftheE-DCH.
RMAC-e,EDCHisthemaximumallowedE-DCHbitrate.
SAMDPDUisthesizeoftheAMDPDU(the2-octetsheaderpartaddedtothepayload
size)inULtransferdirection.
HMAC-e/esisthesizeoftheMAC-e/esheader,6+6+6=18bits.
Figure 55 MaximumuserbitrateoftheULRBandTTIoftheE-DCHforMAC-i/is

where:
RMAC-i,EDCHisthemaximumallowedE-DCHbitrate(transmissionbitrateonE-
DCH).
SPDUisthepayloadsizeoftheAMDPDUinULtransferdirection.
SAMDPDUisthesizeoftheAMDPDU(bothheaderandpayload)inULtransfer
direction.
HSS+TSNisthesizeofSSandTSNinMAC-isheader,totalsizeisonebyte(8bits).
HLCHid+L+FisthesizeofLCH-ID,LengthandFlaginMAC-iheader,totalsizeistwo
bytes(16bits).
TTIisthetransmissiontimeintervaloftheE-DCH.

TheUE-specificpacketschedulerreconfiguresthemaximumallowedE-DCHuserbit
rate,andupdatesittotheMAClayeriftheactivesetupdatesthevaluechangesaswell.
IfthevalueincreasesandMAClayercannotupgradeitsresourcereservation
accordingly,itinformstheUE-specificpacketscheduleraboutthefailureinbitrate
upgrade,andtheUE-specificpacketschedulerkeepsthecurrentmaximumtotaluplink
symbolrate.
TheUE-specificpacketschedulerdefinestheE-DCHMAC-dflowidentityforevery
establishedE-DCHMAC-dflow.AllRBs(streamingandNRT)usedifferentMAC-dflows.
ForthefirstMAC-dflowtheIDiszero.EverytimeanewMAC-dflowisallocated,the
valueofthenewIDisincreasedwiththestepsize1comparedtothehighestcurrently
usedMAC-dflow.
SupportedmaximumULE-DCHbitrateis1.45Mbit/sifSRBsaremappedonE-DCH
with10msTTIthatis,themaximumallowedSFconfigurationis2*SF4withE-DCH10
msTTI.

Issue:06B DN70303923 123


Radiobearer,transportchannelandphysicalchannel WCDMARANRRMHSUPA
parameters

8.6 Maximumalloweduplinksymbolandbitrate
Thissectionprovidesinformationon:

Cell-basedmaximumtotaluplinksymbolrate
E-DCHmaximumbitratebasedonmaximumuplinkuserbitrateoftheRAB
FinalmaximumtotaluplinksymbolrateoftheUE
Maximumuserbitratefornon-scheduledtransmission
MaximumULuserbitrateforaUEwithstreamingRB
MaximumsetofE-DPDCHs/maximumchannelizationcodeswithstreamingRBs

Cellbasedmaximumtotaluplinksymbolrate
TheMaxTotalUplinkSymbolRateRNPparameterdefinesthemaximumtotaluplink
symbolrateofE-DPDCH(s)oftheUEinthecell.Thepossiblevaluesare960kbit/s
(SF4),1920kbit/s(2*SF4),3840kbit/s(2*SF2),5760kbit/s(2*SF2+2*SF4)withQPSK,
andupto11520kbit/s(2*SF2+2*SF4)with16QAM.
ThevalueofthisparameterischeckedwhentheE-DCHisallocatedandE-DCHactive
setisupdated.Themodificationoftheparameterrequirescelllocking,thatis,the
parametervaluecannotchangeduringthelifespanoftheE-DCH.

E-DCHmaximumbitratebasedonmaximumuplinkuserbitrateof
theRAB
TheUE-specificpacketschedulerdefinestheE-DCHmaximumbitratebasedonthe
maximumuplinkuserbitrateoftheRAB.
TheE-DCHmaximumbitrateiscalculatedasfollows:
E-DCHMaxBitRate=FactorEDCHMaxBitRateUplinkRABMaxBitRate
where,
FactorEDCHMaxBitRateistheRNCconfigurationparameter,anditdefinesthefactor
tocalculatetheE-DCHmaximumbitratefromthemaximumuplinkuserbitrateofthe
RAB.Theparameterhasalsoaspecialvalue(0),whichdeactivatestheuseofthe
maximumuplinkuserbitrateoftheRABforthispurpose.Inthiscase,theE-DCH
maximumbitrateisnotlimitedbasedontheuplinkmaximumbitrateoftheRAB,and
informationelementisnotsent.ThevalueofthisparameterischeckedonlyintheE-
DCHallocationphase.Thatis,changingthevalueoftheparameterdoesnotaffectthe
existingE-DCHallocations.TheRBbitratecantemporarilyexceedthemaximumRAB
bitrateifthevalueoftheFactorEDCHMaxBitRateRNCconfigurationparameteris
higherthanone.ThisisrecommendedwhenitisknownthatthereisalotofE-DCH
trafficinthecell,thenatureoftheE-DCHtrafficisbursty,oritisknownthatthe
applicationdoesnotfullyutilizetheE-DCHchannelcapacity.
UplinkRABMaxBitRateistheuplinkmaximumbitrateoftheRAB,anditisreceived
fromthecorenetwork.
TherestrictionissignaledtotheBTSusingtheNBAP:E-DCHMaximumBitRate
informationelement.TheinformationelementcanbesignaledusingNBAP:RadioLink
SetupandNBAP:RadioLinkReconfigurationprocedures.Therestrictionissignaledto

124 DN70303923 Issue:06B


WCDMARANRRMHSUPA Radiobearer,transportchannelandphysicalchannel
parameters

theDRNCusingRNSAP:E-DCHMaximumBitRateinformationelement.The
informationelementcanbesignaledusingRNSAP:RadioLinkSetupandNBAP:Radio
LinkReconfigurationprocedures.
WiththeHSUPA16QAM,theupperlimitoftheE-DCHmaximumbitrateis11498kbit/s.
InthecaseofmultipleNRTRABsorstreamingwithNRTRAB(s),theE-DCHmaximum
bitrateiscalculatedasfollows:

Figure 56 E-DCHmaximumbitrate

NotethatnisthenumberofNRTandstreamingRABs.
TheE-DCHmaximumbitrateE-DCHMaxBitRatespecifiestherateofthetransport
channelbelowMAC-e.TheBTSusesitfortheE-DCHschedulingdecision.TheE-DCH
maximumbitrateiscalculatedbytheRNCandsentintheNBAPRadioLinkSetup,
AdditionorReconfigurationmessagestotheBTS/RNSAPRadioLinkSetup,Additionor
ReconfigurationmessagestotheDRNC.
FactorEDCHMaxBitRateisamanagementparameterthatdefinestheE-DCH
maximumbitrateinrelationtotheUL/DLMaximumBitRateRABparameterforthe
casesof2NRT,3NRTandPSstreamingRABcombinations.InthecaseofmultiNRT
RABsandstreamingwithNRTRAB(s),FactorEDCHMaxBitRateisequaltoanyofthe
managementparametersFactorEDCHMaxBitRate2NRT,
FactorEDCHMaxBitRate3NRTandFactorEDCHMaxBRPSstream.Inotherwords,in
thecaseofoneNRTRAB,FactorEDCHMaxBitRateisusedfortheNRTRAB,inthe
caseoftwoNRTRABs,FactorEDCHMaxBitRate2NRTisusedforallNRTRABsand
forthreeNRTRABs,FactorEDCHMaxBitRate3NRTisusedforallNRTRABs.Ifthe
RABcombinationincludesPSstreamingRABs,FactorEDCHMaxBRPSstreamisused
forthePSstreamingservice.
TheradiobearerrateexceedsthemaximumrateoftheE-DCHbecauseofMAC-eand
RLCheadersandMAC-elevelretransmissions.MultiplexingofPSI/BRABsrequiresa
lowermaximumE-DCHbitrate.PSstreamingRABsthathaveamaximumbitrateequal
totheguaranteedbitraterequireahigherE-DCHmaximumbitrate.

NSTfortheSRBsonE-DCHandoneHARQprocessforSRBsonE-
DCHTTI2ms
ThereisoneHARQprocessallocatedforSRBsonHSUPAwhentheE-DCHTTI2msis
configured.IfonlySRBsonHSUPAareconfiguredwithNST,theHARQprocessofthe
leftmostbitissetto1([10000000])intheestablishmentphase.Otherwise,oneofthe
HARQprocessesallocatedfortheserviceusingNSTisusedalsobySRBsontheE-
DCH.AnotherservicewiththeNST(GBRservice)ispossibleonlywithFullHSPA
configuration,whenF-DPCHissupported.WithsupportofHSUPA2msTTIorHSUPA
5.8Mbps,onlyNRTservicescanbeusedwithSRBsonHSUPAE-TTI=2ms.

Issue:06B DN70303923 125


Radiobearer,transportchannelandphysicalchannel WCDMARANRRMHSUPA
parameters

ThemaximumnumberofSRBbits/TTI2msfornon-scheduled
transmission
Non-scheduledtransmissionisusedwhenSRBsonE-DCHTTI2msareconfigured.
TheRNCusesthenumberofMAC-dPDUsper2msTTIandthesizeoftheMAC-d
PDUtodeterminethemaximumnumberofSRBbits/2msTTI.
IncaseofthefixedULRLCPDUsize,themaximumnumberofbits/2msTTIis
calculatedinthefollowingway:

Figure 57 Themaximumnumberofbits/2msTTIforfixedULRLCPDUsize

where:
NumberOfMACDSRBPDUsissetforfixedvalue2,SPDUissizeoftheMAC-dPDU,and
MACe/esHeaderisthesizeoftheMAC-e/esheader.

ThesizeofMAC-dPDUisRLCpayloadsize+RLCheader=144bits.MAC-e/esheader
=preferably18bits(NDDI(6bitsfortheDatadescriptionindicator(DDI))+NPDU(6bits
fortheNumberofMAC-dPDUs)+NTSN(6bitsfortheTransmissionSequenceNumber
(TSN))).
IncaseoftheflexibleULRLCPDUsize,themaximumnumberofbits/2msTTIis
calculatedinthefollowingway:

Figure 58 Themaximumnumberofbits/2msTTIforflexibleULRLCPDUsize

FortwoMAC-dPDUs,theMaximumBitsForNSTofSRB2MSTTIis2timessumofLCH-
L-F-16bits(consistsofLCHID-4bits,L-11bitsandF-1bit),TSN-6bits,SS-2
bits,andSRBPDUsize-144bits.Thatisintotal336bits.
ThemaximumnumberofbitsshouldbesenttoBTSinMaximum Number of Bits per
MAC-e PDU for Non-scheduled TransmissionIEandtoUEinMax MAC-e PDU contents
sizeIE.

ThemultiplexinglistfortheE-DCHMAC-dflowoftheSRBs
TheE-DCHMAC-dflowmultiplexinglistofthesignalingradiobearerindicatesifitisthe
firstMAC-dflowforwhichPDUsareplacedintheMAC-ePDU.TheotherMAC-dflows
fromwhichtheMAC-dPDUsareallowedtobeincludedinthesameMAC-ePDU.UE-
specificACoftheSRNCdefinesinthemultiplexinglisttheservices(trafficclasses)that
areallowedtobetransferredwiththeCSvoiceservice.Twoseparatemultiplexinglist
areusedforthetwopossibleE-TTIvalues.

ThefinalmaximumtotaluplinksymbolrateoftheUE
Thefinalmaximumtotaluplinksymbolrate(E-DPDCH(s))oftheUEandtheBTSis
definedtobetheminimumofthefollowinglimitations:

UEcapability
UEcapabilityisreceivedfromtheUE.

126 DN70303923 Issue:06B


WCDMARANRRMHSUPA Radiobearer,transportchannelandphysicalchannel
parameters

ThemaximumuplinkuserbitrateoftheRAB
TheRNCconfigurationstructureparameterThresholdMaxEDPDCHSRdefinesbit
ratethresholdswhenmaximumtotaluplinksymbolrateofE-DPDCH(s)isrestricted
when960kbit/s(correspondstospreadingfactorSF4),1920kbit/s(correspondsto
spreadingfactorset2*SF4),or3840kbit/sisallowed(correspondstospreading
factorset2*SF2).Membersintheparameterstructurearerespectively
ThresholdMaxEDPDCHSR960kbps,ThresholdMaxEDPDCHSR1920kbpsand
ThresholdMaxEDPDCHSR3840kbps.
ThemaximumuplinkuserbitrateoftheRABneedstobebeloworequalthanthe
thresholduntilrestrictionisset.InthecaseofmultipleNRTRABs,thesumofthe
maximumuplinkuserbitratesisusedforcomparison.
IfthemaximumuplinkuserbitrateoftheRABisbeloworequalto
ThresholdMaxEDPDCHSR960kbpsthreshold,thenrestrictionissetaccording
toit.
IfthemaximumuplinkuserbitrateoftheRABisabove
ThresholdMaxEDPDCHSR960kbpsthresholdandbeloworequalto
ThresholdMaxEDPDCHSR1920kbpsthreshold,thenarestrictionisset
accordingtoit
IfthemaximumuplinkuserbitrateoftheRABisabove
ThresholdMaxEDPDCHSR1920kbpsthresholdandbeloworequalto
ThresholdMaxEDPDCHSR3840kbpsthreshold,thenarestrictionisset
accordingtoit.
IfthemaximumuplinkuserbitrateoftheRABisabove
ThresholdMaxEDPDCHSR3840kbps,thenthemaximumtotaluplinksymbol
rate5760kbit/sisallowed(correspondstospreadingfactorset2*SF2+2*SF4).
Theparameterhasalsothespecialvalue(0)thatdeactivatestheusageofthe
maximumuplinkuserbitrateoftheRABs.Thisvalueisusedtolimitthemaximum
totaluplinksymbolrate.Thevaluesoftheseparametersarecheckedonlyduringthe
E-DCHallocationphase.Itmeansthatchangingthevalueoftheparameterdoesnot
affecttheexistingE-DCHallocations.
Cellbasedlimitation
ThecellbasedlimitationisdefinedwiththeMaxTotalUplinkSymbolRateRNP
parameter.Fromalltheparameters'cellvaluesthatbelongtoanE-DCHactiveset,
thelowestparametervalueisused.Thesignaledvalueisupdatedwitheachsoft
handoverbranchadditionordeletion,andthelowestvaluechanges.
Thecurrentvalueis,however,keptiftheMAClayercannotupgradeitsresource
reservationasrequested.
BTScapability
BTScapabilityisreceivedfromtheBTSinNBAP:E-DCHSFCapabilityinformation
element.Fromalltheparameters'cellvaluesthatbelongtoanE-DCHactiveset,the
lowestparametervalueisused.Thesignaledvalueisupdatedwitheachsoft
handoverbranchadditionordeletion,andthelowestvaluechanges.Thecurrent
valueis,however,keptiftheMAClayercannotupgradeitsresourcereservationas
requested.TheBTScapabilityoftheDRNCBTSisnotknown.HencetheSRNC
definesthemaximumtotaluplinksymbolratefortheE-DCHMAC-dflowoverIur-
interfacewithouttheBTScapabilityinformation,whichisonlyavailableinthe
controllingRNC(E-DCHSFCapability).
GuaranteedbitrateofthestreamingRAB
Forstreamingservices,thecalculationsbasedontheguaranteedbitratearedone
asdefinedinSectionMaximumULuserbitrateforaUEwithstreamingRB.

Issue:06B DN70303923 127


Radiobearer,transportchannelandphysicalchannel WCDMARANRRMHSUPA
parameters

WhentheE-DCHMAC-dflowisestablishedfortheCSvoiceRAB,whichis
transferredinthemulti-serviceHSUPAconfigurationwiththeotherRABs,thenthe
contributionoftheAMRtotheuplinkbitrateequalsRamrEDCH.

TheinformationissignaledtotheUEusingRRC:Maximum channelisation codesIEand


toBTS/DRNCusinganNBAP:Maximum Set of E-DPDCHsIE/RNSAP:Maximum Set of
E-DPDCHsIE.Quantityisaspreadingfactororasetofspreadingfactors.The
reconfigurationoftheIEsisperformedusingasynchronizedprocedureaftertheactive
setisupdated.
TheRNCdoesnotlimitthemaximumtotaluplinksymbolrateofE-DPDCH(s)forNRTs
below960kbit/s(SF4),thatis,thepossiblevaluesare960kbit/s(SF4),1920kbit/s
(2*SF4),3840kbit/s(2*SF2),and5760kbit/s(2*SF2+2*SF4).
WhentheRNCreceivestheguaranteedbitrate(GBR)valueof0kbit/sforUL,DL,or
bothULandDL,thevalueisnormalizedto8kbit/s.ThenewvalueisusedasGBRforall
purposes.WhenE-DCHisallocated,thenormalizedvalueisusedtodefinethebitrate
fornon-scheduledtransmission.ThisvalueisalsousedintheSRNCandtheDRNC.
However,incaseofinactivePSRABs,theDCH0/0isstillused.

Themaximumuserbitratefornon-scheduledtransmission
TheUE-specificpacketschedulerallocatesnon-scheduledtransmissionforE-DCH
channelselectedforPSstreamingRB,whilethescheduledtransmissionisallocatedfor
NRTRBs.
AlwayswhentheE-DCHchanneltypeisselectedfortheSRBswithE-TTI=2msorE-
TTI=10mswithGBRservice,theUE-specificpacketschedulerallocatesanon-
scheduledtransmissiontoit.WhenSRBsE-TTI=10msandactiveGBRservicesdonot
exist,thenthescheduledtransmissionisusedalsoforSRBs.
TheRNCusestheguaranteedbitrate,whichisprovidedbythecorenetwork,todefine
themaximumuserbitratefornon-scheduledtransmission.Fornon-scheduled
transmission,theRNCthuslimitsthemaximumbitrateto512kbit/s.Inotherwords,the
largestguaranteedbitrateforPSstreamingRABsequals512kbit/s.Requestsforlarger
guaranteedbitratesarerejectedwhenanon-scheduledtransmissionisallocated.
First,thenumberofMAC-dPDUsiscalculated,whichisneededtotransfertheamount
ofdatarelatedtotheguaranteedbitratewiththedefinedBLERperTTI.

Figure 59 NumberofMAC-dPDUs

whereGBRistheguaranteedbitratereceivedfromIu.BLERtargetisthelayer1BLER
targetforE-DCH.TTIisthetransmissiontimeintervaloftheE-DCHandSPDUisthe
payloadsizeoftheULAMPDU.Thenthecorrespondingbitrateiscalculated.

Figure 60 MaximumnumberofbitsperMAC-ePDUfornon-scheduledtransmission

128 DN70303923 Issue:06B


WCDMARANRRMHSUPA Radiobearer,transportchannelandphysicalchannel
parameters

Finally,thenumberofbitsperMAC-ePDUiscalculatedandsenttotheBTSin
'MaximumNumberofBitsperMAC-ePDUforNon-scheduledTransmission'IEandto
theUEinthe'MaxMAC-ePDUcontentssize'IE.
WhenMAC-e/esisapplied:

Figure 61 MaximumnumberofbitsperMAC-ePDUwithMAC-e/es

SPDU+HisthesizeofULAMPDUincludingtheheader(320+16bits).

NTSNisthesizeofTransmissionSequenceNumberfieldinMAC-esheader(6bits).

NDDIisthesizeofDataDescriptionIndicatorfieldinMAC-eheader(6bits).

NNisthesizeofNumberofMAC-dPDUsfieldinMAC-eheader(6bits).

WhenMAC-i/isisapplied:

Figure 62 MaximumnumberofbitsperMAC-ePDUwithMAC-i/is

SPDU+HissizeofULAMPDUincludingtheheader(320+16bits).

NLCH-IDissizeofLogicalChannelIdentifiedfieldinMAC-iheader(4bits).

NLissizeofLengthfieldinMAC-iheader(11bits).

NFissizeofFlagfieldinMAC-iheader(1bit).

NTSNissizeofTransmissionSequenceNumberfieldinMAC-isheader(6bits).

NSSissizeofSegmentationStatusfieldinMAC-isheader(2bits).

NSTfortheE-DCHMAC-dflowoftheCSvoicebearer
Thenon-scheduledtransmissionisappliedtotheE-DCHMAC-dflowoftheCSvoice
RAB.WhenE-TTIequals2ms,oneHARQprocessisallocatedfortheE-DCHMAC-d
flow.IfCSvoicecanbetransferredwiththeSRB,thenthesameprocessisindicatedin
theNBAPIEHARQProcessAllocationFor2msNon-ScheduledTransmissionGrantas
theE-DCHMAC-dflowoftheSRBhasallocated.

ThemaximumnumberofbitsfortheNSToftheE-DCHMAC-dflow
establishedfortheCSvoiceRAB
TheMaximumNumberofBitsperMAC-ePDUfornon-scheduledtransmissionindicates
thenumberofbitsallowedtobeincludedinaMAC-ePDUperE-DCHMAC-dflow
configuredfornon-scheduledtransmissions.Generally,theMAC-dflowoftheSRBhasa
higherSPIvalue,andtherebyitisprioritizedovertheCSvoiceintheE-TFCselection.
Therefore,themaximumSRBbitratewillbelimitedsothatatleastoneCSvoiceframe
canalwaysbetransmittedtogetherwiththesignalingwhenthemaximumpuncturingis
appliedinordertominimizetheCSvoicedelay.Themaximumnumberoftheallowed
NSTbitsinMAC-ePDUdependsontheE-TTI,SFandAMRcodecsetoftheCSvoice

Issue:06B DN70303923 129


Radiobearer,transportchannelandphysicalchannel WCDMARANRRMHSUPA
parameters

service.TableTable8:MaximumnumberofMAC-dPDUs(NMACd)forSRBandAMR,
E-TTI=2msdefinesthemaximumnumberofMAC-dPDUsfortheSRBandAMR
codecsetstobeconfiguredforE-DPDCHwhenE-TTIequals2ms:

Table 8 MaximumnumberofMAC-dPDUs(NMACd)forSRBandAMR,E-TTI=2
ms
MaximumnumberofMAC-dPDUs(NMACd)

E-TTI=2ms AMR(5.9,4.75) RestofAMRandAMRWB


sets

SF vN8 vN4 vN8 vN4

SRB 2 2 2 2

AMRand 3 3 2 3
AMRWB

ThetableTable9:MaximumnumberofMAC-dPDUs(NMACd)forSRBandAMR,E-TTI
=10msdefinesthemaximumnumberofMAC-dPDUsfortheSRBandAMRcodecsets
tobeconfiguredforE-DPDCHwhenE-TTIequals10ms:

Table 9 MaximumnumberofMAC-dPDUs(NMACd)forSRBandAMR,E-TTI=10
ms
MaximumnumberofMAC-dPDUs(NMACd)

E-TTI=10ms AMR(5.9,4.75) RestofAMRandAMRWB


sets

SF vN32 vN16 vN32 vN16

SRB 2 2 2 2

AMRand 3 3 2 3
AMRWB

IfalowerupperlimithasbeendefinedforthemaximumnumberoftheMAC-dPDUsof
theE-DCHMAC-dflowtransferringtheSL,thenitisusedinsteadoftheonedefinedin
thetableTable8:MaximumnumberofMAC-dPDUs(NMACd)forSRBandAMR,E-TTI
=2msorinthetableTable9:MaximumnumberofMAC-dPDUs(NMACd)forSRBand
AMR,E-TTI=10ms.
WhenMAC-e/esisappliedthemaximumnumberNmaxNST(voice)oftheNSTbitsper
MAC-ePDUfortheE-DCHMAC-dflowoftheCSvoiceRABisobtainedfromthe
equation:

Figure 63 MaximumnumberNmaxNST(voice)oftheNSTbitsperMAC-ePDUfor
MAC-e/es

130 DN70303923 Issue:06B


WCDMARANRRMHSUPA Radiobearer,transportchannelandphysicalchannel
parameters

NDDI=6bitsfortheDatadescriptionindicator(DDI).

NPDU=6bitsfortheNumberofMAC-dPDUs.

NTSN=6bitsfortheTransmissionSequenceNumber(TSN).

NMACdisthenumberoftheMAC-dPDUsfromtheprevioustables.

NUMDisthesizeoftheMAC-dPDUoftheradiobearer.Itsvalueequalsthesizeofthe
UMDPDUandiscalculatedforthemaximummodeofthecodecsetoftheCSvoice
bearer.
WhenMAC-i/isisappliedthemaximumnumberNmaxNST(voice)oftheNSTbitsper
MAC-ePDUfortheE-DCHMAC-dflowoftheCSvoiceRABisobtainedfromthe
equation:

Figure 64 MaximumnumberNmaxNST(voice)oftheNSTbitsperMAC-ePDUfor
MAC-i/is

NTSN=6bitsfortheTransmissionSequenceNumber(TSN).

NSS=2bitsfortheSegmentationStatus(SS).

NLCH-ID=4bitsfortheLogicalChannelIdentified(LCH-ID).

NL=11bitsfortheLength(L).

NF=1bitfortheFlag(F).

NMACdisthenumberoftheMAC-dPDUsfromtheprevioustables.NUMDisthesizeofthe
MAC-dPDUoftheradiobearer.ItsvalueequalsthesizeoftheUMDPDUandis
calculatedforthemaximummodeofthecodecsetoftheCSvoicebearer.
IftheSRBsandtheCSvoicearetransferredtogether(forbothfixedandflexibleUL
RLC),thenthemaximumnumberoftheNSTbitsNmaxNST(SL)isdefinedalsofortheE-
DCHMAC-dflowoftheSRBwiththemethoddescribedabove.ThesizeoftheMAC-d
PDUfortheSRBis144bits.QuantityNmaxNSTissignaledtoUEusingRRCMaxMAC-e
PDUcontentssizeIE,toBTSintheNBAPMaximum Number of Bits per MAC-e PDU for
Non-scheduled TransmissionfortheE-DCHMAC-dflowsoftheSLandCSvoice.The
sameRNSAPIEisusedinsignalingittothetargetRNC.

ThemultiplexinglistfortheE-DCHMAC-dflowoftheCSvoiceRAB
E-DCHMAC-dflowmultiplexinglistoftheCSvoicebearerindicatesifitisthefirstMAC-
dflowforwhichPDUsareplacedintheMAC-ePDU.TheotherMAC-dflowsare
allowedtobeincludedinthesameMAC-ePDU.TheUE-specificACoftheSRNC
definesinthemultiplexinglisttheservices(trafficclasses)thatareallowedtobe
transferredwiththeCSvoiceservice.Twoseparatemultiplexinglistareusedforthetwo
possibleE-TTIvalues.
TheE-DCHMAC-dflowisestablishedfortheCSvoiceRAB.ThentheUE-specific
admissioncontrolofSRNCdefinesthevalueofthemaximumE-DCHbitratetoconform
tothehighestAMRmodebitrateofthecodecsetthatthecell-specificAChasselected
fortheCSvoicebearer.WhentheCSvoiceisestablishedasasingleserviceRABthen
themaximumE-DCHbitrateissettoRamrEDCH:

Issue:06B DN70303923 131


Radiobearer,transportchannelandphysicalchannel WCDMARANRRMHSUPA
parameters

Figure 65 ThemaximumE-DCHbitrate

ETTIequalsthevalueofE-TTI.ThemaximumE-DCHbitratevalueissignaledinthe
NBAPE-DCHMaximumBitrateIEtotheBTS,andintheRNSAPE-DCHMaximum
BitrateIEtotargetRNC.

TheinitialE-TTIvaluefortheCSvoiceservice
IftheHSUPA2msTTIfeatureisnotactivatedtoallcellsoftheactiveset
(HSUPA2MSTTIEnabled),thenthe10msTTIisselectedfortheUEwithCSvoiceRAB
thatismappedtoHSPA.
IftheHSUPA2msTTIfeatureisactivatedtoallcellsoftheactiveset
(HSUPA2MSTTIEnabled),thentheUEandacell-specificadmissioncontrolsdefinethe
E-TTIvaluewiththequalityrulesdefinedfortheE-TTIselection.However,iftheUE
alreadyhasE-DCH(excludingstandaloneSRBcase),thenaTTIthatisalreadyinuse,
isstillused.IncaseofstandaloneSRBswhenCSvoiceRABisbeingsetup,SRBsare
reconfiguredtousethesameTTIasCSvoiceiftheselectedTTIisnotthesamethat
wasusedwithSRBs(thesamefunctionalityasinthePScases).Admissioncontrolis
alsopreparedtoreconfigurebetweenthetwoE-TTIsaftertheCSvoiceRABissetup.

MaximumULuserbitrateforaUEwithstreamingRB
Whenstreamingservicesareallocated,theUE-specificpacketschedulerdefinesthe
maximumULuserbitrateforallRBsthattheUEhasaccordingtothefollowingrules:

Streamingtrafficclass:
MaximumuserbitrateforstreamingRB=guaranteedbitrate(GBR)received
fromtheCoreNetwork.

Non-real-timetrafficclasses:
nominalbitrategiven:theMaximumuserbitrateforNRTRB=NBRdefinedin
theHSPANBRValuesparameterstructure.
nominalbitratenotgiven:theMaximumuserbitrateforNRTRB=
NRTRBBRWithEDCHStrradionetworkplanningparameter.

ThesemaximumuserbitratesforRBsareusedwhencalculatingthemaximumsetofE-
DPDCHs/maximumchannelizationcodes.Notethattheusercanusuallygetgreater
NRTULbitratesbecausethespreadingfactor(maximumsetofE-DPDCHs)isrounded
downtoalowerspreadingfactorandahigherbitrate.Moreover,puncturingenablesa
higherbitrate.

MaximumsetofE-DPDCHs/maximumchannelizationcodeswith
streamingRBs
TheUE-specificpacketschedulercalculatestheL1bitrateandtherequiredspreading
factororasetofspreadingfactorsasafunctionofthetotalmaximumuserbitrate.
ThenetbitrateofMAC-ePDUiscalculatedfirst:

132 DN70303923 Issue:06B


WCDMARANRRMHSUPA Radiobearer,transportchannelandphysicalchannel
parameters

Figure 66 NetbitrateofMAC-ePDU

Thenthebitrateaftertheattachmentofpadding(tofillawholeMAC-ePDU)andCRCis
calculated.
BRwithCRC=[NetBRofMACePDU]+MCRC

Thenumberofcodeblocksandthesizeofeachcodeblocksarecalculatedasfollows:

Figure 67 Numberofcodeblocksandthesizeofeachcodeblock

Finally,thetotalnumberofbitsinaTTIbeforeratematchingisachievedbyperforming
channelcodingandattachingtailbits.Thisresultisusedintheratematchingalgorithm.
BRbeforRM=NumberOfCodeBlocks*(CCR*BRperCodeBlock+Mtail)

where:
MaxUserBRisthemaximumalloweduserbitrateperTTIofcertainradiobearer.Thisis
basedonthemaximumuplinkbitrateoftheRAB.Ifthemaximumuserbitrateofan
individualradiobearerisnotequaltoanintegermultipleoftheRLCPDUsize,theRNC
roundsitupwardssothatitisequaltothismultiple.Thisisdonebyaddingpaddingbits
inthelastRLCPDU.
NetBRofMACePDUisthenetbitrateoftheMAC-ePDUwithoutpadding
BRwithCRCistherequireddatabitrateaftertheattachmentofpaddingandCRC.The
bitratemustberoundedupwardstothenextE-DCHtransportblocksize.
NumberOfCodeBlocksisthenumberofcodeblocks.
BRperCodeBlockisthebitratepercodeblockafterbitsareeveneduptoeachblock.
BRbeforeRMisthetotalnumberofbitsinaTTIbeforeratematching.
kisthenumberofthelogicalchannelsmappedtoE-DCH.
MRCPDUSizeisthenumberofthebitsintheRLCPDU.Thedefaultvalueis320bits.

MRLCHeaderisthenumberofthebitsintheRLCPDUheader.Itslengthis16bits.

MTSNisthenumberofthebitsintheTransmissionSequenceNumberfield(TSN).Its
lengthis6bits.
MDDIisthenumberofthebitsintheDataDescriptionIndicatorfield(DDI).Itslengthis6
bits.
MNisthenumberofthebitsinthenumberoftheMAC-esSDUfield(N).Itslengthis6
bits.

Issue:06B DN70303923 133


Radiobearer,transportchannelandphysicalchannel WCDMARANRRMHSUPA
parameters

MDDI0isthenumberofthebitsinthespecificDataDescriptionIndicatorfield(DDI).Its
lengthis6bits.Includedonlyifitfitsthetransportblock
MCRCisthenumberofthebitsintheCyclicRedundancyCheckfield(CRC).Itslengthis
24bits.
CCRistheChannelCodingRate.TheE-DPDCHturbocodingrateis3.
MTailisthenumberofthebitsintheTailfield.Itslengthis12bits.

ThetableTable10:E-DPDCHslotformatsdefinesthemaximumpossiblechannelbit
rateforeachspreadingfactororaspreadingfactorcombination.

Table 10 E-DPDCHslotformats
Identityof SForSF ChannelBit Bits/Frame Bits/ Bits/Slot
combination combination Rate(kbit/s) Subframe Ndata

N256 SF256 15 150 30 10

N128 SF128 30 300 60 20

N64 SF64 60 600 120 40

N32 SF32 120 1200 240 80

N16 SF16 240 2400 480 160

N8 SF8 480 4800 960 320

N4 SF4 960 9600 1920 640

2*N4 2*SF4 1920 19200 3840 1280

2*N2 2*SF2 3840 38400 7680 2560

2*N2+2*N4 2*SF2+ 5760 57600 11520 3840


2*SF4

Aneasymethodofcalculatingtherequiredspreadingfactor(allowedfortheUE)or
spreadingfactorcombination(maximumchannelizationcode/codes)forthecalculated
datarateistomaximize(channelbitrateisminimized)ifoneE-DPDCHissufficientfor
transmission,andtominimizeifmorethanoneE-DPDCHsareneeded.
ThetableTable11:ExampleofrequiredE-DPDCH(s)spreadingfactor(s)foreachuser
bitrateshowsanexampleoftherelationbetweenthesumofuserbitratesandthe
requiredspreadingfactororthespreadingfactorcombination.Notethatinformationin
thistableassumesthatthereisonlyonelogicalchannelmappedtoE-DCH,theRLC
PDUsizeis320bit,andthevalueofthePLnon-maxisequalto0.68.Theradioaccess
network'smaximumforthespreadingfactorcombinationis2*SF4andE-DCHUE
categoryis2.

Table 11 ExampleofrequiredE-DPDCH(s)spreadingfactor(s)foreachuserbitrate
Userbitrate MinimumallowedSF

134 DN70303923 Issue:06B


WCDMARANRRMHSUPA Radiobearer,transportchannelandphysicalchannel
parameters

Table 11 ExampleofrequiredE-DPDCH(s)spreadingfactor(s)foreachuserbitrate
(Cont.)
16kbit/s(1RLCPDUofsize320bit) SF32

32kbit/s(1RLCPDUofsize320bit) SF32

64kbit/s(2RLCPDUofsize320bit) SF16

96kbit/s SF8

128kbit/s SF8

160kbit/s SF4

192kbit/s SF4

224kbit/s SF4

256kbit/s SF4

288kbit/s SF4

320kbit/s SF4

352kbit/s SF4

384kbit/s SF4

416kbit/s SF4

448kbit/s 2*SF4

480kbit/s 2*SF4

512kbit/s 2*SF4

544kbit/s 2*SF4

576kbit/s 2*SF4

608kbit/s 2*SF4

640kbit/s 2*SF4

672kbit/s 2*SF4

704kbit/s 2*SF4

736kbit/s 2*SF4

768kbit/s 2*SF4

Issue:06B DN70303923 135


Radiobearer,transportchannelandphysicalchannel WCDMARANRRMHSUPA
parameters

Table 11 ExampleofrequiredE-DPDCH(s)spreadingfactor(s)foreachuserbitrate
(Cont.)
800kbit/s 2*SF4

832kbit/s 2*SF4

864kbit/s 2*SF4

896kbit/s 2*SF4

928kbit/s 2*SF4

960kbit/s 2*SF4

992kbit/s 2*SF4

1024kbit/s 2*SF4

1056kbit/s 2*SF4

1088kbit/s 2*SF4

1120kbit/s 2*SF4

1152kbit/s 2*SF4

1184kbit/s 2*SF4

1216kbit/s 2*SF4

1248kbit/s 2*SF4

1280kbit/s 2*SF4

1312kbit/s 2*SF4

1344kbit/s 2*SF4

1376kbit/s 2*SF4

1408kbit/s Doesnotfitinto2*SF4

WhenthestreamingRBisreleasedfromtheUEorreconfiguredtoDCH0/0kbit/s,the
UE-specificpacketschedulerdefinesthemaximumsetofE-DPDCHs/maximum
channelizationcodesasdescribedintheSectionThefinalmaximumtotaluplinksymbol
rateoftheUE.ThenewvalueisreconfiguredintheBTSandtheUEatthesametimeas
thestreamingRBisreleased.
WhenthestreamingRBisallocatedandanewNRTRBisestablishedfortheUEorthe
oldNRTRBisreleasedfromtheUEorreconfiguredtoDCH0/0kbit/s,theUE-specific
packetschedulercalculatesthemaximumsetofE-DPDCHs/maximumchannelization

136 DN70303923 Issue:06B


WCDMARANRRMHSUPA Radiobearer,transportchannelandphysicalchannel
parameters

codesasdescribedintheSectionMaximumULuserbitrateforaUEwithstreamingRB.
Ifthevaluechanges,thenewvalueisreconfiguredtotheBTSandtheUEatthesame
timeastheNRTRBisconfigured.

MaximumSetofE-DPDCHswhenE-DCHMAC-dflowisestablished
fortheCSvoiceRAB
WhentheE-DCHMAC-dflowisestablishedfortheCSvoiceasthesingleserviceRAB,
theUE-specificadmissioncontrolofSRNCdefinestheMaximum Set of E-DPDCHsof
theE-DPCHinformationusingtwoE-TTIspecificmanagementparameters:

IfE-TTIequals2ms,thevalueisreadfromthemanagementparameter
MaxSetOfEDPDCHCSAMR2,
IfE-TTIequals10ms,thevalueisreadfromthemanagementparameter
MaxSetOfEDPDCHCSAMR10.

ThevaluefortheMaximum Set of E-DPDCHsisreadfromeitherofthetwo


managementparameterswhentheestablishmentoftheE-DCHMAC-dflowisinitiated
withaparticularE-TTIvalue,oreachtimewhenthevalueoftheE-TTIismodified.
InformationissignaledtotheUEintheMaximum channelisation codesoftheRRCIEE-
DPDCHinfototheBTSintheMaximum Set of E-DPDCHsoftheNBAPIEE-DPCH
information,andtothehandovertargetRNCintheMaximum Set of E-DPDCHsofthe
RNSAPIEE-DPCHinformation.

8.7 SelectionofHARQmethod
TheRNCconfigurationparameterHARQRVConfigurationdefineswhichHARQ
methodisusedinacertainBTS.ThepossiblechoicesareChaseCombiningor
IncrementalRedundancyCombining.
TheBTSsignalstotheRNCinformationwhichmethod-ifany-itsupports(IR
CombiningCapable,ChaseCombiningCapable,IRandChaseCombiningCapable)
usinganNBAP:E-DCH HARQ Combining Capabilityinformationelement.WBTS
supportbothChaseCombiningandIncrementalRedundancyCombiningmethods,thus
selectionofthemethodbasedonlyontheRNCconfigurationparameter
HARQRVConfigurationisadequate.However,theSRNCdoesnotknowtheHARQ
methodsupportedbytheDRNCBTS.
TheHARQmethodthatisdefinedtobeusedintheHSPAservingcelldefinestheHARQ
methodfortheRRCconnectioninquestion.
TheinformationontheselectedHARQmethodissignaledtotheBTS/DRNCusing
NBAP/RNSAP:HARQInfo for E-DCHandtotheUEusingRRC:HARQ RV
Configurationinformationelements.ChaseCombiningisdenotedwithrv0and
IncrementalRedundancyCombiningwithrvtable.
ThevalueoftheparameterHARQRVConfigurationischeckedonlyinE-DCH
allocationandHSPAservingcellre-selectionphases.Itmeansthatchangingthevalue
oftheparameterdoesnotaffecttheexistingE-DCHallocations.
ParametersareapplicableforallsupportedAMRandAMRWBcodecsets.The
outerloopPCisupdatedwiththemodifiedvaluesofthemanagementparametersonlyin
thenextsetup,orinthenextmodificationoftheE-DCHMAC-dflow.

Issue:06B DN70303923 137


Radiobearer,transportchannelandphysicalchannel WCDMARANRRMHSUPA
parameters

8.8 SIRoftheDPCCHwhenE-DCHisconfiguredinthe
radiolink
TheUE-specificpacketschedulerdefinestheinitial,theminimum,andthemaximumSIR
oftheDPCCHwhentheE-DCHisconfiguredintheradiolink.

InitialSIR
ThevalueoftheSIRtargetrepresentstheRxdiversityantennaspecificvalue.TheUE-
specificpacketschedulerdefinestheinitialSIRoftheDPCCHwhentheE-DCHis
configuredintheradiolink.
TheparametervalueisdeterminedinternallyasshowninthetableTable12:InitialSIR
ofDPCCHwhenE-DCHisconfiguredbyusingthenumberofRxantennasinthecell
(RxDivIndicatorRNPparameter)andthemaximumsetofE-DPDCHsinthe
parametermapping.

Table 12 InitialSIRofDPCCHwhenE-DCHisconfigured

1Rxantenna 2Rxantenna 4Rxantenna

SF256 9dB 3dB 2dB

SF128 9dB 3dB 2dB

SF64 9dB 3dB 2dB

SF32 9dB 3dB 2dB

SF16 9dB 3dB 2dB

SF8 9dB 3dB 2dB

SF4 9dB 3dB 2dB

2*SF4 10dB 4dB 3dB

2*SF2 12dB 6dB 5dB

2*SF2+2*SF4 12dB 6dB 5dB

OnlySF4,2xSF4and2xSF2areused.
TheRNCusestheSIRtargettocomputetheamplituderatioofDPCCH/DPDCHandto
configuretheouterlooppowercontrol.The3GPPSIRvalueissignaledtotheouterloop
powercontrolfunctionoftheSRNC.Formoreinformationonthedeterminationofits
valueseesectionInitialtargetSIRforuplinkDPCCHinWCDMA RAN RRM Admission
Control.

138 DN70303923 Issue:06B


WCDMARANRRMHSUPA Radiobearer,transportchannelandphysicalchannel
parameters

IftheBTSdoesnotmeasuretheSIR,itusesthereceivedSIRvalueduringthepacket
schedulingwhenthedatarateisconvertedtopower.TheSIRtableissignaledtothe
BTSinaprivateNBAP:ConfigurationDatamessage.EithertheRxdiversityantenna
specificvalueorthe3GPPSIRtargetvalueissignaledtotheBTS.Formoreinformation
onhowtheCRNCdefinesfromtheBTScapabilityinformationwhichoneisused,see
sectionsInitialtargetSIRforuplinkDPCCHandBTSradiointerfacecapabilitiesin
WCDMA RAN RRM Admission Control.Iftheuplinkradiolinkisreconfigured,admission
controlsendstheupdateduplinkDPCCHSIRtargetvaluetotheuplinkouterlooppower
controloftheRNC.

MinimumandmaximumSIR
TheparametervaluefortheminimumandthemaximumSIRoftheDPCCHis
determinedinternallyasshowninthetableTable13:MinimumandmaximumSIRof
DPCCHwhenE-DCHisconfiguredusingthemaximumsetofE-DPDCHsinthe
parametermapping.WhenE-DCHisconfiguredintheradiolink,theUE-specificpacket
schedulerdefinestheminimumandthemaximumSIRoftheDPCCH.

Table 13 MinimumandmaximumSIRofDPCCHwhenE-DCHisconfigured

MinimumSIR MaximumSIR

SF256 0dB 12dB

SF128 0dB 12dB

SF64 0dB 12dB

SF32 0dB 12dB

SF16 0dB 12dB

SF8 0dB 12dB

SF4 0dB 12dB

2*SF4 0dB 13dB

2*SF2 0dB 15dB

2*SF2+2*SF4 0dB 15dB

OnlySF4,2xSF4and2xSF2areused.
TheminimumandthemaximumSIRtargetsareutilizedbytheouterlooppowercontrol
oftheRNC.ItisnecessarytolimitsothatSIRisnotadjustedastooloworhigh.The
valuesoftheminimumandmaximumSIRtargetsrepresentthe3GPPSIRvalues.

Issue:06B DN70303923 139


Radiobearer,transportchannelandphysicalchannel WCDMARANRRMHSUPA
parameters

8.9 BLERtargetsforE-DCHandDCH
ThevalueoftheL1blockerrorratio(BLER)targetforE-DCHisdeterminedinternallyas
10%.ItisusedbytheouterlooppowercontroloftheRNC.
ThevalueofthemaximumL1BLERtargetforE-DCHisdeterminedinternallyas16%.It
isusedbytheouterlooppowercontroloftheRNC.
ThevalueofthemaximumBLERtargetforbothSRBandAMRDCHswhentheradio
linkhasaconfiguredE-DCHisdeterminedinternallyas1%.Itisusedbytheouterloop
powercontroloftheRNC.
ThemanagementparameterL1BLERTEDCHVoice10definesthevaluefortheL1BLER
targetoftheL1BLERtargetwhentheE-TTIequals10ms.Themanagementparameter
L1BLERTEDCHVoice2definesthevaluefortheL1BLERtargetoftheL1BLERtarget
whentheE-TTIequals2ms.
ParametersarelocatedtotheWRABobjectidentifiedwiththemanagementparameter
EbNoSetIdentifieroftheservingE-DCHcell.TheUE-specificACispreparedto
updatetheouterloopPCwiththenewvalueoftheBLERtargetiftheWRABobjectis
changedintheservingcellchange.
ThemanagementparameterEDCHBLERAdjCSVoice10definestheL1HARQ
retransmissionsthresholdfortheouterlooppowercontrol.Theouterlooppowercontrol
usesthisretransmissionfordetectionofablockerrorwhentheE-TTIequals10ms.
ThemanagementparameterEDCHBLERAdjCSVoice2definesthethresholdvaluewhen
theE-TTIequals2ms.
ParametersarereadfromtheWRABobjectidentifiedwiththemanagementparameter
EbNoSetIdentifieroftheservingE-DCHcell.TheUE-specificACispreparedto
updatetheouterloopPCwiththenewvalueoftheHARQretransmissionthresholdifthe
WRABobjectischangedintheservingcellchange.
ParametersareapplicableforallAMRandAMRWBcodecsets.TheouterloopPCis
updatedwiththemodifiedvaluesofthemanagementparametersonlyinthenextsetup
orinthenextmodificationoftheE-DCHMAC-dflow.

8.9.1 DynamicHSUPABLER
WhenHSUPADynBLEREnabledRNClevelparameterissettoEnabled,theRRM
providesthesetofHSUPABLERtargetvaluesforthefollowingvariousconditions:

HSUPApeakrates
HSUPAcellcapacity
HSUPAuserthroughputatcelledge

WhenHSUPADynBLEREnabledparameterissettoDisabled,thelegacyhandlingis
followedtoprovideHSUPABLERtargetvaluetoUserPlane.

140 DN70303923 Issue:06B


WCDMARANRRMHSUPA Radiobearer,transportchannelandphysicalchannel
parameters

OuterLoopPowerControlsetupandreconfiguration
Whenthebit0ofRU40_MAINT_14 (002:2110)PRFILEparameterissetto
1(Enabled),theRRM/L3checkstheHSPAservingcellload(numberofHSPAUEsina
cell)againsttheRU40_MAINT_14 (002:2110)PRFILEparameterthresholdatthetime
ofE-DCHallocation,beforesendingtheBLERtargetstotheOLPC.
WhenthecalculatedHSUPAservingcellload(numberofE-DCHallocations)isbigger
thantheRU40_MAINT_14 (002:2110)PRFILEparametervalueofbit1-bit7
(Thresholdvalue),thefollowingscenariosoccur:

TheRRMconfiguresBurstyBLERtargetvalueswithcontinuousBLERvaluesbefore
sendingallthreeBLERtargetvaluesforPeak/Bursty/ContinuousdataratetoL2.
Incaseofthe2msTTIconfiguration:theBursty BLER target valueissetto
Continuous BLER state target value(L1ContBLERTrgtEDCH2),insteadof:
L1BurstDataBLERTrgtEDCH.Number of retransmissions after that BLER Target
is applied for bursty dataissettoNumber of retransmissions after that BLER
Target is applied for continuous data(DynHSUPABLERContDataRx2),insteadof:
DynHSUPABLERBurstDataRx..
Incase10msTTIconfiguration:theBursty BLER target valueissetto
Continuous BLER state target value(L1ContBLERTrgtEDCH10), instead of:
L1BurstDataBLERTrgtEDCH. Number of retransmissions after that BLER Target
is applied for bursty dataissettoNumber of retransmissions after that BLER
Target is applied for continuous data(DynHSUPABLERContDataRx10),instead
ofDynHSUPABLERBurstDataRx.

Otherwise,theRRMconfigurestheBLERtargetsforPeak/Bursty/Continuousdata
rateasdefinedinRNWdatabaseparameters.

TherecommendedRU40_MAINT_14 (002:2110)PRFILEparametervaluesare:

bit0=0
bits1tobit7=23H

Inthesetupandreconfigurationphase,whenthefollowingconditionsaresimultaneously
met:

thebit0ofRU40_MAINT_07 (002:2103)PRFILEparameterissetto0(no effect)


thenumberofHSUPAusersinthecellisbiggerthanthevalueofbit1tobit6ofthe
RU40_MAINT_07 (002:2103)PRFILEparameterorequal(afterthisallocation)

TheOLPCControllerreceivesasetofHSUPABLERTargetvalues(asdefinedabove)
andmaximumdatarateforallRBsisused,asdefinedinRetransmissionparametersof
AMRLC
Otherwise,whenthefollowingconditionsaresimultaneouslymet:

Thebit0ofRU40_MAINT_07 (002:2103)PRFILEparametervalueissetto1
Thedynamicpoweroffsetalgorithmallocateslowpoweroffsets/lowinitialSIRtarget
(alsoincaseofE-DPDCHinterpolationmethod)fortheUE

Theaboveconditionsindicate,thattheOLPCControllerreceivesasetofHSUPABLER
TargetvaluesRetransmissionparametersofAMRLC,andthemaximumdataratefor
eachRBsforPeakandBurstyBLERstate.ForContinuousBLERstate,theOLPCis
configuredforthisUEwithparametervaluesthatareusedwhtntheDynamicHSUPA

Issue:06B DN70303923 141


Radiobearer,transportchannelandphysicalchannel WCDMARANRRMHSUPA
parameters

BLERisnotactivated(L1BLERfromL1BLERTargetEDCH,
DynHSUPABLERContDataRx2,andDynHSUPABLERContDataRx10parametersvalues
arefixedtothevalue1).
Havingallocatedorconfigureduser-specificconfigurationonce,theyarenot
reconfiguredneitherbecauseofchangesinthenumberofHSUPAusersinthecell,nor
thechangesinlowvs.highpoweroffsetconfigurationconditions.
TheRRM/L3detectstheaboveconditionsandconfiguresOLPCaccordingly.

w TherecommendedRU40_MAINT_07 (002:2103)PRFILEparametervalues
are:bit0=0andbits1tobit6=03H.

UptoRN5.0,onlyoneBLERtargetwassenttoOLPCcontroller.L3informsallnew
RNPSparameters(forparameters,seeTable66:RAN2302:DynamicHSUPABLER
parameters)toOLPCforDynamicHSUPABLERcalculation.

8.10 E-DPDCHpowerinterpolation
TheE-DPDCHpowerinterpolationusagewithHSUPA2msand10msdataratesisa
genericfunctionality.WhenHSUPA16QAMisapplied,theE-DPDCHpowerinterpolation
isconsideredtobesupportedandisapplied.
Otherwisethesupportisverifiedaccordingtothefollowingcriteria:

TheUEindicatesthesupportforE-DPDCHpowerinterpolationbyincludingthe
Support for E-DPDCH power interpolation formulaIEtotheUE radio access
capabilityIEintherelevantRRCmessage.IftheSupport for E-DPDCH power
interpolation formulaIEisnotincluded,thentheUEdoesnotsupporttheE-DPDCH
powerinterpolation.
TheBTSisconsideredtosupporttheE-DPDCHpowerinterpolationiftheBTSisE-
DCHpowerboosting-capable,thatis,iftheBTSindicatesthesupportfortheE-DCH
powerboosting.
TheE-DPDCHpowerinterpolationcanbeusedinallcellsoftheActiveSet.
IftheDRNCispresentintheE-DCHActiveSetlist,theE-DPDCHpower
interpolationisnotused.

WhentheE-DPDCHpowerinterpolationisapplied,theusageisindicatedinNBAPand
RRCmessageswithE-DPDCH Power InterpolationIEsettovalueTrue.Otherwisethe
valueissettoFalse.
E-DPDCH Power InterpolationIEwithstatusofTrueorFalseisalwayssignaledtothe
UEs,thatsupportE-DPDCHpowerinterpolationinASU,whenE-DPCCH InfoIEissent
inreconfigurationRRCmessages(nomatterifE-DPDCHpowerinterpolationisenabled
inRNCornot).

RadioLinkReconfigurationrelatedtoE-DPDCHpowerinterpolation
TheE-DCHradiolinkreconfigurationisindicatedbyNBAP:RadioLinkReconfiguration
PrepareandRNSAP:RadioLinkReconfigurationPreparemessagestotherelevant
radiolinks(cellsbelongingtotheActiveSet)inthefollowingcases:

142 DN70303923 Issue:06B


WCDMARANRRMHSUPA Radiobearer,transportchannelandphysicalchannel
parameters

WhenthecriteriaindicateachangeinapplyingtheE-DPDCHpowerinterpolationin
theActiveSet,theActiveSetupdateismadebyusingtheRRC:ActiveSetUpdate
procedureandmessage.
WhenthedataratechangeinsideTTI(either2msTTIor10msTTI)takesplace,the
E-DPDCHpowerinterpolationrelatedamplituderatiosareindicatedtotheUEby
usingtheRRC:PhysicalChannelReconfigurationprocedureandmessage.
Whentheswitchbetween2msTTIand10msTTItakesplace,theE-DPDCHpower
interpolationrelatedamplituderatiosareindicatedtotheUEbyusingtheRRC:
TransportChannelReconfigurationprocedureandmessage.

8.11 DynamicHSUPApoweroffsets
Thestaticpoweroffsetsareoptimizedforhighbitdatarates(HSUPApeakrates).The
poweroffsetsaretoohighforlowbitrates(lowbitratesareusedwithlargenumberof
HSUPAusers).Alsothethroughputispooronthecelledge.Optimizationofthepower
offsetsisnotpossibleforbothhighandlowbitratessimultaneouslywhentheE-DPDCH
powerextrapolationmethodisused.TheDynamicHSUPApoweroffsetsareusedforthe
UEsthatdonotsupportE-DPDCHpowerinterpolation.Thereforetwosetsofpower
offsetsareimplemented:

onenewsetforlowbitrates
anotherset(existingvalues)forhighbitrates

Thisfunctionalityispartofbasicsoftware(BSW)inRadioNetworkController.
Whenthepoweroffsetsoptimizedforlowbitratesisselected,themaximumtotaluplink
symbolrateoftheE-DPDCH(s)oftheUEdoesnotexceedthevalueof3840kbit/s.That
meansthemaximumsetthatcanbeusedis2*SF2(set2*SF2+2*SF4isforbidden).
Thedeterminationofusedpoweroffsetsisperformedinthefollowingcases:

E-DCHsetup
RBsetupforNRT
RBsetupforRT/PSstreaming
RBsetupforRT/CSvoiceoverHSPA
switchfrom2msTTIto10msTTI
switchfrom10msTTIto2msTTI
RBreleaseofPSstreaming
RBreconfigurationduetobranchadditionifalsoHSUPAmodificationtakesplace
RBreconfigurationduetobranchdeletion
servingcellchange

ThedecisionofusedpoweroffsetisbasedontheUEmeasurement(RSCPorEcNo)
andonthenumberofHSPAusersintheHSPAservingcell.

8.11.1 Selectionofhigh/lowbitrateoptimizedHSUPApower
offset
ThedeterminationoftheuseofhighorlowbitrateoptimizedHSUPApoweroffsetis
basedonUEreport(RSCPorEcNo)andnumberofHSPAusersintheHSPAserving
cell.TheloadoftheULDCH,definedintheHSUPAdynamicpoweroffsetalgorithm

Issue:06B DN70303923 143


Radiobearer,transportchannelandphysicalchannel WCDMARANRRMHSUPA
parameters

takesintoaccountRel99loadofULDCHchapter,alsohastobetakenintoaccount.If
reportedbytheUE,theRSCPisusedindeterminingtheuseofhighorlowbitrate
optimizedHSUPApoweroffset.Otherwise,theEcNoisused.
BasedonUEreportedvalueandthenumberofHSPAusersinHSPAservingcell,the
useofhighorlowbitrateoptimizedHSUPApoweroffsetisdeterminedfromtheconstant
tabledefinedby:

DynPwrOffsetTable2for2msTTI
DynPwrOffsetTable10for10msTTI

IncasethereisnopureE-TTI=2msorE-TTI=10msusersinthecell,theuseofhighor
lowbitrateoptimizedHSUPApoweroffsetforE-DCHusers(regardlessoftheusedE-
TTI)isadditionallydeterminedfromtheconstanttabledefinedbythe
DynPwrOffsetTable10Mix.
Wheneveroneofthevaluesreadfromthetwodifferenttables(mixedandE-TTIspecific)
islow,thelowvalueisused.ThenumberofHSPAusersusedforreadingisasumof
HSPAuserswithE-TTI=10ms,HSPAuserswithE-TTI=2ms,andEquivalentHSPA
users.EquivalentHSPAusersaredefinedinHSUPAdynamicpoweroffsetalgorithm
takesintoaccountRel99loadofULDCHchapter.
IncasethedeterminednumberoftheHSPAusersintheHSPAservingcelliszero,the
useofhighorlowbitrateoptimizedHSUPApoweroffsetisdeterminedfromthetable
definedbythepreviouslymentionedparameters.
WhenaRTHSUPARB(PSstreamingorCSvoiceoverHSPA)isamongRABsmapped
toE-DCH,thelowvalues(lowindication)areused.Inthiscase,theRSCP/EcNoand
numberofHSPAusersisnotusedforindicatingthehighorlowvalues.
TheuseofhighorlowbitrateoptimizedHSUPApoweroffsetsperRSCP/EcNoand
numberofHSPAusersareintroducedinthefollowingtables:

Table 14 FixedtableDynPwrOffsetTable10

RSCP(dBm) EcNo(dB) High/Lowindication

<-108 <-14 L L L L L L

-105...-108 -13...-14 L L L L L L

-101...-104 -11...-12 L L L L L L

-98...-100 -10 L L L L L L

-95...-97 -9 H H L L L L

>-95 >-9 H H L L L L

Amountofusers 0-5 6-10 11-15 16-25 26-40 >40

144 DN70303923 Issue:06B


WCDMARANRRMHSUPA Radiobearer,transportchannelandphysicalchannel
parameters

Table 15 FixedtableDynPwrOffsetTable2

RSCP(dBm) EcNo(dB) High/Lowindication

<-108 <-14 L L L L L L

-105...-108 -13...-14 L L L L L L

-101...-104 -11...-12 L L L L L L

-98...-100 -10 H H L L L L

-95...-97 -9 H H H L L L

>-95 >-9 H H H L L L

Amountofusers 0-1 2-3 4-6 7-12 13-20 >20

Table 16 FixedtableDynPwrOffsetTable10Mix

RSCP(dBm) EcNo(dB) High/Lowindication

<-108 <-14 L L L L L L

-105...-108 -13...-14 L L L L L L

-101...-104 -11...-12 L L L L L L

-98...-100 -10 L L L L L L

-95...-97 -9 H H L L L L

>-95 >-9 H H L L L L

Amountofusers 1 2 3-4 5-7 8-10 >10

where:
H=Highbitratepoweroffsetvaluesthatshouldbeused
L=Lowbitratepoweroffsetvaluesthatshouldbeused

8.11.2 AdditionalthresholdforDynamicHSUPAPowerOffsets
duetonumberofHSPAusers
TheDynamic HSUPA Power OffsetsfeaturetakesintoaccountnumberofHSPAusersin
thecell(HSPAuserswithE-TTI=10ms,HSPAuserswithE-TTI=2ms,andEquivalent
HSPAusers).By002:1903 RN60_MAINT_27PRFILEparametertheoperatorcanset
athresholdfornumberofHSPAusers.

Issue:06B DN70303923 145


Radiobearer,transportchannelandphysicalchannel WCDMARANRRMHSUPA
parameters

ThethresholddefineshowmanyHSPAusersinthecellcanexistbeforethenumberof
HSPAuserscantriggerlowbitrateoptimizedHSUPApoweroffsetsduetonumberof
HSPAusersinthecell.AslongasthetotalnumberofHSPAusersinthecellisbelow
thedefinedthreshold,thenonlyCPICHRSCPorCPICHEcNoreportedbytheUEis
takenintoaccountinthealgorithmofDynamicHSUPAPowerOffsetsandmaytrigger
lowbitrateoptimizedHSUPApoweroffsets.
Defaultvalueofthe002:1903 RN60_MAINT_27PRFILEparameteris0H,which
meansthethresholdisnotinuse.Rangeoftheparameterisfrom0x01Hto0x7FH(in
decimal,1to127)HSPAservingcellusersinthecell.
Toactivatethethreshold,002:1903 RN60_MAINT_27PRFILEparameterneedsbe
configuredtosomeothervaluethan0H.
Todeactivatethethreshold,002:1903 RN60_MAINT_27PRFILEparameterneedsto
beconfiguredbacktodefaultvalue0H.

8.11.3 HSUPAdynamicpoweroffsetalgorithmtakesintoaccount
Rel99loadofULDCH
HSUPAdynamicpoweroffsetalgorithmtakesintoaccounttheRel99loadofULDCHof
thecell.
Rel99loadofULDCHofthecellisscaledtomatchtheHSPAusers.Anequivalentvalue
intermsofthenumberofHSPAusersisdeterminedfromtheRel99loadoftheULDCH
bythefollowingequation:

Where:
LDCH,CELListheULDCHloadfactorofthecell.Formoreinformation,seeWCDMA RAN
RRM Admission Control.LDPDCH_AMR_12.2NBistheloadfactorof12.2kbit/sAMRusedas
areferencecallforscalingtheULDCHloadofthecelltoanequivalentloadcausedby
HSPAcallintheUL.
HSUPAdynamicpoweroffsetalgorithmaffectstheselectionofthemaximumtotaluplink
symbolrateoftheUEsE-DPDCH(s).Thealgorithmisrun,supportingalltheUEs,and
usingHSUPAregardlessoftheUErelease.
Ifthesystemhasdecidedtouselowbitratevalues,thenthemaximumtotaluplink
symbolrateoftheUEsE-DPCH(s)shouldnotbehigherthan3840kbit/s(2*SF2).That
means,themaximumsetthatcanbeusedis2*SF2(set2*SF2+2*SF4isforbidden).

146 DN70303923 Issue:06B


WCDMARANRRMHSUPA RLClayerconfiguration

9 RLClayerconfiguration

g NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.

WhenPSstreamingorinteractiveandbackgroundradioaccessbearersaretransferred
withtheHSPA,thetransfermodeoftheRLCsistheacknowledgedmode(AM)fortheir
radiobearers.
TheretransmissionparametersoftheAMRLCsareconfigurablewithaparticularsetof
themanagementparameters.Althoughonlyafixedsetofthepollingandstatusreporting
triggersoftheAMRLCcanbeusedwithHSUPA,thevaluesofquantitativetriggersand
timersarechangeable.
TheRNCimplementsanalgorithm,analgorithmthatenablesthedynamicdefinitionof
thetransmissionandreceivingwindowsizesfortheAMRLCentitiesinaccordancewith
theRLCbufferingcapabilityoftheUEandusedradiobearerdatarates.Thealgorithm
allowsusingeventhewholeRLCbufferingcapabilityoftheUEtobeemployedforeach
transferdirectiontomaximizetransmissionwindowsizes.Theoperatorisprovidedwith
themeanstocontrolthealgorithmwithasetofmanagementparameters.
ManagementparametervaluesareappliedwhentheAMRLCentityiscreatedorthe
retransmissionparametersoftheentityaremodified.Modificationofthemanagement
parametersvaluesisnotasufficientreasonforthereconfigurationoftheAMRLC
entities.
RetransmissionparametersoftheAMRLCentityemployedforthereverseRBthat
transfersdataintheHS-DSCHconfigurationareintroducedinWCDMA RAN RRM
HSDPA.RetransmissionparametersoftheAMRLCentityemployedfortheRBthat
transfersdataintheDCH,FACHorRACHconfigurationareintroducedinWCDMA RAN
RRM Admission Control.Theretransmissionparametersmaydifferinthedifferent
transportchannelconfigurations,andthereforemayneedtobeupdatedifthe
configurationsaremodified.

9.1 RetransmissionparametersofAMRLC
Highpeakdataratesandlargevariationsinthedataratesofthenon-realtimeradio
bearersaretypicalfortheHSPA.Highdatarateincreasestheprobabilityintheblocking
oftheRLCtransmissionwindow.Dataratedependentpollingandstatusreporttriggers
areusedtominimizetheblockingprobability.Theproblemwiththedataratedependent
triggersisthatifthedatarateistemporarilydecreasedand,forinstance,ifanRLC
statusreportislost,theRLCretransmissionofalostAMDPDUisdelayed,whichcan
significantlydelaythedeliveryoftheRLCSDUtothehigherlayersforitsparts.Timer-
basedpollingandstatusreportingprovidesamechanismtorecoverfromtheloststatus
reportswithinacontrolledtimeperiod;timer-basedpollingguaranteesaminimumpolling
frequencyalsowithlowdatarates.
TheoperatorisabletomanageAMRLCretransmissionparameterswithasetof
parametersbelongingtothefollowingparameterstructures:

PSinteractiveandbackgroundbearers:AM RLC configuration for PS NRT with E-


DCH(AMRLCOnEDCHOfNRTPS).

Issue:06B DN70303923 147


RLClayerconfiguration WCDMARANRRMHSUPA

PSstreamingbearers:AMRLCconfigurationforPSstreamingwithE-DCH
(AMRLCOnEDCHOfStrPS)

ThetableTable17:UsedpollingandstatusreportingtriggersfortheAMRLCsofthe
bearerssummarizestheusedpollingandstatusreportingtriggersfortheAMRLCsof
thebearers,whicharetransferredintheE-DCHconfiguration.

Table 17 UsedpollingandstatusreportingtriggersfortheAMRLCsofthebearers

Pollorstatus Supportin Triggerused Definition Configuration
reporttrigger RNC(Yes,No) (Yes,No) methodforthe ofthevalue
trigger

Timerpoll Yes Yes Management Valueofthe


periodic parameter timer
changeable

Timerstatus Yes No Management Unchangeable


periodic parameter

Timerpoll Yes No Management Unchangeable


parameter

PollPDU Yes Yes Setinternallyby Minimumvalue


analgorithm ofthePoll_PDU
changeable

No Management Unchangeable
parameter

PollSDU Yes Yes Setinternallyby Unchangeable


analgorithm

No Management Unchangeable
parameter

MissingPDU Yes Yes Management Unchangeable


detection parameter

Timerstatus Yes Yes Management Valueofthe


prohibit parameter timer
changeable

Timerpoll Yes No Management Unchangeable


prohibit parameter

Last Yes Yes Management Unchangeable


transmission parameter
PDUpoll

Last Yes Yes Management Unchangeable


retransmission parameter
PDUpoll

148 DN70303923 Issue:06B


WCDMARANRRMHSUPA RLClayerconfiguration

Table 17 UsedpollingandstatusreportingtriggersfortheAMRLCsofthebearers
(Cont.)

Pollorstatus Supportin Triggerused Definition Configuration
reporttrigger RNC(Yes,No) (Yes,No) methodforthe ofthevalue
trigger

PollWindow Yes No Management Unchangeable


parameter

ThevaluesofthecolumnTrigger usedaredefinedwiththeselectorsofthemanagement
parametersAM RLC status report triggers for PS NRT with E-
DCH(AMRLCOnEDCHOfNRTPSTriggers)andAM RLC status report triggers for PS
streaming with E-DCH(EDCHStrPSTriggers).Thevaluesoftheselectorscannotbe
modifiednow.Thismeansthatareducednumberofthetriggersandtimerscanbe
configuredfortheAMRLCentities.Itguaranteesthatonlytestedconfigurationsare
usedfortheRLC.Therearemanagementparametersthatenabletheoperatortomodify
thevaluesoftheusedtriggersandtimers.
Notethatitisstronglyrecommendedthatthevaluesofthemanagementparameters
shouldnotbemodifiedintheworkingradionetworkwithoutknowingtheconsequences
ofthenewvaluesinthedatatransferandthesignalprocessingloadofRNC,thatis,
withouttestingthembeforehandinaseparatetestnetwork.

AMRLCroundtriptime
Theminimumpollingfrequencyisdeterminedbydefiningfirsttheaverageroundtrip
time(RTT)forthesignalingbetweentheAMRLCentitiesintheUEandtheRNC.AM
RLCRTTisusedtoestimatetheaverageresponsetimefromthemomentwhentheAM
RLCentitysendsanAMDPDUtoitspeerentitywiththepollbitset,tothereceiving
momentofthecorrespondingstatusPDU.RTTdependsontheL1/L2processingdelay
oftheUEandtheRNC,processingdelayofBTS,Uuinterfacedelay,andtheIub
transferdelay.
ThevalueoftheAMRLCroundtriptimeisdefinedwiththeAMRLCRespTimeEDCH
managementparameter;itisthevalueoftheRTTfortheuplinkdatatransferwhenthe
radiobearerismappedtotheE-DCH,andthereversetransportchannelistheHS-
DSCH.

Minimumpollingandstatusreportingfrequency
IfoneormoreofthethreeAMRLCtimers,Timer_poll_periodicorTimer_pollintheRLC
entityoftheUE,orTimer_status_periodicintheRLCentityoftheRNC,areused,they
equalthevaluedefinedwiththeAMRLCstatusperiodmaxforPSNRTwithE-DCH
(AMRLCOnEDCHOfNRTPSPeriodMax),orAMRLCstatusperiodmaxforPSstreaming
withE-DCH(EDCHStrPSPeriodMax)managementparameter.Thevaluerepresents
themaximumstatusreportingperiodoftheAMRLCentities;itisdefinedinrelationto
theAMRLCroundtriptime.Ifthevalueofthemaximumstatusreportingperiodofthe
AMRLCparameterismax,andthevalueoftheAMRLCRespTimeEDCHparameteris
TRTT,theabsolutevalueforthetimersbecomesequaltotheproductmaxTRTT.

Issue:06B DN70303923 149


RLClayerconfiguration WCDMARANRRMHSUPA

TheuseoftheRLCtimersTimer_poll_periodic,Timer_pollandTimer_status_periodicin
E-DCHconfigurationisdefinedwiththeselectorsTimer poll periodic,Timer polland
Timer status periodicoftheAMRLCOnEDCHOfNRTPSTriggers,or
EDCHStrPSTriggersmanagementparameter.Theselectorvaluesarecurrently
unchangeable,andtheirvaluesaresetsothattheTimer_poll_periodicisalwaysusedin
theE-DCHconfiguration,theothersarenotused.

Algorithmtosetthedataratedependentpollingtriggers
ThedataratedependentpollingtriggerPoll every Poll_PDU PDUorPoll every Poll_SDU
SDUcanbesetintheRLCentityofUEwiththefollowingalgorithm.
AssumingthatatleaststatusAMRLCstatusreportsareexpectedtobereceivedduring
theAMRLCtransmissionwindow,thepollingperiodshouldconformtothevalueofthe
quantityTexpected:

Figure 68 ExpectedAMRLCstatusreportingperiodforE-DCH

ThevalueofstatusismanagedwiththeAM RLC status reports count for PS NRT with


E-DCH(AMRLCOnEDCHOfNRTPSCount),orAM RLC status reports count for PS
streaming with E-DCH(EDCHStrPSCount)parameter.QuantityTxWs(Byte)isthesize
ofthetransmissionwindowoftheRLCentityinUE.Rmaxisthemaximumuserdatarate
oftheULRB.ThevalueoftheRmaxisdefinedwiththeequation:

Figure 69 MaximumE-DCHuserdatarateoftheAMRLCforMAC-es

Figure 70 MaximumE-DCHuserdatarateoftheAMRLCforMAC-is

ForMAC-es,theRMAC-e,EDCHisthemaximumE-DCHbitrateofthebearer;formore
information,seeConfigurationoftheMAClayer.SAMDPDUisthesizeoftheAMDPDUin
theuplinktransferdirection.HMAC-e/esisthesizeoftheMAC-e/esheaderequalto18
bits.
ForMAC-is,theRMAC-i,EDCHisthemaximumallowedE-DCHbitrate(transmissionbit
rateonE-DCH).SPDUisthepayloadsizeoftheAMDPDUinULtransferdirection.
SAMDPDUisthesizeoftheAMDPDU(bothheaderandpayload)inULtransferdirection.
HSS+TSNisthesizeofSSandTSNinMAC-isheader,totalsizeisonebyte(8bits).
HLCHid+L+FisthesizeofLCH-ID,LengthandFlaginMAC-iheader,totalsizeistwobytes
(16bits).

150 DN70303923 Issue:06B


WCDMARANRRMHSUPA RLClayerconfiguration

IfthevalueoftheSatelliteIubUsagemanagementparameterequals'Disabled',then
TIubisequaltoTRTT.IfthevalueoftheSatelliteIubUsagemanagementparameter
equals'Enabled',thentheTIubisequaltothevaluetheAMRLCRTTPollPDUSatellite
managementparameter.
ThemaximumvaluewhichRmaxcantakeintheformulaequalsTxWs(Byte)*8/TRTT.

IftheRABusestheUMRB,thentheSPDUisthepayloadsizeoftheULUMDPDUand
theSAMDPDUisthesizeofUMDPDU.

Iftheexpected status reporting periodTexpectedissmallerthanthemaximumstatus


reportingperioddefinedwiththeproductmaxTRTT,theadmissioncontroldefinesthe
quantity#Poll_Bytewiththefollowingequation:

Figure 71 ValueofAMRLC#Poll_ByteforE-DCH

Figure 72 ValueofAMRLC#Poll_PDUforE-DCH

NPollPDUisthevaluevalue(%)ofthemanagementparameter
AMRLCOnEDCHOfNRTPSPollPDU.ForfixedULRLCtheMaxPDUPayloadSizeiseither
320bitsor640bits(640forHSUPA16QAM).ForflexibleULRLCthe
MaxPDUPayloadSizeisdeterminedwiththefollowingequation:

Figure 73 MaxPDUPayloadSize

WhereMaxSizeisdefinedbytheMaxULRLCPDUSizeparameter.
RLCreceiveroftheRNCisconfiguredtousethepolltriggerPoll every Poll_PDU PDU
andthevalueofthePoll_PDUequalsto#Poll_PDU.IfTexpectedisnotsmallerthan
maxTRTTthenthePoll every Poll_PDU PDUisdeactivatedwithnon-modifiable
parameter(thatis,onlyperiodicalpollingisused).
ThesizeofthetransmissionwindowoftheRLCentityinUE,denotedwithTxWs(Byte),
iscalculatedasdefinedinexistingprocedure.Incalculationthefollowingchangesto
existingfactorsoftheformulaaretakenintoaccount:

ThefeasiblelowerlimitofthetemporaryPDUsizeSminPDU,kistheminimumsizeof
theAMDPDUsinthetransferdirectionoftheRBwithouttheAMDPDUheaderpart
andthevalueisdefinedasfollows:
ForflexibleULRLCPDUsize:

Issue:06B DN70303923 151


RLClayerconfiguration WCDMARANRRMHSUPA

MinSizeisdefinedbytheMinULRLCPDUSizeparameter.
ForfixedULRLCPDUsize:
TheSminPDU,kequalstothefixedULRLCPDUpayloadsizethatis320bitsor
640bitsforHSUPA16QAM.

ThefeasibleupperlimitSmaxPDU,kisthemaximumsizeoftheAMDPDUsinthe
transferdirectionoftheRBwithouttheAMDPDUheaderpartandthevalueis
definedasfollows:
ForflexibleULRLCPDUsize:
whenMaxULRLCPDUSizeisgreaterthan128

otherwise

MaxSizeisdefinedbyparameterMaxULRLCPDUSize(headerwithlength
indicatorisincluded).For15-bitlengthindicatortheheadersizeis4octets(32
bits)andfor7-bitlengthindicator3octets(24bits).
ForfixedULRLCPDUsize:
TheSmaxPDU,kissetequaltoSminPDU,k.

WhenflexibleULRLCPDUsizeisapplied,themaximumvalueofTxWs(Byte) tobe
indicatedfromRRMtoL2RLCentityis200270bytes.Thisvaluedeterminesthesizeof
thereceiverRLCwindow.EveniftheTxWswindowsizeinamountofPDUsis2047(as
indicatedtoUEandRLCentities)thewindowsizeinRNCindicatedbyTxWs(Byte)is
limitedbecauseofmemoryconsumption.WhenflexibleULRLCPDUsizeisused,the
HSUPS16QAMusedwith2msTTIisthebasisindeterminingthereceiverRLCwindow
size.WithHSUPA16QAMmaximumuserbitrate11444kbit/sandusedtimevalueof
140ms(RTTvalueof100ms+prohibittimeof40ms),therequiredreceiverRLCwindow
sizeinbytesis11444kbit/s*0.140s/8=200270Bytes.
TheamountofmaximumsizeFlexibleRLCPDUs(1505bytes)fittingtoreceiverRLC
windowinL2entityis140piecesifPDUsizeissmallerthantheamountofPDU(max
PDUamountis2047asdefinedbyTxWswindowsize).
IncaseofflexibleULRLCPDUsize,astheRMAC,EDCHisindicatingthemaximum
allowedE-DCHbitrate,thefollowingfactorsarealsodefinedforthemaximumE-DCH
bitrate:

TheSPDUisthepayloadsizeoftheULAMDPDU.
TheSAMDPDUisthesizeoftheAMDPDUwithheaderpartaddedtothepayload
size.

Thesizesofthefactorsareindicatedinbitsinthefollowingtable:

152 DN70303923 Issue:06B


WCDMARANRRMHSUPA RLClayerconfiguration

Table 18 SPDUandSAMDPDUsizesinflexibleULRLCcase

TTI SFset SPDU SAMDPDU

2ms 2*SF2+2*SF4with 22936 23000


HSUPA16QAM

2ms 2*SF2+2*SF4 11464 11496

2ms 2*SF2withmaxsymbol 5736 5768


rate5760kbit/s

2ms 2*SF2 3960 3992

2ms 2*SF4 2696 2728

2ms SF4 1368 1400

10ms 2*SF2(*) 19936 20000

10ms 2*SF4 14392 14456

10ms SF4 6928 6960

(*)NotethatFlexibleRLCinULisnotsupportedwith2*SF2whenE-TTI=10ms.
WhentheE-DCHbitrateislimitedto2Mbit/sincaseof2msTTI(becauseadditional
poweroffsetisinuse),theSPDUis3936bitsandtheSAMDPDUis3968bits.

WhenthereistwoRLCPDUsinoneFPframe(2msTTIHSUPA16QAM,10msTTI
2*SF2,and2msTTI2*SF4)theSPDUandSAMDPDUaresumsoftwoRLCPDUsizes.

IncaseoffixedULRLCPDUsize:

TheSPDU(thepayloadsizeoftheULAMDPDU)is320bitsor640bitswithHSUPA
16QAM.
TheSAMDPDUisthesizeoftheAMDPDUwithheaderpartaddedtothepayloadsize
(16bitsforheader),thatis336bitsor656bitsforHSUPA16QAM.

ThemaximumvalueofPoll_PDUthatcanbesignaledtotheUEwiththeRRC
messagesis128:

IftheproducedvalueofthePoll_PDUisnothigherthan128,theSRNCconfigures
theRLCentityoftheUEtousethepolltriggerPoll every Poll_PDU PDU.Thevalue
Poll_PDUisroundeduptotheclosestvalueallowedintheRRCsignaling,andisnot
higherthanSTxWs.
IftheproducedvalueofthePoll_PDUishigherthan128,admissioncontroldefines
thequantityPoll_SDUwiththefollowingequation:

Issue:06B DN70303923 153


RLClayerconfiguration WCDMARANRRMHSUPA

Figure 74 ValueofAMRLC_SDUforE-DCH

SSDUequalsthevalueoftheattributeMaximum SDU sizeoftheRAB.

IfPoll_SDUishigherthan128intermsofthenumberoftheAMDPDUs,theSRNC
configurestheRLCentityoftheUEtousethepolltriggerPoll every Poll_SDU SDUwith
thevaluePoll_SDU;otherwise,theSRNCconfigurestheRLCentityoftheUEtousethe
polltriggerPoll every Poll_PDU PDUsettingthevalueofthePoll_PDUequalto128.
IftheexpectedstatusreportingperiodTexpectedisnotsmallerthanthemaximumstatus
reportingperiodmaxTRTT,thealgorithmsetsneitherthedataratedependpolling
triggersPoll every Poll_PDU PDUnor Poll every Poll_SDU SDU.
TheuseofthealgorithmisdefinedwiththeselectorExpectedstatusreportingperiodof
themanagementparameterAMRLCOnEDCHOfNRTPSTriggersor
EDCHStrPSTriggers.Theselectorvalueiscurrentlyunchangeable;thealgorithmis
usedintheE-DCHconfiguration.

Maximumpollingandstatusreportingfrequency
TheminimumperiodisdefinedfortheRLCpollingandstatusreportingtocontrolthe
statusreportingfrequency,andtoreducetheamountofthemultipleretransmissionsof
anunsuccessfullytransmittedAMDPDU.TheminimumperiodisdefinedwiththeAM
RLC status period min for PS NRT with E-DCH(AMRLCOnEDCHOfNRTPSPeriodMin)
managementparameterorAM RLC status period min for PS streaming with E-
DCH(EDCHStrPSPeriodMin):

Timer_poll_prohibitissettothevalueoftheAMRLCOnEDCHOfNRTPSPeriodMinor
EDCHStrPSPeriodMinparameterintheRLCentityofUEifithasbeenactivated
withtheselectorTimer_poll_prohibitoftheAMRLCOnEDCHOfNRTPSTriggersor
EDCHStrPSTriggersparameter.Theselectorvalueiscurrentlyunchangeable;the
timerisnotusedintheE-DCHconfiguration.
Timer_status_prohibitissettothevalueoftheAMRLCOnEDCHOfNRTPSPeriodMin
orEDCHStrPSPeriodMinparameterintheRLCentityoftheSRNCifithasbeen
activatedwiththeselectorTimerstatusprohibitofthe
AMRLCOnEDCHOfNRTPSTriggersorEDCHStrPSTriggersparameter.Selector
valueiscurrentlyunchangeable;thetimerisusedintheE-DCHconfiguration.

Othermethodstosetthepollingandstatusreportingtriggers
ThesenderoftheRLCentityinUEisconfiguredasfollows:

PollingtriggerPoll_PDUissettothevalueoftheAM RLC period Poll_PDU for PS


NRT with E-DCH(AMRLCOnEDCHOfNRTPSPollPDU)orAM RLC period Poll_PDU
for PS streaming with E-DCH(EDCHStrPSPollPDU)parameterifthetriggerhas
beenactivatedwiththeselectorPoll_PDUofthe
AMRLCOnEDCHOfNRTPSTriggersorEDCHStrPSTriggersparameter,unlessit
hasalreadybeengivenavaluewiththealgorithmExpectedstatusreportingperiod.
ValueoftheselectorPoll_PDUiscurrentlyunchangeable;triggerisnotsetforthe
E-DCHconfigurationwiththemanagementparameter.

154 DN70303923 Issue:06B


WCDMARANRRMHSUPA RLClayerconfiguration

PollingtriggerPoll_SDUissettothevalueoftheAM RLC period Poll_SDU for PS


NRT with E-DCH(AMRLCOnEDCHOfNRTPSPollSDU)orAM RLC period Poll_SDU
for PS streaming with E-DCH(EDCHStrPSPollSDU)parameterifthetriggerhas
beenactivatedwiththeselectorPoll_SDUofthe
AMRLCOnEDCHOfNRTPSTriggersorEDCHStrPSTriggersparameter,unlessit
hasalreadybeengivenavaluewiththealgorithmExpectedstatusreportingperiod.
ThevalueoftheselectorPoll_SDUiscurrentlyunchangeable;thetriggerisnotset
fortheE-DCHconfigurationwiththemanagementparameter.
PollingtriggerPoll_WindowissettothevalueoftheAM RLC period Poll_Window for
PS NRT with E-DCH(AMRLCOnEDCHOfNRTPSPollWindow)orAM RLC period
Poll_Window for PS streaming with E-DCH(EDCHStrPSPollWindow)parameterif
thetriggerhasbeenactivatedwiththeselectorPoll_windowofthe
AMRLCOnEDCHOfNRTPSTriggersorEDCHStrPSTriggersparameter.Thevalue
oftheselectoriscurrentlyunchangeable;thetriggerisnotusedwiththeE-DCH
configuration.
PollingtriggersLast transmission PDU poll and Last retransmission PDUpollcanbe
setseparatelywithtwoselectorsLasttransmissionPDUpollandtheLast
retransmissionPDUpolloftheAMRLCOnEDCHOfNRTPSTriggersor
EDCHStrPSTriggersparameter.Thevaluesoftheselectorsarecurrently
unchangeable;thetriggersarebothusedwiththeE-DCHconfiguration.

ThereceiveroftheRLCentityinRNCisconfiguredasfollows:

StatusreporttriggerMissing PDU indicatorissetifthetriggerhasbeenactivated


withtheselectorMissingPDUindicatoroftheAMRLCOnEDCHOfNRTPSTriggersor
EDCHStrPSTriggersparameter.Thevalueoftheselectoriscurrently
unchangeable;thetriggerisusedwiththeE-DCHconfiguration.ThemissingPDU
indicationisusedforfasterindicationofthelostAMDPDUsandforfasterrecovery
fromthelostpolling.

OperationmodesoftheSDUdiscardfunction
ForAMRLCsofPSinteractiveandbackgroundbearerstransferredintheE-DCH
configuration,Timer based SDU discard with explicit signallingisnotemployed.SDU
discard after MaxDAT number of transmissionsandNo_discard after MaxDAT number of
transmissionsareboththeimplementedmodesinRNC.SDU discard after MaxDAT
number of transmissionsisusedifthemodehasbeenactivatedwiththeselectorSDU
discardafterMaxDATtransmissionsoftheAMRLCOnEDCHOfNRTPSTriggers
managementparameter;otherwise,themodeNo_discard after MaxDAT number of
transmissionsisused.Thevalueoftheselectoriscurrentlyunchangeable;thetriggeris
setsothatthesecondmodeisused.
ForthePSstreamingbearer,theTimer based SDU discardcanbeused.Inthiscase,
theRLCentityoftheRNCisconfiguredwiththevalueTdiscardoftheRLCtimer
Timer_discardachievedfromthefollowingequation:

Figure 75 TimerbasedSDUdiscardconfiguration

Rgisthevalueoftheguaranteedbitrateinuplink,SSDUisthevalueofthemaximum
SDUsizeinbits,andTRABisthevalueofthetransferdelay.Allthreeparametersare
includedintheRABattributes.TDisc,offsetisthevalueofthe

Issue:06B DN70303923 155


RLClayerconfiguration WCDMARANRRMHSUPA

AMRLCOnEDCHOfStrDiscardTimemanagementparameter.Discardedtimevalues
signaledtotheRLCentitiesofUEandRNCareroundedasdescribedinthedefinitionof
theAMRLCOnEDCHOfStrDiscardTimeparameter.
ThevalueoftheMaxMRW RLCparameterissettothevalueoftheAM RLC MaxMRW
transmissions for PS NRT with E-DCH(AMRLCOnEDCHOfNRTPSMaxMRW)orAM RLC
MaxMRW transmissions for PS streaming with E-DCH(EDCHStrPSMaxMRW)
managementparameter.TheRLCparameterissignificantonlyiftheSDU discard after
MaxDAT retransmissionsisapplied.
ThevalueoftheRLCtimerTimer_MRWissettothevalueoftheproductmaxTRTT,if
theSDUdiscardafterMaxDATretransmissionsisapplied.
ThevalueoftheMaxDAT RLCparameterissettothevalueoftheAM RLC MaxDAT
transmissions for PS NRT with E-DCH(AMRLCOnEDCHOfNRTPSMaxDAT)orAM RLC
MaxDAT transmissions for PS streaming with E-DCH(EDCHStrPSMaxDAT)
managementparameter.
ThevalueoftheMaxRST RLCparameterissettothevalueoftheAM RLC maxRST
transmissions for PS NRT with E-DCH(AMRLCOnEDCHOfNRTPSMaxRST)orAM RLC
maxRST transmissions for PS streaming with E-DCH(EDCHStrPSMaxRST)management
parameter.
ThevalueoftheRLCtimerTimer_RSTissettothevalueoftheproductmaxTRTT.

TheretransmissionparametersoftheAMRLCentitiescanbedifferentinthevarious
transportchannelconfigurations,andthereforepossiblyneedanupdateifthetransport
channelconfigurationsaremodified.TheparametersoftheAMRLCentityemployedfor
theRBtransferringdataintheDCHorFACHorRACHconfigurationareintroducedin
ParametersinWCDMA RAN RRM Admission Control.Theretransmissionparametersof
theAMRLCentityemployedforthereverseRB,whichistransferringdataintheHS-
DSCHconfiguration,areintroducedinHSDPAphysicalchannel,transportchannel,radio
bearerandRLCconfigurationinWCDMA RAN RRM HSDPA.

9.2 TransmissionandreceivingwindowsofRLC
TheRNCimplementsanalgorithmthatenablesthedynamicdefinitionofthe
transmissionandreceivingwindowsizesfortheAMRLCentitiesinaccordancewiththe
RLCbufferingcapabilityoftheUEandusedradiobearerdatarates.Theoperatoris
providedwithmeanstocontrolthealgorithmwithmanagementparameters.
EspeciallywhenabearertransfersdataintheHS-DSCH/E-DCHconfiguration,thedata
ratescanbehighineitherofthetwotransferdirections,andalsovarybetweenthe
uplinkanddownlink;actualdatatransferdirectionisnotnecessarilyevenknownwhen
thetransportchannelresourcesareallocatedfortheRAB.Thetransmissionand
receivingwindowsareallocatedsothatthewindowsaretogethertakingjustthesizeof
theRLCbuffer,whichtheUEhasreporteditscapability.Thecapabilityislimited,and
thereisariskthatthetransmissionwindowofthedatatransferdirectionbecomesfull
whilethetransmissionwindowoftheoppositedirectionisalmostempty.
TheUEmemoryisdynamicallysharedbytheRLCAMentitiesandtheMAC-hs
reorderingentitiesatanytime.TheUEisabletoevaluateitsconsumption.REL-06
3GPPspecifications25.321and25.322ofMACandRLCspecifyhowUEshould
consideritselfandwhatmeasurementstheUEshouldtakeinamemoryshortage

156 DN70303923 Issue:06B


WCDMARANRRMHSUPA RLClayerconfiguration

situationwhentheamountofstoredAMRLCPDUsandMAC-hsPDUsexceedsits
capability.ThisabilityoftheUEenablestheRNCtooverbooktheRLCbufferoftheUE
whentheRNCisallocatingthetransmissionandwindowsizesforUEsAMRLCentity.
AdmissioncontroloftheSRNCdefinesthemaximumAMRLCbufferoftheUEandwhat
admissioncontrolcanbeusedintheallocationofthetransmissionandreceiving
windows.ThemaximumbuffersizesaremappedfromtheTotal RLC AM and MAC-hs
buffer sizeinformationreportedbytheUE.ThemaximumAMRLCbufferisdefined
separatelyforeachreportedvalueof50,100,150,and200Kbytesusingfour
parametersofthemanagementparameterstructureAM RLC maximum buffer allocation
for UE(AMRLCMaximumBufferUE)inthemapping.Themanagementofthebuffersizes
enablesthebearertouseeventhewholeRLCbufferingcapabilityinonedatatransfer
directionatatime.IftheUEreportshigherRLCbufferingcapability,thenthereported
valueisusedinthedefinitionsoftheRLCwindowsizes.ThemanagementoftheRLC
buffersizeisvalidonlyforthoseRRCconnectionsthathavetheE-DCHconfiguredat
leastinoneoftheirradiolinks.
ThemaximumallocatedE-DCHuserdataratethatisusedinthedynamicwindowsize
allocationalgorithmissetequaltotheRmaxdefinedintheSectionRetransmission
parametersofAMRLC.

AMRLCwindowsize
ThealgorithmincludingthecaseswhenthePSbeareristransferredintheE-DCH
configurationisdescribedindetailinWCDMA RAN RRM Admission Controlfor:

Rel.5orearlierUEs.
Rel.6orlaterUEsthathavejustonePSRABmappedtoHS-DSCH.

IftheUEisRel.6orlater,andifithasmorethanonePSRABmappedtoHS-DSCH,the
followingmechanismappliestoeachNRTandPSStreamingRAB:
TherelativeUL/DLwindowsizesWSr n ULandWSr n DLarecalculatedasdescribedin
WCDMA RAN RRM Admission Control.Thecalculationofrelativewindowsizesisbased
onRn ULandRn DL,whereRn ULandRn DLarethepeakrateoftheMAC-dflowofRABn
inULandDLrespectively.Formoreinformation,seeWCDMA RAN RRM HSDPA.
ThebufferoverbookingisbasedontheassumptionthattheULandDLwindowsofRAB
1occupy100%oftheavailableUEbuffer:

Figure 76 AvailableUEbuffer

wherendenotesanRAB,forexamplen=1=>RAB1.RAB1denotestheRABwiththe
highest(Rn UL+Rn DL)

Thebufferoverbookingislimitedtothemaximumtotaloverbooking:
KOB=MIN(KOB,KOBmax)

wherethevalueKOBmaxisdefinedbymanagementparametersasfollows:

AMRLCBufMaxOverbook2NRT

Issue:06B DN70303923 157


RLClayerconfiguration WCDMARANRRMHSUPA

2NRTRABs
1NRTRAB+1PSStreamingRAB

AMRLCBufMaxOverbook3NRT
2NRTRABs+1PSStreamingRAB
3NRTRABs
3NRTRABs+1PSStreamingRAB

TheTotalBuffer,thatistheinputforthecalculationoftheabsolutewindowsizes,is
specifiedby:
TotalBuffer=AMRLCMaximumBufferUE*KOB

Theabsolutewindowsizesarecalculatedfromrelativewindowsizesandthetotalbuffer
sizeasdescribedinWCDMA RAN RRM Admission Control.UTRANsideAMRLCuses
staticbufferpartitioningforRelease6andearlierUEs.Dynamicbufferpartitioning
betweenNRTRABsisnotapplied.

GeneralconfigurationparametersoftheAMandUMRLCentitiesfor
theSRBsonE-DCH/DCH
ACproducesthegeneralconfigurationparametersoftheAM,andACproducesthe
transmissionwindowsizesoftheAMRLCentitiesofUE,andRNCfortheSRBsRB2,
RB3andRB4mappedonHSUPAisdefinedinWCDMA RAN RRM Admission Control
byusingtheexistingAMRLCTXWindowSizeSRBparameter.Additionally,RLCwindow
sizesfortheSRNSrelocations,hardhandovers-intra-RNC,inter-RNCandinter-RAT
hardhandoversaregeneratedasdefinedinWCDMA RAN RRM Admission Control.
SDUdiscardisnotusedforUMRLCofSRB1.TransportchannelparametersforSRBs
onE-DCHarepresentedintheTable19:TransportchannelparametersforSRBsonE-
DCHtable.

Table 19 TransportchannelparametersforSRBsonE-DCH
Alt1 Alt2
FixedRLC+MAC-e/es(Rel-6andlater FixedRLC+MAC-i/is(Rel-8andlater
releases)NOTE2 releases)NOTE2

Higherlayer RAB/Signaling SRB#1 SRB#2 SRB#3 SRB#4 SRB#1 SRB#2 SRB#3 SRB#4
RAB

RLC Logicalchannel DCCH DCCH DCCH DCCH DCCH DCCH DCCH DCCH
type

RLCmode UM AM AM AM UM AM AM AM

Payloadsizes 136 128 128 128 136 128 128 128


[bit]

Maxdatarate DependsonUEcategoryandTTI
[bps]

AMDPDU 8 16 16 16 8 16 16 16
header[bit]

158 DN70303923 Issue:06B


WCDMARANRRMHSUPA RLClayerconfiguration

Table 19 TransportchannelparametersforSRBsonE-DCH(Cont.)
MAC MAC-es 4logicalchannelmultiplexing 4logicalchannelmultiplexing
multiplexing

MAC-dPDU 144 144


size[bit]

MACtype MAC-e/es MAC-i/is

MAC-e/es/ 18 24
MAC-i/isheader
fixedpart[bit]

Layer1 TrCHtype E-DCH E-DCH

TTI 10ms(alt.2ms)(NOTE1) 10ms(alt.2ms)(NOTE1)

Codingtype TC TC

CRC[bit] 24 24

NOTE1:Thesupportof2msTTIdependsontheUEcategory.
NOTE2:Alternative1withFixedRLC+MAC-e/esisthedefaultconfiguration.Fortestcasesthatusealternatives2(Fixed
RLC+MAC-i/is)thenthisisexplicitlystatedinthetestcase.

RetransmissionparametersfortheAMRLCentitiesoftheSRBson
HSUPAaretransferredinE-DCH/DCHconfiguration(HSUPA2msTTI)
RetransmissionparametersfortheAMRLCentitiesoftheSRBsonHSUPAare
transferredinE-DCH/DCHconfiguration,asdefinesACofSRNC.Retransmission
parametersfortheAMRLCentitiesoftheSRBsonHSPA,whicharetransferredinE-
DCH/HS-DSCHconfiguration,definesACofSRNC.Theconfigurationisdefinedin
WCDMA RAN RRM HSDPA.SDUDiscardfunctionmodeforAMRLCofSRB,whichare
transferredinE-DCH/DCHconfiguration,definesACofSRNC.Theconfigurationis
definedinWCDMA RAN RRM Admission Control.SDUDiscardfunctionmodeforAM
RLCofSRB,whicharetransferredinE-DCH/HS-DSCHconfiguration,definesACof
SRNC.TheconfigurationisdefinedinWCDMA RAN RRM HSDPA.

Thefollowingmanagementparametersareintroducedforthedefinitionofthelengthof
theAMRLCstatusreportingperiod:

L2roundtriptimevalue,whichisappliedinconfiguringtheRLCsenderandreceiver
oftheAMSRBinRNC,isreadfromtheAMRLCRespTimeRevEDCHmanagement
parameter.
L2roundtriptimevalue,whichisappliedinconfiguringtheRLCsenderandreceiver
oftheAMSRBintheUE,isreadfromtheAMRLCRespTimeDCH40management
parameter.
ValueoftheL2roundtriptimeisdenotedwithTRTT.TheRNRLC-
AMRLCSRB3n4RespTimemanagementparameterdefinestheL2roundtriptimefor
signalingbearersRB3andRB4whentheRAN2494: Fast Cell_PCH Switching
featureisused.

Issue:06B DN70303923 159


RLClayerconfiguration WCDMARANRRMHSUPA

TheAMRLCOnDCHOfSRB34PeriodMaxparameterdefinesthemaximumstatus
reportingperiod,whichisappliedinconfiguringtheRLCsenderandreceiverofthe
AMSRBintheUEandRNC,expressedintherelationtotheL2roundtriptime
valueoftheparameterisdenotedwithmax.TheRNRLC-AMRLCSRB3n4PeriodMax
managementparameterdefinesthemaximumstatusreportingperiodinrelationto
theL2roundtriptimerespectivelyforsignalingbearersRB3andRB4whenthe
RAN2494: Fast Cell_PCH Switchingfeatureisused.

SenderoftheRLCentityinRNCisconfiguredasfollows:
TimersTimer_pollandTimer_poll_periodicaresettothevaluemax*TRTTiftheyhave
beenactivatedwiththe'Timerpollperiodic'andthe'Timerpoll'ofthe
AMRLCOnDCHOfSRB34Triggersparameter.
SenderoftheRLCentityintheUEisconfiguredasfollows:

IfthevalueoftheSatelliteIubUsagemanagementparameterequalsto
'Disabled',thenTimersTimer_pollandTimer_poll_periodicaresettothevalue
max*TRTTiftheyhavebeenactivatedwiththe'Timerpollperiodic'andthe'Timer
poll'oftheAMRLCOnDCHOfSRB34Triggersparameter.
IfthevalueoftheSatelliteIubUsagemanagementparameterequals'Enabled',
thenthetimersTimer_pollandTimer_poll_periodicaresettobeequaltothe
maximumofthetwoquantities-max*TRTTandTperiod,iftheyhavebeenactivated
withthe'Timerpollperiodic'andthe'Timerpoll'ofthe
AMRLCOnDCHOfSRB34Triggersparameter.ValueoftheTperiodquantityisobtained
fromthefollowingequation:
Tperiod=max*TRTT+OSatellite
OSatelliteisequaltothevalueoftheAMRLCOnDCHSRB136OffSatmanagement
parameter.

TherestofthesenderparametersoftheRLCentitiesinRNCandtheUEareconfigured
asfollows:

TimerTimer_poll_prohibitissettothevalueofthe
AMRLCOnDCHOfSRB34PeriodMinparameterifithasbeenactivatedwiththe
'Timer_poll_prohibit'oftheAMRLCOnDCHOfSRB34Triggersparameter.
PollingtriggerPoll_PDUissettothevalueoftheAMRLCOnDCHOfSRB34PollPDU
parameterifthetriggerhasbeenactivatedwiththe'Poll_PDU'ofthe
AMRLCOnDCHOfSRB34Triggersparameter.
PollingtriggerPoll_SDUissettothevalueoftheAMRLCOnDCHOfSRB34PollSDU
parameterifthetriggerhasbeenactivatedwiththe'Poll_SDU'ofthe
AMRLCOnDCHOfSRB34Triggersparameter.
PollingtriggerPoll_Windowissettothevalueofthe
AMRLCOnDCHOfSRB34PollWindowparameterifthetriggerhasbeenactivatedwith
the'Poll_window'oftheAMRLCOnDCHOfSRB34Triggersparameter.
PollingtriggersLasttransmissionPDUpollandLastretransmissionPDUpollareset
ifthetriggershavebeenactivatedwiththe'LasttransmissionPDUpoll'andthe'Last
retransmissionPDUpoll'oftheAMRLCOnDCHOfSRB34Triggersparameter.
ValueoftheMaxDATRLCparameterissettothevalueofthe
AMRLCOnDCHOfSRB34MaxDATparameter.

ReceiveroftheRLCentityisconfiguredasfollows:

TimerTimer_status_periodicissettothesamevalueastheTimer_poll_periodicand
Timer_pollaresetinthesenderoftheRLCentityifithasbeenactivatedwiththe
'Timerstatusperiodic'oftheAMRLCOnDCHOfSRB34Triggersparameter.

160 DN70303923 Issue:06B


WCDMARANRRMHSUPA RLClayerconfiguration

TimerTimer_status_prohibitissettothevalueofthe
AMRLCOnDCHOfSRB34PeriodMinparameterifithasbeenactivatedwiththe'Timer
statusprohibit'oftheAMRLCOnDCHOfSRB34Triggersparameter.
StatusreporttriggerMissingPDUindicatorissetifthetriggerhasbeenactivated
withtheAMRLCOnDCHOfSRB34Triggersparameter.

ManagementparametervaluesareappliedwhentheAMRLCentityiscreatedorthe
retransmissionparametersoftheentityaremodified.Modificationofthemanagement
parameters'valuesisnotasufficientreasonforthereconfigurationoftheAMRLC
entities.
ValuesoftheRLCvariablesandtimerssignaledtotheRLCentitiesoftheUEandRNC
areroundedasdescribedinthedefinitionofeachparameterofthe
AMRLCOnDCHOfSRB34structure.

UMRLCconfiguration
WhenHSPAisestablishedfortheCSvoiceRAB,theUE-specificadmissioncontrol
configuresthetransmittingandreceivingUMRLCentitiesfortheradiobearerbothinthe
SRNCandtheUE.TheCSvoicebearerisstilltransferredwiththeTMradiobearersin
theR99transportchannelconfiguration.WhentheE-DCHMAC-dflowisestablishedfor
theCSvoiceRAB,theUE-specificadmissioncontrolconfiguresthereceivingUMRLC
entityoftheRNCwiththefollowingparameters:

Alternative extension bit interpretationissetforinformingtheRLCentityaboutusing


theextensionbittoindicatethattheUMDPDUincludesacompleteSDU,whichis
notsegmented,concatenatedorpadded.
7-bitLength indicatorvalueisusedfortheULUMDPDUs.
Provisioningofsequencenumber-theSN_delivery parameter-isnotconfigured,
meaningthatthereceiverdoesnotdelivertheRLCsequencenumbertogetherwith
theSDUstotheupperlayers.
Out of sequence deliveryofSDUsfunctionisnotconfigured.
Duplicate avoidance and reorderingfunctionisnotconfigured.
UMDPDUsizesareconfiguredfortheAMRmodesofthecodecsetthatthecell-
specificadmissioncontrolhasselectedforthecall,includingthepossibleSIDframe.
SizesNUMDoftheUMDPDUsaredefinedasintroducedinTheUMDPDUand
MAC-dPDUsizesoftheCSvoiceRB.InformationissignaledintheRLCsizelistof
theE-DCHandincludedintheRRCIERB Mapping Info.

WhentheE-DCHMAC-dflowisestablishedfortheCSvoiceRAB,theUE-specific
admissioncontrolconfiguresthetransmittingUMRLCentityoftheUEwiththefollowing
parameters:

Timer-basedSDU discardfunction,withoutexplicitsignaling,isconfigured.The
valueoftheSDU discardtimerisdefinedwiththeUMRLCEVoiceDiscardTime
managementparameter.ThevalueoftheSDU discardtimerissignaledtotheUEin
theRRCRLC infoIEwiththeUMRLCTransmission RLC discardparameter.
Alternative extension bit interpretationissetforenablingtheRLCentitytoindicate
withtheextensionbitthattheUMDPDUincludesacompleteSDU,whichisnot
segmented,concatenatedorpadded.

TheUMDPDUandMAC-dPDUsizesoftheCSvoiceRB
SRNCreceivesfromtheMSC,intheRANAPresourceallocationrequest:

Issue:06B DN70303923 161


RLClayerconfiguration WCDMARANRRMHSUPA

amessagedescriptionoftheexactRABsubflowSDUsizesforeachAMRmodeand
apossibleSIDframe.

TheUE-specificACcanproduceforeachAMRmodethesizeSPDCPofthePDCPSDU
bysummingoverthesub-flowsthesubflow-specificSDUsizes.SizesofthePDCPand
theUMRLCheadersbothequaleightbits.RecallingthatPDCPPDUisoctetaligned,
TheUE-specificACcanusethegeneralformulaforcalculatingNUMD:

Figure 77 PDCPPDUisoctetaligned

Table 20 UMDPDUsizesfortheRBofCSAMR
AMRmodeorSID(kbps) 12.2 7.95 5.9 4.75 SID

UMDPDUsizeNUMD(bits) 264 176 136 112 56

TableTable21:UMDPDUsizesfortheRBCSAMRWBintroducestheUMDPDUsizes
fortheRBofCSAMRWB.

Table 21 UMDPDUsizesfortheRBCSAMRWB
AMRWBmodeorSID(kbps) 12.65 8.85 6.6 SID

UMDPDUsizeNUMD(bits) 272 200 152 56

TheRLCPDUsizeinCSvoiceoverHSPAisdefinedbyalistofPDUsizesaccordingto
theAMRcodecsincludedtocodecset.ThemaximumMAC-dPDUsizeisdeterminedby
thehighestAMRcodecinthecodecset(eitherCSAMRorCSAMRWBcodecset).
ForCSAMRthemaximumMAC-dPDUsizeisthecorrespondingvalueofthehighest
CSAMRcodecincodecset,asdefinedinfollowingtable:

Table 22 MAC-dPDUsizesfortheRBofCSAMR
AMRmodeorSID(kbps) 12.2 7.95 5.9 SID

MAC-dPDUsizeNUMD(bits) 264 176 136 56

ForCSAMRWBthemaximumMAC-dPDUsizeisthecorrespondingvalueofthe
highestCSAMRWBcodecincodecset,asdefinedinfollowingtable:

Table 23 MAC-dPDUsizesfortheRBCSAMRWB
AMRWBmodeorSID(kbps) 12.65 8.85 6.6 SID

MAC-dPDUsizeNUMD(bits) 272 200 152 56

162 DN70303923 Issue:06B


WCDMARANRRMHSUPA RLClayerconfiguration

JitterbuffermanagementfortheCSservicesmappedtoHSPA
WhentheE-DCHMAC-dflowisestablishedfortheCSvoiceRB,theUE-specific
admissioncontrolofSRNCdefinesthemaximumbufferingtimeMaxCSdelayforthe
uplinkCSvoiceframesintheRNC.Max CS delaycandependontheusedE-TTIvalue-
2msor10ms-therefore,twomanagementparametersareintroducedforit:

IfE-TTIequals2ms,theMaxCSdelayvalueisreadfromthemanagement
parameterMaxCSDelayRNCETTI2,
IfE-TTIequals10ms,theMaxCSdelayvalueisreadfromthemanagement
parameterMaxCSDelayRNCETTI10.

ThevalueofMaxCSdelayisreadfromeitherofthetwomanagementparametersand
fromthePDCPentityupdatedwiththisvalue.Thevalueisreadwhentheestablishment
oftheE-DCHMAC-dflowisinitiatedwithaparticularE-TTIvalue,orwhenevertheE-TTI
valueismodified.

9.3 DeliveryoftheRLCSDUstothehigherlayers
Insequence,deliveryisguaranteedbytheRLCentityontheSRNC,regardlessofthe
possiblevalueoftheRANAPRABattributeDelivery Order.
TheRLCentityoftheRNCdoesnottransfertheRLCSDUsdetectedaserroneousover
theIuinterface,regardlessofthepossiblevalueoftheRANAPRABattributeDelivery of
erroneous SDU.

Issue:06B DN70303923 163


UEcapabilityrelatedtoE-DCH WCDMARANRRMHSUPA

10 UEcapabilityrelatedtoE-DCH

g NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.

UEradioaccesscapabilitiesincludetheparametersthatdefinewhethertheUEsupports
E-DCH,andifitdoes,withwhatcharacteristics.
UEradioaccesscapabilityIEincludesthefollowingE-DCHandE-DPCHrelated
information:

E-DCHsupport
ItdefineswhethertheUEsupportsE-DCH(andE-DPCH)ornot.
MaximumnumberofE-DPDCHchannels
ItdefinesthemaximumnumberofE-DPDCHchannelsthattheUEiscapableof
transmitting.TheUEcansupport1,2or4E-DPDCHs.
MinimumspreadingfactoroftheE-DPDCH
ItdefinestheminimumspreadingfactoroftheE-DPDCHthattheUEiscapableof
transmitting.TheUEcansupporteitherSF=2or/andSF=4.
Supportof2msTTIforE-DCH
ItdefineswhethertheUEsupports2msTTIornot.

TheuplinkUEcapabilityisrestrictedwithsimultaneousE-DCHconfigurationasdefined
inthe3GPPTS25.306.TheRNCsupportsonlyAMR(includesallsupported
narrowbandandwidebandAMRcodecrates)andsignalinglink3.4kbpssimultaneously
withE-DCH,thusULDPCHcapabilitydoesnotlimitDCHbitratesinthiscase.
ThetableTable24:FDDE-DCHphysicallayercategories.definesFDDE-DCHphysical
layercategories.TheUEsignalstheE-DCH physical layer categoryinformationelement
assuchtotheRNC.

Table 24 FDDE-DCHphysicallayercategories.

E-DCH Maximum Minimum Supportfor Maximum Maximum
category numberof spreading 10and2ms numberofbits numberofbits
E-DCH factor TTIE-DCH ofanE-DCH ofanE-DCH
codes transportblock transportblock
transmitted transmitted transmitted
withina10ms withina2msE-
E-DCHTTI DCHTTI

Category1 1 SF4 10msTTI 7110 -


only

Category2 2 SF4 10msand2 14484 2798


msTTI

Category3 2 SF4 10msTTI 14484 -


only

164 DN70303923 Issue:06B


WCDMARANRRMHSUPA UEcapabilityrelatedtoE-DCH

Table 24 FDDE-DCHphysicallayercategories.(Cont.)

E-DCH Maximum Minimum Supportfor Maximum Maximum
category numberof spreading 10and2ms numberofbits numberofbits
E-DCH factor TTIE-DCH ofanE-DCH ofanE-DCH
codes transportblock transportblock
transmitted transmitted transmitted
withina10ms withina2msE-
E-DCHTTI DCHTTI

Category4 2 SF2 10msand2 20000 5772


msTTI

Category5 2 SF2 10msTTI 20000 -


only

Category6 4 SF2 10msand2 20000 11484


msTTI

Category7 4 SF2 10msand2 20000 22996


msTTI

Notethatwhen4codesaretransmittedinparallel,twocodesaretransmittedwithSF2and
twowithSF4

Categories1to6UEssupportQPSKonly.
Category7UEssupportQPSK(2msTTI,10msTTI)and16QAM(2msTTI).
AllUEE-DCHcategoriescanbeusedinRAN.TheRNCchecksUEcapabilityand
selectsnetworkfunctionalitiesaccordingly.RANdoesnotsupportTTI=2msandmore
thantwoE-DPDCHchannels.
ThetableTable25:TotalRLCandMAC-hsparametersforFDDHS-DSCHandE-DCH
physicallayercategories.definestotalRLCandMAC-hsparametersforFDDHS-DSCH
andE-DCHphysicallayercategories.ThesevaluesreflecttotalbuffersizesofHS-DSCH
andE-DCHcategoriesforsimultaneousHS-DSCH/E-DCHoperation.

Table 25 TotalRLCandMAC-hsparametersforFDDHS-DSCHandE-DCH
physicallayercategories.

HS-DSCH Categories Categories Categories Category Category Category Category Maximum
category 1to4 5and6 7and8 9 10 11 12 numberof
[kbytes] [kbytes] [kbytes] [kbytes] [kbytes] [kbytes] [kbytes] AMRLC
E-DCH
entities
category

Category1 100 100 200 300 300 50 50 6

Categories2 100 150 200 300 300 50 100 6


and3

Category5 100 150 200 300 300 100 100 6

Issue:06B DN70303923 165


UEcapabilityrelatedtoE-DCH WCDMARANRRMHSUPA

Table 25 TotalRLCandMAC-hsparametersforFDDHS-DSCHandE-DCH
physicallayercategories.(Cont.)

HS-DSCH Categories Categories Categories Category Category Category Category Maximum
category 1to4 5and6 7and8 9 10 11 12 numberof
[kbytes] [kbytes] [kbytes] [kbytes] [kbytes] [kbytes] [kbytes] AMRLC
E-DCH
entities
category

Category4 - 150 300 300 400 100 100 6

Category6 - 200 300 400 400 150 150 6

TheUEsupportstheCSvoiceoverHSPA,ifthePDCPCapabilityIEreceivedinthe
RRCUE-RadioaccesscapabilityincludestheRel7extensionparameterforthesupport
forCSvoiceoverHSPAset.

166 DN70303923 Issue:06B


WCDMARANRRMHSUPA MinimumserviceforHSUPAusers

11 MinimumserviceforHSUPAusers

g NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.

TheWBTSimplementshybridthroughputandtheinterference-basedE-DCHscheduler.
Thebenefitofthiskindofalgorithmisthatitattemptstoofferatleasttheminimum
serviceforthoseE-DCHusersinthecellthataresufferingfromreceivedwideband
interferencespikes.Iftheuplinktrafficlevelofthecellislow,thesourceofthe
interferenceisconsideredtobeoutsidethecell,andE-DCHresourcesareallocated
withoutanyinterferenceestimates.Whentheowncellthroughputexceedsaparticular
level,interferenceestimationsareinitiated,andtheplannedinterferencetargetisapplied
intheE-DCHscheduling.
Themethoddoesnotsolvetheproblemsthatresultpurelyfromthephysicalaspectsof
theuplinkcoverage.Theguaranteedthroughputisatthecostofsmallercoveragewhen
theexternalinterfererispresent;UEsconnectedtotheaffectedcellhavetousemore
transmissionpower,andtheUEsatthecelledgemightnotbeabletotransmitwith
enoughpowertohavetheirsignalsreceived.
TheRNCprovidestheBTSwiththeminimumthroughputthresholdforR99DCHandE-
DCHresourceallocation.BecauseR99DCHandE-DCHuserssharethesamepower
resourcesofthecell,theBTSshouldbeabletoestimatethetotaluplinkDCHthroughput
ofthecell.TheRNCprovidestheBTSwithmeanstosolvethistaskmoreeasily,without
complicatedandprocessing-power-requiringmeasurements.

11.1 MinimumtotalE-DCHthroughputofthecell
TheoperatorisabletodefinetheminimumtotaluplinkthroughputcommontotheR99
DCHsandE-DCHsineachE-DCHcell,whichtheBTScanuseinitsresourceallocation
withoutconsideringthereceivedwidebandinterference.Itisnotpossibletosetanydata
ratethresholddirectly.Instead,theminimumreceivedDCHandE-DCHpowershare,
whichtheDCHsandE-DCHscanuseregardlessofthereceivedinterference,isdefined.
ConsiderthatRDEWPSMinisthevalueoftheInterference margin for the minimum E-
DCH load(PrxLoadMarginEDCH)managementparameter.

Figure 78 Minimumuplinkowncellloadfactor

Theequationdefinestheplannedthroughput-basedminimumguaranteeduplinkDCH
andE-DCHloadthresholdLminCELLofthecell.QuantityLminCELLiscalledMinimum
uplink own cell load factor;itrepresentstheminimumallowedDCHandE-DCHpower
shareinthereceivedtotalwidebandinterferencepower..
WhenE-DCHtraffic,togetherwiththepossibleuplinkDCHtraffic,doesnotexceedthe
loadfactorvalueLminCELL,theBTSdoesnotmakeanypowerestimationsand
interferencethresholdcheckingsintheE-DCHscheduling.Whenthecellthroughput

Issue:06B DN70303923 167


MinimumserviceforHSUPAusers WCDMARANRRMHSUPA

exceedstheLminCELL,theBTSinitiatestheinterference-basedE-DCHscheduling
againsttheplannedinterferencetargetPrxMaxTargetBTS.SeetheFigureFigure79:
MinimumthroughputforE-DCHschedulinginBTS.

Figure 79 MinimumthroughputforE-DCHschedulinginBTS
i-factor

Noiserise

E-DCHload
PrxMaxTargetBTS canbe
increased
PrxOffset inthegreen
PrxLoadMarginMaxDCH area
PrxTarget
PrxLoadMarginEDCH
PrxLoadMarginDCH
Power MinimumUL own
spiking cellload factor

Current UL DCH Minimum E-DCH OwnCellLoad


owncell loadfactor loadfactor Factor(capacity)

NotethatinthefigureFigure79:MinimumthroughputforE-DCHschedulinginBTS,UL
DCHincludestheE-DCHnon-scheduledtransmission(NST)asitisnotscheduledby
theBTS.E-DCHconsistsofscheduledtransmissionsonE-DCHscheduledbytheBTS.
WhenE-DCHtraffic,togetherwiththepossibleuplinkDCHtrafficconformingtotheload
factorvalueLminCELL,isallowedregardlessoftheexperiencedinterferencewithout
riskingthenetworkstability,itmeansthattheinfluenceoftheadjacentcellsis
consideredinsignificant.Therefore,theother-to-own-cellinterferenceratio-valueofthe
i-factor-isconsideredverysmallwhentheEquationFigure78:Minimumuplinkowncell
loadfactorisdefined.
R'99DCHsandE-DCHsusethesameinterferenceresources.Becauseallocationof
DCHandnon-scheduledtransmission(NST)E-DCHresources(doneintheRNC)
overridesthescheduledtransmissionE-DCHresourceallocation,(doneintheBTS),and
theminimumuplinkowncellloadfactoriscommontoDCHsandE-DCHs,the
throughputguaranteedforE-DCHschedulingbecomesdynamicanddependentonthe
amountoftheDCHandE-DCHNSTtraffic.ThefigureFigure79:Minimumthroughput
forE-DCHschedulinginBTSillustratesthesituation;thecurrent uplink DCH load factor
representsthetotaluplinkthroughputoftheDCHandE-DCHNSTusersandthe
minimum E-DCH load factorrepresentstheremainingavailableguaranteedtotal
throughputfortheE-DCHscheduling.
QuantitiesPrxLoadMarginDCH,PrxLoadMarginMaxDCH,PrxTargetandPrxOffsetofthe
FigureFigure79:MinimumthroughputforE-DCHschedulinginBTSaretheplanned
throughputandinterferencetargetsusedinR99DCHresourceallocation.Theirvalues
aredefinedwiththeInterference margin for the minimum UL DCH
load(PrxLoadMarginDCH),Interference margin for the maximum UL DCH
load(PrxLoadMarginMaxDCH),Target for received power(PrxTarget)andOffset for
received power(PrxOffset)managementparameters.Forinformationontheir
significance,seeWCDMA RAN RRM Admission Control.TheRNCdoesnotapplythe
Minimum uplink own cell load factorLminCELLinitsDCHresourceallocationdirectly;it
hasthroughputthresholdsofitsown.

168 DN70303923 Issue:06B


WCDMARANRRMHSUPA MinimumserviceforHSUPAusers

TheCRNCsendstheMinimum uplink own cell load factorLminCELLwiththeNBAP:


Private MessagetotheBTScell.

Table 26 ContentsofthecellloadfactorIE

IE/Group Presence Range IETypeand Semantics
Name Reference Description

CellLoad O INTEGER unit1


Factor (0...1000)

ThevalueoftheloadfactorLminCELLisincludedintheCell Load FactoroftheHSUPA


Cell ParametersIE.

11.2 BTSestimatesthetotaluplinkDCHthroughput
E-DCHandR99DCHsusecommonuplinkradioresources.TheBTSshouldbeableto
estimatetheuplinkthroughputoftheDCHusersofthecelltodeterminewhatisthe
remainingguaranteedthroughputinE-DCHscheduling.DCHtrafficloadinuplinkis
estimatedbydefiningitspowershareinthereceivedwidebandinterference,thatis,the
uplinkowncellloadfactor.Themethodmakesitpossibletodifferentiatebetweenthe
servicesandtheircontributiontotheuplinkDPCHpowershare.
IftheBTSshouldestimatetheloadfactorforeachoftheDCHs,forexample,it
measurestheaverageDCHdataratesandthereceivedSIRoftheDPCCH;therequired
processingloadbecomestoobigifeachconnectionismeasured.Theestimationofthe
DCHloadismadeeasierfortheBTS;theBTSactuallydoesitinthesimilarwayasthe
RNCdoesit,sobothnetworkelementshaveequalinformationfortheuplinkDCHload.
TheBTSmaintainstheuplinkloadfactorofDCHswiththeDCHconfigurationdatathatit
receivesfromtheNBAPradiolinkhandlingmessagebyusingaparticularloadfactor
mappinginformationthattheCRNCsendstoeachBTScellasitsconfigurationdata.
Thecell-specificadmissioncontroloftheCRNCdefinesthesignalinglinkandradio
bearerofeachPSandCSRABtypessupportedbytheRNC,atableoftheuplinkDCH
loadfactors.ItisproducedwiththeorderedlistsinwhichuplinkDCHloadfactorvalues
areassignedtoeachpossiblemaximumuplinkDCHuserdatarateoftheradiobearers.
Thesebitrate/loadfactorlistsareseparatedbyassigningeachofthemabearer-specific
NBAPFrame Handling Priority(FHP)value.
CRNCsendstheuplinkDCHloadfactormappingtableswiththeNBAP:Private
MessagetotheBTScell.TheLoad DCH Table of the HSUPA Cell ParametersIE
includestheuplinkDCHloadfactormappingtables.

Issue:06B DN70303923 169


MinimumserviceforHSUPAusers WCDMARANRRMHSUPA

Table 27 ContentsoftheloadDCHTable

IE/Group Presence Range IETypeand Semantics
Name Reference Description

Frame 116 FHP+1


handling
priority

>LoadDCHlist 18 Indexforthe
maximumDCH
userdatarates

>>DCHdata M INTEGER Unit:bitsper


rate (0...38400) 100ms

>>DCHload M INTEGER Unit1


factor (0...1000)

EachlistDCH data rateincludesthemaximumuserdataratesoftheDCH,andthelist


DCH load factor includesthecorrespondingDCHloadfactorsforthedatarates.The
actualFrameHandlingPriorityvalueincrementedby1givesthevalueoftheFrame
handling priorityindexoftheLoad DCH Table IE.Load DCH lististhelistindexofthe
maximumDCHuserdatarates.
TheoverheadoftheuplinkphysicalcontrolDPCCHisincludedintheuplinkDCHload
factoroftheRRCconnection.Therefore,theCRNCsendstotheBTStheIELoad DCH
TableoftheHSUPA Cell Parametersforamappingtable,whichenablestheBTSto
solvetheloadfactoroftheDPCCH.ThemappingtableisintroducedintheTableTable
28: Contents of the load DPCCH Table.

Table 28 ContentsoftheloadDPCCHTable

IE/Group Presence Range IETypeand Semantics
Name Reference Description

Minimum 1...7
Spreading
Factorindex

>DPCCHload M INTEGER Unitone


factor (0...1000)

ThelistDPCCH load factorincludestheDPCCHloadfactormapping.Minimum


Spreading Factor indexliststheDPCCHloadfactorinformationaccordingtotheordered
setoftheminimumuplinkDPDCHspreadingfactors4,8,16,32,64,128and256.
TheloadfactorsandtheirvaluesequaltheonesthattheRNCappliesintheuplinkDCH
resourceallocationsofitsown.Formoreinformationonthevaluesoftheloadfactors,
seeWCDMA RAN RRM Admission Control.

170 DN70303923 Issue:06B


WCDMARANRRMHSUPA MinimumserviceforHSUPAusers

WhentheWBTSreceivesanyoftheNBAPradiolinkhandlingmessages,itdetermines
thevaluesoftheFrame handling priorityindexandtheLoad DCH listindexoftheLoad
DCH TableforeachuplinkDCHoftheradiolink:

ThevalueoftheFrame handling priorityindexoftheDCHequalsthevalueofthe


Frame Handling PriorityIEoftheDCHintheNBAPradiolinkhandlingmessage
increasedby1.
ThevalueoftheFrame handling priorityindexpointstoaparticularDCH data rate
listoftheLoad DCH Table.ThevalueoftheLoad DCH listindexequalsthevalue
locationofthemaximumDCHuserdatarateintheDCH data rate list,whichisequal
toorsmallerthanthemaximumDCHdataratedefinedbytheTFSoftheuplink
DCH,orthesumofmaximumDCHdataratesdefinedbytheTFSsofthe
coordinateduplinkDCHs.IfnoLoad DCH listindexvalueisfound,theLoad DCH list
indexissettovalue1.
ThevalueLDCHoftheloadfactorisreadfortheDCHfromthepositionintheDCH
load factorlistpointedbythedeterminedvaluesoftheFrame handling priorityindex
andtheLoad DCH listindex.

CCTrCHoftheDPCHincludesoneormoreDCHs,itsloadfactorLDPDCHisachieved
asasumoftheDCH-specificloadfactors:

Figure 80 UplinkDCHloadfactorofCCTrCH

UsingtheMinimum Spreading FactorinformationoftheNBAPmessage,theBTS


definesthevalueoftheMinimum Spreading Factor indexandreadsthevalueLDPCCHof
theuplinkDPCCHloadfactorfromtheDPCCH load factorlist.
TheBTSdefinestheradiolinkspecificuplinkDCHloadfactorLDPCHoftheRRC
connection:

Figure 81 UplinkDCHloadfactoroftheRRCconnection

TheBTSproducestheuplink DCH own cell load factor LDCH,CELLofalluplinkDCHusers


asasumoftheRRCconnectionspecificloadfactors.

Figure 82 UplinkDCHowncellloadfactor

TheBTSupdatesLDCH,CELLeverytimeaDCHisestablished,modifiedorreleased:

Figure 83 MaintainingoftheuplinkDCHowncellloadfactor

Iftheradiolinkisestablished,LOld(DPCH)equals0;iftheradiolinkisreleased,LNew(DPCH)
equals0.

Issue:06B DN70303923 171


MinimumserviceforHSUPAusers WCDMARANRRMHSUPA

TheTableTable29:ExampleloadDCHtableforthePSinteractiveRABofTHP1shows
anexampleoftheloadfactormappingfortheDCHofthePSinteractiveservice,whose
TrafficHandlingPriorityequals1.ItsFrameHandlingPriorityissetto6.Thevaluesof
theloadfactorsconformtothedefaultparametrizationoftheRNC.

Table 29 ExampleloadDCHtableforthePSinteractiveRABofTHP1

FHP+ Load 1 2 3 4 5 6 7 8
1 DCH
list

7 DCH 384 256 128 64 32 16 8 0


data
rate

DCH 166 117 62 32 16 13 7 0


load
factor

TheTableTable 30: Example for the DPCCH load factor mappingshowsanexampleof


theloadfactormappingfortheDPCCHoverhead.Thevaluesoftheloadfactors
conformtothedefaultparametrizationoftheRNC,andrepresentthevalueswhenthe
two-wayreceiverdiversityisused.

Table 30 ExamplefortheDPCCHloadfactormapping

Minimum 4 8 16 32 64 128 256
SFof
DPDCH

Minimum 1 2 3 4 5 6 7
Spreading
Factor
index

DPCCH 15 12 11 8 5 5 5
loadfactor

TheCRNCsendstheBTSuplinkDCHloadfactormappingtablesforthecellwhenthe
HSUPAconfigurationissetupinthecell.TablesareupdatedtotheBTSifanyofthe
managementparametersthataffectthevaluesofthetablesismodified.

11.3 BTSdefinestheminimumtotalE-DCHthroughput
ConsiderthatLminCELListhevalueoftheMinimum uplink own cell load factor,whichthe
CRNChasconfiguredtotheE-DCHcelloftheBTS.IftheBTShasestimatedthat
LDCH,CELListhecurrentvalueoftheuplinkDCHowncellloadfactor,theminimumE-

172 DN70303923 Issue:06B


WCDMARANRRMHSUPA MinimumserviceforHSUPAusers

DCHowncellloadcapacityLminEDCH,whichBTScanuseinitsE-DCHresource
allocationwithoutconsideringthereceivedinterferencepower,isachievedfromthe
followingequation

Figure 84 AvailableguaranteedE-DCHthroughput

ThequantityLminEDCHisdynamic;itsvaluedependsonthemomentaryvalueofthe
LDCH,CELL,thatis,themomentaryamountofallocateduplinkDCHresources.Seethe
FigureMinimumthroughputforE-DCHschedulinginBTS.WhentheBTSusesLminEDCH
forE-DCHscheduling,ittakesintoaccountnon-scheduled(streaming)trafficonE-DCH.
DPCCHisconsideredtobetheDPCHoverhead,andthereforetobelongtotheuplink
DCHloadfactorofthecell,thoughtheE-DPCHisconfiguredinaradiolink.
Consequently,theBTSdoesnotincludetheDPCCHoverheadinthemomentaryuplink
owncellE-DCHloadfactorvaluewhenitiscomparingitwiththedynamicthreshold
LminEDCH.

TheBTSisabletodefinethecurrentloadfactorsoftheE-DCHusersfromthepower
offsetsoftheE-TFCsconformingtotheselectedE-DCHdataratesandfromtheDPCCH
SIRvalueswhichBTShasestimatedfortheE-DCHradiolinks.
WhilemeasuringtheDPCCHSIRforanE-DCHradiolink,theBTSaddsanoffsetvalue
tothemeasurementresult.TheCRNCsendstheoffsetvaluetotheBTSwiththeNBAP:
Private MessagetotheBTS.IESIRDPCCH OffsetoftheHSUPA Cell ParametersIE
includesit,seetheTableTable31:ContentsoftheSIRDPCCHoffsetIE.

Table 31 ContentsoftheSIRDPCCHoffsetIE

IE/Group Presence Range IETypeand Semantics
Name Reference Description

SIRDPCCH M INTEGER(- Unit0.1dB


offset 3030)

ThevalueoftheSIR DPCCH offsetisdefinedwiththeSIR target offset for DPCCH with


E-DPCH(SIRDPCCHOffsetEDPCH)managementparameter.
Forinformationonthesetup,seeWCDMA RAN RRM Handover Control.

Issue:06B DN70303923 173


SharinginterferencebetweenHSPAandNRTDCH WCDMARANRRMHSUPA
users

12 SharinginterferencebetweenHSPAandNRT
DCHusers

g NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.

PSRel99NRTDCHusersandHSPAuserssharethesameinterferencepower
resourceleftoverfromthereal-timeserviceDCHusers.ThescheduleroftheNRTDCH
resourcesislocatedtotheSRNC,whilethescheduleroftheE-DCHresourcesislocated
totheBTS.Independentschedulingcanresultinspuriousservingbetweentheusers.
HSUPARRMoftheRNCprovidestheoperatorwithmeanstocontroltheinterference
sharebetweentheNRTDCHandHSPAusers:

TheRNCisabletodefinethepowershareofthereceivedwidebandinterference
power,whichtheE-DCHuserscreate,onthebasisofspecialmeasurement
informationreceivedfromtheBTS.
TheRNCproducesadynamicinterferencetargetfortheNRTDCHscheduling-the
PrxTargetPSintheFigureDynamicinterferencetargetfortheNRTDCHscheduling
inRNC.DynamicPrxTargetPSistheinterferencetargetoftheNRTDCHscheduling
intheRNCinsteadofthestaticplannedtarget,whichisdefinedwiththeTarget for
received power(PrxTarget)managementparameter.Sharingtheinterferencemeans
thatthevalueofPrxTargetPSiscontrolleddynamicallyinthedevelopmentofthe
ratiooftheHSPAandtheNRTDCHtraffics.PrxTargetisstilltheplannedstatic
thresholdintheRTDCHallocation.
Twomanagementparametersareintroducedtodefinetheupperandlowerlimitsfor
thevariationofthedynamicschedulingthresholdPrxTargetPS.PrxTargetPSMax
definestheupperlimit,andPrxTargetPSMinthelowerlimitofthePrxTargetPS.See
theFigureDynamicinterferencetargetfortheNRTDCHschedulinginRNC.
Theoperatorisabletodefinehowthedynamicschedulingthresholddividesthe
availablepowerresourcebetweentheDCHandHSPAusers.Management
parametersareintroducedtoprioritizebetweentheDCHandHSPAusersinthe
sharingoftheinterference.Theoperatorcandecidewhethertofavour,forinstance,
thespectralefficientE-DCHtraffic.Prioritizationalsodistinguishesbetweenthe
trafficclassesofthebearers.
Themanagementparametersareintroducedtodefinetheminimumperiodforthe
modificationofthePrxTargetPS,andthemodificationstepsizes.Byusingthem,
operatorisabletocontrolthesensitivityofthealgorithm,itsabilitytorespondtothe
changesinthetrafficsharesoftheNRTDCHandE-DCHtraffics,andtheRTDCH
trafficaswell.

DynamicsharingoftheuplinkinterferencebetweentheHSPAandtheDCHusersgives
themaximumthroughput,asalltheavailablepowercanbeeffectivelyutilizedintheratio
ofthetrueDCHandHSPAtraffic.

174 DN70303923 Issue:06B


WCDMARANRRMHSUPA SharinginterferencebetweenHSPAandNRTDCH
users

Figure 85 DynamicinterferencetargetfortheNRTDCHschedulinginRNC

PrxMaxTargetBTS

HSPA interference
PrxTarget

PrxTargetPSMax

PrxTargetPS

PrxTargetPSMin

Non-HSPA interference

Note:Thenon-scheduled(streaming)trafficonE-DCHisconsideredhereasnon-HSPA
trafficasitisscheduledintheRNC.
TherecanbethreekindsoftransportchannelconfigurationsallocatedforthePS
interactiveandbackgroundRABsintheCELL_DCHstate:DCH/DCH,HS-DSCH/DCH
andHS-DSCH/E-DCH.UserswhohavethetransportchannelconfigurationDCH/DCHin
alltheirradiolinksarecalledDCHusers;HSPAusershaveeithertheconfigurationHS-
DSCH/DCHortheconfigurationHS-DSCH/E-DCHinatleastoneoftheirradiolinks.

12.1 ReceivedE-DCHpowershare
TheBTSisabletomeasureandreportthereceivedinterferencepowershareoftheE-
DCHstogetherwiththereceivedtotalwidebandinterferencepower.ReceivedE-DCH
powershare(REPS)isincludedastheE-DCH Load FactorintheHSUPA Measurement
InformationoftheRadio Resource Measurement Report,whichtheBTSsendsfortheE-
DCHcellwiththeNBAP:Private Message.REPSvalueisreceivedfromtheBTS
togetherwiththemeasurementresultofthereceivedtotalwidebandpower(RTWP),
measurementsaredescribedpreciselyintheSectionCell-Specificloadcontrolin
WCDMA RAN RRM Admission Control.
Loadcontrolproducestheaveragereceivedtotalnon-E-DCHinterferencepowerofthe
E-DCHcellforULNRTDCHresourceallocation.Thecell-specificloadcontrolobtains
themeasurementresultvalueforthetotalreceivednon-E-DCHscheduledtransmission
interferencepowerPrxNonEDPCHSTfromthefollowingequation:

Figure 86 Totalreceivednon-EDCHscheduledtransmissioninterferencepowerofthe
cell

whereLEDCH,CELListheE-DCHowncellloadfactorofthescheduledE-DCHcelltraffic.
Theloadfactorisproducedbycell-specificloadcontroloftheCRNCfromthe
measurementresultmeasuredandreportedbytheBTS,seetheSectionCell-Specific
loadcontrolinWCDMA RAN RRM Admission Control.RTWPisthecoexistent
measurementresultofthetotalreceivedinterferencepower.Thecell-specificload

Issue:06B DN70303923 175


SharinginterferencebetweenHSPAandNRTDCH WCDMARANRRMHSUPA
users

controlupdatesthenon-EDCHscheduledtransmissioninterferencepowervalue
PrxNonEDCHSTwiththemeasurementresultasdescribedinWCDMA RAN RRM
Admission Control.
Cell-specificloadcontroloftheCRNCestimatestheinstantaneousvalueof
PrxNonEDCHSTbyapplyingtheuplinkPIEformula.Thechangeof PrxNonEDCHSTin
PrxNonEDCHSTcausestheuserplanetosendthefirstuplinkactivityindicationforthe
establishedE-DCHMAC-dflowofthePSstreamingortheCSvoiceRAB.WhentheE-
DCHMAC-dflowofeitherofthetwoservicesisupgraded,loadcontrolusestheuplink
PIEformulatoproduce PrxNonEDCHST.WhentheE-DCHMAC-dflowisreleasedor
downgraded,loadcontrolusestheuplinkPDEformulatoproducetheamount
PrxNonEDCHSTofthereductioninthereceivedinterferencepower.UplinkPIEand
PDEformulasareintroducedinWCDMA RAN RRM Admission Control.
Thereceivednon-E-DCHscheduledtransmissioninterferencepowerPrxNonEDCHSTis
averagedintheCRNC.Thesimplelinearmeanfilterisusedwiththeslidingwindowfor
thesamplevaluesPrxNonEDCHST.Averagingwindowismovedinthepaceofthereceived
RadioResourceMeasurementReports.Twodifferentsizesfortheslidingtypesofthe
averagingareavailable:

TheLoad measurement averaging window size for packet


scheduling(PSAveragingWindowSize)managementparameterdefinesthe
windowsizeusedinaveragingthePrxNonEDPCHSTfortheuplinkNRTDCH
scheduling.
UplinkNRTDCHoverloadcontrolusesitsownaveragingwindowdefinedwiththe
Non-EDPCH interference averaging window size for LC(WinLCHSUPA)management
parameter.

AsamplePrxNonEDCHST(tn)ofPrxNonEDCHSTisaddedtotheaveragingwindowatevery
arrivingschedulingmomenttn.PrxNonEDCHSTisaveragedusingthefollowingformula:

Figure 87 AveragedPrxNonEDCHST

wherePrxNonEDCHST(tn)isthelatestproducedPrxNonEDCHSTsample,andNisthevalueof
thePSAveragingWindowSizeortheWinLCHSUPAparameter.
AveragingwindowsizeofadmissioncontrolisdefinedwiththeUL measurement
averaging window for AC(WinACRABsetupUL)managementparameter.

12.2 DynamicinterferencetargetintheuplinkNRTDCH
scheduling
WhenaHSUPAconfigurationissetupinthecell,adynamicallyadjustedtarget
thresholdPrxTargetPSofthereceivedwidebandinterferencepowerisemployedforthe
uplinkNRTDCHresourcescheduling,insteadoftheconventionaltargetvaluethatis
definedwiththemanagementparameterTarget for received power(PrxTarget).The
valueofthePrxTargetPSisadjustedifeithertheDCHusersortheHSPAusers

176 DN70303923 Issue:06B


WCDMARANRRMHSUPA SharinginterferencebetweenHSPAandNRTDCH
users

experienceinterferencecongestion;trafficshareofthetwousertypesissignificantinthe
adjustment.ThevalueofthePrxTargetPScanvarybetweenthelowerlimitdefined
withtheMin PS target in HSPA-DCH interference sharing(PrxTargetPSMin)
managementparameterandtheupperlimitdefinedwiththeMax PS target in the HSPA-
DCH interference sharing(PrxTargetPSMax)managementparameter.
PrxTargetPSisappliedintheNRTDCHschedulingunderthefollowingconditions:

DynamicPrxTargetPSistakenintousefortheinterferencetargetoftheuplink
NRTDCHschedulingwhenthefirstE-DCHMAC-dflowisestablishedinthecell.
Downlinktransportchanneltypeisnotsignificant;itcanbeeitherDCHorHS-DSCH.
WhentherearenoE-DCHMAC-dflowsinthecell,thetargetintheNRTDCH
resourceallocationisPrxTarget.Consequently,theuseofPrxTargetPSends
whenthelastE-DCHMAC-dflowisreleasedfromthecell.
TheinitialvalueofthePrxTargetPSissetequaltothevalueofthe
PrxTargetPSMax.TheinitialvalueisalsotakenintousewhenthelastNRTUL
DCHisreleased.
PrxTargetPSisadjustedbasedonthelastmeasurementresultRTWPofPrxTotal
receivedfromtheBTSandtheaveragedvalueofthenon-E-DCHscheduled
transmissioninterferencepowerquantityPrxNonEDCHST.
PrxTargetPSisonlyadjustedwhenthereareoneormorescheduledNRTDCH
userstogetherwithoneormoreHSPAuserswiththeestablishedE-DCHMAC-d
flowsinthecell.
IfPrxTargetPSMaxandPrxTargetPSMinaresettoanequalvalue,theRNC
doesnotadjustthevalueofthePrxTargetPS.RNCsetsthePrxTargetPStothis
commonvalueandusesitasthetargetvalueintheNRTDCHresourcescheduling.

WhentheHS-RACHhasbeensetupinthecell,thePrx_target_PSispossibletoadjust
betweenthevaluesofthePrxTargetPSMinandPrxTargetPSMaxHSRACH
managementparameters.
IfthePrxTargetPSMaxHSRACHRNPplanningparametervalueissettoequalwiththe
specialvalue(32767),thePrxTargetPSMaxHSRACHparametervalueisreplacedwitha
valuesetbyPrxTargetPSMaxRNPparameter.
WhentheHS-RACHhasbeensetupinthecell,theinitialvalueofthePrx_target_PSis
equaltothevalueofthePrxTargetPSMaxHSRACHparameter.Thefollowingscenarios
areconsidered:

InitialvalueistakenintousewhentheHS-RACHhasbeensetupinthecell.
InitialvalueistakenintousealsowhenthelastNRTULDCHisreleasedinthecell.
IfPrxTargetPSMaxHSRACHandPrxTargetPSMinparametersaresettoanequal
value,theRNCdoesnotadjustthePrx_target_PS,butitisusedasthetargetvalue
intheULNRTDCHresourceallocation.
Prx_Target_PSisusedalwayswhentheHS-RACHhasbeensetupinthecell
(althoughthereisnoE-DCHuseronCELL_FACH(HS-RACHuser)orCELL_DCH
(HSUPAuser)states).

WhentheHS-RACHhasbeensetupinthecell,thePrx_target_PSneedstobeequalor
lowerthanthevaluesetbythePrxTargetPSMaxHSRACHparameterorthan
Prx_Target_PS_Target.

TriggersfortheadjustmentofthePrxTargetPS
ThedynamicadjustmentofthePrxTargetPSisbasedon:

Issue:06B DN70303923 177


SharinginterferencebetweenHSPAandNRTDCH WCDMARANRRMHSUPA
users

thelastmeasurementresultPrxTotalofthereceivedtotalwidebandpowerRTWP
receivedfromtheBTS
theaveragedvalueofPrxNonEDCHST,thatis,thenon-EDCHscheduledtransmission
interferencepowerPrxNonEDCHST.

AveragingwindowsizesaredefinedwiththePSAveragingWindowSizemanagement
parameterforbothmeasurements.
AdjustmentofthePrxTargetPSisexecutedwhenthepacketscheduleroftheCRNC
detectsinterferencecongestioneitherintheallocationoftheE-DCHortheNRTDCH
resources.InterferencecongestionofE-DCHresourcesoccursifbothconditionsapply.

Figure 88 InterferencecongestionofE-DCH

LEDCH,CELListhelastvalueoftheowncellE-DCHloadfactorofthescheduledE-DCH
trafficproducedbythecell-specificloadcontroloftheCRNC.LEDCH_Streaming,CELListhe
loadfactorofstreamingRBsonE-DCH.LDCH,CELListhecurrentvalueoftheuplinkDCH
owncellloadfactorwhichincludesbothNRTandRTDCHsofthecell.LminCELListhe
valueoftheminimum uplink own cell load factor;quantityisintroducedintheSection
MinimumtotalE-DCHthroughputofthecell.Throughputbaseduplinkloadcheckingis
addedtotheconditionInterference congestion of E-DCHtoensurethattherereallyisat
leastminimumE-DCHandDCHtraffictoraisethevalueoftheRTWP.
Similarconditiontypesaredefinedforthedetectoroftheinterferencecongestionofthe
uplinkNRTDCHs,withtheexceptionthatonlythenon-E-DCHinterferenceandDCH
throughputarecountedin:

Figure 89 InterferencecongestionofNRTDCH

InterferencecongestionisexperiencedintheuplinkNRTDCHschedulingifthereceived
non-EDCHSTinterferencepowerapproachesthedynamicNRTDCHschedulingtarget
whenthereisDCHtrafficinthecell.PrxTargetPSisthecurrentvalueofthedynamic
thresholdPrxTargetPS.LDCH,CELListhecurrentUL(NRTandRT)DCHowncellload
factor.LEDCH_Streaming,CELListheloadfactorofstreamingRBsonE-DCH.Thethreshold
LminDCH,NRTofthetotalDCHthroughputcomparisonisachievedfromtheequation
(expressedinthelinearnotation):

Figure 90 MinimumDCHloadthresholdintheDCHcongestiondetection

178 DN70303923 Issue:06B


WCDMARANRRMHSUPA SharinginterferencebetweenHSPAandNRTDCH
users

ThequantityLminDCHrepresentstheminimumthroughputthresholdfortheRTandNRT
DCHsandRTE-DCHallocations.ItsvaluesaredefinedwiththePrxLoadMarginDC
managementparameter.Formoreinformation,seetheSectionMinimumtotalE-DCH
throughputofthecell.
ThequantityPrxtargetEDCHistheplannedinterferencetargetvalueoftheE-DCH
schedulingspecifiedbythePrxMaxTargetBTSmanagementparameteriftheHSUPA
InterferenceCancellationReceiverfeatureisnotapplied.WhentheHSUPAInterference
CancellationReceiverfeatureisapplied,thenthequantityPrxtargetEDCHisthevalueofthe
PrxMaxOrigTargetBTSRNPparameter.Thevalueofthequantityequalsthe
maximumofthevaluesofthePS target step down in HSPA-DCH interference
sharing(PrxTargetPSStepDown)andPS target step up in HSPA-DCH interference
sharing(PrxTargetPSStepUp)managementparameters.
Ifneitherofthetwoconditionsiseffective,thevalueofthePrxTargetPSisnot
adjusted.Ifeitherofthetwoconditionstriggers,thepacketscheduleroftheRNC
calculateswiththecurrentHSPA,andNRTDCHtrafficsharesanidealinterference
targetPrxTargetIdealfortheNRTDCHschedulingtodeterminewhetherthevalueof
thePrxTargetPSshouldbemodifiedornot.

IdealinterferencetargetPrxTargetIdeal
First,aweightedproportionoftheNRTPSDCHusersiscalculatedinallNRTDCHand
E-DCHusersandthen,usingthisratio,thevalueofthePrxTargetIdealisdefinedby
dividingthecontrollableinterferencebetweentheNRTDCHandE-DCHusers(equation
isexpressedinthelinearnotation):

Figure 91 IdealinterferencetargetPrxTargetIdeal

ThequantityPrx_target_EDCHisthevalueoftheRNPparameterPrxMaxTargetBTS,the
averagetotalnon-controllablereceivedinterferencepower-seeWCDMA RAN RRM
Admission Control.
ThequantityWeightUL,DCHisthecelllevelweightfactorofallPSinteractiveand
backgroundbearersthatuseDCHsinuplink;consequently,WeightEDCHisacelllevel
weightfactorofallPSinteractiveandbackgroundbearerstransferringdatawiththeE-
DCH.PrxTargetEDCHistheplannedinterferencetargetvalueoftheE-DCHscheduling
definedwiththePrxMaxTargetBTSmanagementparameter.Prx_ncistheaverage
receivedtotalnon-controllableinterferencepower;itrepresentsthetotalreceived
widebandinterferencewhentheinterferenceshareoftheNRTandstreamingDCHand
E-DCHusersisremovedfromitseeWCDMA RAN RRM Admission Control.Prx_scis
theaveragetotalsemi-controllablereceivedinterferencepowerrelatedtostreaming
users.Averagingisbasedonthesamplesoftheinstantaneoussemi-controllable
interference.PSrx_PS_MaxisthevalueofthePrxTargetPSMaxmanagementparameter
andPSrx_PS_MinisthevalueofthePrxTargetPSMinmanagementparameter.

DecreaseofthePrxTargetPS
TheRNCpacketscheduleroftheRNCdecreasesthevalueofthePrxTargetPS

Issue:06B DN70303923 179


SharinginterferencebetweenHSPAandNRTDCH WCDMARANRRMHSUPA
users

iftheconditionInterference congestion of E-DCHbecomeseffective,and


iftheproducedvalueofthePrxTargetIdealislowerthanthecurrentvalueofthe
PrxTargetPS.

Figure 92 DecreaseofthePrxTargetPS

E-DCHMAC-dflow(s)inthecell
UL NRT DCHuser(s)inthecell

P rx_total received

P rx_total > No
P rx_target_EDCH -

Yes

No
P rx_target_PS>Prx_target_PS_target

Yes

NodecreaseofPrx_target_PS
DecreasePrx_target_PS
Checkincrease

ThestepsizeofthedecreaseisdeterminedwiththePrxTargetPSStepDown
managementparameter,butinawaythatPrxTargetPSisnotdecreasedlowerthan
themaximumofthevaluesofthePrxTargetPSMinmanagementparameterandthe
calculatedidealtargetvaluePrxTargetIdeal.

IncreaseofthePrxTargetPS
TheRNCpacketschedulerincreasesthevalueofPrxTargetPS

iftheconditionInterference congestion of NRT DCHbecomeseffective,and


iftheproducedvalueofPrxTargetIdealishigherthanthecurrentvalueofthe
PrxTargetPS.

180 DN70303923 Issue:06B


WCDMARANRRMHSUPA SharinginterferencebetweenHSPAandNRTDCH
users

Figure 93 IncreaseofthePrxTargetPS

E-DCHMAC-dflow(s)inthecell
UL NRT DCHuser(s)inthecell

P rxNonEDPCHST produced

P rxNonEDCHST > No
P rx_target_PS -

Yes

No
P rx_target_PS>Prx_target_PS_target

Yes

NoincreaseofPrx_target_PS
IncreasePrx_target_PS
Checkdecrease

ThestepsizeoftheincreaseisdeterminedwiththePrxTargetPSStepUpmanagement
parameter,butinawaythatPrxTargetPSisnotincreasedhigherthantheminimumof
thevaluesofthePrxTargetPSMaxmanagementparameterandthecalculatedideal
targetvaluePrxTargetIdeal.

ModificationperiodofthePrxTargetPS
TheadjustmentofthePrxTargetPSisdoneperiodically,andwhenRT-over-NRTis
appliedfornewPSstreamingRB.Thelengthofthemodificationperiodisdefinedwith
thePS target tune period in HSPA-DCH interference
sharing(PrxTargetPSAdjustPeriod)managementparameter.Theparameter
definestheperiodintermsofreceivedtotalinterferencepowerreportingintervals.The
conditionsoftheadjustmentarecheckedineachmodificationperiod.

Issue:06B DN70303923 181


SharinginterferencebetweenHSPAandNRTDCH WCDMARANRRMHSUPA
users

PrioritizationofHSPAandDCHusersinthesharingofthe
interference
ThequantityWeightUL,DCHoftheequationIdealinterferencetargetPrxTargetIdealisthe
celllevelweightfactorofallPSinteractiveandbackgroundbearersthatareusingDCHs
inuplink;consequently,WeightEDCHisacelllevelweightfactorofallPSinteractiveand
backgroundbearersthataretransferringdatawiththeE-DCH.
CelllevelweightfactorsWeightUL,DCHand WeightEDCHareobtainedtoproducefirstfor
eachRRCconnectionthathasaradiolinkestablishedinthecell,weightfactors
Weight(RRC)UL,DCHandWeight(RRC)EDCH.CelllevelweightfactorWeightUL,DCHisthen
equaltothesumofRRCconnection-specificweightfactors Weight(RRC)UL,DCH.
Consequently,theweightWeight(RRC)EDCHisachievedbysummingupthequantities
Weight(RRC)EDCHoverthecell.

Checkingoftheblockingconditionsisdoneeveryschedulingperiodwhentheperiod
sincethelastmodificationofthePrx_Target_PShasexpired.ThePStargettuneperiod
isspecifiedwiththePrxTargetPSAdjustPeriodmanagementparameter.
TheweightvalueofanRRCconnectiondependsonthetrafficclassesandtraffic
handlingpriorityvaluesofitsNRTPSradioaccessbearers,andalsoonwhetherthe
bearerisusingHS-DSCHorDCHindownlinkdatatransfer.TheweightvalueofanRRC
connectionistheweightofitshighestpriorityNRTPSradiobearer.WhetheranRABis
includedintheHSPAtraffictypeorNRTDCHtraffictypedependsonthetransport
channelconfigurationthatitsradiobearerisusingindownlinkanduplink.
EachNRTPSradioaccessbeareroftheRRCconnectionisassignedaweightvalue
Weight(RAB)UL,DCHandWeight(RAB)EDCH dependingonitsuplinktransportchannel
type,DCHorE-DCH,thatis,whethertheRRCconnectionhasanE-DCHMAC-dflow
establishedfortheRABornot:

Figure 94 RAB-specificweightsinDCHandE-DCHconfigurations

ASdenotestheactivecellsetoftheRRCconnection.ThequantityWeight(RAB)HSDPAis
theweightoftheRABwhenithasaHS-DSCHMAC-dflowestablished;itsvalueis
definedwiththesetoftheparametersWeightHSPABG,WeightHSPATHP1,
WeightHSPATHP2andWeightHSPATHP3ofthemanagementparameterstructure
Weight of HSPA UE(WeightHSPA).Consequently,Weight(RB)DCHistheweightofthe
RABwhenitdoesnothaveaHS-DSCHMAC-dflowestablished;itsvalueisdefinedwith
thesetoftheparametersWeightDCHBG,WeightDCHTHP1,WeightDCHTHP2and
WeightDCHTHP3ofthemanagementparameterstructureWeight of NRT DCH
UE(WeightDCH).ManagementparametersareoriginallyintroducedinWCDMA RAN
RRM HSDPA.
Thedefinitionofthecell-specificweightsisbasedonthenumberofthePSNRTRABs
andprioritizationbetweentheirtrafficclassesinteractiveandbackground-andtraffic
handlingpriorities(THP)oftheinteractiveclass.DifferentiationbetweentheHSPAand
DCHisbasedontheexistenceoftheMAC-dflow;itenablesthecontrolleddifferentiation
betweenHSPAandDCHusersinthesharingoftheuplinkinterference.

182 DN70303923 Issue:06B


WCDMARANRRMHSUPA SharinginterferencebetweenHSPAandNRTDCH
users

Aparticulartrafficclassortraffichandlingprioritycanbeexcludedindeterminationofthe
weightvaluesbysettingitsweightvalueto0withtheWeightHSPAandWeightDCH
parameters.Ifallweightvaluesaresetto0,thecelllevelweightvalueobtainsvalue1
forbothWeightEDCHandWeightDCH.
TheweightvalueisdeterminedforeachRRCconnectionwhichhaseitheruplinkDCHor
E-DCHallocatedforaPSNRTRAB.Inthecaseofmulti-RAB,thevalueoftheRABwith
thehighestpriorityisused.
CellleveluplinkDCHandE-DCHweightsarecalculatedbysumminguptheRRC
connectionspecificuplinkDCHandE-DCHweights:

Figure 95 CellleveluplinkDCHandE-DCHweightfactors

whereARPuserrepresentstheweightvaluerelatedtotheARPoftheUEspecifiedbythe
RNClevelARPWeightparameter.IftheQoS aware HSPA Schedulingfeatureisnot
activatedinthecell,afixedweightof1isusedforallARPvalues.Formoreinformation,
seeWCDMA RAN RRM HSDPA.

Example
ThetableTable32:ExamplemappingoftheRABspecificDCHandHSDPAweights
showsanexamplehowtheRABspecificDCHandHSDPAweightvaluesaredefined
withthemanagementparameterstructuresWeightDCHandWeightHSPA.

Table 32 ExamplemappingoftheRABspecificDCHandHSDPAweights

Trafficclassof Parameterstructure Parameterstructure
RAB WeightHSPA WeightDCH

Parameter Value Parameter Value

InteractiveTHP WeightHSPATH 100 WeightDCHTH 90


1 P1 P1

InteractiveTHP WeightHSPATH 75 WeightDCHTH 65


2 P2 P2

InteractiveTHP WeightHSPATH 50 WeightDCHTH 40


3 P3 P3

Background WeightHSPAB 25 WeightDCHBG 15


G

Issue:06B DN70303923 183


SharinginterferencebetweenHSPAandNRTDCH WCDMARANRRMHSUPA
users

ConsiderthatsixRRCconnections,RRC1,RRC2,RRC3,RRC4,RRC5andRRC6,
havetheradiolinksinthecell.RRCconnectionshavethefollowingPSinteractiveand
backgroundRABsestablishedwiththeirtransportchannelconfigurations:

RRC1: PSbackgroundRABDCH/DCHconfiguration

RRC2: PSinteractiveRABofTHP1inDCH/DCHconfiguration
PSinteractiveRABofTHP3inDCH/DCHconfiguration
PSbackgroundRABinDCH/DCHconfiguration

RRC3: PSinteractiveRABofTHP2inHS-DSCH/DCH
configuration

RRC4: PSinteractiveRABofTHP2inHS-DSCH/E-DCH
configuration

RRC5: PSinteractiveRABofTHP1inHS-DSCH/E-DCH
configuration

RRC6: PSinteractiveRABofTHP1inHS-DSCH/E-DCH
configuration

AverageroundedRRCconnectionspecificULDCHandE-DCHweightfactorsarethen
producedfromtheRABspecificweightfactors:

RRC1: Weight(RRC1)UL,DCH=15.

RRC2: Weight(RRC2)UL,DCH=90.

RRC3: Weight(RRC3)UL,DCH=75.

RRC4: Weight(RRC4)EDCH=75.

RRC5: Weight(RRC5)EDCH=100.

RRC6: Weight(RRC6)EDCH=100.

CelllevelweightfactorsarethenachievedfortheHSPAusersandDCHusers:
WeightEDCH=Weight(RRC4)EDCH+Weight(RRC5)EDCH+Weight(RRC6)EDCH=75+
100+100=275
WeightUL,DCH=Weight(RRC1)UL,DCH+Weight(RRC2)UL,DCH+Weight(RRC3)UL,DCH=15
+90+75=180
NowtheweightrationrtDCHoftheEquationIdealinterferencetargetPrxTargetIdeal
canbesolvedfromthecelllevelweightfactors:
nrtDCH=WeightUL,DCH /(WeightEDCH+WeightUL,DCH)=180/(275+180)=0.40

Assumenowthefollowingvaluesforthemanagementparameters(valuesare
expressedinrelationtothenoisepowerlevel):

184 DN70303923 Issue:06B


WCDMARANRRMHSUPA SharinginterferencebetweenHSPAandNRTDCH
users

ValuePrxTtargetEDCHoftheplannedinterferencetargetPrxMaxTargetBTSforE-DCH
scheduling:6dB=3.98.
ValueoftheplannedinterferencetargetPrxTargetforDCHresourceallocation:4dB.
ValuePSMaxofPrxTargetPSMax=4dB=2.51.
ValuePSMinofPrxTargetPSMin=2dB=1.58.
ValueofPrx_ncistheaveragereceivedtotalnon-controllableinterferencepower:1
dB=1.26.
ValueoftheincreasestepsizeparameterPrxTargetPSStepUp:0.5dB.
ValueofthedecreasestepsizeparameterPrxTargetPSStepDown:0.5dB.

NowwecancalculatethevalueoftheidealinterferencetargetfromtheequationIdeal
interferencetargetPrxTargetIdeal:
PrxTargetIdeal=MIN{MAX[1.26+0.40(3.981.26),1.58]2.51}=2.35=3.7dB.
ConsiderthatthecurrentvalueofthedynamicinterferencethresholdPrxTargetPSof
theNRTDCHschedulingequals3.9dB.IftheE-DCHsareintheinterference
congestioninthewaytheconditionInterferencecongestionofE-DCHdefinesit,the
PrxTargetPScanbedecreasedbythestepof0.5dBtothenewvalueof3.7dB.
AlthoughtheuplinkNRTDCHswerealsoexperiencingtheinterferencecongestion
undertheconditionInterferencecongestionofNRTDCH,thevalueofthePrxTargetPS
cannotbeincreased,becausetheidealinterferencetargetPrxTargetIdealgetsa
valuelowerthanPrxTargetPScurrentlyhas.
NotethatinthisexamplethevalueoftheARPWeightparameterisassumedtobe1for
allusers.

12.3 UplinkNRTDCHoverloadcontrolintheE-DCHcell
TheconventionaluplinkoverloadcontroloftheNRTDCHresourcesappliestheRRC
TFC-controlprocedureinthereductionoftheuplinkdatarates.ItleavestheuplinkDCH
resourcesintheBTSuntouched;partoftheBTSHWresourcesisnotavailableforthe
E-DCHtraffic.TheBTScanalsouseatoobiguplinkowncellDCHloadfactorinits
throughputbasedE-DCHscheduling.BecausetheNBAPsignalingdoesnothave
meansfortheTFCSsubsetdefinitions,theonlywaytoupdatetheBTSwithnewuplink
DCHparametersistousetheNBAPradiolinkreconfigurationprocedures.Therefore,
thefollowingoverloadcontrolalgorithmisemployedfortheuplinkNRTDCHand
streamingDCHandE-DCHresourcesintheSRNCwhentheHSUPAhasbeen
configuredinthecell.
Thegeneralthroughputandinterference-basedconditionstodetecttheoverloadofthe
uplinkDCHandstreamingE-DCHresourcesinacellare(forstreamingoverload
conditionsarealwaysverifiedtoPrxTargetandnevertoPrxTargetPS):

Figure 96 GeneralconditionsoftheuplinkDCHoverload

Issue:06B DN70303923 185


SharinginterferencebetweenHSPAandNRTDCH WCDMARANRRMHSUPA
users

Formoreinformationonconditionsandtheirquantities,seeWCDMA RAN RRM


Admission ControlandWCDMA RAN RRM Packet Scheduler;aswellastheSection
MinimumtotalE-DCHthroughputofthecell.

LDCH,CELListheowncellloadfactorofalluplinkDCHusers.
LncEDCH,CELLisnotappliedandisconsideredtobesetto0.
LEDCH_Streaming,CELListheloadfactorofstreamingRBsonE-DCH.
LminDCHistheminimumuplinkloadthresholdfortheDCHresourceallocation.Its
valuesaredefinedwiththeInterference margin for the minimum UL DCH
load(PrxLoadMarginDCH)managementparameter.
LmaxDCHisthemaximumuplinkloadthresholdfortheDCHresourceallocation.Its
valuesaredefinedwiththeInterference margin for the maximum UL DCH
load(PrxLoadMarginMaxDCH)managementparameter.
Prx_targetisthevalueoftheTarget for received power(PrxTarget)management
parameterorissetequaltodynamicinterferencetargetPrxTargetPSoftheuplink
NRTDCHscheduling;theSectionDynamicinterferencetargetintheuplinkNRT
DCHschedulingspecifieswhichoneisusedeachtime.
PrxOffsetisthevalueoftheOffset for received power(PrxOffset)management
parameter.
PrxNonEDCHSTistheaveragereceivedinterferencepowerofthenon-EDCHscheduled
transmissionusersasspecifiedintheSectionReceivedE-DCHpowershare.

IfthesumoftheuplinkDCHandE-DCHstreamingresourcesisoverloaded,thecell-
specificpacketschedulerofSRNCstartsmodificationorreconfigurationoftheuplink
DCH(s)oftheInteractiveorBackgroundclassradiobearers.TheDCH time limit for UL
NRT DCH overload in E-DCH cell(OCULNRTDCHGrantedMinAllocT)management
parameterdefineswhetheritispossibletodecreasethebitrateandatthesametime
reconfiguretheuplinkDCHparameterstotheBTSorevenreleasetheDCH.IftheDCH
hasbeenallocatedforlongertimethanthevalueofthe
OCULNRTDCHGrantedMinAllocTparameterdefines,theoverloadcontrolactionis
possibletobedoneasaradiolinkreconfigurationprocedure;seetheFigureExampleof
enhancedoverloadcontrolfortheULNRTDCHradiobearer,
OCULNRTDCHGrantedMinAllocTandLoadControlPeriodPSinteractions.Allocationtime
ismeasuredfromthemomentwhenanon-zerobitrateisallocatedfortheDCHin
uplink.TheresultoftheDCHreleasecanbetheDCH0/0orRRCstatechangefrom
CELL_DCHtoCELL_FACH,dependingontheservicecombinationoftheRRC
connection.
Theselectionoftheradiobearers,whosebitrateshavetobedecreased,isdoneinthe
followingorder:

1. ThecandidatePSNRTbearers,whichusebitratehigherthantheinitialDCHbit
rate,areselectedasfirstforadowngrade.Later,thePSbearerofthelowestQoS
priorityisselectedfromtheprimarilyselectedPSRBofthehighestDCHbitrate.
AmongthePSbearersofthelowestQoSpriority,theonewhichhasthelongest
DCHallocationtimeisselected.QoSpriorityisdefinedwiththe
QoSPriorityMappingmanagementparameter.
2. WhenthecellhasonlyPSNRTbearersoftheinitialorlowerDCHbitratesavailable,
thePSbearerofthelowestQoSpriorityisprimarilyselected.AmongthePSbearers
ofthelowestQoSprioritytheonewhichhasthelongestDCHallocationtimeis
selected.AlsoPSstreamingRBscanbereleased.Thismayoccuronlyafterthe

186 DN70303923 Issue:06B


WCDMARANRRMHSUPA SharinginterferencebetweenHSPAandNRTDCH
users

NRTRBsarereleased,becausestreamingRBshavealwayshigherprioritythanthe
NRTRBs.Transportchannel,wherethePSstreamingRBismapped(DCHor
EDCH),doesnotaffectthedecision.
3. InactivePSbearersaretakenintoaccountasthecandidatesforselection,butthey
areexcludedfromthepowerestimationastheyarealreadypartiallyinvisibleinthe
nextreceivedcommonmeasurementreport.DowngradingoftheDCHbitratesofthe
PScallsisperformedinthefollowingway:
FirstlyallPScallsmustbedowngradedtoinitialbitratelevelbeforeanyofthem
canbedowngradedtotheminimumbitratelevel.
FinallytheUEswiththeminimumbitratesaremovedtotheCELL_FACHstate
ortheDCHisreconfiguredto0/0whentheUEhasotherbearersactive.

IntheDRNC,theprioritizationorderstartsfirstbasedontheIurPriorityparameter
value.Thenextstepsareasdescribedabove.
ThefollowingadditionalprinciplesareappliedinthereductionoftheuplinkNRTDCH
overload:

IfthemaximumloadthresholdLmaxDCHisexceeded,downgradingisdoneinone
overloadperiodsothatthesumofthecurrentDCHloadfactorLDCH,CELLandthe
currentE-DCHstreamingloadfactorLEDCH_Streaming,CELLisreducedwiththevalue
MIN(LDCH,CELL + LEDCH_Streaming,CELL - LmaxDCH, LnrtDCH,CELL). LnrtDCH,CELListheown
cellloadfactoroftheuplinkNRTDCHusers;itisintroducedinWCDMA RAN RRM
Admission Control.TheMaximum uplink power decrease in packet
scheduling(DeltaPrxMaxDown)powerdecreaselimitparameterisignored.
IftheinterferencedomainoverloadthresholdPrx_target + Prx_offsetisexceeded,
downgradingisdonesothatthequantity(LDCH,CELL + LEDCH_Streaming,CELL- LminDCH)
keepsnon-negativewhenthesumoftheuplinkDCHloadfactorLDCH,CELLandE-
DCHstreamingloadfactorLEDCH_Streaming,CELLisreducedbecauseoftheoverload
actions.TheDeltaPrxMaxDownpowerdecreaselimitparameterisapplied.

TFC-controlmethodisusedwhentheallocationtimeforthemodifiedDCHislowerthan
OCULNRTDCHGrantedMinAllocT.Thephysicalresourcesarenotmodifiedinthis
case.WhentheallocationtimeforthemodifiedDCHishigherthan
OCULNRTDCHGrantedMinAllocT,theRRCradiolinkreconfigurationprocedureis
applied.
Ittakessometimebeforethedecreaseintheinterferenceisvisibleinthecommon
measurementreportsreceivedbytheRNCfromtheBTS.Thisdelaycanbelongerthan
theschedulingperiod,therefore,itisnecessarytowaituntiltheloadcontrolactionshave
affectedittopreventnewunnecessaryloadcontrolactionsinthenextschedulingperiod.
ThePS load control period(LoadControlPeriodPS)managementparameter
determineshowfrequentlythepacketscheduleroftheSRNCcanperformloadcontrol
actionsinthecellinquestion.

Issue:06B DN70303923 187


SharinginterferencebetweenHSPAandNRTDCH WCDMARANRRMHSUPA
users

Figure 97 ExampleofenhancedoverloadcontrolfortheULNRTDCHradiobearer,
OCULNRTDCHGrantedMinAllocTandLoadControlPeriodPSinteractions
Overloaddetection
OCULNRTDCHGrantedMinAllocT
BitRate TheDCH
modification
isnotallowed
LoadControlPeriod dueto Load-
UL DCH Bitrate
Allocation upgraded ControlPeriod
Inactivity timer
forNRT RB
time

Minimum
allowed
BitRate Time
Scheduling
andRRind Bitratedecreaseddueto overload. Bitratedecreased,
Period TFCsubsetmethod isused. RL reconfiguration isused
RL reconfiguration isnotallowed (orswitched toCCH)

Figure98:Exampleofloaddecreasealgorithm,DCHmodificationandFigure99:
Exampleofloaddecreasealgorithm,DCHmodificationandreleasegiveexamplesofthe
enhancedoverloaddecreasealgorithm.Initialbitrateisassumedtobeequalto128
kbpsandtheminimumbitrateto16kbps.

Figure 98 Exampleofloaddecreasealgorithm,DCHmodification

Figure 99 Exampleofloaddecreasealgorithm,DCHmodificationandrelease

WhenthemaximumDCHbitratesoftheNRTradiobearershavebeendowngradedfor
theuplinkDCHoverload,andtheoverloadsituationisover,theoriginalDCHbitrates
aregivenbacktothosebearerswhosebitratesweredecreasedbeforeanynewDCH
allocationsaremade.

188 DN70303923 Issue:06B


WCDMARANRRMHSUPA SharinginterferencebetweenHSPAandNRTDCH
users

12.4 LoadbasedhandoveranddirectedRRCconnection
setup
WhentheHSUPAhasbeenconfiguredinthecell,thetriggersandthresholdsoftheload
basedhandoversanddirectedRRCconnectionsetupsdifferfromtheonesdefinedfor
thenon-HSUPAcells:

TheaveragereceivedinterferencepowerPrxNonEDCHofthenon-EDCHusersdefines
theinterferencepowerinsteadofthereceivedtotalwidebandpower.SeetheSection
ReceivedE-DCHpowershare.
TheMax PS target in HSPA-DCH interference sharing(PrxTargetPSMax)
managementparameterdefinestheupperlimitthresholdforthereceived
interferenceinsteadoftheTarget for received power(PrxTarget)management
parameter.

FormoreinformationonloadbasedhandoveranddirectedRRCconnectionsetup,see
WCDMA RAN RRM Handover Control.

Issue:06B DN70303923 189


PowercontrolforHSUPAdownlinksignalingchannels WCDMARANRRMHSUPA

13 PowercontrolforHSUPAdownlinksignaling
channels

g NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.

WithHSUPA,newdownlinkchannelsareintroduced:

TheE-HICH(E-DCHHARQAcknowledgmentIndicatorChannel)
TheE-RGCH(E-DCHRelativeGrantChannel)
TheE-AGCH(E-DCHAbsoluteGrantChannel)

TheHSUPARRMalgorithmintheRNCreservestherequiredcodesandpowerforthe
E-AGCHandE-RGCH/E-HICHphysicalchannels.
ThesecondE-AGCHissetupinthecellifE-TTI=2msissupported.

13.1 SettingthepowersforHSUPAdownlinksignaling
channels
Thissectionprovidesinformationonparametersthatcanbeusedbytheoperatorto
adjustthenecessarypowersforphysicalchannelsE-AGCHandE-RGCH/E-HICH.
However,thedefaultvaluesarecarefullyplannedsothattherequiredgradecanbe
reached.
WhenthepowercontrolparametersofHSUPAdownlinksignalingchannelsare
modified,theRNCdetectswhetherthecellinquestionisconfiguredtotheWBTSby
checkingtheNBAPCommModeRNPparameter.

ProprietaryE-AGCHandE-RGCHpoweroffsetsandmaximumE-
HICHpowerforWBTS
TheRNCsignalsproprietaryE-AGCHandE-RGCHpoweroffsetsandthemaximumE-
HICHpowertotheWBTS.Thevaluesfortheinformationelementsarereadfromthe
followingRNPparameters.Theseparametersaremodifiableonlywhenthecellin
questionislocatedinaWBTS:

ThetransmissionpoweroffsetoftheE-AGCH(PtxOffsetEAGCH)
ThisparameterdefinesthetransmissionpoweroftheE-DCHAbsoluteGrant
Channel.E-AGCHpowerisrelatedtothetransmissionpowerofprimaryCPICH.
ThetransmissionpoweroffsetoftheE-RGCH(PtxOffsetERGCH)
ThisparameterdefinesthetransmissionpoweroftheE-DCHRelativeGrant
Channel.E-RGCHpowerisrelatedtothetransmissionpowerofprimaryCPICH.
ThemaximumtransmissionpowerE-HICH(PtxMaxEHICH)
ThisparameterdefinesthemaximumtransmissionpoweroftheE-DCHHARQ
AcknowledgmentIndicatorChannel.E-HICHpowerisrelatedtothetransmission
powerofprimaryCPICH.

190 DN70303923 Issue:06B


WCDMARANRRMHSUPA PowercontrolforHSUPAdownlinksignalingchannels

NBAPinformationelementsarecell-specific,andtheyaresignaledindependentlyto
eachcelloftheWBTSusingtheprivateNBAP:CONFIGURATIONDATAmessage.The
changeoftheparametervaluedoesnotaffectanexistingcellconfiguration.

RNCsignalsE-AGCH,E-RGCHandE-HICHpoweroffsetstoWBTS
ThisfunctionisvalidwhenDPCHorF-DPCHisused.
TheRNCsignalsproprietaryannexZ-specificE-AGCH,E-RGCHandE-HICHpower
offsetstoWBTSsimilarlyasinRU10(definedintheSectionProprietaryE-AGCHandE-
RGCHpoweroffsetsandmaximumE-HICHpowerforWBTS).TheRNCdoesnotsignal
E-DCH2msTTIspecificproprietaryannexZE-AGCH,E-RGCHandE-HICHpower
offsetstotheWBTS.
Inaddition,theRNCsignals3GPP-specificE-AGCH,E-RGCHandE-HICHpower
offsetstoWBTSwhenitsupportsE-DCHTTI=2ms.E-DCHTTI=2mssupport
informationprovidedbyWBTSviaNBAPindicatestotheRNCthatWBTSisconfigured
withnewHWandSWcapableofhandling3GPP-specificE-xxCHpoweroffsets.
Thevaluesforthe3GPP-specificinformationelementsthataresenttoWBTSareread
fromthefollowingRNPparametersasfollows(dBnotation):

ThevalueforinformationelementE-AGCHPowerOffsetisreadfromthesumof
RNPparameters:

-8dB-Ptx,max+PtxOffsetEAGCHDPCCH+PtxOffsetExxCH2ms+
PtxOffsetExxCHSHO

ThevalueforinformationelementE-RGCHPowerOffsetisreadfromthesumof
RNPparameters:

-14dB-Ptx,max+PtxOffsetERGCHDPCCH+ PtxOffsetExxCH2ms+
PtxOffsetExxCHSHO

ThevalueforinformationelementE-HICHPowerOffsetisreadfromthesumofRNP
parameters:

-14dB-Ptx,max+PtxOffsetEHICHDPCCH+ PtxOffsetExxCH2ms+
PtxOffsetExxCHSHO
IfE-DCHTTItobeutilizedis2ms,thevalueoftheRNPparameter
PtxOffsetExxCH2msisaddedtothesignaledvalue.Otherwise,forexample,whenE-
DCHTTIis10ms,noaddingisdone,thevalueofPtxOffsetExxCH2msinequationsis
0.
IfaconnectionenterstheE-DCHsofthandoverstate(forexample,non-servingE-DCH
RLSexists),andF-DPCHdoesnotexist,thevalueoftheRNPparameter
PtxOffsetExxCHSHOisaddedtothesignaledvalue.Otherwise,forexample,whenthe
connectionisnotintheE-DCHsofthandoverortheF-DPCHexist,noaddingisdone,
thevalueofPtxOffsetExxCHSHOinequationsis0.BothRNPparameters
PtxOffsetExxCH2msandPtxOffsetExxCHSHOareaddedtothesignaledvaluesif
E-DCHTTIis2ms,theconnectionisintheE-DCHsofthandoverstateandnoF-DPCH
exists.
ParametersPtxOffsetExxCH2msandPtxOffsetExxCHSHOaremodifiableinthe
GUIonlywhenthecellinquestionislocatedintheWBTS.

Issue:06B DN70303923 191


PowercontrolforHSUPAdownlinksignalingchannels WCDMARANRRMHSUPA

ParametersPtxOffsetEAGCHDPCCH,PtxOffsetERGCHDPCCHand
PtxOffsetEHICHDPCCHareexistingparametersusedinRU10forNBxxxandnowin
RU20,modifiedtobesuitableforbothWBTSandNBxxx.Parametersaremodifiablein
GUIwhenthecellinquestionislocatedinNBxxxorWBTS.
Ptx,maxisamaximumpoweroftheradiolinkinrelationtoP-CPICH.Possibleservice
combinationsare:

standaloneSRB
SRB+AMR
F-DPCH

-8dBand-14dBintheequationsareneededtosetthetargetleveltoexistinglevel
whichis-5dBand-11dBbelowP-CPICHpowerafterSHOcompensation(thedefault
valueis3dB).
NBAPinformationelementsareradiolinkspecific,andtheyaresignaledindependently
toeachradiolinkthatbelongstoE-DCHactiveset.However,informationelementE-
AGCHPower OffsetissignaledonlytotheHSPAservingcell.ValuesofthesignaledIEs
ofallradiolinksarereconfigurediftheE-DCHTTIchangesorifthesofthandoverisset
uporreleased.Theparametervalueisreadonlywhenaradiolinkissetupor
reconfigured.Thatis,changingthevalueoftheparameterdoesnotaffecttheexisting
radiolinks.

192 DN70303923 Issue:06B


WCDMARANRRMHSUPA HSUPAhandovers

14 HSUPAhandovers

g NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.

HandoversenablethemobilityofaHSUPA-capableUEwhentheE-DCHchannelis
allocatedfortheUE.Itwidensthecoverageareaofagivenbitrate.Thegainis
significant,especially,withhighbitrates.Softhandover(SHO)gainforE-DCHissimilar
inmagnitudetothetraditionalR'99DCHSHO.

14.1 Softhandovers
Thefollowingsoft/softerhandovers(SHO)aresupportedforE-DCH:

Intra-BTSintra-RNCsofterhandoverbetweencellswhichbelongtothesameLCG
Intra-BTSintra-RNCsofthandoverbetweencellswhichbelongtodifferentLCGs
Inter-BTSintra-RNCsofthandover
Inter-RNCsoft/softerhandover(IfHSPA over Iurfeatureisenabled)

IftheHSPA over Iurfeatureisdisabledthen,incaseofaninter-BTSinter-RNCsoft


handover,E-DCHisnotconfiguredtoasofthandoverbranchunderthedriftRNC.The
signalinglinkandDCHforAMRvoicecallcanbeconfiguredtoasofthandoverbranch
underthedriftRNC.
Inanintra-BTSintra-RNCsofterhandoverwithintheLCG,theE-DCHactivesetneeds
tobeidenticalwiththeDCHactiveset.Thatmeans,theE-DCHisconfiguredtothenew
softerhandoverbranchonlyifotherbranchesunderthesameLCGhaveE-DCH
allocated.
Incaseofinter-BTSsofthandoverandintra-BTSsofthandoverbetweenLCGs(contrary
tointra-BTSsofterhandoverwithinLCG)theDCHactivesetcanbedifferentfromtheE-
DCHactiveset.ThisallowsanadditionofacellthatdoesnotsupportE-DCHtothe
DCHactiveset.
Duringtheintra-BTSsofthandoverbranchaddition,theE-DCHisconfiguredtothenew
softhandoverbranchregardlessofthechanneltypeoftheSHObranchesinotherLCGs
underthesameBTS.IftheE-DCHactivesetupdatefailsandthereisnootherSHO
branchunderthisLCG(softhandover),thecellisleftoutfromE-DCHactivesetanditis
addedtotheDCHactiveset.Thatis,anactivesetcell(orcells)inoneLCGmight
belongtotheE-DCHactivesetwhileotheractivesetcell(orcells)inanotherLCGmight
not.

14.1.1 E-DCHactiveset
E-DCHactivesetdefineswhichcellsparticipateintheE-DCHtraffictransmission.E-
DCHactivesetisasubsetoftheDCHactiveset(whichcarriesthesignalinganda
possiblesimultaneousAMRvoicecall).ThemaximumnumberofcellsinaE-DCHactive
setisthree(likeforDCH).

Issue:06B DN70303923 193


HSUPAhandovers WCDMARANRRMHSUPA

AnE-DCHactivesetisbuiltwhentheE-DCHchanneltypeisselected.Allcellsinthe
DCHactivesetareaddedtotheE-DCHactivesetifpossible.Thefollowingreasonscan
preventRNCfromaddingthecelltotheE-DCHactiveset.

1. HSUPAisnotenabledforthecell.ThisisdefinedwiththeHSUPAEnabledRNP
parameter.
2. AcellisunderDRNC.ThesofthandoverovertheIurinterfaceissupportedforE-
DCHifHSPAovertheIurfeatureisenabled.Otherwise,whenadriftingRNCgets
therequesttoaddasofthandoverbranchforanUEwiththeE-DCHchanneltype,
thedriftingRNCrejectstherequest(IfHSPAoverIurisdisabled,seeSofthandover
overIur).
3. ThemaximumnumberofE-DCHusersisreachedinthecellorintheBTS-specific
localcellgroup.
4. TherearenotanyfreeE-DCHresourcesintheBTS-specificlocalcellgroup.
5. Someotherreasons(forexample,signalingproblems).

AcellwithoutHSPAPSstreamingsupportcanbeaddedtoanE-DCHactivesetifthe
BTSSWsupportsit.Thatcell,however,cannotbeselectedasaservingcell.
IfacellcannotbeaddedtotheE-DCHactivesetwhenitisbuilt,theRNCchecksifE-
DCHcanbetakenintouse.TheE-DCHactivesethastobeacceptablewhenthecellor
cellsthatcannotbeaddedtotheE-DCHactivesetareleftoutfromtheE-DCHactive
set.NotealsothatthesofterhandoverbranchofthecellthatcannotbeaddedtotheE-
DCHactivesetneedstobeleftoutfromtheE-DCHactiveset.AcceptableE-DCHactive
setisdefinedintheSectionChanneltypeselectionbetweenDCHandE-DCH.
IfE-DCHisallocated,butthecellisleftoutfromtheE-DCHactiveset,theRNCtriesto
additlater.IfaddingthecelltotheE-DCHactivesetfailedbecauseofcapability-related
reasons(causes1and2inthenumberedlistabove),theRNCdoesnottrytoaddthe
celltotheE-DCHactiveset.IfaddingthecelltotheE-DCHactivesetfailedbecauseof
capacity-relatedreasons(causes3,4and5inthenumberedlistabove),theRNCtries
toaddthecelltotheE-DCHactivesetperiodicallyuntilitsucceeds,orthecellis
removedfromtheDCHactiveset.
TheE-DCHactivesetshouldbeequaltotheDCHactivesetfortheHSUPA2msTTI,
theF-DPCHandtheCSvoiceoverHSPA.
TheRNCupdatestheE-DCHactivesetwhenE-DCHisallocatedandtheDCHactive
setneedstobeupdated(1Aor1CmeasurementreportreceivedfromtheUE).The
reasonslistedabove(inthenumberedlist)cancauseafailureinE-DCHactiveset
updating.IfacellcannotbeaddedtotheE-DCHactiveset,theRNCevaluatesiftheE-
DCHactivesetisstillacceptablewithoutthatcell.IftheE-DCHactivesetisstill
acceptablewithoutthatcell,E-DCHusagecancontinue.Ifnot,channeltypeneedstobe
switchedtotheDCH.NotethatifacellcannotbeaddedtotheE-DCHactiveset,andif
thereisalreadyasofthandoverbranchwithE-DCHallocationunderthesameLCGof
theBTS,thechanneltypeisswitchedtotheDCH.

14.1.2 Parametersetsinsofthandover
HSUPAbringstwonewmeasurementparametersetsusedforintra-frequency
measurementcontrol(FMCS).TheidentifierHSPAFmcsIdentifierisusedwhenanNRT
PSRABand/orstreamingPSRABisestablishedthathasanHS-DSCHandanE-DCH
transportchannelallocated.TheidentifierRTWithHSPAFmcsIdentifierisusedwhenan
AMRspeechCSRABisestablishedsimultaneouslywithanNRTPSRABand/or
streamingPSRABthathasanHS-DSCHandanE-DCHtransportchannelallocated.

194 DN70303923 Issue:06B


WCDMARANRRMHSUPA HSUPAhandovers

Otherwise,thesamemeasurementcontrolandhandoverpathparametersetsareused
aswithHSDPA.

14.1.3 SRNCrelocation
AsHS-DSCHusageisarequirementforE-DCHusage,theSRNCrelocationforHSUPA
followsthesameprinciplesasforHSDPA.IfanSRNCrelocationistriggered,the
channeltypeisswitchedfromE-DCHtoDCH.
AttheRNCborder,HSPARABsarereconfiguredtoDCH.Aninter-RNCcellchangeis
performedforpuremultipleNRTRABsiftheHSPAInter-RNCCellChangefeatureis
active,andtheRABcombinationissupportedforHSPA.IfmultipleNRTRABsare
combinedwitheitherAMRorPSstreamingRABsorboth,andthisRABcombinationis
supportedforHSPA,thechanneltypeisswitchedfromHSPAtoDCH/DCH.
Intheeventofaninter-frequencyhandover,aninter-RNCinter-frequencyhardhandover
isusedforallRABtypes.
ThetargetRNCofanHSPAInter-RNCcellchangeallocatesresourcesaccordingtoits
capabilityandtotheactivatedfeatures.TheresourcescanbeHSPA(UL/DL),HS-
DSCH/DCH,andDCH/DCH.TherelocationrequestisrejectedbythetargetRNCifthe
targetRNCcannotallocateanyotherresourcesthantheSRBDCH,thesignalinglink.
AfteraUE-not-involvedSRNSrelocationfromtheDCH/DCH,thefollowingRABsare
reconfiguredimmediatelyfromDCH/DCHtoHSPA(UL/DL)orHS-DSCH/DCHifthe
HSPAMultiNRTRABsfeatureisactivated,andiftheresourcesareavailable:

multiNRTRABs
(0or1)AMRRAB
(0or1)PSStreamingRAB

Animmediatetransportchannelallocationisrequired,thatisthepacketschedulerinthe
RNCdoesnotqueueHSPAconnections,andatransferviaDCH0/0kbps,orCell_FACH
isnotallowed.
Formoreinformation,seeWCDMA RAN RRM HSDPAandWCDMA RAN RRM
Handover Control.

14.1.4 Inter-RNCCellChange
Fortheinter-RNCcellchange,thetargetRNCallocatesresourcesonbesteffortbasis,
thatiseventhoughHSPAisprimarilyallocated,DCH/DCHcanbeallocatedwhenHSPA
isnotavailable.TherelocationrequestisrejectedbythetargetRNCifthetargetRNC
cannotallocateanyotherresourcesthanSRBDCH,thatisthesignalinglink.Inother
words,NRTRABscannotbeswitchedtoRB0/0kbpsifnoresourcesareavailable.
WhentheRELOCATIONREQUESTmessageisreceived,acheckisperformedto
determinewhichNRTRABsareactive(HSPAorDCHresourcesallocatedinthesource
side),andresourcesareallocatedforallactiveRABsaccordingtothesupported
features.TheBTSandtransmissionresourcesaresetup.
TheRAN1231:HSPAoverIurfeatureutilizesaUE not involvedSRNSrelocationand
alsoaUE involvedSRNSrelocationiftheIur-interfaceiscongested.TheHSPAoverIur
featureisdescribedinWCDMA RAN RRM HSDPA.
TheHSPAInter-RNCCellChangefeatureisdescribedinthecustomerdocument
WCDMA RAN RRM HSDPA.

Issue:06B DN70303923 195


HSUPAhandovers WCDMARANRRMHSUPA

14.1.5 SofthandoveroverIur
SofthandoveroverIur-interfaceissupportedforE-DCHifRAN1231:HSPAoverIur
featureisenabled.Otherwise,whenthedriftingRNCgetstherequesttoaddasoft
handoverbranchfortheUEwithE-DCHchanneltype,thedriftingRNCrejectsthe
request.
RadioLinkSetup/RadioLinkAddition(branchaddition)forE-DCHMAC-dflowis
supportedoverIur-interfaceonlyforUEswithsinglePSNRTRABcombinationonHSPA
withSRBonDCH.ThishappenswhenHSPAoverIurfeatureisenabled.
TheSRNCcheckstheHSUPACapabilityoftheneighboringDRNCcelltobe
added/replacedand/orE-DCHsupportoftheneighborcelloftheDRNCAScelltobe
added/replacedinordertodetermineifbranchadditionforE-DCHMac-dflowispossible
overIurtoaDRNCcell.
TheSRNCsetsuptheE-DCHMAC-dflowoverIur-interfaceduringbranchadditiononly
iftheHSUPAEnabledVCELparameterissettoEnabled.
TheSRNChandovercontrolcannotdistinguishbetweensoftandsofterhandover
scenariosoverIurwhenanintra-frequencymeasurementreporte1aore1cisreceived
indicatingthataDRNCcellmustbeaddedorreplacedastheBTSIdoftheDRNCBTS
controllingtheDRNCcellandtheLCGIdwheretheDRNCcellbelongsisnotknownin
theSRNC.TheSRNCtreatsallbranchadditionrequestsoverIurasasofthandover
requesttoDRNC.
AccordingtothecurrentsofterhandoverprinciplesdefinedintheSRNCboththesofter
handovercellsmustbeinE-DCHactivesetorneitherofthosecanbeinE-DCHactive
set.Hence,whenasofterhandoverbranchistobeadded,theSRNCrequestsE-DCH
fromthenewsofterhandoverbranchonlyiftheothercellsunderthesameLCGofthe
BTShaveE-DCHallocated.However,thiscannotbeensuredfortheDRNCcellsinthe
ASsincetheSRNCdoesnotknowthatasofterbranchisbeingaddedoverIur.
TheDRNCrejectsthebranchadditionrequest(RNSAP:RadioLinkSetup/Addition
Request)ifE-DCHchanneltypeisrequestedforthenewcelltobeaddedwhiletheother
AScellsunderthesameLCGoftheBTSdonothaveE-DCHallocatedorviceversa.
TheDRNCusestheRNSAPcausevalueRequested Configuration not Supportedinthe
RNSAP:RadiolinkSetup/AdditionFailuremessage.
IncaseoftheUEwithconversationalservicesmappedtoHSPA,anewbranchcannot
beaddedtothecelllocatedundertheDRNC.Ifaddingiscompleted,thenthe
conversationalservices(andSRBs)aremappedtoDCHandafterthat,abranchadding
isperformed.
WhentheextensionofHSPAoverIurfunctionalityisavailable,thesofthandoverover
theIurinterfaceduringanchoringissupportedforE-DCH.
E-DCHisnotattemtedtobesetupoverIuraslongastheE-DCHactivesetcontains
DRNCcellfromwhere'E-DCHnotsupported'causevalueisreceived.
Ifthe002:1902 RN60_MAINT_26PRFILEparameterbit0issettovalue1,theUE-
specificRRCintheDRNCacceptstheRadioLinkSetup/AdditionprocedurewithE-DCH
configurationandcompressedmodeparametersfornon-activecompressedmode(for
activemodeCMSCCisrejected).Ifthe002:1902 RN60_MAINT_26PRFILE
parameterbit0issettovalue0andtheSRNCrequestsRadioLinkSetup/Additionwith
E-DCHconfigurationandcompressedmodeparameters,theDRNCrejectsitinlegacy
manner.

196 DN70303923 Issue:06B


WCDMARANRRMHSUPA HSUPAhandovers

Ifthe002:1902 RN60_MAINT_26PRFILEparameterbit0issettovalue1,theUE-
specificRRCintheDRNCacceptsthechanneltypeswitchrequesttoE-DCH
configuration(withRNSAP:RADIOLINKRECONFIGURATIONPREPAREmessage
fromSRNC)withcompressedmodeparametersfornon-activecompressedmode(for
activemodeCMSCCisrejected).Procedureisalsosupportedwithsimultaneous
servingcellchange.Ifthe002:1902 RN60_MAINT_26PRFILEparameterbit0issetto
value0,theDRNCrejecttheCTSinlegacymanner.

14.2 Servingcellselectionandchange
ServingE-DCHcellisacellfromwhichtheUEreceivesAbsoluteGrantsfromtheBTS
scheduler.AUEhasoneServingE-DCHcell.TheservingE-DCHRLScontainsa
servingE-DCHcellandnon-servingE-DCHcell(s)underthesameBTS.TheUEcan
receivecombinedRelativeGrantfromtheServingE-DCHRLS,andithasonlyone
ServingE-DCHRLS.
TheUEcanalsohaveothernon-servingcellsthatdonotbelongtotheServingE-DCH
RLS.Fromthose,theUEcanreceiveaRelativeGrant.
TheE-DCHservingcellisalwaysthesameastheHS-DSCHservingcell.E-DCHusage
doesnotaffectthetriggeringofHS-DSCHservingcellchangeortheselectionoftheHS-
DSCHservingcell.
ThetriggeringofHS-DSCHservingcellchangeandtheselectionofHS-DSCHserving
cellaredescribedintheSectionHSDPAmobilityhandlinginWCDMA RAN RRM HSDPA.
HSPAinter-RNCcellchangetakescareofHSPAmobilitywithmultipleNRTRABs.For
moreinformation,seeWCDMA RAN RRM HSDPA.
RAN1231: HSPA over Iurfeaturecontainsaninter-RNCservingcellchangefunctionality.
TheHSPAoverIurfeatureisdescribedinWCDMA RAN RRM HSDPA.
ServingcellchangeduringanchoringisperformedbyextensionofHSPAoverIur
functionality.Formoreinformation,seeWCDMA RAN RRM HSDPA.

14.3 ChanneltypeswitchbetweenDCHandE-DCH
E-DCHisusedwhenfeasible.Toenablethischanneltypeswitch,functionalitybetween
DCHandE-DCHisneeded.Inthissection,thetriggersforchanneltypeswitchingand
theexecutionaredescribed.
Ifthechanneltypeswitchistriggered,thenthebestpossibletransportchannel
configurationisselectedfortheUE:

1. PrimarilyfullHSPA
2. AMRandSRBsonDCH+PSonHSPA
3. AMRandSRBsonDCH+PSonHSDPA(PSULonDCH)
4. FinallyfullDCH

TheAMRcodecsetisselectedfromtheconfiguredAMRcodecsetsoftheactiveset
cellswiththealgorithmsspecifiedinWCDMA RAN RRM Admission Control.The
exceptionistheload-basedAMRcodecmodeselection,whichisnotappliedinthe
channel-typeswitch.

Issue:06B DN70303923 197


HSUPAhandovers WCDMARANRRMHSUPA

14.3.1 Triggersforchanneltypeswitch
Triggersforchanneltypeswitchcanbeclassifiedintothefollowingthreecategories.

HS-DSCHrelatedtriggers
Quality-relatedtriggers
Othertriggers

HS-DSCHrelatedtriggersaretriggerswhichcauseDCH<E-DCHchanneltype
switchbecauseofanHS-DSCHrelatedprocedure.TheseHS-DSCHrelatedprocedures
are:

DCHHS-DSCHchanneltypeswitch.
HS-DSCHservingcellchange

Quality-relatedtriggersaretriggersthatcauseaDCH<E-DCHchanneltypeswitch,
becauseacellnotintheE-DCHactivesetistoostrongortooweak.Themainideahere
isthatacellthatcannotbeaddedtotheE-DCHactivesetshouldnotcauseproblems.
ProblemscanoccurifthiscellbecomestoostronganditcannotbeusedforanE-DCH
transmission.ThisleadstoanincreaseintheSIRtargetandanincreaseintheUE
transmissionpower.Toavoidtheproblem,achanneltypeswitchfromE-DCHtoDCHis
performed.
Othertriggersaretheonesnotincludedinthepreviouscategories.Theseare:

EDCHCTSwitchGuardTimerexpires
DCHE-DCHchanneltypeswitchingretrytimerexpires
BTSinitiatedE-DCHDCHchanneltypeswitch
PSstreamingestablishment
E-DCHactivesetupdate
CSvoiceRABestablishment(determineswhetheritispossibletoswitchtothefull
HSPAconfiguration)
ActivesetupdatingsothatfullHSPAconfigurationbecomespossible.
RABcombinationchangetocombinationwhereCSvoiceoverHSPAissupported.

IftheE-DCHcannotbeallocatedintheDCHtoE-DCHchanneltypeswitch,theDCH
usageiscontinuedwiththeexistingconfiguration.ThesamechanneltypeisusedinUL
forPSstreamingandNRTbearer.WhenthechanneltypeisswitchedfromDCHtoE-
DCH,thechanneltypeswitchingisperformedforboththePSstreamingRBandthe
NRTRB.

14.3.2 ChanneltypeswitchfromDCHtoE-DCH
AchanneltypeswitchfromDCHtoE-DCHisrequiredtoensurethatE-DCHcanbe
allocatedevenifitwasnotpossibleintheinitialchannelallocation(theinitialchannel
typeselectionbetweenDCHandE-DCH).Triggersforchanneltypeswitchingcanbe
dividedintotwocategories.

Theinitialtriggersarethosethatcantriggerchanneltypeswitchingeachtimetrigger
conditionsbecomevalid.

198 DN70303923 Issue:06B


WCDMARANRRMHSUPA HSUPAhandovers

ThesecondarytriggersareE-DCHquality-andcapacity-relatedtriggers.Thesecan
triggerchanneltypeswitchingonlyiftheinitialtriggertriggeredaDCHtoE-DCH
channeltypeswitch,ortheinitialchanneltypeselectionwouldhaveselectedE-DCH,
butforthequalityorcapacityreasonthatwasnotpossible.

Theinitialtriggersare:

DCHHS-DSCHchanneltypeswitch
HS-DSCHservingcellchange
PSstreamingestablishment
E-DCHactivesetupdate
EDCHCTSwitchGuardTimerexpires
IftheHSPAcanselecttheCSvoiceRAB,buttheUEdoesnothaveafullHSPA
configuration,thentheCSvoiceRABestablishmentdetermineswhetheritis
possibletoswitchtothefullHSPAconfiguration.Thefollowingarethetriggersforthe
switch:
CSvoiceRABestablishment
ActivesetupdatingsothatthefullHSPAconfigurationbecomespossible
RABcombinationchangetoacombinationwhereCSvoiceoverHSPAis
supported

Thesecondarytriggersare:

E-DCHactivesetchangestoacceptable
DCHE-DCHchanneltypeswitchingretrytimerexpires

Additionally,thefollowingprerequisitesneedtobefulfilledbeforetheDCHtoE-DCH
channeltypeswitchisexecuted:

EDCHCTSwitchGuardTimeriscurrentlynotrunning,theonlyexceptionfromthatrule
beingthecasethataDCHtoHS-DSCHchanneltypeswitchalsotriggerstheDCHto
E-DCHchanneltypeswitch.
Noactiveinter-frequencyorinter-systemhandovercausesexist.
E-DCHactivesetdoesnotcontainanymoreDRNCcellfromwhere'E-DCHnot
supported'causevalueisreceivedforRLaddition/setup/reconfiguration.

Formoreinformation,seeWCDMA RAN RRM Handover Control

DCHHS-DSCHchanneltypeswitch
IfintheinitialchannelallocationtheHS-DSCHcannotbeallocated(initialchanneltype
selectionbetweenDCHandHS-DSCH),theE-DCHisnotallocatedeither.Ifachannel
typeswitchistriggeredfromDCHtoHS-DSCH,achanneltypeswitchfromDCHtoE-
DCHisalsotriggered.
IfHS-DSCHallocationfails,theE-DCHcannotbeallocatedeither.IfHS-DSCHis
allocated,buttheE-DCHcannotbeallocatedforthecellselectedforservingtheHS-
DSCHcell,theE-DCHcannotbeallocated.TheE-DCHactivesetmustbeacceptableto
enabletheDCHtoE-DCHchanneltypeswitch.

Issue:06B DN70303923 199


HSUPAhandovers WCDMARANRRMHSUPA

AchanneltypeswitchfromDCHcanbeperformedonlytotheHS-DSCH/E-DCH
configurationforCSvoiceoverHSPA.AchanneltypeswitchfromtheDCHcanbedone
onlytotheHS-DSCH/E-DCHconfiguration,ifflexibleRLC(FRLC)isapplied(see
WCDMA RAN RRM HSDPAtofindtheconditionsunderwhichFRLCisapplied).Ifthe
configurationHS-DSCH/E-DCHisnotpossible,afixedRLCPDUsizeisapplied.

HS-DSCHservingcellchange
TheE-DCHservingcellisalwaysthesameastheHS-DSCHservingcell.TheE-DCH
servingcellmustalwaysbeE-DCH-capable,andtheE-DCHmustbeallocatedforthat
cell.
WhentheRNChasdecidedtochangetheHS-DSCHservingcell,acheckisperformed
todeterminewhetheraDCHtoE-DCHchanneltypeswitchisneeded.IfthenewHS-
DSCHservingcellsupportsE-DCH,acheckisperformedtodeterminewhetherchannel
typeswitchingcanbeperformed.TheE-DCHactivesetmustbeacceptableand
EDCHCTSwitchGuardTimermustbedeactivatedtoenableDCHtoE-DCHchannel
typeswitch.

PSstreamingRBestablishment
Inamulti-servicecombination,thestreamingRBandtheNRTRBmusthavethesame
channeltype(DCH/E-DCH).ThechanneltypeselectedforthePSstreamingRBupon
RABestablishmentcancausechanneltypeswitchingforthealreadyallocatedNRTRB
iftheNRTRBchanneltypeisDCHandE-DCHistheselectedchanneltypeforthePS
streamingRAB.TheNRTRBchanneltypeisswitchedfromDCHtoE-DCHiftheE-DCH
isavailablefortheNRTRB.

E-DCHactivesetupdate
WhenDCHisallocatedforstreamingandNRTservicesandasofthandoverbranchis
deletedfromtheactiveset,theRNCcheckswhetherallcellssupportE-DCH.TheRNC
triggerschanneltypeswitchingfromDCHtoE-DCHifallofthefollowingconditionsare
true:

AllcellssupportE-DCH.
TheHSPAQoSEnabledparameterissettoONfortheservingHS-DSCHcell.

EDCHCTSwitchGuardTimerexpires
WheneveranE-DCHtoDCHchanneltypeswitchisperformed,the
EDCHCTSwitchGuardTimertimerisset.TheonlyexceptionistheBTS-initiatedE-DCH
DCHchanneltypeswitch,inwhichcasethetimerisnotset.
WhenEDCHCTSwitchGuardTimertimerexpires,ittriggersaDCHtoE-DCHchannel
typeswitch.ThisisdonetoenabletheUEtoreturntoE-DCHasfastaspossibleafter
thesafetyperiod(usedtoavoidtoofrequentchanneltypeswitches)definedwiththe
timer.
AcheckisperformedtodetermineiftheHS-DSCHservingcellsupportstheE-DCH,and
iftheE-DCHactivesetisacceptabletoenabletheDCHtoE-DCHchanneltypeswitch.

200 DN70303923 Issue:06B


WCDMARANRRMHSUPA HSUPAhandovers

Figure 100 EDCHTSwitchGuardTimer


E-DCH DCH EDCHCTSwitch-
channel typeswitch GuardTimer expires

EDCHCTSwitch- DCH EDCH


GuardTimerisset typeswitchtriggered

DCH E-DCHchanneltypeswitchisnotpossible.

time

E-DCHactivesetchangestoacceptable
Ifintheinitialchannelallocation(initialchanneltypeselectionbetweenDCHandE-
DCH),orinachanneltypeswitchfromDCHtoE-DCH,theE-DCHcannotbeallocated
becausetheE-DCHactivesetisnotacceptable,theRNCstartstofollowifE-DCHactive
setchangestoacceptable.AnE-DCHactivesetcanchangetoacceptableifthecellnot
inE-DCHactivesetbecomesweakenoughorisremovedfromtheDCHactiveset.
WeakenoughisdefinedrelativetoservingHS-DSCHcell.Theparameter
EDCHAddEcNoOffsetdefinesthethresholdfortheDCHtoE-DCHchanneltypeswitch
trigger.E-DCHactivesetisacceptable(anon-E-DCHcapablecellisweakenough)if
thefollowingequationistrue.
CPICHEcNoNonEDCHNCell<CPICHEcNoEDCHServingCell+EDCHAddEcNoOffset
Where,

CPICHEcNoNonEDCHNCellistheCPICHEcNomeasurementresultofthenon-E-
DCHcellinquestion,
CPICHEcNoEDCHServingCellistheCPICHEcNomeasurementresultoftheserving
E-DCHcell,
EDCHAddEcNoOffsetistheradionetworkplanningparameterthatdefinesthe
additionoffsetforCPICHEcNomeasurementresults.Theparameteroftheserving
E-DCHcellisused.

Figure 101 E-DCHactivesetchangestoacceptable


DL CPICHEc/No
DCH EDCH
(averaged)

ServingHS-DSCHcell
E-DCHcapablecell

EDCHAddEcNoOffset
(default0dB)

NotE-DCHcapablecell

time

EDCHCTSwitchGuardTimermustnotberunningtoenableaDCHtoE-DCHchannel
typeswitch.

Issue:06B DN70303923 201


HSUPAhandovers WCDMARANRRMHSUPA

DCHE-DCHchanneltypeswitchingretrytimerexpires
Occasionally,intheinitialchanneltypeselectionorintheDCHtoE-DCHchanneltype
switch,theE-DCHcannotbeallocated,becausethemaximumnumberofE-DCHusers
arereachedinthecellorlocalcellgroup.Inasofthandoversituationacheckis
performedtodeterminewhetherthecellmakestheE-DCHactivesetunacceptable.Ifit
doesnot,theE-DCHcanbeallocated.
WhenthemaximumnumberofE-DCHuserspreventschanneltypeswitching,the
internalchanneltypeswitchDCHtoE-DCHretrytimerisset.Thetimergetsthe
followingvalue:
INTERVAL=min(10seconds,NUMBER_OFFAILS*2seconds)(1)
Whenthetimerexpires,theRNCattemptsaDCHtoE-DCHchanneltypeswitch.A
checkisperformedtodeterminewhethertheHS-DSCHservingcellsupportsE-DCH,
whethertheE-DCHactivesetisacceptable,andwhetherEDCHCTSwitchGuardTimer
isnotrunning,toenableDCHtoE-DCHchanneltypeswitch.
NotethatiftheE-DCHactivesetisacceptablewithoutthecellwhereE-DCHallocation
failedbecauseofthemaximumnumberofE-DCHusersreachedinthecellorlocalcell
group,theE-DCHcanbeallocated.TheRNCtriestoaddthatcelltotheE-DCHactive
setlater.

AllocationofstreamingservicesonE-DCH
TheusageofE-DCHforstreamingservicesisprovidedinthesamecoverageareaasfor
HSDPA.BoththeE-DCHandtheHS-DSCHareswitchedtoDCHatsametimeifanew
E-DCH/HS-DSCHservingcellisselectedthatdoesnotsupportstreamingQoSfor
HSPA.
TheRNCcheckstheHSPAQoSEnabledparameterfortheservingE-DCHcell.Ifthe
HSPAQoSEnabledparameterissettoOFF,theE-DCHandtheHS-DSCHcannotbe
usedforstreamingservices
Fornon-servingcells,theE-DCHusageforstreamingservicesdependsonthe
capabilitiesoftheBTS.IftheBTSsupportsstreamingservices,itacceptstheadditionof
thenewstreamingserviceforthenon-servingcell.IftheBTSdoesnotsupport
streamingservices,itrejectsthebranchadditiontotheE-DCHactiveset.Ifpossible,the
cellisaddedtotheDCHactiveset.

ChanneltypeswitchingiftheUEentersanHSDPA/HSPAcell
ChanneltypeswitchingtakesplaceifHSDPA/HSPAbecomesavailableinacellinthe
activesetcurrentcellwhiletheUEmovestowardstheareawhereHSDPAorHSPAis
supported.Thesamecriteriaapplyformulti-NRTRABsandforsingle-NRTRABon
HSPA.
Multiplexingisperformedasfollows:

DCH/DCH->HS-DSCH/UL:DCH:L1multiplexingofDLlogicalchannelsis
reconfiguredtoMAC-hsmultiplexing.
DCH/DCH->HSDSCH/E-DCH:bidirectionalL1multiplexingisreconfiguredtoUL
MAC-emultiplexingandDLMAC-hsmultiplexing.
HS-DSCH/UL:DCH->HSDSCH/E-DCH:L1multiplexingofULlogicalchannelsis
reconfiguredtoMAC-emultiplexing.

202 DN70303923 Issue:06B


WCDMARANRRMHSUPA HSUPAhandovers

TheHSPA multi NRT RABsfeatureisenabledbytheHspaMultiNrtRabSupport


managementparameter.
Normalservingcellselection,admissioncontrol,andresourcereservationsaremadefor
SRBsandRBstobeswitched.
RT-over-NRT,RT-over-RTorpre-emptionactionsarenotusedinaDCHtoHSPAswitch.
IfHSPAresourcesarenotfoundinallswitchedRBsand/orSRBs,theswitchisaborted
andDCHresourcesareused.Whentheswitchretrytimerexpires,andtheconditionsfor
theHSPAusagearestillfulfilled,anotherswitchattemptisperformed.

14.3.3 ChanneltypeswitchfromE-DCHtoDCH
ThechanneltypeswitchfromE-DCHtoDCHisnecessaryifE-DCHusagecannotbe
continuedorifE-DCHusagecausesnon-optimaluseofradioresources.Thefollowing
triggerscancauseanE-DCHtoDCHchanneltypeswitch:

HS-DSCHDCHchanneltypeswitch
HS-DSCHservingcellchange
PSstreamingestablishment
NRTradiobearerestablishmentwhenastreamingradiobearerexists
CSvoiceRABestablishment.
E-DCHactivesetchangestounacceptable
Softhandoverbranchadditionfails
BTSinitiatedE-DCHDCHchanneltypeswitch
UnsuccessfulHSUPATTIchangefrom2msto10ms

Iftheuserisinactive(allRABsareinactive)whenachanneltypeswitchfromE-DCHto
DCHistriggered,theUE-specificpacketschedulerreleasestheMAC-dflows,and
preformsthestatetransitionawayfromtheCell_DCHinsteadofthechanneltypeswitch.
Iftheuserisinactive(allRABsareinactive)whenachanneltypeswitchfromE-DCHto
DCHistriggeredforSRBs,theUE-specificpacketschedulerreleasestheMAC-dflows,
andperformedthestatetransitionawayfromtheCell_DCHinsteadofthechanneltype
switch.IfaflexibleRLC(FRLC)isappliedwhenachanneltypeswitchfromE-DCHto
DCHistriggered,theRRMconfiguresafixedRLCPDUsizeinDLdirection.This
requiresaradiobearerreconfigurationRRC-message.

HS-DSCHDCHchanneltypeswitch
IfachanneltypeswitchistriggeredfromHS-DSCHtoDCH,achanneltypeswitchE-
DCHtoDCHisalsotriggered.ThereasonforthisisthatE-DCHusagerequires
simultaneousHS-DSCHusage.FormoreinformationonthereasonsforHS-DSCHto
DCHchanneltypeswitch,seetheSectionHSDPAchanneltypeselectioninWCDMA
RAN RRM HSDPA.
Whenachanneltypeswitchiscompleted,theRNCsetstheEDCHCTSwitchGuardTimer
timer.
AnHSPAinter-RNCcellchangemayalsobeinitiatedifanE-DCHactivesetchangesto
unacceptable.Formoreinformation,seetheHSPAinter-RNCcellchangefeaturein
WCDMA RAN RRM HSDPA.

Issue:06B DN70303923 203


HSUPAhandovers WCDMARANRRMHSUPA

HS-DSCHservingcellchange
TheE-DCHservingcellisalwaysthesameastheHS-DSCHservingcell.TheE-DCH
servingcellmustalwaysbeE-DCHcapable,andtheE-DCHmustbeallocatedforthat
cell.
WhenaHS-DSCHservingcellchangeistriggered,acheckisperformedwhetherthe
newHS-DSCHservingcellsupportsE-DCH.IfthenewHS-DSCHservingcelldoesnot
supportE-DCH,thechanneltypeswitchfromE-DCHtoDCHisnecessary.IfanewHS-
DSCHservingcellsupportsE-DCHbuttheE-DCHactivesetchangestounacceptable,
thechanneltypeswitchfromE-DCHtoDCHisnecessary.
Whenachanneltypeswitchiscompleted,theRNCsetstheEDCHCTSwitchGuardTimer
timer.
FormoreinformationonthereasonsforHS-DSCHservingcellchange,seetheSection
HSDPAchanneltypeselectioninWCDMA RAN RRM HSDPA.

PSstreamingRBestablishment
UpontheestablishmentofthePSstreamingRB,thechanneltypeisselected.IftheNRT
RBchanneltypeisE-DCH,andtheselectedchanneltypeforthePSstreamingbeareris
DCH,thedecisiononchanneltypeswitchingfortheNRTRBthattheUEhasalready
allocatedismadeasfollows:

ifHSPAstreamingisnotactivated,ortheuseofHSUPAisnotallowed,theNRTRB
channeltypeisswitchedfromE-DCHtoDCH.
iftherearenoresourcesavailable,thechanneltypeoftheNRTRBisnotswitchedto
DCH,butE-DCHusageiscontinued.TheRT-over-NRTprocedureisattemptedfor
thestreamingreal-timebearer,andafterwardsaDCHwith0/0kbpsisallocatedand
anewcapacityrequestisawaited.IntheeventofaPSstreamingRABsetup,the
streamingRABisrejected.

ThereasonforthisbehavioristhatstreamingandNRTRBmusthavethesamechannel
type(DCH/E-DCH).

NRTradiobearerestablishmentwhenastreamingradiobearer
exists
IfanNRTradiobearerisestablishedwhileastreamingradiobearerexists,channeltype
switchingfromE-DCHtoDCHmightbetriggeredforthestreamingradiobearerand
otherexistingradiobearersofthesameUE.ChanneltypeswitchingfromE-DCHto
DCHisperformediftheE-DCHcannotbeselectedforthenewNRTradiobearerthe
reasonforwhichisnotcapacity-related.

E-DCHactivesetchangestounacceptable
IfE-DCHisused,andtheE-DCHactivesetcontainsacellorcellsthatarenotintheE-
DCHactiveset,theRNCchecksiftheE-DCHactivesetdoesnotchangeto
unacceptable,whichwouldcauseaE-DCHtoDCHchanneltypeswitch.Thiscan
happenifanon-servingE-DCHcellthatisnotintheE-DCHactiveset,butisintheDCH
activeset,becomestoostrong.ToostrongisdefinedrelativetotheservingHS-
DSCH/E-DCHcell.TheEDCHRemEcNoOffsetparameterdefinesthethresholdforthe
E-DCHtoDCHchanneltypeswitchtrigger.TheE-DCHactivesetisunacceptable(non
E-DCHcapablecellistoostrong)ifthefollowingequationistrue:
CPICHEcNoNonEDCHNCell>CPICHEcNoEDCHServingCell+EDCHRemEcNoOffset

204 DN70303923 Issue:06B


WCDMARANRRMHSUPA HSUPAhandovers

Where,

CPICHEcNoNonEDCHNCellistheCPICHEcNomeasurementresultofthenon-E-
DCHcellinquestion,
CPICHEcNoEDCHServingCellistheCPICHEcNomeasurementresultoftheserving
E-DCHcell,
EDCHRemEcNoOffsetistheradionetworkplanningparameterthatdefinesthat
removaloffsetforCPICHEcNomeasurementresults.

Figure 102 E-DCHactivesetchangestounacceptable


DL CPICHEc/No E-DCH DCH
(averaged)

CellnotinE-DCHactiveset

EDCHRemEcNoOffset
(default2dB)

ServingHS-DSCHcell
CellinE-DCHactiveset

time

Whenachanneltypeswitchiscompleted,theRNCsetstheEDCHCTSwitchGuardTimer
timer.
HSPAinter-RNCcellchangemayalsobeinitiatedifE-DCHactivesetchangesto
unacceptable.Formoreinformation,seetheHSPAinter-RNCcellchangefeaturein
WCDMA RAN RRM HSDPA.
WhentheE-DCHactivesetchangestounacceptableforaUEthathasaPSstreaming
radiobearerallocatedonE-DCH,theactionsdependonthereasonwhythecell(s)
additiontoE-DCHactivefailedthelasttime:

IfthemaximumnumberofE-DCHusersisreachedinthecellortheBTS-specific
localcellgroup,anE-DCHactivesetupdateistriggered.IftheE-DCHactiveset
updatefails,RToverNRTistriggeredontheE-DCHside.
Otherwise,channeltypeswitchingfromE-DCHtoDCHistriggered.Ifthechannel
typeswitchtoDCHfails,RToverNRTcanbetriggered.IfRToverNRTdoesnot
succeed,DCH0/0kbpsisallocatedtoallPSradiobearersoftheUE.

Softerhandoverbranchadditionfails
Occasionally,abranchadditionfailstoDCHandE-DCHactivesets.IfanE-DCHactive
setupdateisnotpossible,thecellisaddedtotheDCHactivesetifpossible.However,if
thereisalreadyanothercellintheE-DCHactivesetunderthesameLCGoftheBTS,
thecellcannotbeaddedtotheDCHactiveset.ThereasonisthattheE-DCHactiveset
andtheDCHactivesethavetobeidenticalinasofterhandover(underoneLCGofthe
BTS).TheE-DCHusagecannotbecontinued,andthechanneltypeisswitchedtothe
DCH.

Issue:06B DN70303923 205


HSUPAhandovers WCDMARANRRMHSUPA

WhenthesofterhandoverbranchadditionfailsforaUEwithaPSstreamingRBonE-
DCH,theRT-over-NRTprocedureistriggered.
ForPSstreamingonE-DCH,multi-RABcombinationswithsimultaneousAMRand/or
NRTradiobearersdonotaffectthedecision.

BTSinitiatedE-DCHDCHchanneltypeswitch
Occasionally,theallocatedHWresourcesforE-DCHintheBTSbecomefragmented.
ThiscanpreventtheefficientusageofHWresources,andblocksomeDCHallocations.
Toavoidthis,theBTSmayneedtocausesomeE-DCHresourcetobereleased.The
BTSthatsendsaRadioLinkFailuremessagewiththecausecodeULRadioResources
NotAvailabletotheRNC.Afterreceivingthis,theRNCchangesthechanneltypefrom
E-DCHtoDCH.
Whenchannelthetypeswitchiscompleted,theRNCdoesnotsetthe
EDCHCTSwitchGuardTimertimer,butitstartstheDCHtotheE-DCHchanneltype
switchimmediately.

ChanneltypeswitchingifUEleavestheHSDPA/HSPAcell
ChanneltypeswitchingtakesplaceifHSDPA/HSPAcannotbemaintainedanylongerin
thecurrentcell,andanewservingcellcannotbefound.Thesamecriteriaareusedfor
singleNRTRABsandmultiNRTRABsonHSPA.Multiplexingisperformedasfollows:

HS-DSCH/UL:DCH->DCH/DCH:MAC-hsmultiplexingoftheDLlogicalchannelsis
reconfiguredtoL1multiplexing.
HSDSCH/E-DCH->DCH/DCH:ULMAC-eandDLMAC-hsmultiplexingis
reconfiguredtobidirectionalL1multiplexing.
HSDSCH/E-DCH->HS-DSCH/UL:DCH:MAC-emultiplexingofULlogicalchannels
isreconfiguredtoL1multiplexing.

HSPAtoDCHswitchtriggeredincaseofCSvoiceRAB
IftheUEhasfullHSPAconfiguration,aswitchtoanotherconfigurationistriggeredinthe
followingcases:

CSvoiceRABestablishment(HSPAchannelscannotbeselectedfornewCSRAB)
channeltypeselection,admissioncontrol

fullHSPA(includingCSvoiceoverHSPA)configurationcannotbekeptanymore,for
example,duetothefollowingreasons:
notsuccessfulHSUPATTIswitchfrom2msto10ms
qualityreasons
startofcompressedmode
acellthatdoesnotsupportCSvoiceonHSPAisaddedtotheactiveset
acellthatisundertheDRNCisaddedtotheactiveset
RABcombinationnotsupportedwithfullHSPAconfiguration(butsupportedwith
DCH)

Thebestpossibleconfigurationisselectedfromthesealternatives.

206 DN70303923 Issue:06B


WCDMARANRRMHSUPA HSUPAhandovers

ResourceproblemsinHSPAtofullDCHswitch
DCHreservationsaremadeinthefollowingorderintheHSPAtoDCHswitchforRBs
(andSRBs):

1. RBwiththehighestQoSprioritypassingadmissioncontrolandallpossibleotherPS
RBspassingtheadmissioncontrol
otherthanpowerresourcesforSRBsandCSRBsarechecked(iftheswitchis
donealsoforSRBs)
PSRBswithanegativeadmissiondecisionaredropped(DCH0/0)inthisstepin
orderofQoSpriority
thenextstepistakenimmediately(withouttryingaresourcereservation),ifthe
conditionsforthissteparenotfulfilled

2. RT-over-(N)RTorpre-emptionjustfortheRBwiththehighestpriority(+SRBs)
3. SRBs/RBsaredropped
incaseofaCSRBproblem,itsRABisreleased
incaseofanSRBproblem,anRRCre-establishmentmayoccur

OtherthanSRBsandCSvoice,RBsarenotdirectlyaffectedbyaDCHswitch,ifjust
SRBsandRBforCSvoiceareswitchedtoDCH,andPSservicesstillusetheHSPA.
RT-over-(N)RTandpre-emptionisperformedaccordingtoDCHrulesdescribedin
WCDMA RAN RRM Admission Control.
TheAMRcodecsetconfigurationoftheHSPAispreservedwhenthechanneltypeis
switchedfromtheHSPAtoDCH.Aload-basedAMRcodecmodeselectionisnot
appliedatthechanneltypeswitch.Formoreinformation,seeWCDMA RAN RRM
Admission Control.

UnsuccessfulHSUPATTIchangefrom2msto10ms
UnsuccessfulHSUPATTIchangefrom2msto10mscausesspecialactions.Ifa
HSUPATTIchangefrom2msto10msisnotsuccessful,thenaswitchtofullDCH
configurationistriggeredsothatallRBs,exceptRBwiththebestQoSpriority,are
mappedtoDCH0/0rightaway.Afterthattheswitchisperformedaccordingtonormal
switchrules.

14.3.4 Channeltypeswitchexecution
IntheDCHtoE-DCHchanneltypeswitch,thesamecheckingsareperformedasinthe
initialchanneltypeselectiontoseewhetherE-DCHcanbeallocated.Theseare
describedintheSectionChanneltypeselectionbetweenDCHandE-DCH.
Ifaprocedure(forexample,aservingHS-DSCHcellchange)alsotriggersachannel
typeswitchbetweentheDCHandtheE-DCH,theprocedureandthechanneltype
switcharerunsimultaneouslyifpossible.
ToavoidfrequentchanneltypeswitchesbetweentheDCHandtheE-DCH,the
EDCHCTSwitchGuardTimerisused.EDCHCTSwitchGuardTimerissetwhentheE-DCH
toDCHchanneltypeswitchiscompleted.(TheonlyexceptioniswhenaBTS-initiatedE-
DCHtoDCHchanneltypeswitchwasthetriggerforthechanneltypeswitch.)Thetimer
hasvaluethatisalwaysgreaterthan0.Whenthetimerisrunning,theDCHtoE-DCH
channeltypeswitchisnottriggered.(TheonlyexceptionisthecasewhentheDCHto

Issue:06B DN70303923 207


HSUPAhandovers WCDMARANRRMHSUPA

HS-DSCHchanneltypeswitchtriggerstheDCHtotheE-DCHchanneltypeswitch.)
Whenthetimerexpires,itishandledasatriggerfortheDCHtoE-DCHchanneltype
switch.
InthechanneltypeswitchfromHS-DSCH/E-DCHtoHS-DSCH/DCH,theinitialbitrate
forHS-DSCHreturnchannelisallocatedfortheULNRTbearer.Inthechanneltype
switchfromHS-DSCH/E-DCHtoDCH/DCH,theinitialbitrateforNRTDCHisallocated
totheDCHfortheNRTbearer.
IntheE-DCHtoDCHchanneltypeswitch,theULbitrateallocatedforastreaming
bearerequalstheguaranteedbitrateorthenexthigherrate.IfaDCHwithsuchbitrate
isnotacceptedasthenewchanneltypebyadmissioncontrol,RT-over-NRTis
attempted.IfRT-over-NRTdoesnotsucceed,aDCHwith0/0kbpsisallocated.The
initialbitrateselectionfortheNRTRBisdescribedinWCDMA RAN RRM HSDPA.
PleasenotethatthenominalbitrateisnotappliedtoDCHtrafficchannels.
Inuplinkdirection,thesamechanneltypeisusedforthePSstreamingandtheNRT
bearer.WhenthechanneltypeisswitchedfromE-DCHtoDCH,bothPSstreamingand
NRTradiobearerareswitched.ThePSstreamingRBisscheduledfirst.

14.4 Hardhandovers
AsHS-DSCHusageisarequirementforE-DCHusage,theinter-frequencyhandovers
(IFHO)andinter-systemhandovers(ISHO)followthesameprinciplesasforHSDPA.
HSUPAdoesnotbringanynewtriggersfortheIFHOorISHO.Ifcompressedmodeis
decidedontostartforaninter-frequencyorinter-systemhandovermeasurements,the
channeltypeisswitchedfromE-DCHtoDCH.
IfHSDPAinter-frequencyhandoverisenabled,theHS-DSCHallocationremainsbutthe
E-DCHisswitchedtoDCHbeforeinter-frequencymeasurementsbegin.
AlgorithmsspecifiedintheWCDMA RAN RRM Admission Controlareappliedinthe
AMRcodecsetselection.TheHSPAconfigurationoftheCSvoicebearertheInter-RAT
HandovertoUTRANisdoneintheR99configuration.
Formoreinformation,seetheSectionHSDPAmobilityhandlinginWCDMA RAN RRM
HSDPAandtheSectionCompressedmodeinWCDMA RAN RRM Handover Control.

14.4.1 HSUPACompressedMode
CompressedModeactivationisalwaysdoneinasynchronizedmanner-CFN-based
activationoverIub.Thetimingforactivation,reconfigurationanddeactivationofthe
CompressedMode(CM)cannotbechanged-theCFNisusedintheBTSandtheUE.
TheCMcanbeactivatedonlywhenthefollowingvariablesallowforthat:

thetransportchannelconfigurationderivedfromtheUEcapability
BTScapability(WBTSforIub)
theRAN1668: HSUPA Compressed Mode for LTE and Inter-frequency Handover
featurecontrolalgorithm
providedRABservices

208 DN70303923 Issue:06B


WCDMARANRRMHSUPA HSUPAhandovers

AftertheCMdeactivation,theRNCtriestogobacktotheoriginaltransportchannel
configurationasusedbeforetheCMactivation.Whenthenumberofuserspercellin
HSDPAorHSUPAisexceeded,thetransportconfigurationisnotrevertedback.Incase
ofRABsetup,modificationorreleaseduringtheactivatedcompressedmode,atransport
channelreconfigurationisnotrequiredaftercompressedmodedeactivation.

WhentheAMRcallsetupisperformedduringtheCMactivation,thecallisswitchedto
theDCHchannelforSRBsonHSPA.
WhentheRTservice(streaming)setupisperformedduringtheCMactivation,the
channeltypeswitchtotheDCH/HS-DSCHisperformed.
ThentheRABisreleasedandthenewRBconfigurationdoesnotsupportcompressed
modeconfiguration,forexample,theDCH/DCH(0/0)withSRBonly,theCM
configurationisdeactivatedandthemeasurementsareterminatedduringRAB
reconfiguration
TheRNCselectsthemethodusedfortheCMandfortheCompressedMode,theRNC
mustsupporttheTransportChannelReconfiguration.
BeforeactivationoftheHSUPAinter-frequencyhandover,theBTScapabilityandvalue
oftheEBTS - BTSSupportForHSPACMparameterischeckedforalltheservingand
non-servingE-DCHcells.Theparametercanhavethefollowingvalues:

HSPA CM supported-thenewRLwillbeaddedtotheDCHactivesetwithexisting
HSPACMparameters.Aftersuccessfulactivesetupdate,theRLsarereconfigured
toDCH/HS-DSCHwithHSDPACMparameters
HSDPA CM supported-thenewRLwillbeaddedtotheDCHactivesetwithexisting
HSPACMparameters.Afterthesuccessfulactivesetupdate,theRLsare
reconfiguredtoDCH/HS-DSCHwithHSDPACMparameters.
Whenthechanneltypeselection(CTS)fails,theHSPACMconfigurationwillbekept
andwillcontinuetryingtheCTSagainwhenevertheUEsendsnewmeasurement
reportthatwouldrequireCTSretrial.Thiswillcontinueuntil,eitherthemomentinthe
UEreportsthemeasurementreportinwhichminimumE-DCHactivesetissatisfied
forthecellinquestion,ortheCMisbecauseofthenormalreasonsorCTS
succeeds.
Only DCH CM supported-thenewRLisaddedwithcurrentCMparameters.
Otherwise,checkifthenewcellisanHSUPACapablecell(HSUPA Enabled
parametervalueequals1(Enabled)andtheBTSSupportForHSPACMparameteris
notequaltoHSPA CM supported;thenewbranchisaddedtotheDCHASifE-DCH
activesetremainsacceptable(legacy)andEDCHallocationisnottriedforthis
branchafterCMisstoppedaspercurrentimplementation.

ThefollowingconfigurationsofthetransportchannelsaresupportedduringtheCM:

E-DCH/HS-DSCH,DCH/HS-DSCH,orDCH/DCH
DCH/HS-DSCHorDCH/DCH
DCH/DCH

Whentheallowedconfigurationalreadyexists,thetransportchannelconfigurationis
reconfigured.Otherwise,thetransportchannelconfigurationisreconfiguredtothebest
possibleallowedconfiguration.
WhentheDCHchannelistobeconfiguredbothinULand/orDL,itisreconfiguredtothe
initialbitrate.Whenthisisnotpossible,theDCH/DCH0/0isconfigured.Thatisvalidfor
RLsoverIubandIur.

Issue:06B DN70303923 209


HSUPAhandovers WCDMARANRRMHSUPA

TheHSUPAconfigurationmustallowforreconfiguration(10ms<->2msTTI),whenthe
HSPACMisactivated.
ThefollowingparameterslimitthemaximumnumberoftheCMusers:

MaxNumberUEHSPACmHOforcriticalhandoverreasons
MaxNumberUEHSPACmNCHOfornon-criticalhandoverreasons

Whenthevalueofthecritical-reasonshandoverisexceededandthenon-criticalis
available,thecritical-reasons-handoverparametercanusethenon-criticalcapacity.
Whenthedescribedthresholdsareexceeded,theUEscannotentertheHSUPA,nor
HSDPACM.TheUEscannotbereconfiguredfromHSPAorHSDPAconfigurationto
DCHconfigurationandcompressedmodenotstarted.
TheHSDPAandHSPAcompressedmodeiscountedusingthesamevariable.Tormore
informationontheHSDPACM,seetheWCDMA RAN RRM HSDPA.

g ThemaximumnumberofUEsinHSPAcompressedmodethresholdcanbe
temporarilyexceeded,whennewsofthandoverbranchtobeaddedtothiscell
belongstotheUEthatisinHSPAcompressedmode.
TheRel5IE:supportOfDedicatedPilotsForChannelEstimationOfHSDSCHpresentinIE:
PhysicalChannelCapabiliyt-hsdsch-r5isusedtoidentifytheearlyRel-6terminals,thatdo
notsupporttheCM.
ThisIEissentaspartofRRCConnection_setup_completeorIE_Capability-Information
message.Whenthisdummybitissettotrue,thenetworkassumesthattheUEdoesnot
supportcompressedmodeforE-DCH.Whenthecompressedmodeistriggered,E-DCH
isreconfiguredtoDCHbeforestartingmeasurement.

g TheHSPAintra-frequencyservingcellchangeinsidethemcRNCandtheFlexi
DirectRNCisallowedwhencompressedmodeison.IncaseInter-ADAserving
cellchanges,theHSPACMmustbestoppedfirst,andthentherelocationcan
beperformed

14.4.2 HSPAinter-frequencyhandover

g NotethattheHSUPACMisalwayscombinedwiththeHSDPAMC.Formore
information,seetheWCDMA RAN RRM HSDPAfunctionalareadescriptionand
theHandover Controlfunctionalareadescription.

t When(aftertheCMandinter-frequencyhandover)theRLadditionistriggered,
theSRNCchecksthecurrentCMconfiguration.

t WhentheDCHisconfigured,seetheWCDMA RAN RRM Handover Control


functionalareadescription.
WhentheHSDPACMisconfigured,seetheWCDMA RAN RRM HSDPAfunctionalarea
description
Whenthenewbranchthatisgoingtobeadded,willbethepartoftheminimumE-DCH
activeset,thecells'BTSmustsupporttheHSPACM,seesection:.
ThePSRABreconfigurationandtheSPIreconfigurationbecauseoftheRAB
reconfigurationsissupportedduringtheHSPACM.

210 DN70303923 Issue:06B


WCDMARANRRMHSUPA HSUPAhandovers

TheRNCchecksiftheconditionsforinter-frequencyhandover(forexample,the
DownlinkDPCHpower)areapplicableafteranyRABprocedure.Whentheconditions
arenotsufficientforanyinter-frequencyhandover,theinterfrequencyhandover
proceduremodeisdeactivated.
WhentheCMison,theinter-frequencySRNCrelocationcannotbeperformed.When
theneedfortheinter-frequencySRNCrelocationappears,theCMmustbestoppedfirst,
thentherelocationisperformed.ThetargetSRNCdecidesiftheCMisneededornot.
Aftertheinter-frequencySRNCrelocation,theCMintheDRNCisimmediatelystopped.
OntheBTSlevel,theCMremainsinthepreparedstateandisre-activatedafterthe
inter-frequencyhandovertriggerisreceived.
FormoreinformationontheSRNCrelocation,seetheWCDMA RAN RRM Handover
Controlfunctionalareadescription.
ThefollowingtypesoftheInter-FrequencyHandovers(IFHO)aresupportedbytheRNC:

CoverageandQualityIFHO
IMSI-basedIFHO
HSPACapabilityhandover(inactivitycase)

InHSUPAIFHOatransportchannelconfigurationonEDCH/HS-DSCH(withorwithout
allocatedAMR)supportstheCMandmeasurementswithoutthetransportchannel
modification.
WhentheuplinktransportchannelmodificationtoDCH(HSDPAreturnchannel)
configurationisrequired,thereconfigurationandtheCMisperformedusingone
synchronizedRLReconfigurationprocedureandmeasurementisstartedimmediately.
TheDCHisallocatedwithinitialbitrate.Whenthereconfigurationdoesnotsucceed,the
RBismappedontheDCH/DCH(0/0).IfafterthatreconfigurationanAMRexistsorother
PSRBwith>0/>0,theCMandthehandovermeasurementsarestartedimmediately.
WhentheAMRdoesnotexist,buttheSRBonlyandDCH/DCH0/0inallRBs,thena
newallocationandhandovertriggerareawaited.
Thepenaltytimer(basedontheHsdschGuardTimerHOisstartedwhenRBsare
mappedtoDCH/DCH(0/0))torestricttheimmediateHS-DSCHre-allocation.
ReconfigurationfromE-DCH/HS-DSCHtoDCH/HS-DSCHconfigurationisperformed
independentlytotheCM,atanytimewhenthemeasurementscanbedone.
ThetargetcellforHSPAIFHOcanbe:

intra-BTS
inter-BTS
intra-RNC
inter-BTSinter-RNC

g Note:InADA4.0,thetargetcellforHSPAinter-frequencyhandovercanbeonly
intra-RNC(ADA)orinter-RNC(ADA)cell.
AftertheIFHOfailure,theRNCattemptstheInter-SystemHandover(ISHO).
ToperformtheISHO,thefollowingcriteriamustbemet:

TheISHOisactivated/pending.
TheRAB based Service HandoverrIEdoesnotpreventtheISHOwiththevalue
Handover to GSM shall not be performedinanyoftheUEsconfiguredRABs.
Furthermore,Quality,Coverage,orImmediateIMSIBasedISHOisallowed.

Issue:06B DN70303923 211


HSUPAhandovers WCDMARANRRMHSUPA

FortheISHO,firstthechanneltypeswitchtotheDCH/DCHmustbeperformed.
Inthetargetcell,theE-DCH/HS-DSCHforRTandNRTPSisallocatedwhenever
possible
TheHSUPACMisnotsupportedfortheRTserviceslikeCSoverHSPAandStreaming
HSPA.Inthatcasesafollowingfallbackmechanismisactivated,beforetheCM:

channeltypeswitchtoDCH
channeltypeswitchtoDCH/HS-DSCHforstreamingonHSPA

TheHSUPACMissupportedonlyforNRTRABs.TheMultiPSNRTRABsare
supportedaswell.

14.4.3 InteractionofHSUPACompressedModeforLTEandInter-
frequencyhandoverwithotherfeatures
TheHSUPACMisnotsupportedbyDC-HSUPA.WhentheDC-HSUPAisactive,a
fallbackmechanism(SC-HSUPA/R99DCH)isperformedbeforetheHSUPACMis
initiated.
TheHSUPAinterfrequency-handoverfunctionalitydefinedinthisfeatureisappliedwith
Multi-BandLoadBalancingforinactivityandmobilitytriggers.
HSUPACMisnotsupportedoverIur.However,whentheservingcellisunderSRNC,
thechanneltypeswitchfromE-DCHtoDCHinULisperformed,providedtheHSDPA
CMisallowedinservingcellinSRNC.WhentheHSDPACMisnotallowedinSRNC,
thechanneltypeswitchtoDCH/DCHisperformed.
TheMIMOisnotactiveduringtheHSUPACM.WhentheIFHOortheISHOtoLTEis
triggeredandMIMOisactive,theRNCdeactivatestheMIMOfirst,beforeinitiating
HSUPACM.
TheDC-HSDPAisactiveduringtheHSUPACM.WhentheIFHOortheISHOtoLTEis
triggeredandDC-HSDPAisactive,theRNCdeactivatestheDC-HSDPAfirst,beforethe
HSUPACM.

212 DN70303923 Issue:06B


WCDMARANRRMHSUPA HandlingofinactiveE-DCHMAC-dflows

15 HandlingofinactiveE-DCHMAC-dflows

g NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.

TheMAClayermeasuresthroughputoftheE-DCHMAC-dflow.Whenitdetectslow
throughputofboththeE-DCHNRTandstreamingMAC-dflow,itreportstotheUE-
specificPS(L3),andtheUE-specificPSmakesthefinaldecisiontoreleaseE-DCH.E-
DCHcanbereleasedonlyifboththeDLHS-DSCHNRTandstreamingMAC-dfloware
releasedsimultaneously.
Theoperatorcanenableinactivitydetectionforstreamingradiobearerswiththe
InactDetForStreamingRBRNClevelRNPparameter.Ifthedetectionisactive,the
systemmonitorstrafficofthestreamingradiobearersandreleasesresourcesofthe
radiobearereverytimeinactivityisdetected.ForNRTradiobearersinactivitydetection
isalwaysinuse.

MAClayermeasuresthroughputoftheE-DCHNRTandstreaming
MAC-dflow
Theuplinkthroughputiscalculatedsothatalltransmittedbitsduringthesliding
measurementwindowaremeasured.TheEDCHMACdFlowThroughputAveWin
managementparameterdefinestheslidingmeasurementwindowsizeforboththeE-
DCHNRTandstreamingMAC-dflowthroughputmeasurement.
Throughputduringtheslidingmeasurementwindow[bps]iscalculatedatevery
transmissiontimeinterval.
ThecollectionofthesamplesstartswhenthefirstactivityintheE-DCHNRTora
streamingMAC-dflowhasbeendetected.Theslidingmeasurementwindowhastobe
fullofsamplesbeforethefirstthroughputmeasurementresultiscalculated.
TheMAClayersendsanHSPA normal utilizationindicationtotheUE-specificPS
immediatelyafterreceivingthefirstdataisreceivedfromtheUE.Ifthefirstactivityofa
MAC-dflowisnotdetectedwithinpre-definedtime(EDCHMACdFlowThroughputAveWin
+2seconds),theMAClayersendsanHSPA low utilizationindication.
ThetimerdefinedwiththeEDCHMACdFlowThroughputTimetoTriggermanagement
parametercanoccurinthefollowingstates:

ItisstartediftheuplinkthroughputofNRTRABdropsbeloworequalsthethreshold
definedwiththeEDCHMACdFlowThroughputRelThrmanagementparameter.
ItisstoppedandresetifthedownlinkthroughputofNRTRABgoesabovethe
thresholddefinedwiththeEDCHMACdFlowThroughputRelThrmanagement
parameter.

Ifthistimerexpires,theMAClayer:

ChecksiflowutilizationisdetectedforHS-DSCHMAC-dflowofthesameRAB.Ifit
isdetected,MAClayersendsanHSPA low utilizationindicationtoUE-specificPS.
ChecksiflowthroughputisdetectedforHS-DSCHMAC-dflowofthesameRAB.Ifit
isdetected,MAClayersendsanHSPA low throughputindicationtoUE-specificPS.

Issue:06B DN70303923 213


HandlingofinactiveE-DCHMAC-dflows WCDMARANRRMHSUPA

IfthevalueoftheEDCHMACdFlowThroughputTimetoTriggermanagement
parameterissetto0s(zeroseconds),MAClayerperformstheactionsdescribedabove
withoutanydelay.
TheEDCHMACdFlowTputStrTtTmanagementparameterdefinesthetimervaluein
caseofstreamingservices.
IftheHSPA low utilizationindicationhasbeensenttotheUE-specificPS,andtheuplink
throughputgoesabovethethresholddefinedwiththe
EDCHMACdFlowThroughputRelThrmanagementparameter,theMAClayersendsthe
HSPA low utilizationindication.Formoreinformation,seeWCDMA RAN RRM HSDPA.
ThevaluesoftheEDCHMACdFlowThroughputAveWin,
EDCHMACdFlowThroughputRelThr,EDCHMACdFlowThroughputTimetoTrigger
andEDCHMACdFlowTputStrTtTmanagementparametersarereadonlywhenE-DCH
isbeingallocated.Thatis,changingthevalueoftheparameterdoesnotaffectthe
throughputmeasurementsoftheexistingE-DCHallocations.
ThevaluesoftheEDCHMACdFlowThroughputAveWin,
EDCHMACdFlowThroughputRelThr,and
EDCHMACdFlowThroughputTimetoTriggermanagementparametersarereadfrom
theWACobjectidentifiedwiththeWACSetIdentifierparameteroftheservingcell.
ChangestotheactivesetbecauseoftheSHO/SCCinthecurrentfrequencylayerdonot
reconfiguretheE-DCHthroughputmeasurements.
TheE-DCHthroughputmeasurementsarereconfiguredincaseofintra-RNCinter-
frequencyHHOonlyifthevaluesinthenewcellaredifferentfromthecurrently
configuredparametervalues.
TheFigureFigure103:ThroughputmeasurementoftheE-DCHNRTMAC-dflow
illustratesthroughputmeasurementoftheE-DCHNRTandastreamingMAC-dflowthat
isperformedattheMAClayer.

Figure 103 ThroughputmeasurementoftheE-DCHNRTMAC-dflow

UE-specificPSmakesthefinaldecisiontoreleaseE-DCHNRTMAC-
dflow
ThefinaldecisiontoreleasetheE-DCHandHS-DSCHNRTorastreamingMAC-dflow
ismadebytheUE-specificPS.TheE-DCHNRTorthestreamingMAC-dflowis
releasedifitsthroughputisdetectedbytheMAClayeraslow.Also,adecisionismade

214 DN70303923 Issue:06B


WCDMARANRRMHSUPA HandlingofinactiveE-DCHMAC-dflows

fortheHS-DSCHNRTorstreamingMAC-dflowtobereleased.Thereleasingalgorithm
oftheHS-DSCHNRTandstreamingMAC-dflowisclarifiedintheWCDMA RAN RRM
HSDPAdocument.
E-DCHNRTorstreamingMAC-dflowisalsoreleasediftheuserdecidestoreleasethe
connection.InactivitysupervisionattheMAClayerandinactivitytimerarenotusedfor
theHS-DSCHandE-DCH,theyareonlyusedforboththeuplinkanddownlinkNRT
DCHs.
IflowthroughputintheULorlowutilizationintheDLisindicatedforoneRABofamulti
PSRABconfigurationbecausenodataistobetransferred,theradiobearerofthe
inactiveRABisreleased.

ExtendedinactivitytimersusedforNRTservices
AnRBcanbereleasediflowutilizationisdetectedforHSDPAMAC-dflowandlow
throughputisdetectedforE-DCHMAC-dflow(thereisnodatatobetransferredforthis
RB).WhenthishappenstoalltheRBsoftheuser,theusercanbetransferredto
Cell_FACHstate.Insteadofstatetransition,theusercanbekeptlongerintheCell_DCH
stateiftheextendedinactivitytimerissetfortheuserwithanRNPparameter.The
followingfiguredescribestheselectionoftheparameter.

Issue:06B DN70303923 215


HandlingofinactiveE-DCHMAC-dflows WCDMARANRRMHSUPA

Figure 104 SettingoftimertoextendthetimeofinactiveuserinCell_DCHstate

Iftheselectedparametervalueissettozero,extendedtimerisnotused.Ifthevalueof
theparameterisbiggerthanzero,extendedinactivitytimerissettothatvalueandthe
timerisstarted.Whenextendedinactivitytimerexpires,allPSMAC-dflowsarereleased
fromtheUEandthestatetransitionawayfromCell_DCHisperformed.
IfanyPSRABoftheuserbecomesactiveornewPSRABisestablishedfortheUE
whenextendedinactivitytimerisrunning,theextendedinactivitytimerisstoppedand
theUEishandledasactiveUE.

15.1 Preventiveoverloadcontrol
Theideaofthepreventiveoverloadcontrolisthatinactiveusersareattemptedtobe
releasedbeforetheactualcongestionhappenssothatnewusersdonotfacecongestion
atall.

216 DN70303923 Issue:06B


WCDMARANRRMHSUPA HandlingofinactiveE-DCHMAC-dflows

Preventivecongestioncontrolisusedincaseofthefollowinglimitations:

ThemaximumnumberofE-DCHallocationsinthecell(MaxNumberEDCHCell
parameter).
TheTemporary maximum number of HSUPA usersfunctionoftheRAN2879: Mass
Event HandlerfeaturemightrestrictE-DCHallocationsinthecell.Formore
information,seeTemporarymaximumnumberofHSUPAuserschapter.
themaximumnumberofE-DCHallocationsintheBTSlocalcellgroup
(MaxNumberEDCHLCGparameter)
ThemaximumnumberofE-DCHallocationsintheBTS(HSUPAXUsersEnabled
parameter).
Activecapacityfeatures.
BTSHWcongestionindicationwithanHSUPAresourcestatusIEoranegative
acknowledgmentmessagewiththecausevalueUL radio resources not available.
ULloadedstateforHSPAusers.

Everytimeanewallocationisperformedoraninactivityisdetectedforauser,thecell-
specificpacketschedulerchecksifpreventiveoverloadcontrolisneeded.
Inthepreventiveoverloadcontrolacell-specificpacketschedulerreleasesallMAC-d
flowsofoneinactiveuser.TheinactiveuserisselectedasdescribedinWCDMA RAN
RRM HSDPA.Theinactiveuserisreleasedafterthenew-userMAC-dflowshavebeen
successfullysetup.

ImpactoftheRNPparametersonthetriggeringoftheULpreventive
overloadactions
Thepreventiveoverloadcontrolstartsifthefollowingequationistrue(thisischeckedin
thecell,BTSlocalcellgroup,andontheBTSlevel):

Figure 105 Preventiveoverloadcontrol

NumberOfUsersisthecurrentnumberofE-DCHallocationsinthecell,BTSlocalcell
group,orBTS(includinganewuser).
MaxNumberOfUsersisthemaximumnumberofE-DCHallocationsinthecell,BTSlocal
cellgroup,orBTS.
InacUsersOverloadFactisthevalueofanidenticallynamedparameter.

ImpactoftheHSUPAresourcestatusonthetriggeringoftheUL
preventiveoverloadactions
Thecell-specificpacketschedulerperformspreventiveoverloadcontrolforBTSHW
congestionindicatedwiththeHSUPAresourcestatusIE.WhentheRNCgetsE-DCH
capacity is limitedorno free E-DCH capacityfromtheWBTSintheHSUPA Resource
StatusIEofthePrivateNBAP:RadioResourceMeasurementReport/AnnexZ/,the
preventiveoverloadcontrolforinactiveusersstarts.TheWBTSreportstheHSUPA
resourcestatusineveryRRI.IneveryRRI,thecell-specificpacketschedulerreleasesall
MAC-dflowsoftwoinactiveusers.Inactiveusersareselectedasdescribedin WCDMA
RAN RRM HSDPA.

Issue:06B DN70303923 217


HandlingofinactiveE-DCHMAC-dflows WCDMARANRRMHSUPA

ImpactoftheactivecapacityfeaturesonthetriggeringoftheUL
preventiveoverloadactions
PreventiveoverloadactionstriggeredbynumberofHSUPAusersareperformedagainst
maximumnumberofuserssetbytheactivecapacityfeatures.
Thepreventiveoverloadcontrolistriggered:

WhentheHSPA 128 Users per CellandHSPA 72 Users per Cellfeaturesarenot


activatedandthenumberofservingandnon-servingusershasfulfilledatleastone
ofthefollowingconditions:
#all_HSUPA_users_in_cellInacUsersOverloadFact*20
#all_HSUPA_users_in_LCGInacUsersOverloadFact*24

WhentheHSPA 128 Users per CellfeatureisnotactivatedandHSPA 72 Users per


Cellfeaturesisactivatedandthenumberofservingandnon-servingusershas
fulfilledatleastoneofthefollowingconditions:
#all_HSUPA_users_in_cellInacUsersOverloadFact*72
#all_HSUPA_users_in_LCGInacUsersOverloadFact*160

WhentheHSPA 128 Users per Cellfeatureisactivatedandthenumberofserving


andnon-servingusershasfulfilledatleastoneofthefollowingconditions:
#serving_HSUPA_users_in_cellInacUsersOverloadFact*128
#serving_HSUPA_users_in_LCGInacUsersOverloadFact*1024

ULloadedstateforHSPAusers
ULloadedstateforHSPAisusedonlyinacellwheretheHSPA 72 Users per
Cell(HSPA72UsersPerCell)featureorHSPA 128 Users per
Cell(HSPA128UsersPerCell)featureisactivated.Inothercases,theULloadedstate
forHSPAusersisnottriggered.
Therearetwoconditionstobefulfilled(atleastforthetimesetwiththe
ULLoadStateTTTparameter):

PrxTotal_av>PrxNoise+PrxMaxTargetBTS+ULLoadStateHSUOffset
whenPICisnotactivatedwithPICStateRNPparameter
PrxTotalRes_av>PrxNoise+PrxMaxTargetBTS+ULLoadStateHSUOffset
whenPICisactivatedwithPICStateRNPparameter

Ifoneoftheconditionsaboveismet,dependingonwhetherPICisactivatedornot,the
followingconditionischecked:

NRT_EPRB_ave_sum/X<ULLoadStateHSUBRLimit

where:

ULLoadStateTTT isanRNPparameterthatdefinesthetimefortriggering
theULloadedstate.

PrxTotal_av isanaveragedPrxTotalmeasurement:

218 DN70303923 Issue:06B


WCDMARANRRMHSUPA HandlingofinactiveE-DCHMAC-dflows

averagingisperformedwithvaluesofthree
consecutivereportingperiodssothatthenewestvalue
replacestheoldestvalueusedincalculation
conditionischeckedfirsttimewhenthreereporting
periodshaveelapsed(averagingwindowisfull)

PrxNoise isthelatestvalueofthesystemnoise.

PrxMaxTargetBTS isanRNPparameterthatdefinesschedulingtargetfor
powerorschedulingtargetforresidualpower.

ULLoadStateHSUOffse isanRNPparameterthatdefinestheloadoffset.This
t parameteralsohasaspecialvalue.Bysettingthisvalue
fortheparameter,ULloadedstateforHSPAusersisnot
triggeredatall.

PrxTotalRes_av istheaveragedresidualPrxTotalmeasurement(thesame
handlingasforPrxTotal_av).

NRT_EPRB_ave_sum istheaveragedsumofallE-DCHprovidedbitrate
measurementsforSPIsusedforNRTservices:

averagingisperformedwithvaluesofthree
consecutivereportingperiodssothatthenewestvalue
replacestheoldestvalueusedincalculation
conditionischeckedfirsttimewhenthreereporting
periodshaveelapsed(averagingwindowisfull)

X isthenumberofactiveNRTE-DCHusersinCell_DCH
stateofthecell.

userswithextendedinactivitytimersareexcluded

ULLoadStateHSUBRLim isanRNPparameterthatdefinesabitratethreshold.
it

AcellissettotheULloadedstateforHSPAuserswhenalltheaboveconditionsare
fulfilledexcludingthecasewherenumberofNRTHSPAusersis0(X=0).InthatcaseUL
loadedstateisnottriggered.
Iftheconditionsarenotfulfilledanymoreatleastforthetimeindicatedwiththe
ULLoadStateTTTparameter,thentheULloadedstateforHSPAusersiscanceled.The
checkingofconditionsisperformedeverytimewhencommonmeasurementsfromthe
BTSarereceived.ParametersULLoadStateTTT,ULLoadStateHSUOffset,and
ULLoadStateHSUBRLimitcanbemodifiedonline.

PreventiveoverloadcontrolactionstriggeredbytheULloadedstate
forHSPAusers
WhenacellissettoULloadstateforHSPAusers,thenalluserswithrunningextended
inactivitytimerarereleasedinacellinquestion.Also,extendedinactivitytimersarenot
starteduntilULloadedstateforHSPAusersiscanceled(usersarereleasedafter
inactivityisnoticedaccordingtonormaltimers).

Issue:06B DN70303923 219


Continuouspacketconnectivity WCDMARANRRMHSUPA

16 Continuouspacketconnectivity

g NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.

TheRNCsupportsthefollowingsubfeaturesofContinuousPacketConnectivity(CPC):

DPCCHGating(ULDTX),
DiscontinuousDLReception(DLDRX),
DiscontinuousULReception(MACDTX),
CQIReportingreduction.

ThemainbenefitsoftheCPCarethereductioninUEbatteryconsumptionandafaster
startfordatatransmission(unnecessarystatetransitionscanbeminimized-nosetupis
needed).AlsoacertainamountofsystemgainintermsofreducedULinterferenceis
achievable.SupportedRABcombinationsforCPCarethesameasforF-DPCHandthey
aredescribedinWCDMA RAN RRM HSDPA.
TheCPCfeaturecanbeactivatedanddeactivatedinthecellwiththeCPCEnabled
parameter.Inanewradiolinkestablishment,theparameterCPCEnabledischecked.If
theCPCfeatureisdeactivatedbychangingtheparameterCPCEnabledtoDisabled,
theCPCisnotdeactivatedforongoingconnections.CPCdeactivationoccursinthe
activesetupdate,orwhentheCPCisdeactivatednormally.Alsotheotherwayround,
whentheCPCEnabledparameterisenabled,CPCactivationoccursintheactiveset
updateorwhenCPCisactivatednormally.IftheCPCfeatureisnotactivatedtothecell,
thentheRNCdoesnothandleCPC-capableUEsdifferentlythannon-CPC-capableUEs.
TheCPCcannotbeusedfortheUEifthereisacellintheactivesetwherethe
CPCEnabledparameterisdisabled.

DiscontinuousULTransmission-DPCCHGating(ULDTX)
Figure 106 ULgating
UL Gating

R99DCHwith20-ms TTI DPDCH


(R99CSvoice) DPCCH
E-DCHwith2-ms TTI
(R6VoIP) E-DPCH

DPCCH
E-DCHwith2-ms TTI
andUL DPCCHgating E-DPCH
(R7VoIP)
DPCCH

ThisisthebasicsubfeatureoftheCPC,whichisapreconditionfortheotherones.
WithoutCPC,theULDPCCHistransmittedallthetime,transmittingthepilotbitsused
forsynchronization,channelestimation,andcalculationofSIRforpowercontrol,
furthermoreTPCbitstocontrolDLtransmissionpower,and,optionally,FBIbitscarrying
thefeedbackinformationforDLtransmitdiversity.

220 DN70303923 Issue:06B


WCDMARANRRMHSUPA Continuouspacketconnectivity

Whengatingisused,then,inabsenceofbothE-DCHandHS-DPCCHtransmission,the
UEautomaticallystopsthecontinuousDPCCHtransmissionandappliesawell-known
DPCCHactivitypattern,with(prevailing)mute(DTX)periodsandshortULDPCCH
bursts.DuringanE-DCHorHS-DPCCHtransmission,DPCCHistransmittedregardless
oftheactivitypattern.Thisdisruptivetransmissionhasofcoursenegativeimpacton
powercontrol,asinthetransmissiongapstheconditionscanchangesignificantly,
becauseof,forexample,fastfading.Inordertoallowpowercontrolandchannel
estimationalgorithmtocatchupwiththechangingconditions,post-andpreamblesare
used.

DiscontinuousDLReception(DLDRX)
DLDRXmaybeusedtodecreasepowerconsumptionoftheUE,andthustoincrease
terminalbatterylife-time(forexampletalk-time).WhentheUEDRXisenabled,theUE
mayturnoffthereceiverwhenthereisnoneedtoreceiveanythinginDL.TheDLDRX
canbeenabledonlyinconjunctionwithULDTX(DPCCHgating).Itusesthesameoffset
asULDTX,anditsperiodmustbeanintegermultipleoradivisorofUE_DTX_cycle_1,
soitfollowsmoreorlessthesamepatternasULDTX(theideaistoallowtheUEto
switchboththereceiverandthetransmitterduringtransmissiongaps).

DiscontinuousULReception(ULDRX)-MACDTX
ThissubfeatureisaimedatusingWCDMABTSresourcesmoreefficiently.WithoutUL
DRX,theWCDMABTSmustbereadytoreceivetheE-DPCCH(andthefollowingE-
DPDCH)ineachTTI.WithULDRX,apatternoftimeinstancesisdefined,atwhich
resumingoftheE-DCHtransmissionafterinactivityispossible.Thus,theWCDMABTS
needstolistentoE-DPCCHonlyatthosetimeinstants.
Pleasenote,thatasimilareffectcanbeachievedusingtheHARQprocessrestriction
(however,thisispossibleonlyforthe2msTTI).ULDRXmayalsobeusedtoforcethe
UEtobundlevoicepackets.ItusesthesameoffsetasULDTX,andincaseHARQ
processrestriction,thecyclelengthofULDRXhastomatchtheULtransmissioncycle
onE-DCHresultingfromtheHARQprocessrestriction.

CQIReportingReduction
TheCPCgainmaybeimpairedsignificantlywhennoCQIreportingreductionisapplied,
becauseduringtheHS-DPCCHtransmissionstheULDPCCHhastobetransmittedas
well.ThisisdonetoprovideTPCfortheF-DPCH.Inordertoavoidthisimpairment,this
subfeatureofCPCreducestheCQIreportingwhenthereisnodatatransmittedonHS-
DSCHforalongerperiodoftime.ThisreducedCQIreportingtakesplaceonlyiftheCQI
reportingpatterndefinedbythelastHS-DSCHtransmissionandCQIcycleoverlapswith
theULDPCCHburstoftheUEDTXpattern.

16.1 CPCactivation
Thecell-specificpacketschedulerperformsthefollowingcheckstoseeifCPCcanbe
activatedonthecelllevel.

Issue:06B DN70303923 221


Continuouspacketconnectivity WCDMARANRRMHSUPA

Figure 107 CPCactivation

CelllevelrequirementsforCPCconfiguration

ContinousPacketConnectivityDTX-DRX
CapabilityIEreceivedfromtheBTS No

Yes

CPCEnabledisenabled
No

Yes

CPCcanbeactivated CPCcannotbeactivated

TheBTScanindicatethatitisCPC-capablewithContinuousPacketConnectivityDTX-
DRXCapabilityIEinAUDITRESPONSEortheRESOURCESTATUSINDICATION
message.OperatorusestheRNPparameterCPCEnabledtoactivateanddeactivate
theContinuousPacketConnectivityfeature.WhentheUE-specificpacketscheduler
requeststheCPCactivationtothecell,thecell-specificpacketschedulerresponseis
basedontheFigureFigure107:CPCactivation.
TheUE-specificpacketschedulerperformsthefollowingcheckstoseeifCPCcanbe
activatedfortheUE.

222 DN70303923 Issue:06B


WCDMARANRRMHSUPA Continuouspacketconnectivity

Figure 108 CPCactivationfortheUE

RequirementsforCPCconfiguration

CelllevelrequirementsforCPC No
configurationareOKforallcellswhichare
in(DCH=E-DCH)activeset.

Yes

DPCCHDiscontinuous Transmission No
SupportIEreceivedfromtheUE

Yes

F-DPCHused/ No
CanF-DPCHbeused?

Yes

Roundtriptime No
measurementisnotactive

Yes

CPCcanbeactivated CPCcannotbeactivated

TheUE-specificpacketschedulerrequestsfromthecell-specificpacketschedulerthe
activationoftheCPCinthecell.TheUE-specificpacketschedulerchecksthatCPCcan
beactivatedtoallthecellsinwhichUEhasasofthandoverbranch(definedalreadyin
theFractionalDPCHfeature).TheUEindicatesitssupportfortheCPCwithDPCCH
DiscontinuousTransmissionSupportIE.ThisIEhastobereceivedfromtheUEbefore
theCPCcanbeactivatedfortheUE.FractionalDPCHisneededwithCPCtomake
downlinkDPCCHdiscontinuous,andinordertoobtaingainfromdiscontinuousuplink

Issue:06B DN70303923 223


Continuouspacketconnectivity WCDMARANRRMHSUPA

transmission(CPC).Whentheroundtriptimemeasurementiscompleted,CPCneedsto
beswitchedoffbytheRNCinorderforthenon-servingBTStobeabletogetaccurate
measurementresults.
CPCisnotconfiguredtoaUEwhenallthefollowingstatementsaretrue:

CPCisenabled
HSPA128userspercellisenabled
ThefeaturestateoftheCPC for 128 HSPA Users LKlicenseisnotON(featurestate
isthecombinationoflicenseavailabilityandfeatureadministrativestateinRNC).

ThismeansthatCPCisnotusedeveniftheCPCisactivatedincasewhereHSPA128
userspercellisactiveandthefeaturestateoftheCPC for 128 HSPA Users LKlicense
issettoOFF.
IfthecheckslistedaboveandthechecksshownintheFigureFigure108:CPC
activationfortheUEandCPCyieldtheresultthatCPCcanbeactivatedfortheUE,the
UE-specificpacketschedulerconfigurestheCPC-relatedparameterstotheBTSandto
theUE.
TheUE-specificpacketscheduleractivatesCPCinthefollowingphases:

inthefirstRABsetupphase
inthestatetransitiontoCell_DCHphase
whenthehardhandoverisdone.

WhentheCPCisnotactivatedfortheUE,theUE-specificpacketschedulerchecksthat
canCPCcanbeactivatedfortheUEifanyofthefollowingthingshappen:

Acellisremovedfromtheactiveset.(Itmightbepossiblethatthiscellwas
preventingCPCusage.)
FractionalDPCHisactivated/adecisionismadetoactivateit.Theactivationis
performedwiththesamemessageastheFractionalDPCCHactivation.
Compressedmodehasconcludedbuthardhandoverisnotstarted.
Roundtriptimemeasurementisended.

Inthenewsoft,orsofterhandoverradiolinkestablishmentphase,theUE-specific
packetschedulerchecksifCPCisactivatedfortheUE.IfCPCisactivated,theUE-
specificpacketschedulerconfiguresCPCactivesettonewsoftorsofterhandoverradio
linkintheestablishmentphase.
WhentheUE-specificpacketschedulernoticesthattheCPCneedstobeactivatedfor
theUE,itsendstheCPC-relatedparameterstotheUEandtoallBTSsintheactiveset.

CPCusedtogetherwithDCHSDPA
TheCPCisactivatedfortheDCHSDPAuseronlyiftheCPCisallowedintheprimary
cell.TheCPCcapabilityisnotrequiredfromthesecondarycell.
ThecurrentSCHSDPACPCparametersarealsousedwhentheDCHSDPAis
allocated.

DLDRXcanbeusedforalltypeofHSUPAtraffic
TherearenolimitationsforwhichfullHSUPAconfigurationstheDLDRXcanbe
configuredfortheUE.

224 DN70303923 Issue:06B


WCDMARANRRMHSUPA Continuouspacketconnectivity

TheUE-specificpacketschedulerdefinesUEDTXDRXOffset
10msTTI:
TheUE-specificpacketschedulerusesfreelyanypossiblevalue(0-159subframes).
2msTTI:
TheUE-specificpacketschedulersetsUEDTXDRXOffsetequaltoHARQProcessID
ofSRBreceived/sentfrom/totheBTS.HARQprocessIDgoesinNBAPinthefollowing
IEs:

HARQProcessAllocationFor2msNon-ScheduledTransmissionGrantIE
HARQProcessAllocationFor2msScheduledTransmissionGrantIE

Ifbotharepresentsimultaneously,thefirstoneisused(NSTgrant).

TheUE-specificpacketschedulerdefinesEnablingDelay
CPCEnablingDelay,anactivationtimefortheCPCsettings,specifieshowlongtheUE
DTXisdisabledaftertheRRCreconfigurationoraftertheRLsetup(Soft/softerHO,
Servingcellchange,UEnotinvolvedSRNCrelocation,statetransition,HardHO).Itis
signaledbytheRNCtotheBTSandtheUEintheongoingprocedure.Enablingdelayis
usedonlyiftheRLsetupissenttoaBTSwiththeFirstRLparameter.Thatis,itisthe
firstRLfortheUE.OtherwiseEnablingDelayissettozero.TheEnablingDelaywillbea
RNC-configurableparameter,anditsvalueisdefinedonthebasisofthefollowing
situations:

nodelay=EnablingDelay=0;DuringSoft/SofterHO,ServingCellChangeandUE
notinvolvedSRNSRelocation
standardtype;forallprocedures,thePropagationDelayIEcanbegiventotheBTS
(forexamplestatetransitions).ThevalueoftheparameterEnablDelayStandis
used.
(H)HOtype;forallprocedures,thisadditionalinformationtotheBTScannotbe
given(forexample(Inter-RNC)inter-frequencyHO,(Inter-RNC)intra-frequencyHO
and(intra-RNC)inter-frequencyHO).ThevalueoftheparameterEnablDelayHHO
isused.

IfEnablingDelayvaluedoesnotchange,andthevalueisnodelay=EnablingDelay=
0,thentheEnablingDelayisnotsenttoUEatall.
IfEnablingDelayneedstobesenttotheBTSbecauseitismandatoryIE(likeinthe
caseofsofthandoverbranchaddition),EnablingDelayvalue0issenttoBTS.
IfEnablingDelayisnotmandatoryIE(likeinthecaseofsofterhandoverbranch
addition),EnablingDelayisnotsenttoBTS.IfEnablingDelay>0,theEnablingDelayis
senttobothBTSandUEalwayswhenneeded.

TheUE-specificpacketschedulerdefinesUEDTXCycle1and2
TheBTSsignalsMaxUEDTXcycleIEtotheRNCtoindicatethelongestUEDTXCycle
thatitsupports.TheUE-specificpacketschedulercomparesittothevalueconfiguredin
theRNWdatabasetoUEDTXCycle1and/orUEDTXCycle2fortheRABcombination
UEuses[NRT(BG/IA)(CPCNRT2msTTI,CPCNRT10msTTI),Streaming
(CPCStreaming2msTTI,CPCStreaming10msTTI)andVoice(CPCVoice2msTTI,
CPCVoice10msTTI)].IfthereceivedvalueinMaxUEDTXcycleIEfromBTSis:

Issue:06B DN70303923 225


Continuouspacketconnectivity WCDMARANRRMHSUPA

equaltoorhigherthantheoneconfiguredforUEDTXCycle1andUEDTXCycle2,
theUE-specificpacketschedulersendstheconfiguredvalueintheRNWdatabase
forUEDTXCycle1,andUEDTXCycle2issenttotheBTSandtheUE
smallerthantheoneconfiguredforUEDTXCycle2butbiggerthantheone
configuredforUEDTXCycle1,theUE-specificpacketschedulersendstotheBTS
andtheUEinUEDTXCycle1theconfiguredvalueintheRNWdatabaseandtoUE
DTXCycle2thegreatestpossiblevaluethatsatisfiesthefollowingrules:
equaltoorsmallerthanMAXUEDTXCycle
equaltoUEwithUEDTXCycle1multipliedbyaninteger

smallerthantheoneconfiguredforUEDTXCycle1andUEDTXCycle2,theUE-
specificpacketschedulersendstotheBTSandtheUEin:
UEDTXCycle1thegreatestpossiblevalueequaltoorsmallerthanMAXUE
DTXCycle
UEDTXCycle2value,definedasabove

TheUE-specificpacketschedulerdefinestheUEDRXCycle
TheUEDRXCycleneedstobeamultiplierofUEDTXCycle1inordertogetUEDTX
andUEDRXworkinafeasibleway.TheUEDRXCycleisdefinedwiththe
UEDRXCycleparameterundertherelevantstructure[NRT(BG/IA)(CPCNRT2msTTI,
CPCNRT10msTTI),Streaming(CPCStreaming2msTTI,CPCStreaming10msTTI)and
Voice(CPCVoice2msTTI,CPCVoice10msTTI)].UEDTXCycle1isdefinedwiththe
UEDTXCycle1parameterunderthesameparameterstructure.
TheUE-specificpacketschedulersendstheUEDRXCycle*UEDTXCycle1valuetothe
BTSandtheUEinUEDRXCycleIE.Ifthevalueisnotanallowedvalue,(UEDRXCycle
-1)*UEDTXCycle1isused.Ifthatvalueisnotallowed,(UEDRXCycle-2)*
UEDTXCycle1isusedandsoon.

OtherDTX-DRXrelatedparameters
IftheUEhasindicatedinDevicetypeIEthatitdoesnotbenefitfrombattery
consumptionoptimization,theUE-specificpacketschedulerdoesnotsendUEDRX
informationtotheBTSandtheUE.
TheCPCrelatedparametersthatneedtobesenttotheBTSandtheUEaredefinedin
thefollowingparametersets:NRT(BG/IA)(CPCNRT2msTTI,CPCNRT10msTTI),
Streaming(CPCStreaming2msTTI,CPCStreaming10msTTI)andVoice
(CPCVoice2msTTI,CPCVoice10msTTI).Theparametersetischosenbasedonthe
RABcombinationoftheUE.Inthemulti-RABcase,theparametersofthehighestRAB
priorityareused.ThevalueInactivity Threshold for UE Grant Monitoringistakenfrom
theparameterInacThrUEDTXCycl2.
IfBTSsendsDefault-SG-in-DTX-Cycle-2IEtoRNCviaNBAP,theRNCforwardsittothe
UEviaRRC.IfBTSdoesnotsendDefault-SG-in-DTX-Cycle-2IE,theRNCdoesnot
sendDefault-SG-in-DTX-Cycle-2IEtoUE.

CPCrelatedparametersreconfiguration
TheCPCparametersareintheRNCobject,whichmeansthatineverycellunderthe
RNCtheCPCparametersarethesame.However,theoperatorcanmodifyparameters
online.Ifparametersaremodified,theUE-specificpacketschedulerreconfiguresnew

226 DN70303923 Issue:06B


WCDMARANRRMHSUPA Continuouspacketconnectivity

CPCparameterstotheBTSsandtheUEinthenextHS-DSCHservingcellchange.
WhenanykindofCPCparameterchangeissignaledtotheBTSandtheUE,anew
timingIEissenttotheUE.EnablingDelayandUEDTXDRXoffsetissenttotheBTS.
Occasionally,newcellsintheactivesetindicateupgradeearliertotheSRNCtheMAX
UEDTXCycleIE(inAuditResponseorResourceStatusIndicationmessage),whichis
smallerthanthecurrentlyusedUEDTXCycle2.Ifitissmaller,theSRNCreconfigures
UEDTXCycle2tothegreatestpossiblevaluethatsatisfiesthefollowingrules:

equaltoorsmallerthanMAXUEDTXCycle
equaltoUEwithDTXCycle1multipliedwithsomeinteger.

Occasionally,newcellsintheactivesetindicateupgradeearliertotheSRNCtheMAX
UEDTXCyclewhichissmallerthancurrentlyusedUEDTXCycle1andUEDTXCycle
2.Ifitissmaller,theSRNCreconfigures:

UEDTXCycle1tothegreatestvaluepossiblesothatitisequaltoorsmallerthan
MAXUEDTXCycle
UEDTXCycle2asdefinedabove

ThereisanumberofconfigurableparametersforNRT(BG/IA)(CPCNRT2msTTI,
CPCNRT10msTTI),Streaming(CPCStreaming2msTTI,CPCStreaming10msTTI)and
Voice(CPCVoice2msTTI,CPCVoice10msTTI)services.Ifthemulti-RABconfiguration
oftheUEchanges(alsowhenstreamingRABisconfiguredtoDCH0/0)sothatthe
parametersneedstobereadfromadifferentparameterset,theUE-specificpacket
schedulerconfiguresnewCPCparameterstotheUEandtheBTSimmediately.The
highestpriorityservicedefinestheusedparameters.
Therearedifferentconfigurableparametersfor2msTTI(CPCNRT2msTTI,
CPCNRT10msTTI),Streaming(CPCStreaming2msTTI,CPCStreaming10msTTI)and
Voice(CPCVoice2msTTI,CPCVoice10msTTI).OnlyforUEDTXCycle1,UEDTX
Cycle2andMACDTXCycleitispossibletosenddifferentvaluestotheUEandthe
BTSfordifferentTTIs(2ms/10ms)inthesamemessage.WhentheTTIisreconfigured,
theUE-specificschedulerchecksifanyotherparameterhasadifferentvalueforthis
newTTIcomparedtotheoldTTI.Ifso,itreconfiguresalltheDRX-DTXparametersto
theUEandtheBTS.
WhentheRNCreceivesinanHARQ Process Allocation For 2ms Non-Scheduled
Transmission GrantIEoranHARQ Process Allocation For 2ms Scheduled Transmission
Grant IEadifferentHARQprocessIDthantheonecurrentlyused,itreconfiguresvalue
oftheUEDTXDRXOffset.
AlwayswhentheEnablingDelayvaluethatisstoredintheUEcontext(itisthevalue
thathasbeenusedwithlatestprocedure)doesnotfittheproceduretobestarted,the
UE-specificpacketschedulerreconfiguresasuitablevaluetotheUEandtheBTS.
WiththeCPCfeature,therearesituationswheretheUE-specificpacketschedulerneeds
toreconfiguretheexistingradiolinkandaddanewradiolinktogether.Inthese
situations,asynchronizedprocedureisused.

16.2 CPCdeactivation
IftheBTSnoticesthatthequalitydeteriorates,theBTScandeactivateCPC.IftheRNC
noticesthatqualitydeteriorates,theRNCswitchesSRBsawayfromHSPA,which
deactivatestheCPC.

Issue:06B DN70303923 227


Continuouspacketconnectivity WCDMARANRRMHSUPA

TheUE-specificpacketschedulermightdeactivateCPCfortheUEbecause:

CPCcannotbeactivatedtothenewcellthatneedstobeaddedtotheactiveset.
ThedeactivationofCPCisdonefirst,andafterthatthenewcellisaddedtothe
activeset.
FractionalDPCHisdeactivated.
Thecompressedmodestarts.
Theroundtriptimemeasurementstarts.TheUE-specificpacketschedulerwaitsfor
anacknowledgmentfortheRLReconfigurationmessagefromeveryBTS.Afterit
hasreceivedacknowledgmentfromeveryBTSintheactiveset,itwaits100ms
beforeitsendsanRTTmeasurementstartingmessagetotheBTS.

WhentheUE-specificpacketschedulernoticesthatCPCneedstobedeactivated,it
checksifastatetransitionawayfromtheCell_DCHstateshouldbeperformedinsteadof
theCPCactivation.Thestatetransitionisperformedifextrainactivitytimerisrunning,
andifanyofthefollowingisvalid:

UEisafastmovingUE.DefinedintheURA_PCHfeature.
Non-CPCExtrainactivitytimefortheUEiszero.

Otherwise,theCPCisdeactivatedfromtheUE.WhentheCPCisdeactivated,theRNC
sendsforthefollowing:

TotheUE:amessage(forexampleRADIOBEARERRECONFIGURATION)without
including'DTX-DRXtiminginformation'IE.Fromthis,theUEshouldinterpretthat
CPCisdeactivated.
TotheBTS:arelevantmessagewithDTX-DRXInformationToModifyincluding
'Deactivate'information.Fromthat,theBTSknowsthatCPCisdeactivated.

228 DN70303923 Issue:06B


WCDMARANRRMHSUPA HSUPA16QAM

17 HSUPA16QAM

g NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.

g NotethatlicenseinformationisrelevantonlytotheIPA-RNCsolution.

Theusageof16QAMmodulationforHSUPAisenabledwiththecell-level
HSUPA16QAMAllowedWCELparameter.IfthisparametervalueissettoEnabledand
theMaxTotalUplinkSymbolRateparametervalueissetto3(correspondingtoa
symbolrateof5760kbpsandaspreadingfactorset2*SF2+2*SF4),theRNCcanuse
theHSUPA 16QAMfeatureinacell.WhentheHSUPA 16QAMfeatureisbeingactivated
inacell,andthatcellisthefirstoneintheBTSwheretheHSUPA16QAMisattempted
foractivation,theHSUPA16QAMlicensestatusisverified.
TheHSUPA 16QAMfeaturecanbeusediftheRAN981: HSUPA 5.8 Mbpsand
RAN1470: HSUPA 2 ms TTIfeaturesareactiveintheRNC.TheRAN1470: HSUPA 2
ms TTIfeaturemustbeusedwiththeCDSP-DHcardintheRNC.
TheE-DCHcategory7UEsupportsQPSKand16QAM.TheRNCkeepsrecordofUE
indicationsofHSUPA16QAMcapabilityontheUEbasis.NotethattheUEselects
autonomously16QAMmodulationifE-TFCIisgreaterthan103(2msTTIE-DCH
TransportBlockSizeTable2)orgreaterthan69(2msTTIE-DCHTransportBlockSize
Table3).
TheBTSindicationsofHSUPA16QAMsupportaresentfromtheBTStotheRNCona
cellbasis.TheHSUPA16QAMcapabilityisbasedonanHSUPA16QAMSupport
indicationrequiredforHSUPA16QAMusage.

17.1 HSUPA16QAMandE-DCHpowerboostingusage
TheHSUPA16QAMcanonlybeusedwithE-DCHpowerboostingandviceversa.The
E-DPDCHPowerInterpolationmethodisalwaysusedwiththeHSUPA16QAM.
TheHSUPA16QAMusagecriteriaareverifiedinthefollowingcases:

DuringRadiolinksetup.
WhentheActiveSetischanged.
When2msTTIswitchto10msTTItakesplace.
WhentheuserplaneissetupforNRTPSRB(NRTinteractiveorNRTbackground).
WhentheULChannelswitchestoE-DCH.
WhenPSRTRABisaddedorreleased.

TheRNCallowstheusageoftheHSUPA16QAMandE-DCHpowerboostinginallcells
oftheActiveSetifthefollowingconditionsarefulfilledineverycelloftheActiveSet:

TheHSUPA16QAMlicenseisavailableandsettoON.
TheHSUPA16QAMisenabledinacellintheRNC.
TheUEisHSUPA16QAMandE-DCHpowerboostingcapableasindicatedfromthe
UEtotheRNCusingtheRRC:CONNECTIONSETUPCOMPLETEmessage.

Issue:06B DN70303923 229


HSUPA16QAM WCDMARANRRMHSUPA

ThecelloftheBTSisHSUPA16QAMandE-DCHpowerboostingcapableas
indicatedfromtheBTStotheRNCintheNBAP:AUDITRESPONSEandNBAP:
RESOURCESTATUSINDICATIONmessages.
ThefeaturesrequiredbytheHSUPA16QAMareinuse.
NRTPSRBisamongtheRBsmappedonE-DCHfortheUE.
2msTTIisusedforradiobearersand5.8mbps(2*SF2+2*SF4)forE-DCH.
AllcellsoftheActiveSetarehandledbytheSRNC,thatis,driftingisnotallowed.
IfflexibleULRLCisapplied,toallowtheHSUPA16QAMusage,thenumberof
activeHSUPAusersinHSDPAservingcellhastobelowerthanorequaltothe
thresholddefinedwiththeHSUPAUserLimit16QAMparameter.
IffixedULRLCisappliedtheULRLCPDUsizeofNRTPSRB(NRTinteractiveor
NRTbackground)forHSUPA16QAMis656.

TheconnectioncanbesingleormultiRAB.ThereisnoimpactofCPConHSUPA
16QAM.
IftheHSUPA16QAMisallowed,theRB(s)areconfiguredto16QAMandthefixedUL
RLCPDUsizewithMAC-esofNRTPSRBis656.When,aftertheverification,the
usageofHSUPA16QAMisnomoreallowed,theRBsareconfiguredtoQPSKandthe
fixedULRLCPDUsizeofNRTPSRBsarereconfiguredtosize336.
TheusageofflexibleULRLCPDUsizewithHSUPA16QAMisallowed.When
disallowingtheuseofHSUPA16QAM,theusageofflexibleULRLCPDUisdetermined
fortheRBreconfigurationaccordingtoflexibleULRLCcriteria.
IftheHSUPA16QAMisallowedforaRBthatisnotcurrentlyusingHSUPA16QAM,the
RB(s)isreconfiguredsothatHSUPA16QAMisallowed.TheULRLCPDUsizeiseither
flexibleorfixed.TheULRLCPDUsizeissetas656whenfixedULRLCPDUsizeis
usedwithMAC-es.ReconfigurationismadetoRB(s)ifneeded(thatis,RB(s)hasbeen
previouslyQPSKwithULRLCPDUsize336).
WhenaddingacelltotheActiveSet,thereconfigurationoftheexistingRB(s)ismade
beforeincludingthecellintheActiveSet.
TherearetworeasonswhytheRBreconfigurationismadebeforetheActiveSetupdate:

TheBTSofanewcelldoesnotsupportHSUPA16QAM.
TheHSUPA16QAMisnotallowedoverIur.

InbothcasestheHSUPA16QAMconfigurationtothenewRB/newcellisnotpossible.
TheHSUPA16QAMisnotappliedinIur(2msTTIisnotusedinIur).

MACresetduetotheHSUPA16QAMapplication
AMACresetismadeintheUE,theBTS,andtheRNCwhenachangeinapplyingthe
HSUPA16QAMtakesplaceforE-DCH(thatis,theapplicationoftheHSUPA16QAM
changesafterthecriteriaverification).TheMACresetisindicatedtotheUEwithMAC-
es/eResetIndicatorIEwithTRUEvalueinrelevantRRCmessagesandtotheBTSwith
MAC-eResetIndicatorintherelevantNBAPmessages.

17.2 RLCPDUsize
ThefixedULRLCPDUsizeforNRTPSRBsisusedasfollows:

230 DN70303923 Issue:06B


WCDMARANRRMHSUPA HSUPA16QAM

IftheHSUPA16QAMisallowedaccordingtoothercriteriathantheRLCPDUsizein
allcellsoftheActiveSet,thentheRLCPDUsizedeterminationismadebasedon
thenumberofactiveHSUPAusersintheHSDPAservingcell.
IfthenumberofactiveHSUPAusersintheHSDPAservingcellislowerthanor
equaltothethreshold,definedwiththeHSUPAUserLimit16QAMparameter,the
RLCPDUsizeis656bits.
OtherwiseanRLCPDUsizeof336bitsisusedandtheHSUPA16QAMisnot
allowed.

IftheHSUPA16QAMisnotallowed,thentheRLCPDUsizeis336bits.
ThedeterminedRLCPDUsizeisvalidforallcellsoftheActiveSet.

TheexistingRLCparametersandwindowsizesareused.TheRBsarereconfigured
whentheRLCPDUsizeischanged.IncasetheRLCPDUsizeisbeingreconfigured
onlyfortheUL(forexample,duetoachangeintheULmodulationschemefrom16
QAMtoQPSK),theRLCOne-sidere-establishmentisperformed.
ThefixedRLCPDUsize656reservesmoreBTSbasebandresourcesthantwo336
PDUs.ThelowestbitratecannotbeachievedwiththeRLCPDU656.TheRLCPDU
656shouldbeusedwhenthereisoneHSUPAuserinthecell.NotethattheflexibleUL
RLCisusedwhenavailable.WhentheflexibleULRLCisnotsupported,afixedRLC
PDUsizeof336/656isused.

RLCPDUreconfigurationwhenchangefrom2msTTIto10msTTIis
performed
WhentheHSUPA16QAMisallowedandusedinRB,andifthe2msTTIisnomore
available(switchedfrom2msTTIto10msTTI),theRLCPDUsizereconfigurationfor
NRTPSRBsinallcellsoftheActiveSetisperformedfrom656bitsto336bits.

17.3 BTScapabilityforHSUPA16QAMandE-DPCCH
boosting
ThefollowinginformationisincludedbytheBTSintheNBAP:AUDITRESPONSE
message:

theSixteenQAM UL CapabilityIEsettoSixteenQAMULCapableforeveryHSUPA
16QAMUL-capableLocalCell.
theE-DPCCH Power Boosting CapabilityIEsettoE-DPCCHPowerBoosting
CapableforeveryE-DPCCHPowerBoosting-capableLocalCell

TheRNCusestheHSUPA16QAMcapabilityonacellbasis
WhenacellexistsintheBTSorwhenthecapabilitiesarechangedintheBTS,theBTS
informstheRNCaboutthecapabilitiesbysendingaNBAP:RESOURCESTATUS
INDICATIONmessageincludingSixteenQAM UL CapabilityIEandE-DPCCH Power
Boosting CapabilityIE.

Issue:06B DN70303923 231


HighSpeedCell_FACH WCDMARANRRMHSUPA

18 HighSpeedCell_FACH
WiththeRAN1913: High Speed Cell_FACHfeaturetheHSPAusageinCell_FACHstate
isenabled.ToimprovetheULperformance,thelogicalchannels(CCCH/DCCH/DTCH),
previouslymappedtotheRACHtransportchannel,aremappedtoE-DCH.Withthis
featuremoreusersaresupportedinCell_FACHstateandsmoothdatatransmissionis
providedforuserswithsmalldatavolumes.

Figure 109 HSUPAchannelmappinginCELL_FACHstate


Logical CCCH DCCH DTCH

Transport RACH E-DCH

Physical PRACH E-DPCH


Thisfeatureutilizesthe3GPPenhancedCell_FACHstatefordownlink(Rel7)anduplink
(Rel8).InthedownlinkdirectionthelogicalchannelsaremappedtoHS-DSCHtransport
channelandintheuplinkdirectiontoE-DCHtransportchannel.
WiththisfeaturetheE-DCHmightbeusedintheuplink(UL)directioninCell_FACHand
idlestates.The3GPPRel8EnhancedUplinkinCELL_FACHstateandIdlemodeisa
combinationof3GPPRel99randomaccesspowerrampingphasewithE-DCH
transmission,wherebyDTCH/DCCHandCCCHtransmissionsaresupported.Atthe
physicallayerthepreambletransmissionwithpowerrampingissimilartotheRel99
RACH,buttheacquisitionindicationandassignmentofresourcesisperformedforE-
DCH.
InidlemodeorifnoE-RNTIidentifierisallocatedtotheUE,onlyCommonControl
Channel(CCCH)datatransmissionispossible.WhentheE-RNTIisallocated(bythe
BTS),acollisionresolutionisperformed.Adedicateddatatransmissionandcontrol
signalingisgrantedontheE-DCH.WhentheassignedcommonE-DCHresourcesare
allocatedfortheUE,innerlooppowercontrolisstarted.TheUEisabletosendthe
ACK/NACKandtheCQIfortheHS-DSCH.
WhenE-DCHtransmissionisnotusedforuplink(forexampleinRel7UE,theRel99
RACHisusedforuplink),thereisnodedicateduplinkfeedbacksignalingchanneland
HSDPAHARQisnotused.Instead,MAClayerisconfiguredtoexecutefixeddownlink
retransmissions.

232 DN70303923 Issue:06B


WCDMARANRRMHSUPA HighSpeedCell_FACH

Figure 110 HSPAusageonCEL_FACHstatevs.HSPAusageonCELL_DCHstate

Mobility based on cell reselection Network controls mobility and


No macro diversity macro diversity minimizing the
interference
Minimum UE category for all
Full UE category information
Dedicated resources reserved available and used as BTS
only during UL transmission scheduler
(HSUPA, UL and DL feedback,
Guaranteed bit rates
F-DPCH)

High Speed Seamless state HSPA in


Cell_FACH transition Cell_DCH

ParametersneededfortheE-DCHtransmissioninCell_FACHstate,thatisE-DCHand
F-DPCHconfigurationforassignedcommonE-DCHresources,areincludedinthe
systeminformationbroadcast(SIB5/SIB5bis).
BTSbasebandresourcesareefficientlysharedbetweenHS-Cell_FACHstateUEssince
theresourcesarenotreservedforaUEduringinactivity.Thisalsoimprovesresource
utilizationattheRNCbecauseCell_DCHsetupisnotneededforshortdataburst.High
SpeedCell_FACHhasmajorbenefitsinBTSandRNCresourceutilization,especially
whenconsideringanincreasedamountsofkeep-alivemessagingfromsmartphones.
ForHS-RACHthefixedvalueE-TTI=10msandtable0isused.

18.1 HS-RACHfunctionality
18.1.1 SetupofHS-RACHconfigurationtothecell
TheBTSinformsRNCwhetheracertaincellsupportsHS-RACH(capabilityofHigh
Speed-RACH/CommonE-DCH)bysendingtheNBAP:AUDITRESPONSEor/and
RESOURCESTATUSINDICATIONmessageinCommon E-DCH Capability,E-AI
Capability,andCommon E-DCH HS-DPCCH CapabilityIEs.
ThecertaincellsupportsHS-RACHwhenthe:

Common E-DCH Capability IEissettoCommonE-DCHCapable,


E-AI CapabilityIEissettoE-AICapable,and
Common E-DCH HS-DPCCH CapabilityIEissettoACK-NACKandCQICapable.

IfanyIEismissingorissettosomethingelsethanmentionedabove,theRNCdoesnot
setupHS-RACHtotheBTSandthecelldoesnotsupportHS-RACH.
IfthecellsupportsHS-RACHandtheHigh Speed Cell FACHfeatureisenabled(withthe
HSRACHEnabledparameter),theHS-RACHconfigurationissetuptothecell
immediatelyduringthecellsetupphaseafterasuccessfulsetup/configurationofHSUPA
inthecell.
SetupofHS-RACHtowardstheBTSisperformedbyusingNBAP:PhysicalShared
ChannelReconfigurationprocedure.

Issue:06B DN70303923 233


HighSpeedCell_FACH WCDMARANRRMHSUPA

Figure 111 HSPAusage

234 DN70303923 Issue:06B


WCDMARANRRMHSUPA HighSpeedCell_FACH

18.1.2 UEcapabilityoftheHS-RACH
Rel8andnewerUEcaninformitsHS-RACH(HighSpeedRACH/CommonE-DCH)
capabilitytotheRNCbysendingtheRRC:RRCCONNECTIONREQUESTorCELL
UPDATE(URA_UPDATE)messagewithSupport of common E-DCHIEsettoTRUE.
ThisIEisalsosettoTRUEintheUEradioaccesscapabilityinformationifUEsupports
it.
TheUEradiocapabilityinformationisreceivedfromUEin:

theoptionalUE radio access capabilityIEoftheRRC:RRCCONNECTIONSETUP


COMPLETEmessage,or
intheInter RAT Handover Infowith Inter RAT CapabilitiesfromthesourceRAT,or
intheSRNS Relocation InfofromthesourceRNSintheRRC Information to target
RNCoftheRANAP:RELOCATIONREQUESmessage.

18.1.3 ChannelizationcodeforHS-RACH
WhentheHSUPAissetupinthecellandtheHSUPA2msTTIfeatureisconfiguredin
thecell,twoE-AGCHchannelizationcodesaresetupintheBTS.RRMdecideswhichof
theE-AGCHchannelizationcodeisusedforHS-RACHwhenHS-RACHisconfiguredin
thecell.
TheE-AGCHchannelizationcodenumber,thatisindexedinthefirstplaceofPSCR
RequestsignaledtotheBTSduringHSUPAsetup,isusedduringsetupofHS-RACH.
Thatis,theE-AGCHcodeisusedbyconnectionswithHSUPA10msTTI.
CodeinformationissignaledtotheBTSbyusingNBAP:PHYSICALSHARED
CHANNELRECONFIGURATIONREQUESTmessagewithinCommon E-DCH E-AGCH
Channellisation Code NumberIEofCommonE-DCHSystemInformationduringsetupof
HS-RACH.
ThesameinformationissignaledtoUEsbyusingRRC:SIB5/5bismessageafter
successfulsetupofHS-RACHwithinE-AGCH InfoIEofCommon E-DCH system info.

18.1.4 ThemaximumtotaluplinksymbolrateoftheHS-RACH
PacketScheduleroftheCRNCdeterminesthemaximumtotaluplinksymbolrateofthe
HS-RACH.
ThemaximumtotaluplinksymbolrateoftheHS-RACHoftheUE(maximumtotal
symbolrateoftheE-DPDCH(s)inCELL_FACHstate)inthecellisdefinedbythe
HSRACHMaxTotSymbolRateWCELparameter.Possiblevaluesare60kbit/s(SF64),
120kbit/s(SF32),240kbit/s(SF16),480kbit/s(SF8,)960kbit/s(SF4),and1920kbit/s
(2*SF4).
ValueofthisparameterischeckedduringcellcreationwhentheHS-RACHissetupin
thecell.Modificationoftheparameterrequirescelllocking.
ThevalueisincludedinCommon E-DCH E-DPCH InformationIEofMaximum Set of E-
DPDCHsinNBAP:PHYSICALSHAREDCHANNELRECONFIGURATIONREQUEST
messageduringHS-RACHsetupandinMaximum channelisation codesIEofRRC:
SIB5/5bismessagewhentheHS-RACHisusedinthecell.

Issue:06B DN70303923 235


HighSpeedCell_FACH WCDMARANRRMHSUPA

18.1.5 E-DCHuserbitrateswithHS-RACH
ThemaximumallowedE-DCHuserbitrateswhentheE-TTI=10msforHS-RACHis:

64kbit/sifmaximumallowedtotaluplinksymbolrateis120kbit/s(correspondsto
spreadingfactorSF32andmaximumE-DCHbitrate69kbit/s).
160kbit/sifmaximumallowedtotaluplinksymbolrateis240kbit/s(correspondsto
spreadingfactorSF16andmaximumE-DCHbitrate169.8kbit/s).
320kbit/sifmaximumallowedtotaluplinksymbolrateis480kbit/s(correspondsto
spreadingfactorSF8andmaximumE-DCHbitrate337.8kbit/s).
672kbit/sifmaximumallowedtotaluplinksymbolrateis960kbit/s(correspondsto
spreadingfactorSF4andmaximumE-DCHbitrate711kbit/s).
1376kbit/sifmaximumallowedtotaluplinksymbolrateis1920kbit/s(corresponds
tospreadingfactorset2*SF4andmaximumE-DCHbitrate1448.4kbit/s).

18.1.6 HARQmethodusedwithHS-RACH
PacketschedulerdefinesHARQmethodusedwithHS-RACH.TheBTSsignalstothe
RNCinformationwhichmethod,ifany,itsupports(IRCombiningCapable,Chase
CombiningCapable,IR,andChaseCombiningCapable).TheBTSsignalsthe
informationtoRNCusingNBAP:E-DCHHARQCombiningCapabilityinformation
element.TheBTSsupportsbothChaseCombiningandIncrementalRedundancy
Combiningmethods.
ExistingRNCHARQRVConfigurationconfigurationparameterisusedtodefinewhich
methodisused.ThisinformationisincludedintheNPAB:PHYSICALSHARED
CHANNELREQUESTmessagewithinHARQ info for E-DCHofCommon E-DCH E-
DPCH InformationduringsetupofHS-RACHandinformtheUEswithRRC:SIB5/5bis
messageaftersuccessfulsetupofHS-RACHwithinHARQ info for E-DCHofCommon
E-DCH System Info.

18.1.7 MaximumE-DCHresourceallocationforCCCH
ThemaximumE-DCHresourceallocationforCCCHisdefinedbynew
HSRACHMaxAllocTimeCCCHWCELparameter.
ItissignaledtotheBTSbyusingNPAB:PHYSICALSHAREDCHANNELREQUEST
messagewithinMaximum E-DCH resource allocation for CCCHIEofCommon E-DCH
InformationduringsetupofHS-RACHandinformedtoUEsviaRRC:SIB5/5bismessage
aftersuccessfulsetupofHS-RACHwithinMaximum E-DCH resource allocation for
CCCHIEofCommon E-DCH System Info.

18.1.8 Maximumperiodforcollisionresolutionphase
Themaximumperiodforcollisionresolutionphaseisdefinedbythenew
HSRACHMaxPeriodCollisWCELparameter.
ItissignaledtotheBTSbyusingNPAB:PHYSICALSHAREDCHANNELREQUEST
messagewithinMaximum period for collision resolution phaseIEofCommon E-DCH
InformationduringsetupofHS-RACHandinformedtoUEsviaRRC:SIB5/5bismessage
aftersuccessfulsetupofHS-RACHwithinMaximum period for collision resolution phase
ofCommon E-DCH System Info.

236 DN70303923 Issue:06B


WCDMARANRRMHSUPA HighSpeedCell_FACH

18.1.9 ReleaseofCommonE-DCH
ThereleaseofCommonE-DCHmethodisdefinedbythenew
HSRACHImplicitReleaseWCELparameter.
IfimplicitcommonE-DCHresourcereleasedefinedwiththeHSRACHImplicitRelease
parameterissettoinfinite,valueFALSEissignaledtotheBTS.Otherwise,valueTRUE
issignaledtotheBTS.TheinformationissignaledtotheBTSbyusingNPAB:
PHYSICALSHAREDCHANNELREQUESTmessagewithinCommon E-DCH implicit
release indicatorofCommon E-DCH InformationduringsetupofHS-RACH.Thevalue
definedbytheHSRACHImplicitReleaseparametersignaledtoUEsassuchvia
RRC:SIB5/5bismessageaftersuccessfulset-upofHS-RACHwithinE-DCH
transmission continuation back offofCommon E-DCH System Info.

18.1.10 PowercontrolalgorithmusedwithHS-RACH
WhenpowercontrolalgorithmusedwithHS-RACHisdefinedwiththealgorithm1,the
TPCstepsize1(indB)isusedandincludedinRRC:SIB5/5bismessage.Ifalgorithm2
isused,TPCstepsizeisnotincludedintheRRC:SIB5/5bismessage.
PowercontrolalgorithmandTPCstepsize(whenneeded)arebroadcastedtoUEsby
theRRC:SIB5/5bismessagewithinPower Control AlgorithmandTPC step sizeIEsof
Uplink DPCH power control infoofCommon E-DCH system infowhenHS-RACHis
used.

18.1.11 ServingGrantinformation
TheRNCreceivesservinggrantinformationfromtheBTSduringsetupofHS-RACH
withinNBAP:PHYSICALCHANNELRECONFIGURATIONRESPONSEmessagewithin
Serving Grant ValueIEoftheCommon E-DCH System Information Response.Thevalue
receivedfromtheBTSissignaledtoUEsassuchbyusingtheRRC:SIB/5bismessage
aftersuccessfulsetupofHS-RACHwithinInitial Serving grant valueIEofCommon E-
DCH system info.

18.1.12 E-DCHResourceconfiguration
ThenumberofcommonE-DCHresourcestobeconfiguredisdefinedbyusingnew
HSRACHCommonEDCHResRNPparameter.
EachCommonE-DCHresourceconfigurationofthecellincludesSymboloffset(Soffset),
F-DPCHcodenumber,ULDPCHinfo(Scramblingcodenumber/type),andE-HICH
Information(ChannelizationCodeandSignatureSequence).

g NotethatE-RGCHspecificinformationhasnotbeenconfiguredforHS-RACH.

ULinterferenceforcommonE-DCH
TheinformationofULinterferenceforcommonE-DCHisoptionalanditsnotused.
ThustheUL interference for common E-DCHIEisnotincludedintoRRC:SIB5/5bis
messageinCommonE-DCHsysteminfoIE.
Thevalueisusedtocalculatethepowerforthefirstpreambleasfollows:

Issue:06B DN70303923 237


HighSpeedCell_FACH WCDMARANRRMHSUPA

IncaseithasnotbeendefinedthenthevaluedefinedinUL interferenceIEofSIB7is
used.

ULscramblingcodeallocationforHS-RACH
EachcommonE-DCHresourceownsauniqueuplinkscramblingcodewithinthesame
frequency.ThenumberofULscramblingcodestobeallocatedinthecellissameas
numberofCommonE-DCHresourcestobesetupinthecell.AllocationsofUL
scramblingcodesareselectedfromthesamerangeasithavebeenmadeforUEs.
ScramblingcodesallocatedfortheHS-RACHusearenotallocatedfortheUEson
CELL_DCHstate.
TheULDPCHisscrambledwithalongscramblingcodenumber/type.
TheULscramblingcodeinformationissignaledtotheBTSbyusingNBAP:PHYSICAL
SHAREDCHANNELRECONFIGURATIONREQUESTmessagewithinUL Scrambling
Code NumberandUL Scrambling Code LenghtIEsofUL Scrambling CodeIEof
Common E-DCH Resource Combination InformationduringsetupofHS-RACH.TheUL
ScramblingcodeinformationissignaledtoUEsbyusingRRC:SIB5/5bismessageafter
successfulsetupofHS-RACHwithinScrambling code numberandScrambling code
typeIEsofUplink DPCH code infoIEofCommon E-DCH Resource Configuration list.

E-HICHchannelizationcodeandE-HICHsignaturesforHS-RACH
ThenumberofE-RGCH/E-HICHsignaturescanvaryfrom1to32dependingonthe
numberofCommonE-DCHresourcesconfiguredinthecell.Thecodenumberallocated
foruseoftheHS-RACHisthesameasthefirstE-RGCH/E-HICHcodeallocatedduring
HSUPAsetupinthecell.
ThenumberofcommonE-DCHresourcestobesetupinthecellhasbeendefinedby
thenewHSRACHCommonEDCHResparameter.
EachCommonE-DCHresourcehasauniqueE-HICHsignatureSequenceperE-HICH
code.SignatureSequenceforthefirstCommonE-DCHresourceissetto0andfor
secondoneitissetto1uptovaluedefinedbytheHSRACHCommonEDCHResparameter.
ThemaximumnumberofsupportedCommonE-DCHresourcesis10(inRU40).

g NotethatthenumberofconfiguredCommonE-DCHresourcesispracticallythe
sameasthemaximumnumberofHS-RACHuserscansenddatawithinthe
sameTTIonHS-RACHinthecell.
NotethatE-RGCHisnotusedincaseofHS-RACH.

E-HICHcodeandsignatureSequenceinformationissignaledto:

BTSbyusingNBAP:PHYSICALSHAREDCHANNELRECONFIGURATION
REQUESTmessagewithinE-RGCH/E-HICH Channelisation CodeandE-HICH
Signature SequenceIEsofCommon E-DCH Resource Combination Information
duringsetupofHS-RACH.
UEsbyusingRRC:SIB5/5bismessageaftersuccessfulsetupofHS-RACHwithin
Channelisation CodeandSignature SequenceIEsofE-HICH info IE of Common E-
DCH Resource Configuration list.

238 DN70303923 Issue:06B


WCDMARANRRMHSUPA HighSpeedCell_FACH

TheRRC:SIB5/5bismessagesignaledtoUEsisoptimizedsothatIEChannelisation
CodeisincludedonlythefirstoccurrenceoftheIEandintheIESignatureSequence
alwaysMDvalueisused.

18.1.13 PRACHpreamblecontrolforHS-RACH
PreambleSignatures
AdmissionControloftheCRNCproducesthePreambleSignaturesforHS-RACHduring
theHS-RACHsetup.
ThesignaturesforHS-RACHareallocatedfromthesamePRACHasduringtheRACH
signatureallocation.TheallowedpreamblesignaturesaredefinedbytheRNP
AllowedPreambleSignaturesparameter.
WhentheHS-RACHisenabledinthecell(theWCEL-HSRACHEnabledparameterisset
toEnabled),thesignaturesareallocatedinthefollowingway:

WhenallthesignaturesareconfiguredwiththeAllowedPreambleSignatures
parameter,thesignaturewiththelowestnumberisallocatedtotheHS-RACH.The
remainingthreeareleftfortheRACHconfigurationandallocation.
Whennotallofthesignaturesareconfiguredwiththe
AllowedPreambleSignaturesparameter,thefirstfreelowestnumberof
signatureisallocatedtotheHS-RACH.TherestisleftfortheRACHuse.

TheHS-RACHsignatureinformationissignaledtotheBTSbyusingNBAP:PHYSICAL
SHAREDCHANNELRECONFIGURATIONREQUESTmessagewithinCommon E-DCH
Preamble SignatureIEofCommon E-DCH Preamble Control Informationduringsetupof
HS-RACH.TheHS-RACHsignatureinformationisalsosignaledtoUEsbyusingRRC:
SIB5/5bismessageaftersuccessfulsetupofHS-RACHwithinAvailable SignatureIEof
PRACH preamble control parameters (for enhanced Uplink).
RNCincludesallthepreamblesignaturestobeusedforRACHandHS-RACHinRACH
transportchannelsetup.

ScramblingCodeNumber
CRNCproducestheScramblingCodeNumberwhentheHS-RACHissetup.
ThesamevalueisusedasithasbeendefinedduringsetupofRACHinthecellandre-
usedassuchduringsetupofHS-RACH.
InformationissignaledtotheBTSbyusingNBAP:PHYSICALSHAREDCHANNEL
RECONFIGURATIONREQUESTmessagewithinScrambling Code NumberIEof
Common E-DCH Preamble Control InformationduringsetupofHS-RACH.Informationis
alsosignaledtowardsUEsbyusingRRC:SIB5/5bismessageaftersuccessfulsetupof
HS-RACHwithinPreamble scrambling code numberIEofPRACH preamble control
parameters (for Enhanced Uplink).
TheRRC:SIB5/5bismessagesignaledtoUEsisoptimizedsothatMDvalueisalways
usedinthePreamble scrambling code numberIEfield.

PreambleThreshold
CRNCdefinesthethresholdforpreambledetectionduringHS-RACHsetup.Theratio
betweenreceivedpreamblepowerduringthepreambleperiodandinterferencelevelis
abovethisthreshold.

Issue:06B DN70303923 239


HighSpeedCell_FACH WCDMARANRRMHSUPA

ThevalueforPreamble ThresholdIEofCommon E-DCH Preamble Control Information


issignaledtotheBTSbyusingNBAP:PSCRmessage.

ExtendedAcquisitionIndicator
TheuseofE-AI(ExtendedAcquisitionIndicator)isdefinedbynewHSRACHExtendedAI
parameter.
IfthevalueoftheHSRACHExtendedAIparameterissettoTRUE,theE-AI IndicatorIE
ofCommon E-DCH Preamble Control InformationisalsosettoTRUEwhentheHS-
RACHissetupandtheIEsendtowardstheBTSbyusingNBAP:PHYSICALSHARED
CHANNELRECONFIGURATIONREQUESTmessage.IfithasbeensettoFALSE,the
E-AI IndicatorIEisnotincludedintheNBAP:PHYSICALSHAREDCHANNEL
RECONFIGURATIONREQUESTmessage.
ThevalueoftheHSRACHExtendedAIparameterisalwayssignaledtowardsUEsby
usingRRC:SIB5/5bismessageaftersuccessfulsetupofHS-RACHwithin E-AI
IndicationIEofPRACH preamble control parameters (for enhanced Uplink).

AICHinformation
WhentheHS-RACHisconfigured,thedefaultvalueisused,thatistheAICH infoIEof
PRACH preamble control parameters (for Enhanced Uplink)isnotpresent/includedin
themessageofSIB5/5bis.ThedefaultvalueusedbyUEisinthefirstoccurrenceinlist
PRACH system information listinSIB5/5bis.
FortheconfigurationofBTStheCommon E-DCH AICH InformationIEofCommon E-
DCH Preamble Control InformationisnotincludedintoNBAP:PHYSICALSHARED
CHANNELRECONFIGURATIONREQUESTmessageduringHS-RACHsetup.

AvailableSubChannelNumber
WhentheHS-RACHisused,theCRNCdefinestheavailablesubchannelnumbersto
bedeliveredtoUEbyusingRRC:SIB5/5bismessage.
ThevalueforAvailable Sub Channel NumberIEofPRACH preamble control parameters
(for Enhanced Uplink)isdefinedbyusingHSRACHSubChannelNumberWCEL
parameterandsignaledtoUEsbyusingRRC:SIB5/5bismessage.
Ifthespecialvalue0isconfigured,theRRC:SIB5/5bismessagesignaledtoUEsis
optimizedsothatMDvalueisalwaysusedintheAvailable Sub Channel NumberIE
field.ThedefaultvalueisthesamevalueasindicatedintheAvailable Sub Channel
NumberIEinthePRACH system information list.
MDvalueisalwaysusedifthesubchannelsdefinedbythe
HSRACHSubChannelNumberparameterisnotthesubsetthechannelsdefinedbythe
AllowedRACHSubChannelsparameter.

PRACHparameters
ACoftheRNCdefinesthePRACH partitioning,Persistence scaling
factors,AC-to-ASC mapping,Primary CPICH TX power,Constant value,
PRACH power offset,andPRACH transmission parameterattributesforHS-
RACH.

240 DN70303923 Issue:06B


WCDMARANRRMHSUPA HighSpeedCell_FACH

TheattributesforHS-RACHarethesameasusedforRACH.PRACH partitioning,
Persistence scaling factors,AC-to-ASC mapping,Primary CPICH TX power,Constant
value,PRACH power offset,andPRACH transmission parameterIEsofPRACH
preamble control parameters (for Enhanced Uplink)arenotpresent/includedintoRRC:
SIB5/5bismessage.

Poweroffset
ACdeterminesthepoweroffsetbetweenthelasttransmittedpreambleandinitialpower
oftheDPCCHtransmissionforHS-RACH.Poweroffsetisdefinedbythenew
PowerOffsetPreamHSRACHWCELparameteranditisusedassuch.Thevalueis
signaledtowardsUEsbyusingRRC:SIB5/5bismessageaftersuccessfulHS-RACH
setupwithinPower offset Pp-eIEofPRACH preamble control parameters (for Enhanced
uplink).

18.1.14 CommonMACflows
TwoCommonMACflowsareestablishedbetweentheBTSandtheRNC.Onefor
signalingdataandotherforuserplanedata.
ForsignalingdatainUL,twoCommonE-DCHMAC-dflowsaresetup.OneforSRB0
andoneforSRB1,SRB2,SRB3,andSRB4.DataseparationisperformedonLogical
Channellevel(range1...15).
TheCRNCdefinestheLogicalchannelsIDsusedforCCCHandDCCHdata
transmissiononHS-RACHinthefollowingway:

theLogicalChannelid15,forSRB0(thevalueisfixedbythe3GPP)
theLogicalChannelid1,forSRB1
theLogicalChannelid2,forSRB2
theLogicalChannelid3,forSRB3
theLogicalChannelid4,forSRB4

TheCRNCdefinestheLogicalchannelsIDsusedforDTCHdatatransmissiononHS-
RACHfromthevaluesbetween5and8.
ForuserplanedatainUL,fourCommonE-DCHMAC-dflowsaresetup.Thusthesum
ofCommonE-DCHMAC-dflowssetupforHS-RACHissix.

CommonMACflowforCCCHandDCCH
ForCCCHandDCCHdatapurposeRNCsetsuponlytwoULCommonMACflow
betweentheBTSandtheRNC.
CommonMACFlowIDissignaledtotheBTSbyusingNBAP:PHYSICALSHARED
CHANNELRECONFIGURATIONREQUESTmessagewithinUL Common MAC Flow ID
IEofUL Common MAC Flow Specific InformationduringsetupofHS-RACH.Building
ModeIndicatorisnotincludedbecauseusedE-TTI=10msinHS-RACH.Notethatthis
informationisnotbroadcastedtoUEsviaSIB5/5bis.

CommonE-DCHMAC-dflowforCCCHandDCCH
ThemaximumnumberofretransmissionsforMAC-dflowofSRBs(CCCH/DCCH)is
definedbytheexistingEDCHMaxHarqReTxSRBRNCconfigurationparameterwhenthe
E-TTI=10mswithHS-RACHisused.

Issue:06B DN70303923 241


HighSpeedCell_FACH WCDMARANRRMHSUPA

InformationissignaledtotheBTSbyusingNBAP:PHYSICALSHAREDCHANNEL
RECONFIGURATIONREQUESTmessageintheMaximum Number of Retransmission
For E-DCHIEofUL Common MAC Flow Specific InformationandforUEsbyusing
RRC:SIB5/5bismessageintheE-DCH MAC-d flow maximum number of retransmissions
IEofCommon E-DCH MAC-d flows.

MaximumE-DCHHARQPowerOffset
PoweroffsetforMAC-dflowofSRBs(CCCH/DCCH)isdefinedbytheexisting
PowerOffsetSRBOnEDCHRNCconfigurationparameterwhentheE-TTI=10mswith
HS-RACHisused.
PoweroffsetforMAC-dflowofRT/NRTRBs(DTCH)fixedvalue0isusedwhentheE-
TTI=10mswithHS-RACHisused.
InformationissignaledtotheBTSbyusingNBAP:PHYSICALSHAREDCHANNEL
RECONFIGURATIONREQUESTmessageinE-DCH HARQ Power Offset FDDIEofUL
Common MAC Flow Specific InformationandforUEsbyusingRRC:SIB5/5bismessage
inE-DCH MAC-d flow power offsetIEofCommon E-DCH MAC-d flows.

MultiplexinglistfortheE-DCHMAC-dflowofSRBs(CCCH/DCCH)
andofPSRBs(DTCH)
E-DCHMAC-dflowmultiplexinglistofthesignalingradiobearerindicatesifitisthefirst
MAC-dflowforwhichPDUsareplacedintheMAC-ePDU.TheotherMAC-dflowsfrom
whichtheMAC-dPDUsareallowedtobeincludedareinthesameMAC-ePDU.
ThereisnotsetanyrestrictionforCCCH/DCCH/DTCHdatatransmittedoverHS-RACH.
Thusinformationisnotincluded/signaledtoBTSbyusingNBAP:PHYSICALSHARED
CHANNELRECONFIGURATIONREQUESTmessageinE-DCH MAC-d Flow
Multiplexing ListIEofUL Common MAC Flow Specific InformationandforUEsbyusing
RRC:SIB5/5bismessageinE-DCH MAC-d flow multiplexing listIEofCommon E-DCH
MAC-d flows.

MaximumnumberofHARQretransmissions
ThemaximumnumberofretransmissionsforMAC-dflowofRT/NRTRBs(DTCH)is
definedbyexistingEDCHMaxNumberOfHARQReTxRNCconfigurationparameterwhen
theE-TTI=10mswithHS-RACHisused.
InformationissignaledtotheBTSbyusingNBAP:PHYSICALSHAREDCHANNEL
RECONFIGURATIONREQUESTmessageintheMaximum Number of Retransmission
For E-DCHIEofUL Common MAC Flow Specific InformationandforUEsbyusing
RRC:SIB5/5bismessageintheE-DCH MAC-d flow maximum number of retransmissions
IEofCommon E-DCH MAC-d flows.

LogicalchannelIDsandMACPDUsizeusedforDTCHdata
transmission
TheLogical Channel IDIEisusedtoidentifytheE-DCHlogicalchannelinScheduling
InformationthatissentoverUu.LogicalChannelidsfrom5to8areusedforRBs.
MACPDUsizeissameforallRBs.

242 DN70303923 Issue:06B


WCDMARANRRMHSUPA HighSpeedCell_FACH

InformationofLogicalChannelidandMACPDUsizeissignaledtotheBTSbyusing
NBAP:PHYSICALSHAREDCHANNELRECONFIGURATIONREQUESTmessagein
Logical Channel IDandMaximum MAC-c PDU Size ExtendedIEsofUL Common MAC
Flow Specific Information.TheinformationisnotbroadcastedtoUEsviaSIB5/5bis.

18.1.15 RLCconfiguration
ParametersfortheAMRLCentitiesoftheSRBs
ACoftheRNCdeterminesparametersfortheAMRLCentitiesoftheSRBs,whichare
transferringthedataintheHS-RACH/HS-DSCHconfigurationwhentheUEison
CELL_FACHstateinthesamewayasitwasdefinedforREL99RACH/FACH
configurationwithfollowingchanges:

AMRLCRespTimeHSSRBparameterdefinestheL2roundtriptimebetweentheAM
RLCentitiesofUEandSRNC.ValueoftheL2roundtriptimeisdenotedwithTRTT.
AMRLCPeriodMaxHSSRBparameterdefinesthemaximumstatusreportingperiodin
relationtotheL2roundtriptime.Valueoftheparameterisdenotedwithmax.

RetransmissionparametersfortheAMRLCentitiesofthePSRBs
ThisrequirementdefinesthePSRABsoftheUEonCELL_FACHstatewhichare
transferringwiththeAMRLCRBsintheE-DCHconfiguration.
ACdeterminesthefollowingAMRLCretransmissionparametersfortransmitterand
receiver:

Pollinginformationforthetransmitter:Timer_Poll_Prohibit,Timer_Poll,Poll_PDU,
Poll_SDU,Last transmission PDU Poll,Last retransmission PDU Poll,Poll_Window,
Timer_Poll_Periodic.
Statusreporttriggersforthereceiver:Missing PDU detection,Timer_status_prohibit,
Timer_status_periodic.
TransmissionWindowSize.
ReceivingWindowsize.

Thefollowingmanagementparametersareintroducedforthedefinitionofthelengthof
theAMRLCstatusreportingperiod:

HSRACHAMRLCRespHSFACHparameterdefinestheL2roundtriptimemeasured
betweentheAMRLCentitiesofUEandSRNC.Valueoftheparameterisdenoted
withTRTT.
AMRLCHSRACHPSPeriodMaxparameterdefinesthemaximumstatusreporting
periodinrelationtotheL2roundtriptime.Valueoftheparameterisdenotedwith
max.
AMRLCHSRACHPSPeriodMinparameterdefinestheminimumstatusreporting
period.

SenderoftheRLCentityinUEisconfiguredasfollows:

TimersTimer_pollandTimer_poll_periodicaresettothevaluemaxTRTTiftheyare
activatedwiththeTimerpollperiodicandtheTimerpollofthe
AMRLCHSRACHPSTriggersparameter.

Issue:06B DN70303923 243


HighSpeedCell_FACH WCDMARANRRMHSUPA

TimerTimer_poll_prohibitissettothevalueoftheAMRLCHSRACHPSPeriodMin
parameterifitisactivatedwiththeTimer_poll_prohibitofthe
AMRLCHSRACHPSTriggersparameter.
PollingtriggerPoll_PDUissettothevalueoftheAMRLCHSRACHPSPollPDU
parameterifthetriggerisactivatedwiththePoll_PDUofthe
AMRLCHSRACHPSTriggersparameter(unlessithasbeengivenavalueearlier).
AMRLCHSRACHPSPollPDUparameterappliestothebytevalueofthetransmission
windowsothattheabsoluteresultofthePoll_PDUisinbytes.Finalvalueofthe
Poll_PDUsignaledtoUEisexpressedinthenumberofAMDPDUs.Itisproduced
bydividingthebytevalueofthePoll_PDUwiththeSmaxPDU,whichisthepayload
sizeofthemaximumuplinkRLCPDUoftheAMRB:

RLCentityoftheRNCusesthebytevaluedirectly.
PollingtriggerPoll_SDUissettothevalueoftheAMRLCHSRACHPSPollSDU
parameterifthetriggerisactivatedwiththePoll_SDUofthe
AMRLCHSRACHPSTriggersparameter.FinalvalueofthePoll_SDUissetsothat
Poll_SDU*SSDUbecomessmallerthantheuplinktransmissionwindowsize
expressedinbytes.SSDUisthemaximumSDUsizeoftheRAB.
PollingtriggerPoll_WindowissettothevalueoftheAMRLCHSRACHPSPollWin
parameterifthetriggerisactivatedwiththePoll_windowofthe
AMRLCHSRACHPSTriggersparameter.
PollingtriggersLast transmission PDU pollandLast retransmission PDU pollareset
ifthetriggersareactivatedwiththeLasttransmissionPDUpollandtheLast
retransmissionPDUpolloftheAMRLCHSRACHPSTriggersparameter.
SDU discard after MaxDAT number of transmissionsisusedifthemodeisactivated
withtheSDUdiscardafterMaxDATtransmissionsofthe
AMRLCHSRACHPSTriggersparameter.Otherwise,themodeNo_discard after
MaxDAT number of transmissionsisused.SDUdiscardmodeTimer based discard
isnotused.
ValueoftheMaxMRWRLCparameterissettothevalueofthe
AMRLCHSRACHPSMaxMRWparameter.TheRLCparameterissignificantonlyifthe
SDUdiscardafterMaxDAT retransmissionsisapplied.
ValueoftheTimer_MRWRLCtimerissettothevaluemaxTRTTiftheSDUdiscard
afterMaxDAT retransmissionsisapplied.
ValueoftheMaxDATRLCparameterissettothevalueofthe
AMRLCHSRACHPSMaxDATparameter.
ValueoftheMaxRSTRLCparameterissettothevalueofthe
AMRLCHSRACHPSMaxRSTparameter.
ValueoftheTimer_RSTRLCtimerissettothevaluemaxTRTT.

ReceiveroftheRLCentityinRNCisconfiguredasfollows:

TimerTimer_status_periodicissettothevaluemaxTRTTifitisactivatedwiththe
TimerstatusperiodicoftheAMRLCHSRACHPSTriggersparameter.
TimerTimer_status_prohibitissettothevalueoftheAMRLCHSRACHPSPeriodMin
parameterifitisactivatedwiththeTimerstatusprohibitofthe
AMRLCHSRACHPSTriggersparameter.
StatusreporttriggerMissing PDU indicatorissetifthetriggerisactivatedwiththe
AMRLCHSRACHPSTriggersparameter.

244 DN70303923 Issue:06B


WCDMARANRRMHSUPA HighSpeedCell_FACH

ManagementparametervaluesareappliedwhentheAMRLCentityiscreatedorthe
parametersoftheentityaremodified.Modificationoftheparametervaluesisnota
sufficientreasonforthereconfigurationoftheAMRLCentities.ValuesoftheRLC
variablesandtimerssignaledtotheRLCentitiesoftheUEandtheRNCareroundedas
describedinthedefinitionofeachAMRLCHSRACHPSparameterstructure.
RetransmissionparametersoftheAMRLCentityemployedforthereverseRBwhichis
transferringdataintheHS-DSCHconfigurationareintroducedinWCDMA RAN RRM
HSDPA.
Retransmissionparametersmaydifferinthedifferenttransportchannelconfigurations
andthereforemayneedupdateiftheconfigurationsaremodified.

18.1.16 Measurementmanagement
ThechapterdescribesmeasurementsusedinHS-RACHtransportchannel(E-DCHon
CELL_FAChstate).FortransportchannelHS-FACH(HS-DSCHonCELL_FACHstate),
seeWCDMA RAN RRM HSDPA.

TVMsoftheHS-FACHusers
TheRNCconfiguresTVMtotheUEandhandlestheTVMreportreceivedfromtheUEof
theHS-FACHuserinCell_FACHstatewhentheuplinktransportchannelusedisHS-
RACH(E-DCH)inuplinkandHS-FACHindownlink.
TheRNCsendsRRC:MEASUREMENTCONTROLmessagetoUEonCELL_FACH
statewhichusingHS-RACH(E-DCH)inULasinpreviousreleaseswithfollowing
changesoftheTVMconfiguration:

ThethresholdofdatainRLCbuffersoftheallRBsthattriggerstheuplinktraffic
volumemeasurementreportisdefinedbyHSRACHVolThrULparameter(inbytes).
Theperiodoftimebetweenthetimingofeventdetectionandthetimingofsendinga
trafficvolumemeasurementreportisdefinedbyHSRACHTimeToTriggerparameter
(inms).
TheRNCdoesnotsignaltheTx interruption after triggerIEtoUEusingE-DCHin
CELL_FACHstate.
UplinktransportchanneltypeIEissetDCH.

MeasurementreportreceivedfromUEishandledsimilarlyasincaseofRel99common
channels.L3createshigh/lowcapacityrequestbasedontheresultofthemeasurement
report.
TheTrafVolPendingTimeULexistingparameterdefineshowfrequentlyUEmaysend
TVMreporttotheRNC.
TVMsdefinedhereareusedalwayswhenthededicatedE-RNTIandH-RNTIhavebeen
allocatedfortheUEonCELL_FACHorCELL_PCHstate.

ActivityoftheHS-FACHuserinuplink
HS-FACHuseractivedecisioninuplinkisbasedonthethroughputofHS-RACH(E-
DCH).
RLC/MAC-dlayermeasurestheactivityoftheE-DCHNRTMAC-dinCELL_FACHstate
basedonthroughputoftheE-DCH:

Issue:06B DN70303923 245


HighSpeedCell_FACH WCDMARANRRMHSUPA

MAC-dofRNCcalculatestheHS-RACHactivitysothatalltransmittedbytesduring
theslidingmeasurementwindowaremeasured.
HSRACHActivityAveWinmanagementparameterdefinestheslidingmeasurement
windowsizeforNRTMAC-dofE-DCH.Whenthemeasurementwindowsizeisset
tooff,theactivityoftheHS-RACHmeasurementisnotbeperformed.
SlidingmeasurementwindowismovedeveryMAC-dschedulinginterval.
Activityduringtheslidingmeasurementwindow[bps]iscalculatedeveryMAC-d
schedulinginterval.
CollectionofthesamplesisstartedwhenthefirstactivityintheMAC-dflowhasbeen
detected.
Slidingmeasurementwindowhastoincludeatleastonesamplebeforethefirst
activitymeasurementresultiscalculated.

L2informsHS-FACHuseractivitytoL3:

IfuplinkthroughputgoesaboveorequaltoHSRACHActivityThr,
HSRACHActTimeToTriggertimerisstarted.
IfuplinkthroughputgoesbelowHSRACHActivityThr,the
HSRACHActTimeToTriggertimerisstoppedandreseted.
IftheHSRACHActTimeToTriggerexpires,theL2sendshighactiveHS-RACH
indicationtoL3,L2resetstheHSRACHActTimeToTriggertimer,andstarts
HSFACHActPendingTimetimer.IfHSFACHActPendingTimehasbeenalready
started,L2restartstheHSRACHActTimeToTriggertimerifuplinkthroughputisabove
orequaltoHSRACHActivityThr.
HSRACHActivityThrisdefinedbytheHSRACHActivityThrWCELparameter.
HSRACHActTimeToTriggerisdefinedbytheHSRACHActTimeToTriggerWCEL
parameter.
HSFACHActPendingTimeisdefinedbytheTrafVolPendingTimeDLexisting
parameter.

WhenL3receiveshighactiveHS-RACHindicationfromL2,L3considersitasahigh
capacityrequestinULandforwardsittoRRM.TheRRMdeterminesthatpreferred
allocationisHSDPA/HSPA(dependsonthecapabilityoftheUEandwhether
configurationissupportedinacellfortheUEsonCELL_DCHsate).

246 DN70303923 Issue:06B


WCDMARANRRMHSUPA FlexibleRLCinUL

19 FlexibleRLCinUL
ThemainpurposeoftheRAN1910: Flexible RLC in ULfeatureistoachievethehigher
HSUPApeakrates.Theoperatorcanactivateanddeactivatethefeaturewiththe
FlexULRLCEnabledRNFCparameter.

19.1 FlexibleULRLCusage
TheRAN1910: Flexible RLC in ULfeatureisusedinallcellsofE-DCHActiveSetforall
RBsandSRBsoftheUEmappedonE-DCHwhenthefollowingcriteriaaremet:

CellisflexibleULRLCcapable(indicatedfromBTStoRNC).
TheUEisflexibleULRLCcapable(indicatedfromUEtoRNC).
TheFlexibleULRLCisenabledinRNCwithFlexULRLCEnabledparameter.
E-DCHonSRBisbeingselectedastheULtransportchanneltype.
CriteriafortheFlexibleRLCusagefordownlinkinacellarefulfilled(HSDPA).
CellishandledbySRNC,thatmeans,driftingisnotallowed.

TheFlexibleULRLCcriteriaareverifiedincaseofactivesetupdate,RB/SRBaddition,
orremovalfortheUE.ThecriteriaarealsoverifiedforSRB-onlycase.
Ifthecriteriaarenotmet,fixedULRLCwithMAC-es,FPDATAFRAMEtype1,andfixed
ULRLCPDUsizeareused.
NotethatSRBsonHSUPA(E-DCH/DCH)configurationisnotsupportedwithCSVoice
overHSPAandRTPSStreamingservices.IftheusageofFlexibleRLCindownlinkis
changed,thecriteriaforFlexibleULRLCusageareverifiedandtheRBsareupdated
accordingly.ThedeterminationofFlexibleULRLCusageismadeduringthesetupof
NRTPSRB,RTPSRB,SRB,andCSvoiceoverHSPA.
ThechangeoftheFlexULRLCEnabledparametervaluedoesnothaveimpacton
existingRBsandSRBs.ThismeansthattheongoingRBsandSRBsarenot
reconfiguredbecauseofthechangeoftheFlexULRLCEnabledparametervalue(from
enabledtodisabledorwiththeorderreversed).
ThereisanexceptiontothisiscasewhereFlexibleULRLChasbeenusedforongoing
RBsandtheFlexULRLCEnabledhasbeensetto0(disabled).WhenanewRBisset
uptoamulti-RAB,theULRLCoftheongoingRBsisreconfiguredfromflexibletofixed
andtheMACisreconfiguredfromMAC-i/istoMAC-e/es.

19.2 FlexibleULRLCfunctionalities
WhenthecriteriafortheusageofFlexibleULRLCfeaturehavebeenfulfilled,the
followingfunctionalitiesaresupported:

MAC-isentityappliedtoNRTPSRB,RTPSRB,SRB,andCSvoiceoverHSPA
FlexibleULRLCPDUsizewithMAC-isandFPDATAFRAMEtype2
FixedULRLCPDUsizewithMAC-isandFPDATAFRAMEtype2

TherulesforapplyingtheflexibleULRLCfunctionalities:

Issue:06B DN70303923 247


FlexibleRLCinUL WCDMARANRRMHSUPA

TheflexibleULRLCPDUsize,MAC-isentity,andFPDATAFRAMEtype2isapplied
withNRTinteractiveandNRTbackgroundwhenE-DCHhasbeenselectedasthe
uplinktransportchanneltypefortheRB.
TheULRLCAMisusedwithNRTinteractiveRBandNRTbackgroundRBwhen
applyingFlexibleULRLCPDUsize.
ThefixedULRLCPDUsize,MAC-isentity,andFPDATAFRAMEtype2isapplied
withPSstreaming.
TheULRLCAMisusedwithPSstreamingRBwhenapplyingFixedULRLCPDU
sizewithMAC-isandFPDATAFRAMEtype2.
ThefixedULRLCPDUsize,MAC-isentity,andFPDATAFRAMEtype2isapplied
withCSvoiceoverHSPA.
TheCSvoiceoverHSPAwithFixedULRLCPDUsizeandMAC-isissupportedin
CDSP-DHcardinIPA-RNC.
TheULRLCUMisusedwithCSvoiceoverHSPARBwhenapplyingFixedULRLC
PDUsizewithMAC-isentityandFPDATAFRAMEtype2.
ForSRBstheMAC-dPDUsizeisfixedto18bytes(144bits)asdefinedforMAC-es
(fixedULRLC)andforMAC-is(flexibleULRLC).ThefixedULRLCPDUsizefor
SRBsisvalidforboth2msTTIand10msTTI.
TheSRBissupportedwithfixedULRLCPDUsizewithMAC-isentityinCDSP-DH
cardsinIPA-RNC.
ThesamemodeforULRLCPDUsize(fixedorflexible)isusedforallbranchesof
oneRB,thatisinallcellsofActiveSet.
WhenUEhasseveralRBsand/orSRBsactive,eachindividualRB/SRBwithMAC-is
canuseeitherfixedULRLCPDUsizeorflexibleULRLCPDUsize.
AllactiveRBsandSRBsofoneUEmappedonE-DCHusethesameMAC(either
MAC-e/-esorMAC-i/-is).InflexibleULRLCthatisMAC-is.
IftheUEhasoneormoreRBsand/orSRBs(sameMACusedforallRBsandSRBs)
andaneedforMACchangefromMAC-i/istoMAC-e/esorwiththeorderreversedis
detectedbecauseofflexibleULRLCavailability(detectedinActiveSetupdate
and/ormobilitycases),theMACresetsisperformedintheRNC,theBTS,andthe
UE.MAC-isresetmeansalsoMAC-iresetbetweentheUEandtheBTS.
TheCDSPcardselectionismadeinIPA-RNCifallotherFlexibleULRLCusage
criteriaarefulfilled.IfCDSP-DHcardcannotbeusedforallbranchesofPSRB(all
cellsinActiveSet)incaseofNRTinteractive,NRTbackground,orPSstreaming
servicethenFlexibleULRLCcriteriaarenotfulfilledandfixedULRLCwithMAC-es
isusedfortheRB.
ThereisnoHWrestrictiondeterminingtheusageofFlexibleULRLC.TheflexibleUL
RLCisappliedtoRBiftheflexibleULRLCusagecriteriaarefulfilledinallcellsof
ActiveSet.

TheRLCPDUsizeischangedwhenRLCconfigurationchangesfromfixedPDUsizeto
aflexiblePDUsizeorwiththeorderreversed.IfonlytheULRLCPDUsizeischanged,
aonesidedRLCre-establishmentistoperformed.IftheRLCPDUsizesinboth
directions(ULandDL)arechanged,twosidedRLCre-establishmentisperformed.
OnesidedRLCre-establishmentinULdirectionisneededifULRLCconfiguration
changesfrom:

flexibletofixedRLCmodeinULdirection
fixedtoflexiblemode(15bitLengthIndicator)inULdirection
flexibletoflexibleRLCmodewithLengthIndicator(LI)modificationfrom15bitto7bit
andwiththeorderreversedinULdirection

248 DN70303923 Issue:06B


WCDMARANRRMHSUPA FlexibleRLCinUL

Notethatthere-establishmentisnotperformedwhenchangingfromfixedtoflexibleRLC
with7bitLI.

19.3 Mobilityandchanneltypeswitch
WhenanewcellisincludedtoActiveSetoracellisremovedfromActiveSet,the
FlexibleULRLCusagecriteriaareverifiedforallcells.IfFlexibleULRLCusagecriteria
arefulfilledforallcellsofActiveSetandCDSP-DHcardisavailableforeverybranchof
PSRB(NRTinteractive,NRTbackground,PSstreaming),FlexibleULRLCisused.If
criteriaarenotfulfilledinoneormorecells,fixedULRLCisused.Ifneeded,thePSRB
isreconfiguredaccordingly.
TheRBreconfigurationtakesplaceinfollowingphases:

Addingcell:beforeaddingnewcelltotheActiveSet.
Removingcell:AfterremovingacellfromtheActiveSet.

Othermobilityandchanneltypeswitch(CTS)cases:

WhentheRBreconfigurationisperformedbecauseofthechangefrom2msTTIto
10msTTIorwiththeorderreversed,theusageofflexibleULRLCisverifiedfornew
configurationoftheRBandflexibleULRLCisusedaccordingly.
WhenachanneltypeswitchfromDCHtoE-DCHisperformedandE-DCH(s)are
allocatedforMAC-dflow(s),theflexibleRLCuplinkPDUsizeisappliediftheflexible
ULRLCcriteriaarefulfilled.
WhenachanneltypeswitchfromE-DCHtoDCHisperformedandDCH(s)are
allocatedforMAC-dflow(s),thefixedULRLCisapplied.
WhenastatechangefromCELL_PCH/URA_PCH/CELL_FACHtoCELL_DCHwith
HSPAisperformedandE-DCHisallocatedfortheMAC-dflow,theflexibleULRLC
isappliedifthecriteriafortheusageofflexibleULRLCarefulfilled.
WhenastatechangefromCELL_DCHwithHSPAtoCELL_FACHisperformedand
commonchannelisassignedforUE,thefixedULRLCisapplied.
WhenE-DCH(s)areallocatedforMAC-dflow(s)ontargetcell,theflexibleULRLCis
appliedwhenflexibleULRLCusagecriteriaarefulfilled.TheRLCparameters(RxWs
andTxWs)arecalculatedintargetRNC.
IfflexibleULRLCisattemptedtobeusedinacellbutcannotbeusedbecauseof
theBTS,thefixedULRLCisusedandRNCconsidersthecellasnon-capableto
flexibleULRLCforthisattempt.
IfflexibleULRLCisattemptedtobeusedinacellbutcannotbeusedbecauseof
theBTS,thefixedULRLCisusedandRNCconsidersthecellasnon-capableto
flexibleULRLCforthisattempt.Ifneeded,theRNCreconfiguresRBstofixedUL
RLC.
IfarequesttouseflexibleULRLCisreceivedoverIurtoDRNC(RNSAPRadioLink
SetupRequest,RNSAPRadioLinkAdditionRequest,RNSAPRadioLink
ReconfigurationPrepare),theDRNChandlestherequestandsendsa
correspondingfailureindicationtoSRNCwithcauseRequestedConfigurationNot
Supported.NotethatFlexibleULRLCisnotsupportedoverIur.Thisisarelevant
casewhentherequestisreceivedfromSRNCofanothermanufacturer.

Issue:06B DN70303923 249


FlexibleRLCinUL WCDMARANRRMHSUPA

19.4 RadioResourceManagementinFlexibleULRLC
WhenflexibleULRLCPDUsizeisusedforNRTinteractiveRBorNRTbackgroundRB,
theflexibleULRLCrelatedRLCandMACparametersaredeterminedasfollows:

MinimumULRLCPDUsizeisdeterminedaccordingtotheMinULRLCPDUSize
parameteraddedwith8bitsfor7bitLengthIndicatororwith16bitsfor15bitLength
IndicatorwithlimitationthattheminimumULRLCPDUsizecannotbehigherthan
largestULRLCPDUsize.
LargestULRLCPDUsizeisdeterminedaccordingtotheMaxULRLCPDUSize
parameter.
IfthelargestULRLCPDUsize,determinedaccordingtotheMaxULRLCPDUSize
parameter,islowerthanorequalto126octets(1008bits)theLengthIndicatorsize
issetto7-bit.Otherwise,theLengthIndicatorsizeissetto15-bit.The
MaxULRLCPDUSizeparameterdeterminesthesizeofRLCPDU(headersincluded).
For7-bitLengthIndicatortheRLCPDUsizeis128octetswithheaderof2octets
andlengthindicatorwith1octet.Themaximumsizeofdataindicatedwith7bitsis
127.Values124-127forAMDPDUarereserved,sotherealmaximumsizeis123.
ThereforethemaximumsizeofAMDPDUis2+1+123=126octets.
ULMACheadertypeisMAC-i/is.
MaximumMAC-dPDUsize(NBAPIEMaximumMAC-dPDUSizeExtended),
definedforHSUPAwithflexibleULRLC,isdeterminedaccordingtothe
MaxMACdPDUSizeExtparameter.

FixedULRLCPDUsizeisusedwithMAC-isforSRB,theRLCandMACparametersare
determinedasfollows:

ULMACheadertypeisMAC-i/is.
RLCPDUsizeisindicatedwithafixedvalueof18bytes(144bits).
MaximumMAC-dPDUsize(NBAPIEMaximumMAC-dPDUSizeExtended),
definedforHSUPAwithflexibleULRLC,isindicatedwithvalueof18bytes(144
bits).

FixedULRLCPDUisbeusedwithMAC-isforPSstreaming,theRLCandMAC
parametersaredeterminedasfollows:

ULMACheadertypeisMAC-i/is.
RLCPDUsizeisindicatedwithafixedvalueof336bitsforRLCPDU(with320bits
payload).
MaximumMAC-dPDUsize(NBAPIEMaximumMAC-dPDUSizeExtended),
definedforHSUPAwithflexibleULRLC,isindicatedwithfixedvalueof42bytes
(336bits).
7-bitLengthIndicatorsizeisused.

FixedULRLCPDUsizeisusedwithMAC-isforCSvoice,theRLCandMAC
parametersaredeterminedasfollows:

ULMACheadertypeisMAC-i/is.
RLCPDUsizeis(sizesare)indicatedwithalistofsamefixedvaluesthataredefined
forMAC-e/es.
MaximumMAC-dPDUsize(NBAPIEMaximumMAC-dPDUSizeExtended),
definedforHSUPAwithflexibleULRLC,isindicatedwithfixedvalue.

250 DN70303923 Issue:06B


WCDMARANRRMHSUPA FlexibleRLCinUL

7-bitLengthIndicatorsizeisusedasdefinedinUMRLCconfiguration.The
AlternativeE-bitinterpretationisused.

Issue:06B DN70303923 251


ManagementdataforHSUPARRM WCDMARANRRMHSUPA

20 ManagementdataforHSUPARRM

20.1 Alarms
Foralarmdescriptions,seeAlarms and BTS FaultsreferenceintheWCDMARAN
SystemLibrary.
AllRANalarmsarecategorizedsothateachalarmhasanalarmnumberbelongingto
oneofthefollowingcategories:

AlarmstriggeredbytheRNC:
1-999Notices
1000-1999Disturbances
2000-3999FailurePrintouts(*,**,***alarms)

AlarmstriggeredbybasestationandtheRNC:
7000-7999BaseStationAlarms,where
7401-7699BaseStationAlarmstriggeredbybasestations
7700-7799BaseStationAlarmstriggeredbytheRNC

ThefollowingtablelistsallalarmsthatarerelatedtotheperformanceofHSUPA.As
HSUPAcanonlybeappliedincellswhereHSDPAisactiveonthedownlink,HSDPA-
relatedalarmsarealsomentioned(apartfromalarms,indicatingproblemsinthebase
stationitself).

Table 33 AlarmsrelatedtoHSUPAradioresourcemanagement

Alarmnumber Alarmname

Base station related alarms

7650 BASESTATIONFAULTY

7651 BASESTATIONOPERATIONDEGRADED

7652 BASESTATIONNOTIFICATION

HSDPA related alarms

7772 HSDPACONFIGURATIONFAILURE

7776 HSDPADISABLEDINWCEL

HSUPA related alarms

7780 HSUPAFAILUREINWCEL

7782 HSUPACONFIGURATIONFAILED

252 DN70303923 Issue:06B


WCDMARANRRMHSUPA ManagementdataforHSUPARRM

20.2 Counters
ThissectionliststhecountersrelatedtoRRMofHSUPA.FormoreinformationonCell
resource,Servicelevel,Trafficandothermeasurements,seeRNC Counters - RNW part.
Therearenocountersrelatedtothefollowingfeatures:

RAN968:HSUPABTSPacketScheduler

20.2.1 RAN826:BasicHSUPA
Table 34 CellresourcemeasurementsforbasicHSUPA

PIID Name Abbreviation

M1000C268 BTSHSUPANOTHWLIMITED BTS_HSUPA_HW_NOT_LIMITED_DUR


DURATION

M1000C269 BTSHSUPAHWLIMITEDDURATION BTS_HSUPA_HW_LIMITED_DUR

M1000C270 BTSHSUPAHWNOCAPACITY BTS_HSUPA_NO_HW_CAPA_DUR


DURATION

M1000C271 DURATIONOFNOACTIVEHSUPA DUR_HSUPA_NO_USERS


USERS

M1000C272 DURATIONOFACTIVEHSUPAUSERS DUR_HSUPA_USERS_1_OR_2


-1OR2SIMULTANEOUSUSERS

M1000C273 DURATIONOFACTIVEHSUPAUSERS DUR_HSUPA_USERS_3_OR_4


-3OR4SIMULTANEOUSUSERS

M1000C274 DURATIONOFACTIVEHSUPAUSERS DUR_HSUPA_USERS_5_OR_6


-5OR6SIMULTANEOUSUSERS

M1000C275 DURATIONOFACTIVEHSUPAUSERS DUR_HSUPA_USERS_7_OR_8


-7OR8SIMULTANEOUSUSERS

M1000C276 DURATIONOFACTIVEHSUPAUSERS DUR_HSUPA_USERS_9_OR_10


-9OR10SIMULTANEOUSUSERS

M1000C277 DURATIONOFACTIVEHSUPAUSERS DUR_HSUPA_USERS_11_OR_12


-11OR12SIMULTANEOUSUSERS

M1000C278 DURATIONOFACTIVEHSUPAUSERS DUR_HSUPA_USERS_13_OR_14


-13OR14SIMULTANEOUSUSERS

M1000C279 DURATIONOFACTIVEHSUPAUSERS DUR_HSUPA_USERS_15_OR_16


-15OR16SIMULTANEOUSUSERS

M1000C280 DURATIONOFACTIVEHSUPAUSERS DUR_HSUPA_USERS_17_OR_18


-17OR18SIMULTANEOUSUSERS

Issue:06B DN70303923 253


ManagementdataforHSUPARRM WCDMARANRRMHSUPA

Table 34 CellresourcemeasurementsforbasicHSUPA(Cont.)

PIID Name Abbreviation

M1000C281 DURATIONOFACTIVEHSUPAUSERS DUR_HSUPA_USERS_19_OR_20


-19OR20SIMULTANEOUSUSERS

M1000C283 MAXNUMBEROFHSUPAUSERSPER MAX_HSUPA_USERS_IN_CELL


CELL

M1000C286 SUMOFHSUPAUSERSPERCELL SUM_HSUPA_USERS_IN_CELL

M1000C287 HSUPAUSERSPERCELL DENOM_HSUPA_USERS_PER_CELL


DENOMINATOR

M1000C318 DURATIONOFACTIVEHSUPAUSERS DUR_HSUPA_USERS_1


-1SIMULTANEOUSUSER

M1000C319 DURATIONOFACTIVEHSUPAUSERS DUR_HSUPA_USERS_3


-3SIMULTANEOUSUSERS

Table 35 ServicelevelmeasurementsforbasicHSUPA

PIID Name Abbreviation

M1001C610 UESUPPORTFORE-DCHCATEGORY UE_SUPP_EDCH_CATEGORY_1


1

M1001C611 UESUPPORTFORE-DCHCATEGORY UE_SUPP_EDCH_CATEGORY_2


2

M1001C612 UESUPPORTFORE-DCHCATEGORY UE_SUPP_EDCH_CATEGORY_3


3

M1001C613 UESUPPORTFORE-DCHCATEGORY UE_SUPP_EDCH_CATEGORY_4


4

M1001C614 UESUPPORTFORE-DCHCATEGORY UE_SUPP_EDCH_CATEGORY_5


5

M1001C615 UESUPPORTFORE-DCHCATEGORY UE_SUPP_EDCH_CATEGORY_6


6

Table 36 RCPMOLPCmeasurementsforbasicHSUPA

PIID Name Abbreviation

M1016C19 ULE-DCHHARQRETRANSMISSIONS UL_EDCH_HARQ_RETRANS

254 DN70303923 Issue:06B


WCDMARANRRMHSUPA ManagementdataforHSUPARRM

Table 37 PacketcallmeasurementsforbasicHSUPA

PIID Name Abbreviation

M1022C3 HS-DSCH/E-DCHPACKETCALLATT PS_ATT_HSDSCH_EDCH_INT


FORINTERACTIVE

M1022C4 HS-DSCH/E-DCHPACKETCALLATT PS_ATT_HSDSCH_EDCH_BGR


FORBACKGROUND

M1022C21 HS-DSCH/E-DCHALLOAFTERHS- HS_E_REQ_HS_E_ALLO_INT


DSCH/E-DCHREQFORINTERACTIVE

M1022C22 HS-DSCH/E-DCHALLOAFTERHS- HS_E_REQ_HS_E_ALLO_BGR


DSCH/E-DCHREQFOR
BACKGROUND

M1022C23 HS-DSCH/DCHALLOAFTERHS- HS_E_REQ_HS_D_ALLO_INT


DSCH/E-DCHREQFORINTERACTIVE

M1022C24 HS-DSCH/DCHALLOAFTERHS- HS_E_REQ_HS_D_ALLO_BGR


DSCH/E-DCHREQFOR
BACKGROUND

M1022C27 DCH/DCHALLOAFTERHS-DSCH/E- HS_E_REQ_D_D_ALLO_INT


DCHREQFORINTERACTIVE

M1022C28 DCH/DCHALLOAFTERHS-DSCH/E- HS_E_REQ_D_D_ALLO_BGR


DCHREQFORBACKGROUND

M1022C33 SWIHS-DSCH/E-DCHTOHS- PS_SWI_HS_E_TO_HS_D_INT


DSCH/DCHFORINTERACTIVE

M1022C34 SWIHS-DSCH/E-DCHTOHS- PS_SWI_HS_E_TO_HS_D_BGR


DSCH/DCHFORBACKGROUND

M1022C35 SWIHS-DSCH/E-DCHTODCH/DCH PS_SWI_HS_E_TO_D_D_INT


FORINTERACTIVE

M1022C36 SWIHS-DSCH/E-DCHTODCH/DCH PS_SWI_HS_E_TO_D_D_BGR


FORBACKGROUND

M1022C39 SWIHS-DSCH/DCHTOHS-DSCH/E- PS_SWI_HS_D_TO_HS_E_INT


DCHFORINTERACTIVE

M1022C40 SWIHS-DCSH/DCHTOHS-DSCH/E- PS_SWI_HS_D_TO_HS_E_BGR


DCHFORBACKGROUND

M1022C43 SWIDCH/DCHTOHS-DSCH/E-DCH PS_SWI_D_D_TO_HS_E_INT


FORINTERACTIVE

M1022C44 SWIDCH/DCHTOHS-DSCH/E-DCH PS_SWI_D_D_TO_HS_E_BGR


FORBACKGROUND

Issue:06B DN70303923 255


ManagementdataforHSUPARRM WCDMARANRRMHSUPA

Table 37 PacketcallmeasurementsforbasicHSUPA(Cont.)

PIID Name Abbreviation

M1022C45 HS-DSCH/E-DCHPACKETCALL PS_REL_NORM_HS_E_INT


NORMRELFORINTERACTIVE

M1022C46 HS-DSCH/E-DCHPACKETCALL PS_REL_NORM_HS_E_BGR


NORMRELFORBACKGROUND

M1022C51 HS-DSCH/E-DCHPACKETCALLREL PS_REL_PRE_EMP_HS_E_INT


DUETOPRE-EMPFORINTERACTIVE

M1022C52 HS-DSCH/E-DCHPACKETCALLREL PS_REL_PRE_EMP_HS_E_BGR


DUETOPRE-EMPFOR
BACKGROUND

M1022C57 HS-DSCH/E-DCHPACKETCALLREL PS_REL_RL_FAIL_HS_E_INT


DUETORLFAILFORINTERACTIVE

M1022C58 HS-DSCH/E-DCHPACKETCALLREL PS_REL_RL_FAIL_HS_E_BGR


DUETORLFAILFORBACKGROUND

M1022C63 HS-DSCH/E-DCHPACKETCALLREL PS_REL_OTH_FAIL_HS_E_INT


DUETOOTHERFAILFOR
INTERACTIVE

M1022C64 HS-DSCH/E-DCHPACKETCALLREL PS_REL_OTH_FAIL_HS_E_BGR


DUETOOTHERFAILFOR
BACKGROUND

Table 38 CellthroughputmeasurementsforbasicHSUPA

PIID Name Abbreviation

M1023C10 TRANSFERREDDATAFORNRTE- NRT_EDCH_UL_DATA_VOL


DCH

20.2.2 RAN973:HSUPAbasicRRM
Table 39 CellresourcemeasurementsforHSUPAbasicRRM

PIID Name Abbreviation

M1000C236 MINHSPADLPOWER MIN_HSPA_DL_POWER

M1000C237 MAXHSPADLPOWER MAX_HSPA_DL_POWER

M1000C238 AVEHSPADLPOWER AVE_HSPA_DL_POWER

256 DN70303923 Issue:06B


WCDMARANRRMHSUPA ManagementdataforHSUPARRM

Table 39 CellresourcemeasurementsforHSUPAbasicRRM(Cont.)

PIID Name Abbreviation

M1000C239 HSPADLPOWERSAMPLES HSPA_DL_POWER_SAMPLES

Table 40 TrafficmeasurementsforHSUPAbasicRRM

PIID Name Abbreviation

M1002C515 ULDCHSELECTEDFOR UL_DCH_SEL_MAX_HSUPA_USR_INT


INTERACTIVEDUETOMAXHSUPA
USERS

M1002C516 ULDCHSELECTEDFOR UL_DCH_SEL_MAX_HSUPA_USR_BG


BACKGROUNDDUETOMAXHSUPA R
USERS

M1002C517 ULDCHSELECTEDFOR UL_DCH_SEL_BTS_HW_INT


INTERACTIVEDUETOBTSHWLIMIT

M1002C518 ULDCHSELECTEDFOR UL_DCH_SEL_BTS_HW_BGR


BACKGROUNDDUETOBTSHW
LIMIT

M1002C519 E-DCHALLOCANCELFOR EDCH_ALLO_CANC_NA_AS_INT


INTERACTIVEDUETONON
ACCEPTABLEAS

M1002C520 E-DCHALLOCANCELFOR EDCH_ALLO_CANC_NA_AS_BGR


BACKGROUNDDUETONON
ACCEPTABLEAS

M1002C523 E-DCHSETUPFAILUREDUETOUE SETUP_FAIL_EDCH_UE_INT


FORINTERACTIVE

M1002C524 E-DCHSETUPFAILUREDUETOUE SETUP_FAIL_EDCH_UE_BGR


FORBACKGROUND

M1002C525 E-DCHSETUPFAILUREDUETOBTS SETUP_FAIL_EDCH_BTS_INT


FORINTERACTIVE

M1002C526 E-DCHSETUPFAILUREDUETOBTS SETUP_FAIL_EDCH_BTS_BGR


FORBACKGROUND

M1002C527 E-DCHSETUPFAILUREDUETO SETUP_FAIL_EDCH_TRANS_INT


TRANSPORTFORINTERACTIVE

M1002C528 E-DCHSETUPFAILUREDUETO SETUP_FAIL_EDCH_TRANS_BGR


TRANSPORTFORBACKGROUND

Issue:06B DN70303923 257


ManagementdataforHSUPARRM WCDMARANRRMHSUPA

Table 40 TrafficmeasurementsforHSUPAbasicRRM(Cont.)

PIID Name Abbreviation

M1002C529 E-DCHSETUPFAILUREDUETO SETUP_FAIL_EDCH_OTHER_INT


OTHERREASONSFORINTERACTIVE

M1002C530 E-DCHSETUPFAILUREDUETO SETUP_FAIL_EDCH_OTHER_BGR


OTHERREASONSFOR
BACKGROUND

M1002C531 E-DCHALLOCATIONSFOR ALLO_SUCCESS_EDCH_INT


INTERACTIVE

M1002C532 E-DCHALLOCATIONSFOR ALLO_SUCCESS_EDCH_BGR


BACKGROUND

M1002C533 E-DCHALLOCATIONDURATIONFOR ALLO_DUR_EDCH_INT


INTERACTIVE

M1002C534 E-DCHALLOCATIONDURATIONFOR ALLO_DUR_EDCH_BGR


BACKGROUND

M1002C535 E-DCHNORMALRELEASEFOR REL_EDCH_NORM_INT


INTERACTIVE

M1002C536 E-DCHNORMALRELEASEFOR REL_EDCH_NORM_BGR


BACKGROUND

M1002C537 E-DCHRELEASEDUEHS-DSCH REL_EDCH_HSDSCH_SCC_INT


SERVINGCELLCHANGEFOR
INTERACTIVE

M1002C538 E-DCHRELEASEDUEHS-DSCH REL_EDCH_HSDSCH_SCC_BGR


SERVINGCELLCHANGEFOR
BACKGROUND

M1002C539 E-DCHRELEASEDUETORLFAILURE REL_EDCH_RL_FAIL_INT


FORINTERACTIVE

M1002C540 E-DCHRELEASEDUETORLFAILURE REL_EDCH_RL_FAIL_BGR


FORBACKGROUND

M1002C541 E-DCHRELEASEDUETOOTHER REL_EDCH_OTHER_FAIL_INT


FAILUREFORINTERACTIVE

M1002C542 E-DCHRELEASEDUETOOTHER REL_EDCH_OTHER_FAIL_BGR


FAILUREFORBACKGROUND

M1002C549 E-DCHALLOFORINTERRNCHHO ALLO_ED_INTER_RNC_HHO_INT


INTERACTIVE

M1002C550 E-DCHALLOFORINTERRNCHHO ALLO_ED_INTER_RNC_HHO_BGR


BACKGROUND

258 DN70303923 Issue:06B


WCDMARANRRMHSUPA ManagementdataforHSUPARRM

Table 40 TrafficmeasurementsforHSUPAbasicRRM(Cont.)

PIID Name Abbreviation

M1002C551 E-DCHSETUPFAILFORINTERRNC STP_F_ED_INTER_RNC_HHO_INT


HHOINTERACTIVE

M1002C552 E-DCHSETUPFAILFORINTERRNC STP_F_ED_INTER_RNC_HHO_BGR


HHOBACKGROUND

M1002C603 E-DCHSETUPFAILUREDUETOUE SETUP_FAIL_EDCH_UE_STR


FORSTREAMING

M1002C604 E-DCHSETUPFAILUREDUETOBTS SETUP_FAIL_EDCH_BTS_STR


FORSTREAMING

M1002C605 E-DCHSETUPFAILUREDUETO SETUP_FAIL_EDCH_TRANS_STR


TRANSPORTFORSTREAMING

M1002C606 E-DCHSETUPFAILUREDUETO SETUP_FAIL_EDCH_OTHER_STR


OTHERREASONSFORSTREAMING

M1002C607 E-DCHALLOCATIONSFOR ALLO_SUCCESS_EDCH_STR


STREAMING

M1002C608 E-DCHALLOCATIONDURATIONFOR ALLO_DUR_EDCH_STR


STREAMING

M1002C609 E-DCHNORMALRELEASEFOR REL_EDCH_NORM_STR


STREAMING

M1002C610 E-DCHRELEASEDUEHS-DSCH REL_EDCH_HSDSCH_SCC_STR


SERVINGCELLCHANGEFOR
STREAMING

M1002C611 E-DCHRELEASEDUETORLFAILURE REL_EDCH_RL_FAIL_STR


FORSTREAMING

M1002C612 E-DCHRELEASEDUETOOTHER REL_EDCH_OTHER_FAIL_STR


FAILUREFORSTREAMING

M1002C615 E-DCHALLOFORINTERRNCHHO ALLO_ED_INTER_RNC_HHO_STR


STREAMING

M1002C616 E-DCHSETUPFAILFORINTERRNC STP_F_ED_INTER_RNC_HHO_STR


HHOSTREAMING

Table 41 RRCsignallingmeasurementsforHSUPAbasicRRM

PIID Name Abbreviation

M1006C127 CELLFACHSTATETOHS-DSCH CELL_FACH_STATE_TO_HS_DSCH

Issue:06B DN70303923 259


ManagementdataforHSUPARRM WCDMARANRRMHSUPA

Table 42 RCPMOLPCmeasurementsforHSUPAbasicRRM

PIID Name Abbreviation

M1016C19 ULE-DCHHARQRETRANSMISSIONS UL_EDCH_HARQ_RETRANS

20.2.3 RAN970:HSUPAHandovers
Table 43 HSUPAhandovercounters

PIID Name Abbreviation

M1007C66 SOFTERHANDOVERDURATIONON EDCH_SOFTER_HO_DURA


THESRNCSIDEFORHSUPA
MOBILITY

M1007C67 CELLADDITIONATTEMPTREQBYUE CELL_ADD_ATT_UE_REQ_EDCH_AS


TOE-DCHAS

M1007C68 CELLADDITIONSUCCESSTOE-DCH CELL_ADD_SUCC_EDCH_AS


ACTIVESET

M1007C69 CELLNOTADDEDTOE-DCHACTIVE CELL_ADDED_ONLY_TO_DCH_AS


SETBUTADDEDTODCHAS

M1007C70 CELLADDITIONATTEMPTRETRYTO CELL_ADD_ATT_RETRY_EDCH_AS


E-DCHAS

M1008C239 E-DCHSERVINGCELLCHANGES EDCH_SCC_STARTED


STARTED

M1008C240 E-DCHINTRABTSSERVINGCELL EDCH_SCC_INTRA_BTS_SUCCESS


CHANGESSUCCESSFUL

M1008C241 E-DCHINTERBTSSERVINGCELL EDCH_SCC_INTER_BTS_SUCCESS


CHANGESSUCCESSFUL

M1008C242 E-DCHDOWNGRADEDTODCHIN EDCH_DOWNG_DCH_IN_SCC


SCC

20.2.4 RAN974:HSUPAwithsimultaneousAMRvoicecall
Table 44 HSUPAwithsimultaneousAMRvoicecallcounters

PIID Name Abbreviation

M1002C543 AMR+E-DCHALLOCATIONS AMR_EDCH_ALLO

M1002C544 AMR+E-DCHNORMALRELEASE AMR_EDCH_NORMAL_REL

260 DN70303923 Issue:06B


WCDMARANRRMHSUPA ManagementdataforHSUPARRM

20.2.5 RAN979:HSUPA2.0Mbps
Table 45 HSUPA2.0Mbpscounters

PIID Name Abbreviation

M1017C53 USERULTHROUGHPUT USER_UL_THRP_DIST_CLASS_1


DISTRIBUTION-CLASS1

M1017C54 USERULTHROUGHPUT USER_UL_THRP_DIST_CLASS_2


DISTRIBUTION-CLASS2

M1017C55 USERULTHROUGHPUT USER_UL_THRP_DIST_CLASS_3


DISTRIBUTION-CLASS3

M1017C56 USERULTHROUGHPUT USER_UL_THRP_DIST_CLASS_4


DISTRIBUTION-CLASS4

M1017C57 USERULTHROUGHPUT USER_UL_THRP_DIST_CLASS_5


DISTRIBUTION-CLASS5

20.2.6 RAN1465:HSUPA60UsersperBTS
Table 46 HSUPA60UsersperBTS

PIID Name Abbreviation

M1000C318 DURATIONOFACTIVEHSUPAUSERS DUR_HSUPA_USERS_1


-1SIMULTANEOUSUSER

M1000C319 DURATIONOFACTIVEHSUPAUSERS DUR_HSUPA_USERS_3


-3SIMULTANEOUSUSERS

20.2.7 RAN1262-QoSawareHSPAscheduling
Table 47 CountersforQoSawareHSPAscheduling

PIID Name Abbreviation

M1000C306 SUMSTREAMINGE-DCHMAC-DIN SUM_EDCH_MACD_STREA


CELL

M1000C307 STREAMINGE-DCHMAC-D DENOM_EDCH_MACD_STREA


DENOMINATOR

M1000C308 SUMINTERACTIVEE-DCHMAC-DIN SUM_EDCH_MACD_INTERA


CELL

Issue:06B DN70303923 261


ManagementdataforHSUPARRM WCDMARANRRMHSUPA

Table 47 CountersforQoSawareHSPAscheduling(Cont.)

PIID Name Abbreviation

M1000C309 INTERACTIVEE-DCHMAC-D DENOM_EDCH_MACD_INTERA


DENOMINATOR

M1000C310 SUMBACKGROUNDE-DCHMAC-DIN SUM_EDCH_MACD_BGR


CELL

M1000C311 BACKGROUNDE-DCHMAC-D DENOM_EDCH_MACD_BGR


DENOMINATOR

M1002C599 ULDCHSELECTEDFORSTREAMING UL_DCH_SEL_MAX_HSUPA_USR_ST


DUETOMAXHSUPAUSERS R

M1002C600 ULDCHSELECTEDFORSTREAMING UL_DCH_SEL_BTS_HW_STR


DUETOBTSHWLIMIT

M1002C601 E-DCHALLOCANCELFOR EDCH_ALLO_CANC_NA_AS_STR


STREAMINGDUETONON
ACCEPTABLEAS

M1002C602 DLDCHSELECTEDFORSTREAMING DL_DCH_SEL_HSDPA_POWER_STR


DUETOHSDPAPOWER

M1002C603 E-DCHSETUPFAILUREDUETOUE SETUP_FAIL_EDCH_UE_STR


FORSTREAMING

M1002C604 E-DCHSETUPFAILUREDUETOBTS SETUP_FAIL_EDCH_BTS_STR


FORSTREAMING

M1002C605 E-DCHSETUPFAILUREDUETO SETUP_FAIL_EDCH_TRANS_STR


TRANSPORTFORSTREAMING

M1002C606 E-DCHSETUPFAILUREDUETO SETUP_FAIL_EDCH_OTHER_STR


OTHERREASONSFORSTREAMING

M1002C607 E-DCHALLOCATIONSFOR ALLO_SUCCESS_EDCH_STR


STREAMING

M1002C608 E-DCHALLOCATIONDURATIONFOR ALLO_DUR_EDCH_STR


STREAMING

M1002C609 E-DCHNORMALRELEASEFOR REL_EDCH_NORM_STR


STREAMING

M1002C610 E-DCHRELEASEDUEHS-DSCH REL_EDCH_HSDSCH_SCC_STR


SERVINGCELLCHANGEFOR
STREAMING

M1002C611 E-DCHRELEASEDUETORLFAILURE REL_EDCH_RL_FAIL_STR


FORSTREAMING

262 DN70303923 Issue:06B


WCDMARANRRMHSUPA ManagementdataforHSUPARRM

Table 47 CountersforQoSawareHSPAscheduling(Cont.)

PIID Name Abbreviation

M1002C612 E-DCHRELEASEDUETOOTHER REL_EDCH_OTHER_FAIL_STR


FAILUREFORSTREAMING

M1002C615 E-DCHALLOFORINTERRNCHHO ALLO_ED_INTER_RNC_HHO_STR


STREAMING

M1002C616 E-DCHSETUPFAILFORINTERRNC STP_F_ED_INTER_RNC_HHO_STR


HHOSTREAMING

M1022C169 MAXIMUMDURATIONOFSTREAMING MAX_DUR_EDCH_RB_STREA


E-DCHRADIOBEARER

M1022C170 MINIMUMDURATIONOFSTREAMING MIN_DUR_EDCH_RB_STREA


E-DCHRADIOBEARER

M1022C171 SUMOFSTREAMINGE-DCHRADIO SUM_DUR_EDCH_RB_STREA


BEARERDURATIONS

M1022C172 STREAMINGE-DCHRBDURATION DENOM_DUR_EDCH_RB_STREA


DENOMINATOR

M1022C173 MAXIMUMDURATIONOF MAX_DUR_EDCH_RB_INTERA


INTERACTIVEE-DCHRADIOBEARER

M1022C174 MINIMUMDURATIONOF MIN_DUR_EDCH_RB_INTERA


INTERACTIVEE-DCHRADIOBEARER

M1022C175 SUMOFINTERACTIVEE-DCHRADIO SUM_DUR_EDCH_RB_INTERA


BEARERDURATIONS

M1022C176 INTERACTIVEE-DCHRBDURATION DENOM_DUR_EDCH_RB_INTERA


DENOMINATOR

M1022C177 MAXIMUMDURATIONOF MAX_DUR_EDCH_RB_BGR


BACKGROUNDE-DCHRADIO
BEARER

M1022C178 MINIMUMDURATIONOF MIN_DUR_EDCH_RB_BGR


BACKGROUNDE-DCHRADIO
BEARER

M1022C179 SUMOFBACKGROUNDE-DCH SUM_DUR_EDCH_RB_BGR


RADIOBEARERDURATIONS

M1022C180 BACKGROUNDE-DCHRBDURATION DENOM_DUR_EDCH_RB_BGR


DENOMINATOR

Issue:06B DN70303923 263


ManagementdataforHSUPARRM WCDMARANRRMHSUPA

Table 48 CountersforHSUPAPre-emtionLight

PIID Name Abbreviation

M1022C51 HS-DSCH/E-DCHPACKETCALLREL PS_REL_PRE_EMP_HS_E_INT


DUETOPRE-EMPFORINTERACTIVE

M1022C52 HS-DSCH/E-DCHPACKETCALLREL PS_REL_PRE_EMP_HS_E_BGR


DUETOPRE-EMPFOR
BACKGROUND

M1022C205 HS-DSCH/E-DCHPACKETCALLREL PS_REL_PRE_EMP_HS_E_STRE


DUETOPRE-EMPFORSTREAMING

Table 49 CountersforHSUPA2msTTI

PIID Name Abbreviation

M5000C299 UNHAPPYFRACTIONALLOADVALUE UNHAPPY_FRACT_LOAD_DISTR_C_0


DISTRIBUTION-CLASS00 0

M5000C300 UNHAPPYFRACTIONALLOADVALUE UNHAPPY_FRACT_LOAD_DISTR_C_0


DISTRIBUTION-CLASS01 1

M5000C301 UNHAPPYFRACTIONALLOADVALUE UNHAPPY_FRACT_LOAD_DISTR_C_0


DISTRIBUTION-CLASS02 2

M5000C302 UNHAPPYFRACTIONALLOADVALUE UNHAPPY_FRACT_LOAD_DISTR_C_0


DISTRIBUTION-CLASS03 3

M5000C303 UNHAPPYFRACTIONALLOADVALUE UNHAPPY_FRACT_LOAD_DISTR_C_0


DISTRIBUTION-CLASS04 4

M5000C304 UNHAPPYFRACTIONALLOADVALUE UNHAPPY_FRACT_LOAD_DISTR_C_0


DISTRIBUTION-CLASS05 5

M5000C305 UNHAPPYFRACTIONALLOADVALUE UNHAPPY_FRACT_LOAD_DISTR_C_0


DISTRIBUTION-CLASS06 6

M5000C306 UNHAPPYFRACTIONALLOADVALUE UNHAPPY_FRACT_LOAD_DISTR_C_0


DISTRIBUTION-CLASS07 7

M5000C307 UNHAPPYFRACTIONALLOADVALUE UNHAPPY_FRACT_LOAD_DISTR_C_0


DISTRIBUTION-CLASS08 8

M5000C308 UNHAPPYFRACTIONALLOADVALUE UNHAPPY_FRACT_LOAD_DISTR_C_0


DISTRIBUTION-CLASS09 9

M5000C309 UNHAPPYFRACTIONALLOADVALUE UNHAPPY_FRACT_LOAD_DISTR_C_1


DISTRIBUTION-CLASS10 0

264 DN70303923 Issue:06B


WCDMARANRRMHSUPA ManagementdataforHSUPARRM

Table 49 CountersforHSUPA2msTTI(Cont.)

PIID Name Abbreviation

M5000C310 UNHAPPYFRACTIONALLOADVALUE UNHAPPY_FRACT_LOAD_DISTR_C_1


DISTRIBUTION-CLASS11 1

M5000C311 UNHAPPYFRACTIONALLOADVALUE UNHAPPY_FRACT_LOAD_DISTR_C_1


DISTRIBUTION-CLASS12 2

M5000C312 UNHAPPYFRACTIONALLOADVALUE UNHAPPY_FRACT_LOAD_DISTR_C_1


DISTRIBUTION-CLASS13 3

M5000C313 UNHAPPYFRACTIONALLOADVALUE UNHAPPY_FRACT_LOAD_DISTR_C_1


DISTRIBUTION-CLASS14 4

M5000C314 UNHAPPYFRACTIONALLOADVALUE UNHAPPY_FRACT_LOAD_DISTR_C_1


DISTRIBUTION-CLASS15 5

M5000C315 UNHAPPYFRACTIONALLOADVALUE UNHAPPY_FRACT_LOAD_DISTR_C_1


DISTRIBUTION-CLASS16 6

M5000C316 UNHAPPYFRACTIONALLOADVALUE UNHAPPY_FRACT_LOAD_DISTR_C_1


DISTRIBUTION-CLASS17 7

M5000C317 UNHAPPYFRACTIONALLOADVALUE UNHAPPY_FRACT_LOAD_DISTR_C_1


DISTRIBUTION-CLASS18 8

M5000C318 UNHAPPYFRACTIONALLOADVALUE UNHAPPY_FRACT_LOAD_DISTR_C_1


DISTRIBUTION-CLASS19 9

M5000C319 UNHAPPYFRACTIONALLOADVALUE UNHAPPY_FRACT_LOAD_DISTR_C_2


DISTRIBUTION-CLASS20 0

M5000C320 HSUPAMACEPDUSWITH2MSTTI MACE_PDUS_2MS_TTI

M5000C321 HSUPAMACEPDUSWITH10MSTTI MACE_PDUS_10MS_TTI

M5000C322 HSUPAMACEPDUDATAWITH2MS MACE_PDU_DATA_2MS_TTI


TTI

M5000C323 HSUPAMACEPDUDATAWITH10MS MACE_PDU_DATA_10MS_TTI


TTI

M5000C324 SUMOFHSUPAUSERSWITH2MSTTI SUM_HSUPA_USERS_2MS_TTI

M5000C325 SUMOFHSUPAUSERSWITH10MS SUM_HSUPA_USERS_10MS_TTI


TTI

M5000C326 HSUPAUSERSDENOMINATOR DENOM_HSUPA_USERS

M5002C38 UEHSUPATHROUGHPUTCLASS00 UE_HSUPA_TP00

Issue:06B DN70303923 265


ManagementdataforHSUPARRM WCDMARANRRMHSUPA

Table 49 CountersforHSUPA2msTTI(Cont.)

PIID Name Abbreviation

M5002C39 UEHSUPATHROUGHPUTCLASS01 UE_HSUPA_TP01

M5002C40 UEHSUPATHROUGHPUTCLASS02 UE_HSUPA_TP02

M5002C41 UEHSUPATHROUGHPUTCLASS03 UE_HSUPA_TP03

M5002C42 UEHSUPATHROUGHPUTCLASS04 UE_HSUPA_TP04

M5002C43 UEHSUPATHROUGHPUTCLASS05 UE_HSUPA_TP05

M5002C44 UEHSUPATHROUGHPUTCLASS06 UE_HSUPA_TP06

M5002C45 UEHSUPATHROUGHPUTCLASS07 UE_HSUPA_TP07

M5002C46 UEHSUPATHROUGHPUTCLASS08 UE_HSUPA_TP08

M5002C47 UEHSUPATHROUGHPUTCLASS09 UE_HSUPA_TP09

M5002C48 UEHSUPATHROUGHPUTCLASS10 UE_HSUPA_TP10

M5002C49 UEHSUPATHROUGHPUTCLASS11 UE_HSUPA_TP11

Table 50 CountersforContinuousPacketConnectivity

PIID Name Abbreviation

M1001C677 UESUPPORTFORCONTINUOUS UE_SUPP_CPC


PACKETCONNECTIVITY

M1001C668 HS-DSCHMAC-DFLOWDURATIONIN ALLO_DUR_HS_DSCH_INACTIV_BGR


INACTIVESTATEFORBACKGROUND

M1001C669 HS-DSCHMAC-DFLOWDURATIONIN ALLO_DUR_HS_DSCH_INACTIV_INT


INACTIVESTATEFORINTERACTIVE

M1001C670 E-DCHALLOCATIONDURATIONIN ALLO_DUR_EDCH_INACTIV_BGR


INACTIVESTATEFORBACKGROUND

M1001C671 E-DCHALLOCATIONDURATIONIN ALLO_DUR_EDCH_INACTIV_INT


INACTIVESTATEFORINTERACTIVE

M1006C200 INACTIVEHSPAUPRELEASEDUETO INACT_HSPA_REL_DUE_PREV_OVER


PREVENTIVEOVERLOAD

M1006C201 CAPACITYREQFORRELEASEDHSPA CAP_REQ_REL_HSPA_DUE_PRE_OVE


DUETOPREVENTIVEOVERLOAD

266 DN70303923 Issue:06B


WCDMARANRRMHSUPA ManagementdataforHSUPARRM

Table 50 CountersforContinuousPacketConnectivity(Cont.)

PIID Name Abbreviation

M5000C285 SUMOFACTIVECPCUSERS SUM_ACTIVE_CPC_USERS

M5000C286 MAXIMUMNUMBEROFACTIVECPC MAX_ACTIVE_CPC_USERS


USERS

M5000C288 SUMOFCPCCONFIGUREDUSERS SUM_CPC_CONFIGURED_USERS

M5000C289 MAXIMUMNUMBERCPC MAX_CPC_CONFIGURED_USERS


CONFIGUREDUSERS

M50