You are on page 1of 195

Release Notes 10.1.

600
Epicor ERP 10.1.500 to 10.1.600
Disclaimer
This document is for informational purposes only and is subject to change without notice. This document and its
contents, including the viewpoints, dates and functional content expressed herein are believed to be accurate as of its
date of publication. However, Epicor Software Corporation makes no guarantee, representations or warranties with
regard to the enclosed information and specifically disclaims any applicable implied warranties, such as fitness for a
particular purpose, merchantability, satisfactory quality or reasonable skill and care. As each user of Epicor software is
likely to be unique in their requirements in the use of such software and their business processes, users of this document
are always advised to discuss the content of this document with their Epicor account manager. All information contained
herein is subject to change without notice and changes to this document since printing and other important information
about the software product are made or published in release notes, and you are urged to obtain the current release
notes for the software product. We welcome user comments and reserve the right to revise this publication and/or
make improvements or changes to the products or programs described in this publication at any time, without notice.
The usage of any Epicor software shall be pursuant to an Epicor end user license agreement and the performance of
any consulting services by Epicor personnel shall be pursuant to Epicor's standard services terms and conditions. Usage
of the solution(s) described in this document with other Epicor software or third party products may require the purchase
of licenses for such other products. Where any software is expressed to be compliant with local laws or requirements
in this document, such compliance is not a warranty and is based solely on Epicor's current understanding of such laws
and requirements. All laws and requirements are subject to varying interpretations as well as to change and accordingly
Epicor cannot guarantee that the software will be compliant and up to date with such changes. All statements of
platform and product compatibility in this document shall be considered individually in relation to the products referred
to in the relevant statement, i.e., where any Epicor software is stated to be compatible with one product and also
stated to be compatible with another product, it should not be interpreted that such Epicor software is compatible
with both of the products running at the same time on the same platform or environment. Additionally platform or
product compatibility may require the application of Epicor or third-party updates, patches and/or service packs and
Epicor has no responsibility for compatibility issues which may be caused by updates, patches and/or service packs
released by third parties after the date of publication of this document. Epicor is a registered trademark and/or
trademark of Epicor Software Corporation in the United States, certain other countries and/or the EU. All other
trademarks mentioned are the property of their respective owners. Copyright Epicor Software Corporation 2017.
All rights reserved. No part of this publication may be reproduced in any form without the prior written consent of
Epicor Software Corporation.

Epicor ERP 10.1.500 to 10.1.600


Revision: May 15, 2017 11:45 a.m.
Total pages: 25
sys.ditaval
Release Notes 10.1.600 Contents

Contents
Posting Rule Changes.............................................................................................................5
Standard and Extended - 10.1.500 to 10.1.600...............................................................................................5
AP Invoice.................................................................................................................................................5
Apply Credit Memo..................................................................................................................................5
AR Payment..............................................................................................................................................5
Bank Adjustment......................................................................................................................................6
Bank Funds Transfer.................................................................................................................................6
Cancel AR Invoice.....................................................................................................................................6
COS and WIP............................................................................................................................................6
CSF - 10.1.500 to 10.1.600.............................................................................................................................9
CSF Columbia...........................................................................................................................................9
AP Adjustment..................................................................................................................................9
AP Apply Debit Memo.......................................................................................................................9
AP Invoice.........................................................................................................................................9
AP Logged Invoice...........................................................................................................................10
AP Payment.....................................................................................................................................10
AP Void Payment.............................................................................................................................10
Apply Credit Memo.........................................................................................................................10
AR Invoice.......................................................................................................................................11
AR Payment.....................................................................................................................................11
AR PI Write-off................................................................................................................................12
Bank Adjustment.............................................................................................................................12
Bank Funds Transfer........................................................................................................................12
Cancel AR Invoice............................................................................................................................13
COS and WIP...................................................................................................................................13
CSF Germany..........................................................................................................................................15
AR Payment.....................................................................................................................................15
Reverse Cash Receipt.......................................................................................................................15
CSF Vietnam...........................................................................................................................................16
AP Adjustment................................................................................................................................16
AP Apply Debit Memo.....................................................................................................................16
AP Invoice.......................................................................................................................................17
AP Payment.....................................................................................................................................17
AP Void Payment.............................................................................................................................17
Apply Credit Memo.........................................................................................................................18
AR Invoice.......................................................................................................................................19
AR Payment.....................................................................................................................................19
Bank Adjustment.............................................................................................................................19
Bank Funds Transfer........................................................................................................................19
Bank Reconciliation.........................................................................................................................19
Cancel AR Invoice............................................................................................................................20

Epicor ERP 10.1.500 to 10.1.600 3


Contents Release Notes 10.1.600

COS and WIP...................................................................................................................................20


Fixed Asset......................................................................................................................................20
Revaluation.....................................................................................................................................20
Reverse Cash Receipt.......................................................................................................................21
Void Payroll Check...........................................................................................................................21
Change List by Release.........................................................................................................22
Change List - Excel Spreadsheet.....................................................................................................................22
Change List - PDF File.....................................................................................................................................24

4 Epicor ERP 10.1.500 to 10.1.600


Release Notes 10.1.600 Posting Rule Changes

Posting Rule Changes

Use this section to review the posting rule changes that occurred between the Epicor ERP 10.1.500 to 10.1.600
application releases. These changes are important if you have customized your Standard or Extended posting
rules, or if you use Country Specific Functionality (CSF) and have customized your posting rules.
The posting rule changes are listed by transaction type and include the impact (Rule, Function, Virtual Business
Document (VBD) structure), Change Description, and SCR (Software Change Request) number.

Standard and Extended - 10.1.500 to 10.1.600

If you have customized your Standard or Extended posting rules, review the following posting rule changes.
Based on the changes, make any required updates to your customized posting rules.

AP Invoice
Rule, Function or VBD Impact Change Description SCR
Added New AP Invoice Line Tax Doc Line, EN-96
New rule:
Posting Codes and Posting Rule to support AP
Post Line Tax Amount to AP/AR Tax Accrual Account Tax Line Level posting.
VBD changed to version 8.0

Added new Doc Line, Posting Entities and EN-746


New rules:
posting rule for Header and Line Misc Charge EN-698
Post Misc Charge Header Tax Amount to AP/AR Tax Tax.
Accrual Account
Post Misc Charge Line Tax Amount to AP/AR Tax Accrual
Account

Apply Credit Memo


Rule, Function or VBD Impact Change Description SCR
Modified "Book Invoice Tax" posting rule 187895
Rule:
Reference GL Control Debit Context to Tax in
Book Invoice Tax order to create the TranGLC record correct to
be linked to taxtran.

AR Payment
Rule, Function or VBD Impact Change Description SCR
Cash Receipt will now accept multi-book 191002
Rule:
accounts when the setup is done for
Default Credit Account for Deposit Payment multi-book.

Epicor ERP 10.1.500 to 10.1.600 5


Posting Rule Changes Release Notes 10.1.600

Bank Adjustment
Rule, Function or VBD Impact Change Description SCR
Fields are correctly populated in GLJrnDtl and 167295
Rules:
RvJrnTrDtl. This was a technical correction.
Book Adjustment Amount
Book Bank Fee Tax
Book Cash Amount
Setup GL Transaction Properties

Bank Funds Transfer


Rule, Function or VBD Impact Change Description SCR
Added contexts to Bank Transaction type and 191602
Rule:
set correct contexts.
Post Exchange Difference

Cancel AR Invoice
Rule, Function or VBD Impact Change Description SCR
Posting Rules have been updated to reverse 185650
Rule:
correctly cash deposits, prepaid deposits and
Reverse Less Deposit Amount get prepaid deposits from cash receipts.

Validation was set to "Ignore" for validate 187413


Rule
Transaction amount is zero for currency
Reverse posting Rounding Difference Amount account in posting rule.

190704
Rule: As of now, we can post the cancellation of
an invoice with a currency other than the base
Reverse posting Rounding Difference Amount
and taxes that are generating rounding.
In Posting Rule, a validation Rule was modified
to ignore the error about "Errors from Rules
for Transaction amount is zero, but book
amount is not zero" for rounding difference
when we cancel an AR invoice

COS and WIP


Rule, Function or VBD Impact Change Description SCR
Cost buckets implemented for the SVG-STK 132276
Added rules:
transaction. This is done by merging the rules
MFG-STK/SVG-STK: Post Burden Cost to WIP and for the SVG-STK and MFG-STK transactions,
Inventory Accounts which follow the same accounting logic.

6 Epicor ERP 10.1.500 to 10.1.600


Release Notes 10.1.600 Posting Rule Changes

Rule, Function or VBD Impact Change Description SCR


MFG-STK/SVG-STK: Post Labor Cost to WIP and
Inventory Accounts
MFG-STK/SVG-STK: Post Material Cost to WIP and
Inventory Accounts
MFG-STK/SVG-STK: Post Material Burden Cost to WIP
and Inventory Accounts
MFG-STK/SVG-STK: Post Subcontract Cost to WIP and
Inventory Accounts
MFG-STK/SVG-STK: Post Rounding Cost to WIP and
Inventory Accounts
Deleted rules:
MFG-STK: Post Burden Cost to WIP and Inventory
Accounts
MFG-STK: Post Labor Cost to WIP and Inventory
Accounts
MFG-STK: Post Material Cost to WIP and Inventory
Accounts
MFG-STK: Post Material Burden Cost to WIP and
Inventory Accounts
MFG-STK: Post Subcontract Cost to WIP and Inventory
Accounts
MFG-STK: Post Rounding Cost to WIP and Inventory
Accounts
SVG-STK: Post Extended Cost to WIP and Inventory
Accounts
SVG-STK: Post Material Burden Cost to WIP (Material)
and WIP (Material Burden) Accounts

When posting Cost of Sales transactions, COS 184489


Function:
account will now be updated with Warehouse
Determine COS Account For Cost Of Sales Detail division.
Rules:
Cost of Sales: Post Burden Cost to COS and AR Clearing
Accounts
Cost of Sales: Post Labor Cost to COS and AR Clearing
Accounts
Cost of Sales: Post Material Burden Cost to COS and
AR Clearing Accounts
Cost of Sales: Post Material Cost to COS and AR Clearing
Accounts
Cost of Sales: Post Rounding Amount to COS and AR
Clearing Accounts
Cost of Sales: Post Subcontract Cost to COS and AR
Clearing Accounts

Epicor ERP 10.1.500 to 10.1.600 7


Posting Rule Changes Release Notes 10.1.600

Rule, Function or VBD Impact Change Description SCR


Cost amounts (per cost buckets) will be posted 187424
Functions:
to COS and Contra COS accounts after
Determine COS Account For Plant Transfer receiving parts on the Target Plant (i.e. when
posting PLT-ASM/PLT-MTL/PLT-STK
Deleted posting rules:
transactions)
STK-PLT: Post Burden Cost to COS and Contra COS
Accounts
STK-PLT: Post Material Cost to COS and Contra COS
Accounts
STK-PLT: Post Material Burden Cost to COS and Contra
COS Accounts
STK-PLT: Post Labor Cost to COS and Contra COS
Accounts
STK-PLT: Post Subcontract Cost to COS and Contra COS
Accounts
STK-PLT: Post Rounding Amount to COS and Contra
COS Accounts
Added new posting rules:
PLT-ASM/PLT-MTL/PLT-STK: Post Burden Cost to COS
and Contra COS Accounts
PLT-ASM/PLT-MTL/PLT-STK: Post Material Cost to COS
and Contra COS Accounts
PLT-ASM/PLT-MTL/PLT-STK: Post Material Burden Cost
to COS and Contra COS Accounts
PLT-ASM/PLT-MTL/PLT-STK: Post Labor Cost to COS and
Contra COS Accounts
PLT-ASM/PLT-MTL/PLT-STK: Post Subcontract Cost to
COS and Contra COS Accounts
PLT-ASM/PLT-MTL/PLT-STK: Post Rounding Amount to
COS and Contra COS Accounts

Reference context is corrected. This fix ensures 190787


Rules:
correct reversal of a posted transaction, but
PLT-ASM/PLT-MTL: Post Rounding Amount to WIP and doesn't affect the posting itself.
Variance Accounts

Break down COS WIP Manufacturing variances EN-224


New functions:
to the component cost.
Determine Manufacturing Variance Account For Given
Context and Plant Division
Modified rules:
MFG-VAR: Post Burden Cost to WIP and Variance/COS
Accounts
MFG-VAR: Post Labor Cost to WIP and Variance/COS
Accounts

8 Epicor ERP 10.1.500 to 10.1.600


Release Notes 10.1.600 Posting Rule Changes

Rule, Function or VBD Impact Change Description SCR


MFG-VAR: Material Burden Cost to WIP and
Variance/COS Accounts
MFG-VAR: Post Labor Cost to WIP and Variance/COS
Accounts
MFG-VAR: Post ODC Cost to WIP and Variance/COS
Accounts
MFG-VAR: Post Rounding Cost to WIP and Variance/COS
Accounts
MFG-VAR: Post Subcontract Cost to WIP and
Variance/COS Accounts

CSF - 10.1.500 to 10.1.600

If you have customized your CSF posting rules, review the following posting rule changes. Based on the changes,
make any required updates to your customized posting rules.

CSF Columbia

If you have customized your CSF Columbia posting rules, review the following posting rule changes that were
made from Epicor ERP 10.1.500 to 10.1.600.

AP Adjustment
Rule, Function or VBD Impact Change Description SCR
Add context for reference GL controls to 159919
Rule:
"Post Currency Gain/Loss amount" rule
Post Currency Gain/Loss amount

AP Apply Debit Memo


Rule, Function or VBD Impact Change Description SCR
Booking rule "Post Currency Difference 168400
Rule:
Amount" has its validation "Transaction
Post Currency Difference Amount amount is zero for currency account" action
set to "Ignore".

AP Invoice
Rule, Function or VBD Impact Change Description SCR
Added New AP Invoice Line Tax Doc Line, EN-96
Added rule:
Posting Codes and Posting Rule to support
Post Line Tax Amount to AP/AR Tax Accrual Account AP Tax Line Level posting.
VBD changed to version 8.0

Epicor ERP 10.1.500 to 10.1.600 9


Posting Rule Changes Release Notes 10.1.600

Rule, Function or VBD Impact Change Description SCR


Rule: For AP invoice and AP Payment, 184771
Self-assessment Taxes now post Debit to AP
Post Tax Amount to AP/AR Tax Accrual Account
Tax Contra and Credit to AP Tax Accrual.
Added new Doc Line, Posting Entities and EN-746
New rules:
posting rule for Header and Line Misc EN-698
Post Misc Charge Header Tax Amount to AP/AR Tax Charge Tax.
Accrual Account
Post Misc Charge Line Tax Amount to AP/AR Tax Accrual
Account

AP Logged Invoice
Rule, Function or VBD Impact Change Description SCR
AP_Logged_Invoice posting rules are 196561
Rule:
updated.
Setup GL Journal Main Data

AP Payment
Rule, Function or VBD Impact Change Description SCR
Rule: For AP invoice and AP Payment, 184771
Self-assessment Taxes now post Debit to AP
Post Payment Taxes
Tax Contra and Credit to AP Tax Accrual.

AP Void Payment
Rule, Function or VBD Impact Change Description SCR
Rule: Fixed AP Void Payment posting rule for void 175918
payments created in Bank Statement
Post Payment Total to Bank Cash/Pending Account
Processing

Apply Credit Memo


Rule, Function or VBD Impact Change Description SCR
Now posting code will be stored in the 166871
Rule:
GLJrnlDtl table for the currency gain loss
Post Currency Difference amount when applying a credit memo

Handling amount signs when posting 182514


Rule:
Self-assessment taxes in Apply Credit Memo
Book Invoice Tax transaction is corrected

Modified "Book Invoice Tax" posting rule 187895


Rule:
Reference GL Control Debit Context to Tax
Book Invoice Tax in order to create the TranGLC record
correct to be linked to taxtran.

10 Epicor ERP 10.1.500 to 10.1.600


Release Notes 10.1.600 Posting Rule Changes

AR Invoice
Rule, Function or VBD Impact Change Description SCR
Columbia AR_Invoice posting rules are 196556
Functions:
updated with all changes from Extended
Amount is negative AR_Invoice
Define Project Billing Deferred Revenue Context
Determine Appropriate Context for Invoice Line
Determine Appropriate Context for the Revenue Account
Determine Billing Account For Appropriate Context
Determine Call Account For Appropriate Contex
Determine Contract Account For Appropriate Context
Determine Revenue Account for Line Type Part and Given
Context Context
Get Reference Revenue/Returns Account for Given Context
Context
Determine Discount Account
Rules:
Post Currency Difference (Allocated Deposit)
Post Deferred Revenue Amount (All Invoices, Call)
Post Deferred Revenue Amount (All Invoices, Contract)
Post Deferred Revenue Amount (All Invoices, Part)
Post Discount Amount (All Invoice Types, Call)
Post Discount Amount (All Invoice Types, Contract)
Post Discount Amount (All Invoice Types, Part)
Post Extended Price Amount (All Invoice Types, Contract)
Post Extended Price Amount (All Invoices, Call)
Post Extended Price Amount (Credit Memo, Part)
Post Extended Price Amount (Project Billing)
Post Extended Price Amount (Regular Invoice, Part)
Post Rounding Difference Amount
Post Tax Shipment Net Movement Deduction
Set up GL journal main data

AR Payment
Rule, Function or VBD Impact Change Description SCR
AR_Payment posting rules updated with all 196557
Functions:
changes in Extended rules
Reconcile Other Balances

Epicor ERP 10.1.500 to 10.1.600 11


Posting Rule Changes Release Notes 10.1.600

Rule, Function or VBD Impact Change Description SCR


Rules: Book Bank Fee
Book Bank Fee Tax
Book Currency Gain/Loss
Book Invoice Payment Credit
Book Invoice Tax
Book Tax Currency Gain/Loss
Book Withholding Tax
Default Credit Account for Deposit and Misc Payment
Prorate Payment Discount to Invoice Lines
Setup GL Journal Properties

Cash Receipt will now accept multi-book 191002


Rule:
accounts when the setup is done for
Default Credit Account for Deposit Payment multi-book.

AR PI Write-off
Rule, Function or VBD Impact Change Description SCR
Payment Instrument Write-off posts correctly 172554
Rule:
using the Account provided by the user in
Post PI Total to Write-off Account the UI and the transactions are generated
correctly. (Unbalanced transaction error no
longer displays).

Bank Adjustment
Rule, Function or VBD Impact Change Description SCR
Fields are correctly populated in GLJrnDtl 167295
Rules:
and RvJrnTrDtl (technical correction)
Book Adjustment Amount
Book Bank Fee Tax
Book Cash Amount
Setup GL Transaction Properties

Bank Funds Transfer


Rule, Function or VBD Impact Change Description SCR
Rule: Posting rule updated to correctly select 167296
Target Bank Account if new transfer is
Post the movement from Transfer Account to Target Bank
posted from bank statement.
Cash Account

12 Epicor ERP 10.1.500 to 10.1.600


Release Notes 10.1.600 Posting Rule Changes

Rule, Function or VBD Impact Change Description SCR


Added contexts to Bank Transaction type 191602
Rule:
and set correct contexts in Post Exchange
Post Exchange Difference Difference posting rule.

Cancel AR Invoice
Rule, Function or VBD Impact Change Description SCR
Posting Rules have been updated to reverse 185650
Rule:
correctly cash deposits, prepaid deposits
Reverse Less Deposit Amount and get prepaid deposits from cash receipts.

Rule: Validation was set to "Ignore" for validate 187413


Transaction amount is zero for currency
Reverse posting Rounding Difference Amount
account in posting rule "Reverse posting
rounding difference

COS and WIP


Rule, Function or VBD Impact Change Description SCR
191416
Rule: Amount validation is changed to avoid
incorrect assignment of a "-" sign.
All posting rules in COS&WIP transaction are affected.
Specifically, to assign debit/credit accounts,
the rules will now check the sign of
Transaction amount instead of Book
amount, and the check itself is changed to
">=0".

Account hierarchy is restored for ADJ-CST 177381


Rule:
transactions
ADJ-CST: Post Extended Cost to Purchase Variance and
Inventory Accounts

Cost buckets implemented for the SVG-STK 132276


Added Rules:
transaction. This is done by merging the
MFG-STK/SVG-STK: Post Burden Cost to WIP and Inventory rules for the SVG-STK and MFG-STK
Accounts transactions (which follow the same
accounting logic).
MFG-STK/SVG-STK: Post Labor Cost to WIP and Inventory
Accounts
MFG-STK/SVG-STK: Post Material Cost to WIP and
Inventory Accounts
MFG-STK/SVG-STK: Post Material Burden Cost to WIP and
Inventory Accounts
MFG-STK/SVG-STK: Post Subcontract Cost to WIP and
Inventory Accounts
MFG-STK/SVG-STK: Post Rounding Cost to WIP and
Inventory Accounts
Deleted rules:

Epicor ERP 10.1.500 to 10.1.600 13


Posting Rule Changes Release Notes 10.1.600

Rule, Function or VBD Impact Change Description SCR


MFG-STK: Post Burden Cost to WIP and Inventory Accounts
MFG-STK: Post Labor Cost to WIP and Inventory Accounts
MFG-STK: Post Material Cost to WIP and Inventory
Accounts
MFG-STK: Post Material Burden Cost to WIP and Inventory
Accounts
MFG-STK: Post Subcontract Cost to WIP and Inventory
Accounts
MFG-STK: Post Rounding Cost to WIP and Inventory
Accounts
SVG-STK: Post Extended Cost to WIP and Inventory
Accounts
SVG-STK: Post Material Burden Cost to WIP (Material) and
WIP (Material Burden) Accounts

Cost amounts (per cost buckets) will be 187424


Functions:
posted to COS and Contra COS accounts
Determine COS Account For Plant Transfer after receiving parts on the target plant (i.e.
when posting PLT-ASM/PLT-MTL/PLT-STK
Deleted posting rules:
transactions).
STK-PLT: Post Burden Cost to COS and Contra COS
Accounts
STK-PLT: Post Material Cost to COS and Contra COS
Accounts
STK-PLT: Post Material Burden Cost to COS and Contra
COS Accounts
STK-PLT: Post Labor Cost to COS and Contra COS Accounts
STK-PLT: Post Subcontract Cost to COS and Contra COS
Accounts
STK-PLT: Post Rounding Amount to COS and Contra COS
Accounts
Added new posting rules:
PLT-ASM/PLT-MTL/PLT-STK: Post Burden Cost to COS and
Contra COS Accounts
PLT-ASM/PLT-MTL/PLT-STK: Post Material Cost to COS and
Contra COS Accounts
PLT-ASM/PLT-MTL/PLT-STK: Post Material Burden Cost to
COS and Contra COS Accounts
PLT-ASM/PLT-MTL/PLT-STK: Post Labor Cost to COS and
Contra COS Accounts
PLT-ASM/PLT-MTL/PLT-STK: Post Subcontract Cost to COS
and Contra COS Accounts
PLT-ASM/PLT-MTL/PLT-STK: Post Rounding Amount to COS
and Contra COS Accounts

14 Epicor ERP 10.1.500 to 10.1.600


Release Notes 10.1.600 Posting Rule Changes

Rule, Function or VBD Impact Change Description SCR


Break down COS WIP Manufacturing EN-224
Added functions:
variances to the component cost.
Determine Manufacturing Variance Account For Given
Context and Plant Division
Modified rules:
MFG-VAR: Post Burden Cost to WIP and Variance/COS
Accounts
MFG-VAR: Post Labor Cost to WIP and Variance/COS
Accounts
MFG-VAR: Material Burden Cost to WIP and Variance/COS
Accounts
MFG-VAR: Post Labor Cost to WIP and Variance/COS
Accounts
MFG-VAR: Post ODC Cost to WIP and Variance/COS
Accounts
MFG-VAR: Post Rounding Cost to WIP and Variance/COS
Accounts
MFG-VAR: Post Subcontract Cost to WIP and Variance/COS
Accounts

CSF Germany

If you have customized your CSF Germany posting rules, review the following posting rule changes that were
made from Epicor ERP 10.1.500 to 10.1.600.

AR Payment
Rule, Function or VBD Impact Change Description SCR
Cash Receipt will now accept multi-book 191002
Rule:
accounts when the setup is done for
Default Credit Account for Deposit Payment multi-book.

Reverse Cash Receipt


Rule, Function or VBD Impact Change Description SCR
Updated posting rules in Reverse Cash Receipt 181157
Rules:
transaction so that rules would take amounts
Books the tax amount back to Interim account from VBD when no amounts are found in
Reference GL controls. This logic is required
Reverse Bank Fee
because the conversion creates reference GLC
Reverse Bank Fee Tax records in TranGLC but those records contain
only accounts and no amounts.
Reverse Currency Gain
Reverse Currency Loss
Reverse Deposit Payment Credit

Epicor ERP 10.1.500 to 10.1.600 15


Posting Rule Changes Release Notes 10.1.600

Rule, Function or VBD Impact Change Description SCR


Reverse Discount Tax Adjustment
Reverse Discount Tax Adjustment Total
Reverse Invoice Payment
Reverse Misc Payment Credit
Reverse Misc Payment Tax
Reverse Payment Discount
Reverse Posting of the Debit Note amount
Reverse Prorated Discount
Reverse Rounding Difference
Reverse Tax
Reverse Tax Currency Gain
Reverse Tax Currency Loss

CSF Vietnam

If you have customized your CSF Vietnam posting rules, review the following posting rule changes that were
made from Epicor ERP 10.1.500 to 10.1.600.

AP Adjustment
Rule, Function or VBD Impact Change Description SCR
Base code changes merged 147131
Rule:
Post Currency Gain/Loss amount

AP Apply Debit Memo


Rule, Function or VBD Impact Change Description SCR
194027
Rules: New way of <Apply Debit Memo>
posting is implemented:
Post Amount Applied to Debit Memo
- lines related to Debit Memo are posted
Post Amount Applied to Invoice
in single line.
Post Amount Applied to Prepayment
- lines related to Invoices are posted as
Post Currency Difference Amount previously (one per invoice).
Post Gain/Loss Amount to Interim Tax
Post Payment Taxes
Post Withholding Taxes
Reverse Invoice Interim Tax and Post it to Accrual

Base code changes merged 147131


Rule:

16 Epicor ERP 10.1.500 to 10.1.600


Release Notes 10.1.600 Posting Rule Changes

Rule, Function or VBD Impact Change Description SCR


Post Currency Difference Amount

AP Invoice
Rule, Function or VBD Impact Change Description SCR
Rule: Base changes were merged 188629
Post Tax Amount to AP/AR Tax Accrual Account

Added New AP Invoice Line Tax Doc Line, EN-96


Added rule:
Posting Codes and Posting Rule to
Post Line Tax Amount to AP/AR Tax Accrual Account support AP Tax Line Level posting
VBD changed to version 8.0

Added new Doc Line, Posting Entities and EN-746


Added posting rules:
posting rule for Header and Line Misc EN-698
Post Misc Charge Header Tax Amount to AP/AR Tax Accrual Charge Tax
Account
Post Misc Charge Line Tax Amount to AP/AR Tax Accrual
Account

AP Payment
Rule, Function or VBD Impact Change Description SCR
Base changes were merged 188629
VBD version is updated to 11.0
Rules:
Post Invoice Tax Discount Adjustment Amount to Tax Account
Post Payment Taxes
Post Payment Total to Bank Cash/Pending Account
Post Rounding Amount
Deleted rule:
Post Check Amount to Bank Cash/Pending Account

AP Void Payment
Rule, Function or VBD Impact Change Description SCR
195240
Rules: Assignments of the new
"VNACSubGroup_c" code were added
Post Bank Fee Amount
to rules.
Post Bank Fee Tax Amount
"Book summarize" was set to
Post Discount Tax Adjustment Amount "Summarize debit and credit separately"
value.
Post Gain/Loss Amount

Epicor ERP 10.1.500 to 10.1.600 17


Posting Rule Changes Release Notes 10.1.600

Rule, Function or VBD Impact Change Description SCR


Post Gain/Loss Amount to Interim Tax
Post Operational Amount to Paybles/Expense/Prepayment
Account
Post Payment Discount Amount to Discount Account
Post Payment Total to Bank Cash/Pending Account
Post Rounding Amount
Post Tax Amount
Post Total Discount Adjustment to Discount Account
Post Withholding Tax

Base changes were merged 188629


VBD version is updated to 8.0
Rules:
Post Gain/Loss Amount
Post Withholding Tax
Post Rounding Amount
Post Payment Total to Bank Cash/Pending Account
Deleted rule:
Post Check Amount to Bank

Apply Credit Memo


Rule, Function or VBD Impact Change Description SCR
Logic of the Vietnamese UD fields' 195032
Rules:
assignment was corrected.
Book Invoice Tax
Book Tax Currency Gain/Loss
Post Applied Amount to Accounts Receivable
Post Currency Difference Amount
Post Total Applied amount
Post Withholding Taxes
Reverse Credit Card Payment
Reverse Deferred Tax
Reverse Deposit Tax Amount

Base code changes merged 147131


Rule:
Book Invoice Tax Post Currency Difference Amount

18 Epicor ERP 10.1.500 to 10.1.600


Release Notes 10.1.600 Posting Rule Changes

AR Invoice
Rule, Function or VBD Impact Change Description SCR
Corrected VN correspondence accounting 195034
Rule:
in case either Deposit Invoice is created
Post Deposit Amount (Deposit Invoices) directly or from Deposit payments by 'Get
.' action.
VBD version is updated to 11.0 Base changes were merged 188629

AR Payment
Rule, Function or VBD Impact Change Description SCR
Base code changes merged 147131
Rules:
Book Rounding Difference Amount
Default Credit Account for Deposit and Misc Payment

Cash Receipt will now accept multi-book 191002


Rule:
accounts when the setup is done for
Default Credit Account for Deposit Payment multi-book.

Bank Adjustment
Rule, Function or VBD Impact Change Description SCR
Base code changes merged 147131
Rules:
Book Adjustment Amount
Book Bank Fee Tax
Book Cash Amount
Setup GL Transaction Properties

Bank Funds Transfer


Rule, Function or VBD Impact Change Description SCR
Base code changes merged 147131
Rules:
Post Exchange Difference

Bank Reconciliation
Rule, Function or VBD Impact Change Description SCR
Base code changes merged 147131
Rules:
Statement Line - Book Currency Gain/Loss

Epicor ERP 10.1.500 to 10.1.600 19


Posting Rule Changes Release Notes 10.1.600

Rule, Function or VBD Impact Change Description SCR


Statement Line - Post Variance Amount

Cancel AR Invoice
Rule, Function or VBD Impact Change Description SCR
Base code changes merged 147131
Rules:
Restore Deposit Tax
Reverse Less Deposit Amount
Reverse posting Rounding Difference Amount

Base code changes merged 188629


Added Rule:
Restore Deposit Tax

COS and WIP


Rule, Function or VBD Impact Change Description SCR
Base code changes merged 147131
Functions:
Transaction has Landed Cost (new)
Determine COS Account For Plant Transfer
Rules:
All posting rules in COS&WIP transaction are affected.

Fixed Asset
Rule, Function or VBD Impact Change Description SCR
Base code changes merged 147131
Rules:
Post Depreciation Charge
Post Impairment Revaluation Surplus Amount

Revaluation
Rule, Function or VBD Impact Change Description SCR
Base code changes merged 147131
VBD version is updated to 11.0
Functions:
Bank Revalue Text
Rule:
A/P Invoice - Balance Adjustment

20 Epicor ERP 10.1.500 to 10.1.600


Release Notes 10.1.600 Posting Rule Changes

Rule, Function or VBD Impact Change Description SCR


Bank Account - Balance Adjustment"Bank Account - Realized
Gain
Bank Account - Realized Loss
Bank Account - Unrealized Gain
Bank Account - Unrealized Loss

Reverse Cash Receipt


Rule, Function or VBD Impact Change Description SCR
Updated posting rules in Reverse Cash 181157
Rules:
Receipt transaction so that rules would
Books the tax amount back to Interim account take amounts from VBD in case when
no amounts are found in Reference GL
Reverse Bank Fee
controls. This logic is required because
Reverse Bank Fee Tax conversion creates reference GLC records
in TranGLC but those records contain
Reverse Currency Gain
only accounts and no amounts.
Reverse Currency Loss
Reverse Deposit Payment Credit
Reverse Discount Tax Adjustment
Reverse Discount Tax Adjustment Total
Reverse Invoice Payment
Reverse Misc Payment Credit
Reverse Misc Payment Tax
Reverse Payment Discount
Reverse posintg of the Debit Note amount
Reverse Prorated Discount
Reverse Rounding Difference
Reverse Tax
Reverse Tax Currency Gain
Reverse Tax Currency Loss

Void Payroll Check


Rule, Function or VBD Impact Change Description SCR
Base code changes merged 147131
Rule:
Setup GL Journal properties

Epicor ERP 10.1.500 to 10.1.600 21


Change List by Release Release Notes 10.1.600

Change List by Release

Use this section to review the resolved issues and enhancements that occurred since the last Epicor ERP 10.1.500
application release. Each Epicor ERP application update is cumulative. For example, the Epicor 10.1.600 update
includes resolved issues and enhancements from versions 10.1.500 to 10.1.600.
The change list records are sorted by Release (600.x), Functional Area, Module, and Job number. Each record
includes a type and summary description. The information is divided into four sections:
Resolved Issues
Application Enhancements
Performance Enhancements
Software Interface Changes
The change list is provided in two formats:
Excel spreadsheet: An attached file can be selected and opened in Microsoft Excel. You can filter, sort and
format the spreadsheet.
PDF File: An embedded PDF file of the Excel spreadsheet can be viewed and printed. For improved viewing,
the PDF file is displayed in a landscape layout.
Use the steps below to open the Change List as an Excel spreadsheet or PDF File.

Change List - Excel Spreadsheet


To open the spreadsheet file, select the Attachments (paperclip) icon. Your Attachments icon may look similar
to one of the following:

22 Epicor ERP 10.1.500 to 10.1.600


Release Notes 10.1.600 Change List by Release

The change list file attachment is listed. You can double-click on the file to open it in Microsoft Excel or you can
right-click on the file and select to Save it to a folder on your local machine.
After opening the spreadsheet file, you can filter, sort, or format the list using standard Microsoft Excel functionality.
Below are a few examples for filtering and sorting the list.
Filter the List. For example, if you want to filter the list for only 10.1.600.1, select the drop-down arrow next
to the Update column header and select the 10.1.600.1 version. Your dialog may look similar to the following:

Sort the List. For example, if you want to sort the list by a series of specific columns, click the Sort button and
enter your sorting criteria. Your dialog may look similar to the following:

Epicor ERP 10.1.500 to 10.1.600 23


Change List by Release Release Notes 10.1.600

Change List - PDF File


To view the change list as a separate PDF file, scroll to the next pages. For improved viewing, the PDF file is
displayed in a landscape layout.

24 Epicor ERP 10.1.500 to 10.1.600


EpicorERP10.1.600ChangeList
10.1.500to10.1.600
Disclaimer
Thisdocumentisforinformationalpurposesonlyandissubjecttochangewithoutnotice.Thisdocumentandit
contents,includingtheviewpoints,datesandfunctionalcontentexpressedhereinarebelievedtobeaccurateasofit
dateofpublication.However,EpicorSoftwareCorporationmakesnoguarantee,representationsorwarrantieswith
regardtotheenclosedinformationandspecificallydisclaimsanyapplicableimpliedwarranties,suchasfitnessfora
particularpurpose,merchantability,satisfactoryqualityorreasonableskillandcare.AseachuserofEpicorsoftwarei
likelytobeuniqueintheirrequirementsintheuseofsuchsoftwareandtheirbusinessprocesses,usersofthisdocumen
arealwaysadvisedtodiscussthecontentofthisdocumentwiththeirEpicoraccountmanager.Allinformationcontained
hereinissubjecttochangewithoutnoticeandchangestothisdocumentsinceprintingandotherimportantinformation
aboutthesoftwareproductaremadeorpublishedinreleasenotes,andyouareurgedtoobtainthecurrentrelease
notesforthesoftwareproduct.Wewelcomeusercommentsandreservetherighttorevisethispublicationand/o
makeimprovementsorchangestotheproductsorprogramsdescribedinthispublicationatanytime,withoutnotice
TheusageofanyEpicorsoftwareshallbepursuanttoanEpicorenduserlicenseagreementandtheperformanceo
anyconsultingservicesbyEpicorpersonnelshallbepursuanttoEpicor'sstandardservicestermsandconditions.Usage
ofthesolution(s)describedinthisdocumentwithotherEpicorsoftwareorthirdpartyproductsmayrequirethepurchas
oflicensesforsuchotherproducts.Whereanysoftwareisexpressedtobecompliantwithlocallawsorrequirement
inthisdocument,suchcomplianceisnotawarrantyandisbasedsolelyonEpicor'scurrentunderstandingofsuchlaw
andrequirements.Alllawsandrequirementsaresubjecttovaryinginterpretationsaswellastochangeandaccordingly
Epicorcannotguaranteethatthesoftwarewillbecompliantanduptodatewithsuchchanges.Allstatementso
platformandproductcompatibilityinthisdocumentshallbeconsideredindividuallyinrelationtotheproductsreferred
tointherelevantstatement,i.e.,whereanyEpicorsoftwareisstatedtobecompatiblewithoneproductandalso
statedtobecompatiblewithanotherproduct,itshouldnotbeinterpretedthatsuchEpicorsoftwareiscompatible
withbothoftheproductsrunningatthesametimeonthesameplatformorenvironment.Additionallyplatformo
productcompatibilitymayrequiretheapplicationofEpicororthirdpartyupdates,patchesand/orservicepacksand
Epicorhasnoresponsibilityforcompatibilityissueswhichmaybecausedbyupdates,patchesand/orservicepack
releasedbythirdpartiesafterthedateofpublicationofthisdocument.Epicorisaregisteredtrademarkand/o
trademarkofEpicorSoftwareCorporationintheUnitedStates,certainothercountriesand/ortheEU.Allothe
trademarksmentionedarethepropertyoftheirrespectiveowners.CopyrightEpicorSoftwareCorporation2017
Allrightsreserved.Nopartofthispublicationmaybereproducedinanyformwithoutthepriorwrittenconsento
EpicorSoftwareCorporation.

Epicor10.1.600
Revision:May2017
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description

10.1.600 ExecutiveManagement ExecutiveDashboard 188396 Application PartWhereUsedDashboardappearstoreturndatarelatedtoadifferentpart


10.1.600 FinancialManagement AccountsPayable 67870 Application SupplierTaxLiabilityOverwrittenbycountry'staxliability
InvoiceEntryAPWarningmessagemissingwhenletterofcreditisdifferentinthe
10.1.600 FinancialManagement AccountsPayable 72764 Application POreceiplineandintheinvoice

10.1.600 FinancialManagement AccountsPayable 163571 Application PaymentEntryDeletingaPaymentshouldrequirevoidingthelegalnumber


BankAdjustmentEntryBankAcctID,BankTranNumandTranDocTypeIDareempty
10.1.600 FinancialManagement AccountsPayable 167295 Application inErp.GLJrnDtl
PaymentInstrumentStatusAddinganewGLControldoesnotchangefocusonGL
10.1.600 FinancialManagement AccountsPayable 172396 Application ControlTab
10.1.600 FinancialManagement AccountsPayable 174416 Application PaymentEntryModify'EnterPaymentTotal'behavior

10.1.600 FinancialManagement AccountsPayable 175469 Application PaymentEntryYoucanselectandmodifyPettyCashgroupsinPaymentEntry


PaymentInstrumentPayableMessageboxtopreventuseAPInvoicewithWH
10.1.600 FinancialManagement AccountsPayable 175622 Application taxesisempty
PaymentEntryAPprocessPaymentsformBankexportfilepathgetsremoved
10.1.600 FinancialManagement AccountsPayable 181245 Application onceyouchangethenameofthefile
APInvoiceBalanceReportIncorrectlycalculatesClosingCreditandusesaDebitas
10.1.600 FinancialManagement AccountsPayable 183440 Application theRevaluationamounts
10.1.600 FinancialManagement AccountsPayable 184641 Application InvoiceEntryAPPostingAPInvoiceonHoldgoestoreviewjournal
APInvoiceBalanceReportReportdoesnotworkwhenthereisadebitmemo
10.1.600 FinancialManagement AccountsPayable 184703 Application involved
PaymentInstrumentUpdatePaymentInstrumentUpdatecanretrieveandupdate
10.1.600 FinancialManagement AccountsPayable 185391 Application recordsofincorrecttypes

10.1.600 FinancialManagement AccountsPayable 185823 Application InvoiceEntryAPReadytoCalculatedoesnotdefaultforApprovedLoggedInvoices


ApplyDebitMemo/PrepaymentErrormessagewhentryingtoapplyprepayment
10.1.600 FinancialManagement AccountsPayable 185827 Application withwithholdingtax
1099ProcessingConversionProgramcvap0042(9010)runsforallcompanieswith
10.1.600 FinancialManagement AccountsPayable 186239 Application CSFUS
PaymentEntrySelectInvoicesgeneratesonlyonepaymentwhenselecting
10.1.600 FinancialManagement AccountsPayable 186324 Application invoiceswithdifferentbank
PaymentEntryWhenazeroAPpaymententered,theEditListdoesnotdisplay
10.1.600 FinancialManagement AccountsPayable 186404 Application supplierandinvoicedetails
InvoiceEntryAPIncorrectUnitCostforDropShipmentreceiptlinewhenusinga
10.1.600 FinancialManagement AccountsPayable 186423 Application CostPerdifferentthan/G1011
10.1.600 FinancialManagement AccountsPayable 186864 Application PaymentEntryFormstatusisn'tsetonResetProcessPaymentoperation

Page2
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


LoggedinvoiceEntryLoggedInvoicecanbesavedandpostedwiththeDueDate
10.1.600 FinancialManagement AccountsPayable 187018 Application onblank

10.1.600 FinancialManagement AccountsPayable 187167 Application InvoiceEntryAPDebitMemoisnotcreatedduetoanUOMdecimalserror


InvoiceEntryAPWhenmanuallyenteringaccountsandsaving,validationshould
10.1.600 FinancialManagement AccountsPayable 187280 Application occuruponsave
PaymentTrackerClearedDateshowsBankStatementProcessingApplyDate
10.1.600 FinancialManagement AccountsPayable 187616 Application insteadoftheClearDateassignedtotheline
InvoiceEntryAPIncorrectRecepitLineSelectionwhenmanuallychangingLines
10.1.600 FinancialManagement AccountsPayable 187689 Application Numberorder
PaymentInstrumentTrackerAPdataisnotrefreshwhenPaymentInstrumentIdis
10.1.600 FinancialManagement AccountsPayable 187941 Application typed
InvoiceEntryAPDiscountcalculationincorrectwhenaMiscChargeandtaxesare
10.1.600 FinancialManagement AccountsPayable 188305 Application present
InvoiceEntryAPIncorrectaveragecostupdatewhenadjustingpriceduringAP
10.1.600 FinancialManagement AccountsPayable 188326 Application InvoiceEntry

10.1.600 FinancialManagement AccountsPayable 188404 Application InvoiceEntryAPMoveAllocationbuttontobeontopoftheG/LDistributiongrid


TaxReconciliationReportIncorrectreferenceonLegal/DocNumberforInvoice
10.1.600 FinancialManagement AccountsPayable 188617 Application PaymentandApplyDebitMemotransactions
InvoiceEntryAPGLAnalysisisnotcreatedwhenRecurringincludesthesame
10.1.600 FinancialManagement AccountsPayable 188681 Application invoicenumberfor2differentsuppliers
InvoiceEntryAPBlankerrormessageappearswhenassigningalegalnumberto
10.1.600 FinancialManagement AccountsPayable 188753 Application correctioninvoice
PaymentEntryErrorreturnedinprocesspaymentsforelectronicpaymentwhen
10.1.600 FinancialManagement AccountsPayable 189159 Application userFormatCultureisnotsettodefault
InvoiceEntryAPDiscountisoverstatedwhenusingTaxConnectandaself
10.1.600 FinancialManagement AccountsPayable 189165 Application assessedcustomer
10.1.600 FinancialManagement AccountsPayable 189176 Application InvoiceEntryAPADJPURtransactionsdonotupdatejobmaterialcosts
APLetterOfCreditReportValue,Invoiced,OutstandingPO,Uncommittedand
10.1.600 FinancialManagement AccountsPayable 189179 Application Paidvaluesshow5decimals

10.1.600 FinancialManagement AccountsPayable 189310 Application AdvancePaymentBalanceReportExtendedCostshows5decimalsinsteadof2


PaymentEntryUnabletoenterbankaccountdetailsinPaymentEntryfor
10.1.600 FinancialManagement AccountsPayable 189390 Application electronicpaymentinBank/Remittab
APGenerateRecurringInvoices0invoicescreatedwhenuserusefilterbyCycle
10.1.600 FinancialManagement AccountsPayable 189487 Application Codeandsupplieratthesametime
InvoiceEntryAPTaxLiabilitydoesnotdefaultintheHeader/TaxtabiftaxConnect
10.1.600 FinancialManagement AccountsPayable 190122 Application isenabled

Page3
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


InvoiceEntryAPUnabletocreatereceiptlinesforPackingslipLinesgeneratedvia
10.1.600 FinancialManagement AccountsPayable 190174 Application MassReceipt
InvoiceEntryAPRecepitLineUnitcostisnotcovertedtoInvoice'sCurrencywhen
10.1.600 FinancialManagement AccountsPayable 190175 Application itisdifferentthanOrder
InvoiceEntryAPBlankerrormessageappearswhentryingtodeleteaninvoice
10.1.600 FinancialManagement AccountsPayable 190332 Application thatisonReviewJournal
ExpenseDistributionDatesarenotprintingundertheestablisheddateformat
10.1.600 FinancialManagement AccountsPayable 190416 Application accordingtotheuser'sFormatCulture
AgedPayablesDatesinthereportarenotprintingundertheestablisheddate
10.1.600 FinancialManagement AccountsPayable 190417 Application formataccordingtotheuser'sFormatCulture
InvoiceEntryAPEditListdoesnotshowthecorrectinformationwhenmapping
10.1.600 FinancialManagement AccountsPayable 190512 Application andmorethan40accountsareused
APInvoiceEditListShowsonholdinvoicesonthereportbodywhenitshouldnot
10.1.600 FinancialManagement AccountsPayable 190544 Application showthem
PaymentEntryModify'EnterPaymentTotal'behavioraffecttheeditlistremoved
10.1.600 FinancialManagement AccountsPayable 190645 Application theInvoicedocumentamountline,exchangerate
10.1.600 FinancialManagement AccountsPayable 190693 Application InvoiceEntryAPUnabletopastedatainGLanalysistabduetoerror
10.1.600 FinancialManagement AccountsPayable 190758 Application InvoiceEntryAPClosedPOisreopenedafteritisinvoiced

InvoiceEntryAPAllocatedlinesCostdidn'tcalculatecorrectlybetweenthe
10.1.600 FinancialManagement AccountsPayable 190791 Application selectedlinesinproportiontothelinevalueaccordingtothevaluemethod
APInvoiceBalanceReportErroroccursinAPInvoiceBalancewhensortedby
10.1.600 FinancialManagement AccountsPayable 191005 Application SupplierGroup
10.1.600 FinancialManagement AccountsPayable 191432 Application InvoiceEntryAPExternalGLAccountSearchWindowsismissing
10.1.600 FinancialManagement AccountsPayable 191464 Application InvoiceEntryAPPostingSADualEntrytaxescorruptstaxboxreporting
InvoiceEntryAPVarianceoccursbetweenPaymentTotalandPaymentBatch
10.1.600 FinancialManagement AccountsPayable 191472 Application Trackerwhenautodeletenegativepayments
ReceivedbutnotInvoicedMergingcolumnsanddisplayingthenumericfieldsas
10.1.600 FinancialManagement AccountsPayable 191502 Application text,whenusingExcelDataOnlyasOutput
InvoiceEntryAPUsingTaxConnect,anerrordisplayswhentheTaxLiabilityis
10.1.600 FinancialManagement AccountsPayable 191586 Application selectedfortheInvoice

10.1.600 FinancialManagement AccountsPayable 191872 Application LoggedInvoiceTrackerSearchbySupplierfielddoesnotworkandisgrayedout


ReceivedbutnotInvoicedReportdoesnotdisplayamountaccordingtoBook's
10.1.600 FinancialManagement AccountsPayable 192009 Application currency
InvoiceEntryAPGLaccountdescriptiondoesnotdisplayiftheaccountsegment
10.1.600 FinancialManagement AccountsPayable 192132 Application orderisotherthan123
APInvoiceBalanceReportDebitMemodisplayedincorrectlyforRangeByOpen
10.1.600 FinancialManagement AccountsPayable 192139 Application InvoicesatEndDate

Page4
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


InvoiceEntryAPPOMiscChargeisnotcarriedtoAPInvoiceEntryiftheMisc
10.1.600 FinancialManagement AccountsPayable 192147 Application Chargeinbasecurrencyequalszero
AdjustmentAPGain/LossAmountisnotcorrectlyupdatedbasedontheApply
10.1.600 FinancialManagement AccountsPayable 192293 Application date
InvoiceEntryAPUnabletopostintercompanyInvoicewithsaleskitcomponents;
10.1.600 FinancialManagement AccountsPayable 192731 Application errorsinReviewJournal
10.1.600 FinancialManagement AccountsPayable 192879 Application 1099ProcessingReportdoesnotprintwhenUDfieldsareinvolved
InvoiceEntryAPExchangeRateisnotsavedanditreturnstooriginalevenifthe
10.1.600 FinancialManagement AccountsPayable 193281 Application Lockcheckboxisselected

AgedPayablesUnabletoperformcalculationforCurrencycolumninExcelformat
10.1.600 FinancialManagement AccountsPayable 193496 Application ofAgedPayablereportsincethefieldformatistext,notnumber

APInvoiceEditlistIntercompanyJournalsectiondoesnotshowallexternal
10.1.600 FinancialManagement AccountsPayable 193577 Application companies,ifbothexternalcompaniesreferencethesameGLAccount
InvoiceEntryAPIntrastatshowsincorrectNetWeightwhenNetWeightUOMis
10.1.600 FinancialManagement AccountsPayable 193752 Application differentfrominventoryandpurchase
AgedPayablesAgedPayablesReportshowsincorrectbalanceforinvoicewith
10.1.600 FinancialManagement AccountsPayable 194050 Application prepayment

10.1.600 FinancialManagement AccountsPayable 195026 Application InvoiceTrackerAPErrorwhenretreivinginvoicewithdeletedlineinReceiptEntry


10.1.600 FinancialManagement AccountsPayable 195205 Application CheckRegisterDoesnotdisplayOneTimesupplierchecks
LoggedinvoiceEntryIncorrectBank/RemitTochosenwhenhavingthesame
10.1.600 FinancialManagement AccountsPayable 195534 Application Bank/RemittoIDinseveralSuppliers
PaymentInstrumentStatusRemoveallUnapprovedstatusreferencessinceitis
10.1.600 FinancialManagement AccountsPayable 195944 Application notimplementedinAP
InvoiceEntryAPandGLJournalEntryEndDatedoesnotworkforamortization
10.1.600 FinancialManagement AccountsPayable 196108 Application schedules
InvoiceEntryAPUnabletoseeandselectlinesfromaReceiptthathasdifferent
10.1.600 FinancialManagement AccountsPayable 197218 Application POnumbers
ReceivedbutnotInvoicedDoesnotuseCostDecimalsetonCompany
10.1.600 FinancialManagement AccountsPayable 197335 Application Configuration;alsoshowsincompleteUOMandPackingSlip
InvoiceEntryAPInvoicewithDeferredExpenseispostedeventhoughitdoesnot
10.1.600 FinancialManagement AccountsPayable 197783 Application haveanexpenseaccount
10.1.600 FinancialManagement AccountsPayable 199121 Application SupplierCSFNetherlandsTaxIdvalidationinSupplierEntry
PaymentEntryMiscPaymentaccountisbeingsettothemappedbookinsteadof
10.1.600 FinancialManagement AccountsPayable 199141 Application themainbook

Page5
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description

PaymentEntryErrorinTelePayinternationalpaymentswhensupplierhasFinnish
10.1.600 FinancialManagement AccountsPayable 199371 Application IBANbankaccountandcompanybankaccountisNordeaNorway(CSFNorway).

10.1.600 FinancialManagement AccountsReceivable 59349 Application RMAProcessingLine/CommissionSalespersonisnotpulledfromsalesorder


CashReceiptEntryErroroncreditcardexpiredatewhencreditcardpaymentis
10.1.600 FinancialManagement AccountsReceivable 78617 Application notbeingused
InvoiceEntryARMiscChargefrequencyasLastisaddedtoalltheinvoicesfrom
10.1.600 FinancialManagement AccountsReceivable 84915 Application theorder
ProcessFinance/LateChargeCalculatechargeamountbasedonremainingInvoice
10.1.600 FinancialManagement AccountsReceivable 129255 Application Balance
10.1.600 FinancialManagement AccountsReceivable 175766 Application InvoiceEntryARIncorrectUOMconversiondisplayedinEditList

10.1.600 FinancialManagement AccountsReceivable 177731 Application ProcessFinance/LateChargeErrorwhenclickingnewbuttontwiceinFiltertab


PaymentInstrumentReceivableStatusFieldonGroupgriddoesnotshowthe
10.1.600 FinancialManagement AccountsReceivable 177854 Application statusforthefirstPIwhenyouhavemorethanone

10.1.600 FinancialManagement AccountsReceivable 177945 Application CashReceiptsEditListMultibookCashreceiptisnotprintedcorrectlyinEditList

10.1.600 FinancialManagement AccountsReceivable 179709 Application InvoiceEntryARIncorrectindicatoranddiscountsignforCorrectionInvoice


PaymentInstrumentReceivableMultipleissueswithduplicatedPayment
10.1.600 FinancialManagement AccountsReceivable 180707 Application instrumentsIDs
InvoiceEntryARWhencreatingaCreditMemo,ifyouenteraSalesOrdernumber
10.1.600 FinancialManagement AccountsReceivable 183266 Application theLockoptionbecomesgreyedout
PaymentInstrumentStatusChangeIncorrectinvoicebalanceafterOnAcccountPI
10.1.600 FinancialManagement AccountsReceivable 183498 Application StatusChangefromportfoliotounapproved
InvoiceEntryAREOMTermsdonotcalculateduedatecorrectlywheninvoicedate
10.1.600 FinancialManagement AccountsReceivable 183824 Application fallsonthe31st
10.1.600 FinancialManagement AccountsReceivable 184108 Application InvoiceEntryARARInvoicedoesnotdeafaulttoPaymentMethod
CashReceiptEntryBaseamountinCashReceiptEntryisnotupdatedwhenuser
10.1.600 FinancialManagement AccountsReceivable 184245 Application updatestheexchangerate
CashReceiptEntryAllocatedamountisrecalculatedandUnappliedfieldisblank
10.1.600 FinancialManagement AccountsReceivable 184246 Application foraninvoiceselectedtooveparpaid
CashReceiptEntryVariancesaregeneratedduetoBaseCurrenybeingupdated
10.1.600 FinancialManagement AccountsReceivable 184508 Application whenchangingthesettlementamount
CustomerCreditManagerCorrectordertotalopencountandcreditamount
10.1.600 FinancialManagement AccountsReceivable 184639 Application calculations
CashReceiptEntryApplieddebitnotesarecreatedwithincorrectinvoiceNumber
10.1.600 FinancialManagement AccountsReceivable 184690 Application andInvoiceReference

Page6
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


InvoiceEntryARMiscandCancellationInvoicesdonotupdatecorrectlythe
AllocatedCashDepositandRemainingCashDepositamountsfortheir
10.1.600 FinancialManagement AccountsReceivable 184704 Application correspondingSalesOrder
10.1.600 FinancialManagement AccountsReceivable 185373 Application InvoiceEntryARInactivecontractlinesshowonprintedinvoice
InvoiceEntryARAdvanceBillingInvoicecreatedwithIntercompanySalesOrder
10.1.600 FinancialManagement AccountsReceivable 185406 Application causesanerroronMultiCompanyLog
InvoiceTrackerARErrorwhenretrievinganinvoicecreatedwhenOnAccountPIis
10.1.600 FinancialManagement AccountsReceivable 185567 Application posted

InvoiceEntryARMiscInvoicesdonotupdatetheAllocatedCashDepositsamounts
10.1.600 FinancialManagement AccountsReceivable 185650 Application correctlywhentheLessCashDepositisnotfullyappliedintheinvoice
InvoiceEntryARTaxesforShipmentInvoicearenotcalculatedautomaticallywhen
10.1.600 FinancialManagement AccountsReceivable 185790 Application settingTaxLiabilityonSO
ReminderLetterGenerationSystemgeneratesremindersforInvoicesthathave
10.1.600 FinancialManagement AccountsReceivable 186179 Application lessDaysPastDuethanthefirstsequencedefined
VATTaxJournalReportReportdoesnotshowinvoicenumberbutitshows
10.1.600 FinancialManagement AccountsReceivable 186304 Application numbersequence
PaymentInstrumentReceivableSearchFormallowsselectionofaPIGeneratedon
10.1.600 FinancialManagement AccountsReceivable 186575 Application ARInvoicethatwasnotposted
CashReceiptEntryUnallocatingcreditmemoandclickingRefreshcausescurrency
10.1.600 FinancialManagement AccountsReceivable 186840 Application exchangeerror
CustomerCreditManagerZerodollarsaleordersdonotshowinCustomerCredit
10.1.600 FinancialManagement AccountsReceivable 186912 Application Manager

10.1.600 FinancialManagement AccountsReceivable 186971 Application PaymentInstrumentReceivablePaymentInstrumentcannotbecreatedinEWA


InvoiceEntryARRelatedPCIDrecordsshouldnotbedeletedormoveditshistory
10.1.600 FinancialManagement AccountsReceivable 187001 Application untiltheinvoiceisposted
ARInvoiceBalanceReportOpeningBalanceTotalisaddedoneveryTotalFor
10.1.600 FinancialManagement AccountsReceivable 187074 Application Currencyline
CashReceiptEntryErrordisplaysandyoucannotreverseadepositpaymentthat
10.1.600 FinancialManagement AccountsReceivable 187096 Application hasnotbeenappliedyet
OpenInvoiceLoadARIncorrectInvoiceandBalanceAmountafterpastingfrom
10.1.600 FinancialManagement AccountsReceivable 187097 Application Excel
10.1.600 FinancialManagement AccountsReceivable 187116 Application InvoiceEntryARIntrastatIncorrecthandlingofSalesKitsandweight
PaymentInstrumentStatusChangeChangingbetweenstatuswithsameGL
10.1.600 FinancialManagement AccountsReceivable 187243 Application ControldoesnotupdatetheAPPIHeaderStatus
10.1.600 FinancialManagement AccountsReceivable 187279 Application CashReceiptEntryInvoiceUnpostedbalancedisnotcalculatedcorrectly
CustomerStatementsAmountsforUnappliedPaymentInstrumentarenotshown
10.1.600 FinancialManagement AccountsReceivable 187329 Application whenfilteredbyDueDate

Page7
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


CustomerStatementsChargeoftheInvoiceforCancelledPaymentInstrumentsis
10.1.600 FinancialManagement AccountsReceivable 187348 Application notshown
PaymentInstrumentReceivableInvoicesassignedtoGeneratedPIsarenot
10.1.600 FinancialManagement AccountsReceivable 187381 Application displayedfornewPis
ApplyCreditMemoUnbalancetransactionsaregeneratedapplyingCancellation
10.1.600 FinancialManagement AccountsReceivable 187413 Application InvoiceusingfixedvalueTaxType
CashReceiptEntryInvoiceselectiontabshowstheSoldToinvoicesinsteadtheBill
10.1.600 FinancialManagement AccountsReceivable 187430 Application Toinvoices
AgedReceivablesInvoicesinforeigncurrenciesaredisplayingincorrectamount
10.1.600 FinancialManagement AccountsReceivable 187448 Application undertheFuturecolumn
InvoiceEntryARPaymentInstrumentdeletedwhenseveralinvoicesarecreated
10.1.600 FinancialManagement AccountsReceivable 187454 Application withPaymentMethodGeneratePIatinvoiceentry
ARInvoiceBalanceReportIncorrectclosingbalance,paymentsarenotbeing
10.1.600 FinancialManagement AccountsReceivable 187496 Application applied
AdvanceBillingDepositBalanceErrorshowswhenthereisacancellationinvoice
10.1.600 FinancialManagement AccountsReceivable 187510 Application forashipmentinvoicewithlessadvanceamount
ARInvoiceBalanceReportPaymentcreatedwhendebitisappliedbutaninvoiceis
10.1.600 FinancialManagement AccountsReceivable 187547 Application notdisplayedonthereport
InvoiceTrackerARUnappliedReceiptEpishapeshoulddisplayifitcomesfrom
10.1.600 FinancialManagement AccountsReceivable 187587 Application CashReceiptorPaymentInstrumentonaccount
InvoiceEntryARPartwithoutTaxCategoryassigneddonotdefaultinTaxcategory
10.1.600 FinancialManagement AccountsReceivable 187655 Application ofInvoiceLine
InvoiceEntryARBlanksalespersononCustomerEntrycauseserrorwhencreating
10.1.600 FinancialManagement AccountsReceivable 187705 Application ContractBillingInvoice
InvoiceTrackerARError"Inputstringwasnotinacorrectformat"displayswhen
10.1.600 FinancialManagement AccountsReceivable 187706 Application aninvalidcharacterisenteredforinvoicenumber

10.1.600 FinancialManagement AccountsReceivable 187822 Application ReverseCashReceiptDoesnotvalidateTransactionalDocumentbeforereversing

10.1.600 FinancialManagement AccountsReceivable 187837 Application CashReceiptEntryShouldnotbepossibletoremovetransactiondocumenttype


ReverseCashReceiptWhenenteringaduplicatedLegalNumberthescreenclears
10.1.600 FinancialManagement AccountsReceivable 187838 Application out
10.1.600 FinancialManagement AccountsReceivable 187843 Application ARWriteOffandAdjustmentScreenisnot100%visible
ARInvoiceBalanceReportCreditMemoshowsasaCreditAmountforthecash
10.1.600 FinancialManagement AccountsReceivable 187880 Application transactiononthereport
10.1.600 FinancialManagement AccountsReceivable 187889 Application CashReceiptEntrySelfAssessmentTaxarecalculatedasinclusivetaxes
InvoiceEntryARLegalNumberwarningmissingifitisnotgeneratedbefore
10.1.600 FinancialManagement AccountsReceivable 187915 Application posting

Page8
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


InvoiceEntryARErrordisplaysininvoiceifSalesOrderisinsinglecurrencyand
10.1.600 FinancialManagement AccountsReceivable 188053 Application LockRateboxwasselected
PaymentInstrumentStatusChangeGridofSelectPIaddsanewrowwithblank
10.1.600 FinancialManagement AccountsReceivable 188066 Application informationwhenyoupressEnterkey
CashReceiptsEditListCADcurrencydoesnotgenereatethecorrectTransAmount
10.1.600 FinancialManagement AccountsReceivable 188148 Application ontheCashReceiptEditList
CustomerStatementsIncorrectAgingBuckettotaldisplaysafteradjustingDebit
10.1.600 FinancialManagement AccountsReceivable 188199 Application Note
InvoiceEntryARDropdownlistofDocumentTypedisplaysDocumentTypes
10.1.600 FinancialManagement AccountsReceivable 188655 Application definedforARInvoiceandCreditMemo
PaymentInstrumentReceivableGetunapprovedactionreplacedtheexistingPI
10.1.600 FinancialManagement AccountsReceivable 188678 Application alreadycreated
InvoiceEntryARIncorrectbehaviorwhenlocalcompanyisnotconfiguredfor
10.1.600 FinancialManagement AccountsReceivable 188774 Application Intrastat
SalesTaxARSalestaxreportshowsreportableamountdoubledforself
10.1.600 FinancialManagement AccountsReceivable 189002 Application assessmenttax
InvoiceEntryARPaymentInstrumentcanbesavedwithdifferentcurrencythan
10.1.600 FinancialManagement AccountsReceivable 189079 Application invoice
ARLetterOfCreditReportValue,Invoiced,OutstandingandUncommitted
10.1.600 FinancialManagement AccountsReceivable 189187 Application quantitiesshow5decimals
AdvanceBillingDepositBalanceDepositbillingisnotdisplayedaftercancelling
10.1.600 FinancialManagement AccountsReceivable 189248 Application ShipmentInvoice
10.1.600 FinancialManagement AccountsReceivable 189391 Application VATTaxIssueswhenthereportisprintedinotherformats
CashReceiptsTrackerUnappliedCashtransactionsareshownfordifferent
10.1.600 FinancialManagement AccountsReceivable 189477 Application customersonAllocationtab
ARInvoiceBalanceReportExcelDataOnlyshoulddisplaytheformatsimilarto
10.1.600 FinancialManagement AccountsReceivable 189505 Application Excel

10.1.600 FinancialManagement AccountsReceivable 189519 Application CashReceiptEntryAttachmentsoptionisnotavailblewhenaddingaDebitNote


InvoiceEntryAREntityGLCrecordisnotcreated,andInvoiceisnotcapturedinAR
10.1.600 FinancialManagement AccountsReceivable 189530 Application AgingReport
InvoiceEntryARContractBillingdoesnotmergecontractsforsamecustomerto
10.1.600 FinancialManagement AccountsReceivable 189574 Application oneinvoice
InvoiceEntryARInvoicecreatedwithGetDepositPayment,overridestheExchage
10.1.600 FinancialManagement AccountsReceivable 189612 Application Rateappliedinthepayment
CashReceiptEntryARCashReceiptEntrydoublestheordertotalwhencreatinga
10.1.600 FinancialManagement AccountsReceivable 189620 Application depositpayment
10.1.600 FinancialManagement AccountsReceivable 189709 Application CustomerStatementsExporttoExcelDataOnlynotformattedcorrectly

Page9
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


ARInvoiceBalanceReportLegalnumberforCashReceipttransactionislostwhen
10.1.600 FinancialManagement AccountsReceivable 189735 Application LegalnumberisgeneratedforReverseCashTransaction
InvoiceEntryARDepositInvoicedoesnotupdateSalesOrderDepositamountin
10.1.600 FinancialManagement AccountsReceivable 189754 Application reportingcurrencies
SalesTaxReportTaxamountisincorrectforinvoicewithAppliedDepositBilling
10.1.600 FinancialManagement AccountsReceivable 189755 Application andcancellationinvoice
InvoiceEntryARCosmeticIssuesinsidetheCreateCancellationorCorrection
10.1.600 FinancialManagement AccountsReceivable 189924 Application Invoiceform
ARPostedInvoiceUpdateErrordisplayswhenchangingtheDueDateofaninvoice
10.1.600 FinancialManagement AccountsReceivable 190062 Application withaLegalNumber
CashReceiptEntryIncorrectTotalAmountdisplayedwhenbankcurrencyisnot
10.1.600 FinancialManagement AccountsReceivable 190216 Application baseandsettleamountisdifferent
ProcessFinance/LateChargeInvoicesaregeneratedeveniftheamountisless
10.1.600 FinancialManagement AccountsReceivable 190325 Application thanlowestamounttocharge
InvoiceEntryARUnabletopostanInvoicewithalesscashdepositwherebothare
10.1.600 FinancialManagement AccountsReceivable 190335 Application inacurrencydifferentfrombase
InvoiceEntryARContractBillingEditListdislplaysExchangeRate=1wheninvoice
10.1.600 FinancialManagement AccountsReceivable 190346 Application isinforeigncurrency

10.1.600 FinancialManagement AccountsReceivable 190402 Application InvoiceEntryARMiscellaneousChargesarenotconvertedtoInvoicecurrency


OpenInvoiceLoadARTaxTypedropdownlistshowsallthetaxtypesforonetax
10.1.600 FinancialManagement AccountsReceivable 190408 Application liability
ARInvoiceBalanceReportSecondemptypagedisplayswithfewlinesinthefirst
10.1.600 FinancialManagement AccountsReceivable 190447 Application one
InvoiceTrackerARErrordisplaysaftertryingtoopenanInvoicethatdoesnot
10.1.600 FinancialManagement AccountsReceivable 190505 Application exists
CustomerCreditManagerOrderOpenCreditismiscalculatedwhenusedmulti
10.1.600 FinancialManagement AccountsReceivable 190617 Application currency
10.1.600 FinancialManagement AccountsReceivable 190692 Application CashReceiptEntryIncorrectInvoiceselection

10.1.600 FinancialManagement AccountsReceivable 190840 Application CustomerCreditManagerIncorrectorderamountsdisplaywithroundingsetup


10.1.600 FinancialManagement AccountsReceivable 190940 Application InvoiceEntryARIncorrectRoundingonInvoiceentry
CashReceiptEntryUnabletoselectotherbooksandtheiraccountsinMiscCash
10.1.600 FinancialManagement AccountsReceivable 191002 Application Receipt
InvoiceEntryARGroupFieldandExtAmountisnotpopulatedwhenpastinsert
10.1.600 FinancialManagement AccountsReceivable 191139 Application linesoccurs
VATTaxJournalReportDisplaysincorrectinformationregardingTaxwhenusing
10.1.600 FinancialManagement AccountsReceivable 191300 Application severalRateCodes

Page10
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description

InvoiceEntryARSalesOrderlinenumberandReleaseNumberfieldsarenot
10.1.600 FinancialManagement AccountsReceivable 191304 Application populatedontheCreditMemolineusingCopyInvoiceLineActionsoption

10.1.600 FinancialManagement AccountsReceivable 191331 Application VATTaxJournalReportShowsalltheJournalEntrytaxesasonlyonetransaction

10.1.600 FinancialManagement AccountsReceivable 191437 Application CashReceiptEntryUDfieldvalueisnotdisplayedinInvoiceSelectionGrid


InvoiceEntryARInvoiceforthesameperiodcannotbegeneratedagainafteran
10.1.600 FinancialManagement AccountsReceivable 191497 Application unpostedContractBillingInvoicehasbeendeleted
InvoiceEntryARTaxesinLine>DetailarenotdisplayedwhenReadytoCalculate
10.1.600 FinancialManagement AccountsReceivable 191520 Application issetmanually
InvoiceEntryARShipmentinvoicedoesnotdisplayamountswhenAdvanceBilling
10.1.600 FinancialManagement AccountsReceivable 191693 Application andSalesKitareused
CustomerStatementsDebitNotesnotappliedareignoredinFutureandBalance
10.1.600 FinancialManagement AccountsReceivable 191707 Application Due
PaymentInstrumentReceivableGroupfieldsdisplaythesumofPIsnomatterthe
10.1.600 FinancialManagement AccountsReceivable 191723 Application currencies
CashReceiptEntryDebitnoteDueDateisnotcopiedtoDebitNoteInvoiceDue
10.1.600 FinancialManagement AccountsReceivable 191724 Application Date
ARInvoiceBalanceReportB/FbalancesareaddingDebitnotesandURbalances
10.1.600 FinancialManagement AccountsReceivable 191811 Application afterReverse
ARInvoiceBalanceReportIncorrectclosingbalanceinadatepriortothereverse
10.1.600 FinancialManagement AccountsReceivable 191816 Application ofadebitnote

TaxReconciliationReportincorrectStartandEnddateswhenthefirstFiscalYearis
10.1.600 FinancialManagement AccountsReceivable 191880 Application setupwithdierenStartDateandEndDatestosubsequentyears
CashReceiptEntryAutomaticLegalNumberisgeneratingonlyonthefirstandlast
10.1.600 FinancialManagement AccountsReceivable 191949 Application payment
CashReceiptsEditListExchangeRatechangesifOnAccountisselectedonInvoice
10.1.600 FinancialManagement AccountsReceivable 191982 Application Payment
10.1.600 FinancialManagement AccountsReceivable 192014 Application SalesAnalysisTotalsareincorrectwhenusingNetpricing
CashReceiptsTrackerCustomerBalancedoesnotdisplayonA/RReceipt
10.1.600 FinancialManagement AccountsReceivable 192032 Application AllocationforDebitNote
InvoiceEntryARContractbillinggetstheTaxLiabilityfromtheCustomerinstead
10.1.600 FinancialManagement AccountsReceivable 192121 Application theShipTo
CashReceiptEntryBaseAmountisincorrectlycalculatedwhenconversionruleis
10.1.600 FinancialManagement AccountsReceivable 192128 Application inversefrombasetoforeign
CashReceiptEntryDiscountisthesameasReceiptAmountandtheAllocate
10.1.600 FinancialManagement AccountsReceivable 192144 Application amountisdoubled

Page11
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


InvoiceEntryARInvoiceheaderamountincreasesthetaxamountaftermodifying
10.1.600 FinancialManagement AccountsReceivable 192221 Application theinvoicelinetax
InvoiceEntryARChangingtheTaxLiabilitytoaCashDepositInvoicesendsa
10.1.600 FinancialManagement AccountsReceivable 192362 Application warningmessagetotheuser
InvoiceEntryARWhenaCreditMemoisprinteditdoesnotshowtheComponent
10.1.600 FinancialManagement AccountsReceivable 192729 Application foraSalesKitanditdisplaysanerror
CashReceiptEntryTaxisnotcalculatedproperlyafterpaymentwasmade,then
10.1.600 FinancialManagement AccountsReceivable 192836 Application reversethenapplyCM
VATTaxJournalReportInvalidgroupingrecordsbyTaxTran.TranNuminsteadof
10.1.600 FinancialManagement AccountsReceivable 192881 Application InvoiceNumber

10.1.600 FinancialManagement AccountsReceivable 192883 Application VATTaxJournalReportInvalidGLamountsforvoidedBankFeetransaction

10.1.600 FinancialManagement AccountsReceivable 192887 Application CashReceiptEntryHeaderCurrencyoftheBankBaseRateisincorrectlydisplayed


ApplyCreditMemoErrorwhenapplyingaCMtoaninvoicewithdepositamount
10.1.600 FinancialManagement AccountsReceivable 192968 Application duetoaddedtaxes
CashReceiptEntrySoldtoCustomerisbeinginterchangedbytheBilltoCustomer
10.1.600 FinancialManagement AccountsReceivable 193328 Application inthegrid
CashReceiptEntryWhenallcurrenciesonCashReceiptaredifferent,thebase
10.1.600 FinancialManagement AccountsReceivable 193442 Application amountiscalculatedincorrectly
ARReconciliationTrackerVarianceiscreatedforaperiodinopeningbalance
10.1.600 FinancialManagement AccountsReceivable 193722 Application withoutdifferenceinmovementamounts
CashReceiptEntryInvoicesfromParentarenotretrievedwhenit'schildhasa
10.1.600 FinancialManagement AccountsReceivable 193745 Application similarcustomernumber
CashReceiptEntryUnabletopostUnappliedAmountwhenamountis0inbase
10.1.600 FinancialManagement AccountsReceivable 193882 Application currency

10.1.600 FinancialManagement AccountsReceivable 194080 Application CashReceiptsEditListExchangeRateinreportdoesnotdisplay6decimals


PaymentInstrumentBatchGenerationPaymentInstrumentisblankafter
10.1.600 FinancialManagement AccountsReceivable 194219 Application PaymentsInstrumentBatchGenerationprocess;nothingispopulated
CashReceiptEntryARCashReceipterrorduetodiscountnotroundinginthe
10.1.600 FinancialManagement AccountsReceivable 194226 Application invoiceselectionsheetasitdoesforthedisplay
10.1.600 FinancialManagement AccountsReceivable 194439 Application InvoiceTrackerARErrorwhenprintingacopiedARFormReportStyle
10.1.600 FinancialManagement AccountsReceivable 194536 Application InvoiceEntryARUnabletocopyinvoicelinesdueUOMerror
InvoiceEntryARBaseEditListreportdoesnotprovideenoughroomforthedata
10.1.600 FinancialManagement AccountsReceivable 194625 Application displayedwithincertainfields

CustomerCreditManagerOrderTotalgoesnegativewhenmanuallyclosingan
10.1.600 FinancialManagement AccountsReceivable 194651 Application orderreleasewhentheorderhasbeenfullyshippedandinvoiced

Page12
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


InvoiceEntryARAbletoinvoiceagainapackingslipwithSalesKitthathasalready
10.1.600 FinancialManagement AccountsReceivable 194701 Application beeninvoiced

10.1.600 FinancialManagement AccountsReceivable 194758 Application ARInvoiceFormPrintInvoiceisnotprintingSerialNumbersforPackingSlips


ReverseCashReceiptFixProgramtoupdateincorrectInvcTaxrecordsforpartial
10.1.600 FinancialManagement AccountsReceivable 194829 Application payment
10.1.600 FinancialManagement AccountsReceivable 194899 Application ARInvoiceFormErrorwhenprintingARInvoiceformforProjectBilling
DepositSlipReportFormatdoesnotfitonanA4pageandthepageissplitover2
10.1.600 FinancialManagement AccountsReceivable 195124 Application pages
DepositSlipReportFormatdoesnotfitonanA4pageandthepageissplitover
10.1.600 FinancialManagement AccountsReceivable 195124 Application twopages
CashReceiptEntryCashHeadrecordsthatareconvertedfromV8toE10have
10.1.600 FinancialManagement AccountsReceivable 195230 Application emptyBankAcctID,CashBookNum,CashBookLine
InvoiceEntryAROurShipQtyisincorrectlycalculatedifshippingamanufactedpart
10.1.600 FinancialManagement AccountsReceivable 195296 Application withseveralUOMconversions
10.1.600 FinancialManagement AccountsReceivable 195409 Application InvoiceEntryAREndDatedoesnotworkforamortizationshedules
ARInvoiceBalanceReportCustomertotalsareincorrectwithB/Fandsortingby
10.1.600 FinancialManagement AccountsReceivable 195776 Application currency
InvoiceEntryARSeveralLegalnumberscanbeceatedforaninvoicewhenhaving
10.1.600 FinancialManagement AccountsReceivable 195794 Application noPartID
ARInvoiceFormPackNumandPacklinedonotretrievetheinformationfromthe
10.1.600 FinancialManagement AccountsReceivable 195797 Application shipment
InvoiceEntryARFinalshipmentinvoicedoesnotdebittheReversalTaxfromthe
10.1.600 FinancialManagement AccountsReceivable 196102 Application depositinvoice

10.1.600 FinancialManagement AccountsReceivable 196148 Application InvoiceEntryARDeferredRevenuedoesnotdefaultforDropShipmentInvoices


OpenInvoiceLoadARLoadingagroupwith5000+recordslockstheInvcHead
10.1.600 FinancialManagement AccountsReceivable 196181 Application tableandnootherusercanupdateInvcHeadrecords
InvoiceEntryARIndex0displayswhencreatingaCreditMemoafterPrintPreview
10.1.600 FinancialManagement AccountsReceivable 196254 Application InvoicewithLegalNumber
InvoiceEntryARErrordisplayswhencreatingadropshipmentinvoicethathas
10.1.600 FinancialManagement AccountsReceivable 196399 Application SalesOrderswithdifferentBillTo
InvoiceEntryARRevenuescheduleisnotset,andremainingamountisnotzero,
10.1.600 FinancialManagement AccountsReceivable 196666 Application butabletopostandprinteditlist
ProcessFinance/LateChargeNeedtomigrateLocaltablesusedfor10.1.500
10.1.600 FinancialManagement AccountsReceivable 196810 Application implementationto10.1.600
InvoiceEntryARError"UseAlternateBilltoCustomerID"isnotautomatically
10.1.600 FinancialManagement AccountsReceivable 197011 Application checkedforshipmentinvoices
10.1.600 FinancialManagement AccountsReceivable 197314 Application InvoiceEntryARErrordisplayedwithProjectBilling

Page13
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


InvoiceEntryARContractRenewalLinecreatedfor0amountwheninvoicing
10.1.600 FinancialManagement AccountsReceivable 197385 Application severalcontractrenewalsinforeigncurrency
InvoiceEntryARDocumentTypedoesnotchangeaccordinglytothecustomer
10.1.600 FinancialManagement AccountsReceivable 197884 Application selectedifnotallusersareauthorized
ARPostedInvoiceUpdateErrordisplayswhengeneratingtheamortization
10.1.600 FinancialManagement AccountsReceivable 198392 Application schedule
10.1.600 FinancialManagement AccountsReceivable 198655 Application AdjustmentARCannotadjustanegativeCreditMemo
PostingEngineSystemlockswhenmultipleautoinvoiceSO'sareprocessed
10.1.600 FinancialManagement AccountsReceivable 198698 Application concurrently

10.1.600 FinancialManagement AccountsReceivable 198727 Application VATTaxTaxReportEditListforaFilteredCustomerprintsunrelatedtransactions


10.1.600 FinancialManagement AccountsReceivable 199090 Application InvoiceEntryARIncorrectTaxLiabilityoninvoicefromaServiceCall
CommissionReportDoesnotcalculatecommissionforAdvancedBillingInvoices
10.1.600 FinancialManagement AccountsReceivable 199097 Application whenearnedatinvoice
CashReceiptEntryBaseamountcalculatedincorrectlywhenhavingaforeign
10.1.600 FinancialManagement AccountsReceivable 199134 Application settlementcurrency
10.1.600 FinancialManagement AccountsReceivable 199254 Application ARInvoiceFormSingleTaxCodewith0%doesnotdisplay
PrintPettyCashDayBookWhenreportisprintedin'Official'mode,the'Closed
10.1.600 FinancialManagement CashManagement 161801 Application CashDays'areincludedinreport
10.1.600 FinancialManagement CashManagement 164504 Application PettyCashEntrySeveralIssueswithPettyCashentry
PaymentMethodSpellingmistakeinerrormessage"Paymentmethodidis
10.1.600 FinancialManagement CashManagement 176519 Application requiered."
BankAccountTrackerAdjustmentsarenotreflectedfortheyearpostedin
10.1.600 FinancialManagement CashManagement 181436 Application Balance;onlyfortheCurrenctdate
PettyCashEntry(EWA)PettyCashentryErrorduringenterPettyCashdocument
10.1.600 FinancialManagement CashManagement 183770 Tools viaEWA
10.1.600 FinancialManagement CashManagement 184295 Tools PaymentMethodEWAunabletoselectapathforoutputfile
BankStatementProcessingEditListreportshouldcontain0forAPPaymentswith
10.1.600 FinancialManagement CashManagement 185479 Application 0amount

10.1.600 FinancialManagement CashManagement 186394 Application BankAccountTrackerReverseamountisnotreflectedontheBankBalance


BankStatementProcessingBankamountgetsrecalculatedwhenchanging
10.1.600 FinancialManagement CashManagement 186631 Application exchangerateforforeigncurrency
BankAdjustmentEntryAfterselectingandsavingtheRedStornocheckboxofa
10.1.600 FinancialManagement CashManagement 187493 Application groupalreadysaved,anerrordisplays
PettyCashEntryNewAPInvoicePaymenterror:Objectreferencenotsettoan
10.1.600 FinancialManagement CashManagement 187530 Application instanceofanobjectexceptionusingforeigncurrency
10.1.600 FinancialManagement CashManagement 187544 Application SSRSPayrollCheckRegisterReportIssuewithstaticvariables

Page14
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


BankStatementProcessingBankstatementmanualunmatchingforARReceipts
10.1.600 FinancialManagement CashManagement 188029 Application takesalongtimewhentherearemanyopenreceipts
BankAdjustmentEntryGLAccountcontrolworksincorrectlywithmappedbooks
10.1.600 FinancialManagement CashManagement 188476 Application inTransactionType
PettyCashMismatchofApplyDateandFiscalPeriodwhilemakingPattyCash
10.1.600 FinancialManagement CashManagement 189006 Application entries
10.1.600 FinancialManagement CashManagement 189230 Application BankStatementProcessingUnabletodeleteBankStatement
SSRSPettyCashEditListReportAmountsonreportdisplay5decimals.Company
10.1.600 FinancialManagement CashManagement 189591 Application andCurrencyareconfiguredtoshow2.
10.1.600 FinancialManagement CashManagement 189750 Application BankStatementProcessingEditList:incorrectVariance(0.01difference)
10.1.600 FinancialManagement CashManagement 190539 Application PettyCashEntryUnabletocreatepettycashduetoerror
BankStatementProcessingTolerancecheckisnotexecutedduringthenext
10.1.600 FinancialManagement CashManagement 190682 Application matchingifthefirstmatchedtransactionsuitstolerancecondition

10.1.600 FinancialManagement CashManagement 191349 Application BankAdjustmentEntryItispossibletoremoveTransactionDocumentType


BankFundsTransferPostExchangeDifferenceruleofBankFundsTransferdoes
10.1.600 FinancialManagement CashManagement 191602 Application notfillinDebit/CreditContextsinTranGLC
10.1.600 FinancialManagement CashManagement 191842 Application PettyCashEntryRestrictfromenteringmultiplebankfeesinPettyCash

10.1.600 FinancialManagement CashManagement 192104 Application BankStatementProcessingCreateautorunconversionforbankstatements

10.1.600 FinancialManagement CashManagement 192274 Application PettyCashMiscEmployeeAdvancedoesnotdefaultEmployee'sAdvancesaccount


BankStatementProcessingUnabletopostwhenhavingPIforARInvoicewith
10.1.600 FinancialManagement CashManagement 192393 Application witholdingtaxes
BankReceiptFileImport(AR)SystemdoesnotkeeptheOnAccountflagonce
10.1.600 FinancialManagement CashManagement 192514 Application processed
BankReceiptFileImport(AR)NorecordswereshowninImportedPaymentsand
10.1.600 FinancialManagement CashManagement 192930 Application ImportDetailtabafterasuccessfullimport
BankStatementProcessingTranrefvalueisnotusedwiththetranslationwhenthe
10.1.600 FinancialManagement CashManagement 193406 Application languageischanged
BankStatementProcessingIncorrectExchangeRateusedwithabankinaforeign
10.1.600 FinancialManagement CashManagement 195247 Application currency
BankStatementProcessingEditListdoesnotprintOutstandingItemsifStatement
10.1.600 FinancialManagement CashManagement 195276 Application hasnolines
DepositSlipReportErrorifBankAccountinReportOptionspartwasinsertedby
10.1.600 FinancialManagement CashManagement 196370 Application hand
BankStatementProcessingStandardWellsFargobankstatementEIdoesnot
10.1.600 FinancialManagement CashManagement 196688 Application importline'sBankReference

Page15
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


BankStatementProcessingIfAPbatchisexpandedandtheusermatchesits
Paymentsasseparatedocuments,thesePaymentsdon'tgenerateGLtransactiions
10.1.600 FinancialManagement CashManagement 199826 Application whenBankStatementisposted

10.1.600 FinancialManagement CashManagement 200227 Application BankStatementProcessingUnabletocreatelinesonBankstatementprocessing


BankReferenceNumberisnotincludedinSEPApaymentfileifPaymentReference
10.1.600 FinancialManagement CSFAll 187777 Application ismissingoninvoice
CSFCzechAPInvoiceTrackerCzechlayershoulddisplayTransactionType
10.1.600 FinancialManagement CSFAll 188814 Application descriptioninsteadofcode
CSFAU,MY,NZCustomerStatementDepositInvoicesandAppliedDepositsare
10.1.600 FinancialManagement CSFAll 192719 Application displayedwithincorrectsigns
BankPaymentConfirmationImportImportedPaymentsgridcontainslocalization
10.1.600 FinancialManagement CSFAll 194551 Application fieldsfromAPPaymentEntry
10.1.600 FinancialManagement CSFArgentina 195496 Application CancellationinvoiceshowsoriginalinvoiceinformationunderLOCtab
10.1.600 FinancialManagement CSFArgentina 195514 Application Dropshipmentinvoicedoesnotshowdocumentletterinfo
Withholdingtaxdefinedasfirstpayment,doesnotpullcorrectTaxExempt
10.1.600 FinancialManagement CSFArgentina 198813 Application PercentageaccordingtoPaymentDate
10.1.600 FinancialManagement CSFAustralia 192187 Application SomeissuesonARFormincaseofMiscChargesareused
RemittanceAdviceBSBnumberandVendorCodeareincorrectformultiple
10.1.600 FinancialManagement CSFAustralia 192389 Application payments
10.1.600 FinancialManagement CSFAustralia 195100 Application IncorrectfieldisusedforcurrencyvalidationinABApayment
GoldenTaxInterfaceGross,NetandTaxamountsarecalculatedusingtoday's
10.1.600 FinancialManagement CSFChina 189562 Application EffectiveRatenotfromInvoice

10.1.600 FinancialManagement CSFChina 190113 Application BookingVoucherFCCNInvalidExchangeRateisprintedforARInvoicetransaction


GeneralLedgerCNIncorrectresultprintedwhenaDynamicSegmentAccount
10.1.600 FinancialManagement CSFChina 192190 Application incurred
BookingVoucherFCLineswithzerobookamountshouldbeprintedwithcorrect
10.1.600 FinancialManagement CSFChina 193769 Application documentamounts
10.1.600 FinancialManagement CSFChina 194143 Application ErrormessagewhenprocessingEFTFiledoesnotgenerate
10.1.600 FinancialManagement CSFChina 197284 Application StockAgingreportErroroccursifoutputformatisExcelorWord
GeneralLedgerReportPreviewingtakesmorethan10hourstocompletewhen
10.1.600 FinancialManagement CSFColombia 189649 Application selectsinglefiscalperiodduetofilterfunctionality
10.1.600 FinancialManagement CSFColombia 191610 Application UpdateCOS&WIPpostingrule
10.1.600 FinancialManagement CSFEstonia 195815 Application SEPAformatisnotcorrectforEstoniaSwedbankforcredittransfers
10.1.600 FinancialManagement CSFEuropeanUnion 185611 Application SemicoloncannotalwaysbeusedforSEPAremittanceinformation

10.1.600 FinancialManagement CSFEuropeanUnion 189960 Application IntrastatExportWithoutdefinedEIproperties,propertiesstillappearatexport


10.1.600 FinancialManagement CSFEuropeanUnion 190116 Application IntrastatExportEIpropertiescannotbeusedwithdecimalsatexport

Page16
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


10.1.600 FinancialManagement CSFEuropeanUnion 192808 Application SEPASCTpaymentsfailsduetoincorrectelementusage

10.1.600 FinancialManagement CSFEuropeanUnion 196034 Application ChargebearerisincorrectlySLEVinsteadofDEBTforEuropaymentsoutsideEU


10.1.600 FinancialManagement CSFFinland 188979 Application EIgeneratesfilesthoughbusinesserrorhasbeenraised
10.1.600 FinancialManagement CSFGermany 192922 Application CustomerMaintenancewindowhasincorrectheadername
DataExportToolGetEIMetadata()ofsomeDataExportEIsreturnsunusedor
10.1.600 FinancialManagement CSFGermany 198480 Application incorrectlytypedparametersQAforCSFGermany

10.1.600 FinancialManagement CSFGermany 199368 Application DataExportDatefieldsarenotexportedcorrectlyinGDPdUTaxDataExtract


DataExportInAPInvoiceDetails_DE.csvthecolumnforApplyDate,instead
10.1.600 FinancialManagement CSFGermany 199370 Application containsinformationfromthe5thcolumn
10.1.600 FinancialManagement CSFJapan 193346 Application NeedtheZenginoutputfileinANSIinsteadofUTF8
10.1.600 FinancialManagement CSFJapan 195803 Application ARBillingStatementformhasPeriodicBillingcolumnempty

10.1.600 FinancialManagement CSFJapan 195930 Application PaymentEntryZenginEFTAPpaymentfileshoulddisplaybankaccountnumber

10.1.600 FinancialManagement CSFJapan 196427 Application ARPeriodicBillingSetupNovalidationonemptyvalueforDueDateCriteria


RawMaterialMovementQtyAdjustmenttransactionsarenotprintedindetails
10.1.600 FinancialManagement CSFMalaysia 192174 Application columns
DataExportMYSortingordershouldbechangedinPurchases,Suppliesand
10.1.600 FinancialManagement CSFMalaysia 192417 Application LedgerEntryexportfiles
CancellationofARInvoicewithMisc.ChargesstopsprocessingifDigitalTaxReceipt
10.1.600 FinancialManagement CSFMexico 186439 Application isdisabled
10.1.600 FinancialManagement CSFMexico 186936 Application ARInvoiceEntryCannotcreateanAdvanceBillingwith3decimals
ElectronicAccountingGLJournalsMXreportshowsincorrectsignwhenaccount
10.1.600 FinancialManagement CSFMexico 190203 Application natureisA(Credit)
10.1.600 FinancialManagement CSFMexico 193245 Application ARCMforPartialpaymentshouldaddUUIDonOriginalFoliofield
10.1.600 FinancialManagement CSFMexico 193252 Application ARCancellationInvoicegeneratesDigitalTaxReceipt
DTRIt'snecessarytosumthediscountandadvancebillinginthesame
10.1.600 FinancialManagement CSFMexico 193982 Application <descuento>node
10.1.600 FinancialManagement CSFNetherlands 199491 Application CSFNetherlandsSEPAfilenotvalidforbank
10.1.600 FinancialManagement CSFNorway 190897 Application EWA:CompanyConfigurationformdoesnotdisplaydata

10.1.600 FinancialManagement CSFNorway 192172 Application TelepayBankImportcausesrejectedpaymentstoremaininTransmittedStatus


TelepayBankImport:ExtramessageincaseofimportingR1filewitherrorsinbatch
10.1.600 FinancialManagement CSFNorway 194647 Application lines

PaymentimportfailswhenExchangeRateontransferreddateisthesameas
10.1.600 FinancialManagement CSFNorway 201069 Application ExchangeRateofinvoicebutdiffersfromExchangeRateonrequestpaymentdate

Page17
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description

10.1.600 FinancialManagement CSFNorway 201075 Application Forprepaymentsamountsandgain/lossarenotrecalculatedontransferreddate


UnabletoselectAllowchangeafterprintedoptiononLegalNumberwhenselecting
10.1.600 FinancialManagement CSFPeru 189658 Application ARBoEtype

10.1.600 FinancialManagement CSFPeru 196563 Application MultipleBillofExchangegenerationincorrectlysplitsinvoicesamountamongBoEs


MultipleBillofExchangegenerationdoesnotwarniftheuserentersDueDate
10.1.600 FinancialManagement CSFPeru 196637 Application earlierthanadefaultBoEInvoiceDate
10.1.600 FinancialManagement CSFPoland 189456 Application APInvoiceformhasincorrectsize
10.1.600 FinancialManagement CSFSweden 186289 Application GLExportProcessIssueswithexportfileextensionandfileformat
10.1.600 FinancialManagement CSFSweden 193943 Application CannotexportAPpaymentfileinANSIformatasrequiredbythebank
10.1.600 FinancialManagement CSFSweden 195547 Application SEPACreditTransfermessageismissingRegulatoryreportingcode
10.1.600 FinancialManagement CSFTaiwan 187805 Application InvoiceEntryAPGUITaxTypecannotbeassignedforDMRDebitMemo
InvoiceEntryAPContextmenusearchshouldbeaddedforGUITaxTypeCodeand
10.1.600 FinancialManagement CSFTaiwan 188187 Application GUIDeductionCode
LegalNumberisnotassignedautomaticallyforDebitMemoif'DefaultAPInvoice
10.1.600 FinancialManagement CSFTaiwan 189019 Application Number'isselectedassource
ARInvoiceEntryGUITaxType,GUIFormatCodeandGenerationTypearenot
10.1.600 FinancialManagement CSFTaiwan 200554 Application loaded
MonthlyVATReportInvoiceswiththesameInvoiceNumberandInvoiceDateare
10.1.600 FinancialManagement CSFThailand 196374 Application collapsed
StockCardReportshowszerocostifcheckonoption"IncludePartswithout
10.1.600 FinancialManagement CSFThailand 198753 Application Transactions"
10.1.600 FinancialManagement CSFVietnam 147131 Application Postingrulesneedtobeuplifted
10.1.600 FinancialManagement CSFVietnam 180430 Application FinancialReportVNdoesnotreturndataforcorrespondingaccounts
10.1.600 FinancialManagement CSFVietnam 190395 Application CashinBankreportSeveralcosmeticissues:missinglabelandcolons
10.1.600 FinancialManagement CSFVietnam 190397 Application GeneralLedgerreportfailswithnullreferenceexceptiononsomeranges
PostingEngine:ErroringeneratedcodeafterRevisionActivation.Activationis
10.1.600 FinancialManagement CSFVietnam 191339 Application impossible
10.1.600 FinancialManagement CSFVietnam 191722 Application FinancialReportVNAmountiszerowhenprintingaSpecificSegment

10.1.600 FinancialManagement CSFVietnam 193889 Application GeneralLedgerreportFilterGLAccountSearchloadslatestselectedAccountonly


10.1.600 FinancialManagement CSFVietnam 193956 Application GeneralLedgerVNYearSuffixshouldbeaddedasparameterforselection
GeneralLedgerVNSortingshouldbedonebyDate,JournalNumber,Document
10.1.600 FinancialManagement CSFVietnam 196969 Application Number
10.1.600 FinancialManagement CSFVietnam 197048 Application GLGroupshouldhaveatleastonelinewithtype1
10.1.600 FinancialManagement CSFVietnam 197072 Application GLRevaluationpostingcreatescorrespondinglinesincorrectlygrouped

10.1.600 FinancialManagement CSFVietnam 197078 Application CorrespondenceaccountsrulesvalidationismissingifpostingisdonethroughRJ

Page18
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


10.1.600 FinancialManagement CSFVietnam 198879 Application Correspondenceaccountingvalidationruledoesnottriggerinsomecases
Correspondenceaccountingvalidationstopspostingifselfbalancingissetupdueto
10.1.600 FinancialManagement CSFVietnam 198881 Application incorrectgrouping
CurrencyRevaluationProcessProcessonSystemMonitorisshownasthereport
10.1.600 FinancialManagement CurrencyManagement 176278 Application insteadoftheprocess
10.1.600 FinancialManagement CurrencyManagement 179865 Application CurrencyMasterDeletebuttonisnotvalidatedwhentherearenorecords
RateGroupRateTypecannotbelinkedwhenlinkingtoonethatdoesn'thave
10.1.600 FinancialManagement CurrencyManagement 181782 Application Rulesdefined
10.1.600 FinancialManagement CurrencyManagement 182975 Application RateTypeMostfieldstobedisabledforlinkedRateType
CurrencyRevaluationProcessBankRevaluationcannotshowthecorrectoldrate
10.1.600 FinancialManagement CurrencyManagement 186196 Application inRevaluationReportbutthegain/losscalculationiscorrect
RateTypeWhenLinkingRateTypetoglobalratetype,itisnotverifiedthat
10.1.600 FinancialManagement CurrencyManagement 186388 Application ConversionRulesandExchangeratesalreadyexist
CurrencyRevaluationProcessSystemispickingtheincorrectreversalGLAccount
10.1.600 FinancialManagement CurrencyManagement 189403 Application ContextforImmediatereverseAPInvoiceRevaluation
CurrencyRevaluationProcessUpdateprogramisneededtoremoveunposted
10.1.600 FinancialManagement CurrencyManagement 190634 Application unnecessaryrecords
CurrencyRevaluationProcessBankadjustmentrevaluationpickstheincorrect
10.1.600 FinancialManagement CurrencyManagement 191669 Application reversalGLAccountContextforImmediatereverse

10.1.600 FinancialManagement CurrencyManagement 192031 Application CurrencyRevaluationProcessNorecordselectedwheninvoicehasDepositBilling


CurrencyRevaluationProcessNorecordselectedisdisplayedwhenthereisstilla
10.1.600 FinancialManagement CurrencyManagement 193469 Application CMbalancepending
CurrencyRevaluationProcessPettyCashBalancesarenotusingthecorrect
10.1.600 FinancialManagement CurrencyManagement 193599 Application exchangerateandarenotupdatedproperly
ARInvoiceRevaluation(NoReverse)Journallinesfordifferentperiodsare
10.1.600 FinancialManagement CurrencyManagement 197007 Application combinedintooneJournalNuminReviewJournal
EndActivityProcessdoesnotcorrectlycalculateLaborHrsforproductionactivity
10.1.600 FinancialManagement DeferredRevenueAccou 185773 Application withdowntimerecords
DeferredRevenueRecognitionRevenueAmountfieldshowsincorrectamountin
10.1.600 FinancialManagement DeferredRevenueAccou 188868 Application RevenueRecognition
10.1.600 FinancialManagement DeferredRevenueAccou 189117 Application DRAForecastReportOnlyOnHoldOptiondisplaysthereportinblank
RevenueRecognitionOnlyonejournaliscreatedwithapplyday='SelectedDate'
10.1.600 FinancialManagement DeferredRevenueAccou 189222 Application fordistinctscheduledlines
10.1.600 FinancialManagement FixedAssets 117237 Application AssetGroupUnabletoenterAssetGroupsusingcopy/pastefromExcel
AssetTrackerBookValuecalculationshouldbechangedtologicimplementedon
10.1.600 FinancialManagement FixedAssets 148497 Application RevaluationformifGrantisused
AssetDepreciationRecalculationDepreciationFormuladoesnotsupportall
10.1.600 FinancialManagement FixedAssets 171975 Application availableFunctions

Page19
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description

10.1.600 FinancialManagement FixedAssets 178295 Application SpreadCodeNoerrorappearswhenuserimportsspreadcodewithoutCodeId


AssetDisposalEntryCannotdiposeanassetifcostwasaddedbyRevalutionand
10.1.600 FinancialManagement FixedAssets 179284 Application noAdditionswereposted
HelplinkFromAssetDepreciationreportopensSelectedFieldsforAsset
10.1.600 FinancialManagement FixedAssets 187863 Application DepreciationCalculationincorrectly
ValidAssetTransferDisposalAppearsinReviewJournalwithstatusAbortedand
10.1.600 FinancialManagement FixedAssets 187975 Application cannotbeconfirmedtoGL
AssetPostingProcess'ByApplyDate'modecreatesincorrectReviewJournalif
10.1.600 FinancialManagement FixedAssets 188118 Application AssethasRevaluation
TransactionsSeveralcostaffectingtransactionspostedsimultaneouslydonot
10.1.600 FinancialManagement FixedAssets 189389 Application appearinthesameReviewJournal;lockingisincorrect

10.1.600 FinancialManagement FixedAssets 189714 Application AssetDepreciationReportExporttoExcelDataOnlynotformattedcorrectly

10.1.600 FinancialManagement FixedAssets 189715 Application AssetDepreciationForecastExporttoExcelDataOnlynotformattedcorrectly


10.1.600 FinancialManagement FixedAssets 189717 Application AssetEditListExporttoExcelDataOnlynotformattedcorrectly

10.1.600 FinancialManagement FixedAssets 189720 Application AssetAnnualScheduleReportExporttoExcelDataOnlynotformattedcorrectly


AssetPostingProcessImpairmentpostingcauseserror"Attempttolockrecords
10.1.600 FinancialManagement FixedAssets 190980 Application withnotransaction"
AssetAnnualScheduleReportOpeningYearNetBookValueshowsnegative
10.1.600 FinancialManagement FixedAssets 191862 Application amountonAssetAnnualSchedulereport
10.1.600 FinancialManagement FixedAssets 193543 Application AssetAdditionEntryErrorsfoundforAssetAdditionandDisposalEntry
AssetDepreciationRecalculationCalculationdoesnotstopcorrectlywithaperiod
10.1.600 FinancialManagement FixedAssets 195788 Application baseddepreciationmethod

10.1.600 FinancialManagement FixedAssets 197755 Application AssetDepreciationForecastDisplaysdisposedAssetswithB/Fnegativevalues


AssetDisposalEntryDoesnotreversedepreciationamountandcausesnegative
10.1.600 FinancialManagement FixedAssets 198397 Application bookvalue
AutomaticTransactionReversalCannotloadrecordsduetoanerrorinFiscal
10.1.600 FinancialManagement GeneralLedger 146398 Application Calendar;doesnotcreatecurrentyear
FiscalCalendarAbletosetupnewFiscalYearwithouthavingtodeleteyears
10.1.600 FinancialManagement GeneralLedger 151376 Application alreadysetup
AllocationCodDefaultvalueforBAQparametersshouldbefilledifdefinedthem
10.1.600 FinancialManagement GeneralLedger 157925 Application inBAQ
DailyandCurrencyBalancesNeedtobecorrectlymovedfromIStoREbyTransfer
10.1.600 FinancialManagement GeneralLedger 167766 Application OpeingBalancesandVerifyBalances
10.1.600 FinancialManagement GeneralLedger 169309 Application GLControlCodeEWACannotselectadifferenttypeofcontrolcode

Page20
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


GLControlCodeEWAWhenopeningGLControlMaintenancefromPettyCash
10.1.600 FinancialManagement GeneralLedger 169313 Application withrightclickitdoesnotopen
ExportBudgetsEWAUnabletoexportbudgetsduetofilepathwhichcannotbe
10.1.600 FinancialManagement GeneralLedger 172453 Application selected
ChartTrackerPartCostTransactioncreditamountshavewrongsigncausing
10.1.600 FinancialManagement GeneralLedger 175948 Application incorrectsummarization

10.1.600 FinancialManagement GeneralLedger 176929 Application GeneralLedgerAccountTabsequenceisincorrectonGenerateAccountswindow

10.1.600 FinancialManagement GeneralLedger 176940 Application GeneralLedgerAccountTabsequenceisincorrectonDeleteAccountswindow


GeneralLedgerReportandGeneralLedgerAccountSummaryReportDonotprint
10.1.600 FinancialManagement GeneralLedger 177319 Application detailsifBalancecombinationdiffersfromFullAccount
ChartofAccountsRunVerifybalancesEpiShapeshouldnotappearforCOAhaving
10.1.600 FinancialManagement GeneralLedger 177822 Application notransactionspostedintoBooklinked
10.1.600 FinancialManagement GeneralLedger 178034 Application GeneralLedgerReportPrintDetailsflagworksincorrectlyinEWA
10.1.600 FinancialManagement GeneralLedger 178261 Application VerifyBalancesFailsifREaccounthasmaskedDynamicsegment
DatabasePurgeandSummarizeSomerecordsarenotsummarizedafterJournals
10.1.600 FinancialManagement GeneralLedger 178937 Application Purge
BookClearing/Changing/LoadingofREaccountcausesApplicationerrorifCOAhas
10.1.600 FinancialManagement GeneralLedger 179664 Application Dynamicsegment

10.1.600 FinancialManagement GeneralLedger 179965 Application PostingEngineBookMapping:targetaccounthasstatUOMfromsourceaccount


GeneralLedger/AccountSummaryReportsErrorwhenaddingNamedSearchon
10.1.600 FinancialManagement GeneralLedger 180741 Application SegmentSearches
GenerateAllocationsUsingmultiplesourceaccountswithanoffsetaccount
10.1.600 FinancialManagement GeneralLedger 184267 Application generatesincorrectallocation
10.1.600 FinancialManagement GeneralLedger 184401 Application COAImportRevaluationOptionisignoredinallimportmodes
PostingEngineUDfieldsdefinedforGLJrnDtlandTranGLCtablesdonotsupport
10.1.600 FinancialManagement GeneralLedger 185334 Application RequiredandInitValuefunctionality
GLTransactionTypeRVJrnTrDtl.CommentTextdoesnotpopulatethecustomized
10.1.600 FinancialManagement GeneralLedger 186729 Application postingruledefinedvalue
GenerateAllocationsCurrencyamountbecomesequaltobaseamountfor
10.1.600 FinancialManagement GeneralLedger 186861 Application currencyaccountafterreverse
JournalEntryAfterrunningVerifybalances,somepostedJournalrecordshavethe
10.1.600 FinancialManagement GeneralLedger 186913 Application periodmodified
10.1.600 FinancialManagement GeneralLedger 186965 Application GLSegmentReportReportcannotbeprinted/generatedinEWA
ImportingPostingruleswithadifferentPackagesilentlyoverwritestheexisting
10.1.600 FinancialManagement GeneralLedger 187029 Application rules

Page21
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


JournalDetailTrackerTranGLCDetailTransactionDocumentpanehasmissing
10.1.600 FinancialManagement GeneralLedger 187256 Application dataandlabelswhenrecordisloaded
10.1.600 FinancialManagement GeneralLedger 187277 Application JournalEntryUnabletoPostMultiCompanyJournals
JournalEntryCannotpostSingleGLJournalGroupwithseveralJournalsifUD
10.1.600 FinancialManagement GeneralLedger 187311 Application Fieldsareused
PostingEngineSimultaneouspostingofseveralAPInvoicescauseserrorifCOA
10.1.600 FinancialManagement GeneralLedger 187312 Application mappingisused
PostingEngineAutocorrectforValidationRule'ClosingPeriodisspecified,but
10.1.600 FinancialManagement GeneralLedger 187767 Application doesnotexist'worksincorrectly

Journal/ChartTrackerUDFieldsarenotdiplayedbydefaultontabSpecificDetail
10.1.600 FinancialManagement GeneralLedger 187790 Application evenifflag"Hiddenbydefault"isunckeckinUDfieldssetup
10.1.600 FinancialManagement GeneralLedger 187841 Application LegalNumberFiscalYearandFiscalYearSuffixarenotvalidated
PostingEngineValidationRule'Transactionamountiszeroforcurrencyaccount'
10.1.600 FinancialManagement GeneralLedger 187871 Application worksincorrectly
10.1.600 FinancialManagement GeneralLedger 188129 Application ChartofAccountsErrordisplayswhenusinganampersand&
OperationWhencopyinganoperationtoanotherrevision,theoperationwill
10.1.600 FinancialManagement GeneralLedger 188231 Application becomeinvalidifitcontainsafunctioncall
OperationWhentryingtodraganddropoperationsinarule,itworksonlywithin
10.1.600 FinancialManagement GeneralLedger 188234 Application thesamehierarchylevel
10.1.600 FinancialManagement GeneralLedger 188235 Application Copy/PastefunctionDoesnotworkacrossdifferentGLtransactiontypes
UpdateBusinessEntitySegmentValuesProcessendswithanerrormissinglistof
10.1.600 FinancialManagement GeneralLedger 188354 Application notcreatedvalues
COASegmentsIfCOASegmentsmappingisusedthenTranGLCdataissaved
10.1.600 FinancialManagement GeneralLedger 188528 Application incorrectlyandGLAccountisshowncorruptedonUI
10.1.600 FinancialManagement GeneralLedger 188542 Application GeneralLedgerImportGLiscreatingbadrecordsinGLAcctDisptable
ChartofAccountsSegmentsarenotrenumberedifonewasdeletedcausing
10.1.600 FinancialManagement GeneralLedger 188726 Application postingerrors
ReviewJournalErrorreturnedforJournalEntryCancellationofVoidAPPayment
10.1.600 FinancialManagement GeneralLedger 188944 Application entry

10.1.600 FinancialManagement GeneralLedger 189009 Application AccountSegmentGLSegmentvaluecanbedeletedafteraddedtoGLaccount


10.1.600 FinancialManagement GeneralLedger 189933 Application UpdateformatofcolumnCorrAccUIDtothemaxvalueofaSQLintfield
ChartTrackerDoesnotdisplayoriginaljournalnumberandoriginaljournallinefor
10.1.600 FinancialManagement GeneralLedger 190045 Application AutomaticTransactionsReversallines.
PostingEngineEnhancelogwritingtobeparsefriendlybyexternalprograms,i.e.
10.1.600 FinancialManagement GeneralLedger 190268 Application PDTlibraries
10.1.600 FinancialManagement GeneralLedger 190422 Application VerifyBalancesProcessfailsifSegmentFilterissetup

Page22
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description

10.1.600 FinancialManagement GeneralLedger 190550 Application ChartTrackerBAQandQuickSearchfunctionalitydoesnotworkinChartTracker.


10.1.600 FinancialManagement GeneralLedger 190787 Application PostingEngineCosAndWipprocessdoesnotcomplete
PostingEngineFunctionUIDsarechangedinXMLafteranymodificationofposting
10.1.600 FinancialManagement GeneralLedger 190893 Application rules
PostingEngineGroupislockedinReviewingstatuswithnotexistingRJ1afterEdit
10.1.600 FinancialManagement GeneralLedger 190900 Application Listgeneration
PostingEnginePElogiccausesincorrectcalculationwhenusingverysmall
10.1.600 FinancialManagement GeneralLedger 191416 Rule inventorytransactionsanddifferentbook/currency

10.1.600 FinancialManagement GeneralLedger 191452 Application COACategoryMakeSequenceavailableforentrieswithemptyParentCategory


PostingEngineErroronReviewJournalConfirmationforAutocorrectedRed
10.1.600 FinancialManagement GeneralLedger 191559 Application StornoBankAdjustment
10.1.600 FinancialManagement GeneralLedger 191851 Application StructuredTrialBalancereportExporttoExceldoesnotwork
ChartofAccountsCarryForwardBalancesonP\Larecreatedevenwhentheyare
10.1.600 FinancialManagement GeneralLedger 191857 Application notturnedon
10.1.600 FinancialManagement GeneralLedger 192281 Application BudgetImportModifyprogramtoworkinEWA
10.1.600 FinancialManagement GeneralLedger 192282 Application BudgetExportModifyprogramtoworkinEWA
GeneralLedgerAccountGeneralLedgerisabletodeleteGLaccountwithposted
10.1.600 FinancialManagement GeneralLedger 193013 Application activity
PerformanceNeedoptimizationinCalculateBalanceforConsolidationcase(Large
10.1.600 FinancialManagement GeneralLedger 193147 Application Transaction)

10.1.600 FinancialManagement GeneralLedger 193531 Application ReviewJournalUDfieldsassignedto'SetupmainGLjournaldata'doesnotwork

10.1.600 FinancialManagement GeneralLedger 193879 Application PostingEngineClientdatabasehas13mlninabtworkand8mlninabthead


JournalEntryGroupcheckfiscalyearmethodfailsinServiceConnectincase
10.1.600 FinancialManagement GeneralLedger 193916 Application cJEDateisendofthemonth

10.1.600 FinancialManagement GeneralLedger 193946 Application GLTransactionTypeNeedadditionalinfoduringconversionofBookingRules

10.1.600 FinancialManagement GeneralLedger 193988 Application VerifyBalancesFailsondatabaseaftermigrationfrom9.05.702Aversion


ChartofAccountsUserisabletodeleteCOAreferencetypesegmentwhenthere
10.1.600 FinancialManagement GeneralLedger 194008 Application isreferencetypeinsystem
10.1.600 FinancialManagement GeneralLedger 195353 Application JournalEntryErrorwhenhaving365periodsperFiscalYear
10.1.600 FinancialManagement GeneralLedger 195479 Application EarliestApplyDateIncorrectmodulesareusedforvalidation
JournalEntryGLJournalEntry.UpdateExtmethodgeneratesanObjectReference
10.1.600 FinancialManagement GeneralLedger 195694 Application errorwhengeneratingLegalNumbers
10.1.600 FinancialManagement GeneralLedger 196061 Rule ApplyCreditMemoVBDstructuredoesnotcorrespondtotherules

Page23
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


10.1.600 FinancialManagement GeneralLedger 196168 Application UploadTranGLCDataErrordisplayswhenconvertingAPTransactions
PostingEngineOrphanedABTHeadandABTWorkimpactingperformanceand
10.1.600 FinancialManagement GeneralLedger 196575 Application migrationprocessing

10.1.600 FinancialManagement GeneralLedger 196613 Application Erp.Internal.AR.GenARBalance.UpdateBalanceUpdatedoesnotuseuniquekey


GeneralLedgerAccountAbletodeleteaccountalthoughitisreferencedat
10.1.600 FinancialManagement GeneralLedger 196699 Application AccountBudget
GenerateAllocationsErrordisplayswhenallocatingaverysmallvalueinseveral
10.1.600 FinancialManagement GeneralLedger 198306 Application targetaccounts
PostingEngineOnlyfirstHeadervalidationruleerrordisplaysinReviewJournal
10.1.600 FinancialManagement GeneralLedger 198940 Application Log
MenuRenamemenuitemfrom"NewAllocationBatchCode"to"NewAllocation
10.1.600 FinancialManagement GeneralLedger 199200 Application Code"toavoidmisleadingconfusion
TrialBalanceReportCSFGermanyError:Objectreferencenotsettoaninstance
10.1.600 FinancialManagement GeneralLedger 200220 Application ofanobject
MultiCompanyDirectServerProcessPerformanceissuewhenhavingmany
10.1.600 FinancialManagement MultiSiteManagement 155008 Application companies
10.1.600 FinancialManagement MultiSiteManagement 180048 Application ConsolidatetoParentEWAfloatingGLcontrolinDetailPanel
ConsolidatetoParentWhenchangingthelogfilenametheinputstringisnot
10.1.600 FinancialManagement MultiSiteManagement 180052 Application validated
MultiCompanyDirectServerProcessSuggestionnotgeneratedwhenNeedByis
10.1.600 FinancialManagement MultiSiteManagement 184980 Application updatedonBTOSalesOrderonParentCompany
MultiCompanyDirectServerProcessRecordsofPartwithForeignLang
10.1.600 FinancialManagement MultiSiteManagement 185272 Application DescriptionnotremovedfromIntQueOuttable
MultiCompanyDirectServerProcessContinuousProcessinggenerateshugelog
10.1.600 FinancialManagement MultiSiteManagement 185447 Application file
MultiCompanyDirectServerProcessProcesshangsifthepasswordofuserprintis
10.1.600 FinancialManagement MultiSiteManagement 185592 Application cleaned
MultiCompanyDirectServerProcessErrorwhenreceivingPartchangesfrom
10.1.600 FinancialManagement MultiSiteManagement 185718 Application ParentCompany
MultiCompanyDirectServerProcessMCDdoesnotproduceaSysTaskrecordfor
10.1.600 FinancialManagement MultiSiteManagement 186605 Application GenerateSuggestions
ConsolidatetoParentNewyearconsolidationdoesnotmakenecessary
10.1.600 FinancialManagement MultiSiteManagement 187081 Application revaluationofpreviousyear
ConsolidatetoParentNotallconsolidationpostsaretransferredtoTargetBookin
10.1.600 FinancialManagement MultiSiteManagement 187750 Application OverrideMode
ConsolidatetoParentWithanexchangeratechange,theaccountsarenot
10.1.600 FinancialManagement MultiSiteManagement 187762 Application revaluatedonOverrideMode

Page24
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


MultiCompanyDirectServerProcessFailstorecoverwhenuserlaunchingprocess
10.1.600 FinancialManagement MultiSiteManagement 188539 Application haspermissionsinonecompanybutnotinothers
MultiCompanyDirectServerProcessErrorreferringtoGLBatchBalanceswhen
10.1.600 FinancialManagement MultiSiteManagement 189697 Application executingprocess
MultiCompanyDirectServerProcessUnshippingaPack,linkedtoaDropSales
10.1.600 FinancialManagement MultiSiteManagement 189935 Application Order,onlyunshipslastDropShipLine
MultiCompanyDirectServerProcessMSMUnabletointegrateaninvoicefrom
10.1.600 FinancialManagement MultiSiteManagement 191154 Application ICPOprocessduetorounding
MultiCompanyDirectServerProcessMultiCompanyDirectServerProcesscannot
10.1.600 FinancialManagement MultiSiteManagement 191308 Application createAPinvoicesinsourcecompany
MultiCompanyDirectServerProcessIMRecordsarecreatedwhenclosingaJobof
10.1.600 FinancialManagement MultiSiteManagement 192067 Application anonGlobalPart
ConsolidatetoParentSystemallowsusertoclickSubmitandprocessmanytimes
10.1.600 FinancialManagement MultiSiteManagement 192176 Application withoutanerrormessageorvalidation
MultiCompanyDirectServerProcessImproveerrorhandlingwhenprocessing
10.1.600 FinancialManagement MultiSiteManagement 192683 Application inbound(IntQueIn)messages(ImpTran,ImpVal,ImpReg)

10.1.600 FinancialManagement MultiSiteManagement 192877 Application ConsolidatetoParentIncorrectRetrospectiveConsolidation;Transactiondoubled


ConsolidatetoParentTransferIntermediatetoParentcreatesGLbalancesof
10.1.600 FinancialManagement MultiSiteManagement 192902 Application incorrecttype

MultiCompanyDirectServerProcessOurShipQtyUOMdisplaysandtransacts
10.1.600 FinancialManagement MultiSiteManagement 193356 Application withInventoryUOMinsteadofPurchasingUOMwithMultiCompany
ConsolidatetoParentSystemdoesnotallowsimultaneouslyperform
10.1.600 FinancialManagement MultiSiteManagement 193359 Application indepemdentconsolidations

10.1.600 FinancialManagement MultiSiteManagement 193383 Application MultiCompanyDirectServerProcessMemoryspikesforEpicorERPCloudon500


MultiCompanyDirectServerProcessReceivinganIntercompanyReceiptofa
10.1.600 FinancialManagement MultiSiteManagement 193560 Application SerialTrackedPart,SerialNumbercannotbecreated
SaaSMultiCompanyDirectServerProcessImproveerrorhandlingandrecovery
10.1.600 FinancialManagement MultiSiteManagement 194231 Application whencalltosubTaskLauncher.CallTaskmethoddisplayserror

MultiCompanyDirectServerProcessWhenMobileExternalCompanyexistsinany
10.1.600 FinancialManagement MultiSiteManagement 194702 Application company,IMJobOperandIMJobMtlarecreatedjobisreleased
MultiCompanyServerProcessIntercompanyreceiptrecordisnotavailableusing
10.1.600 FinancialManagement MultiSiteManagement 195322 Application twodatabaseswithServiceBusanddirect
MultiCompanyDirectServerProcessDeletedPO,belongingtoanotherSupplier,is
10.1.600 FinancialManagement MultiSiteManagement 195478 Application displayedonChildCompany

Page25
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description

GenericIntegrationServerProcessShouldnotwriteIntQueOutforInvcDtland
10.1.600 FinancialManagement MultiSiteManagement 196595 Application InvcTaxifExtCompany.SendARInvisfalseorInvoiceGroupbeginswith"IMP"
GenericIntegrationServerProcessShouldnotwriteIntQueOutforShipHeadif
10.1.600 FinancialManagement MultiSiteManagement 196622 Application ExtCompany.SendShipisfalse
MultiCompanyDirectServerProcessOnLinkSupplierprocess,PurchasePoint
10.1.600 FinancialManagement MultiSiteManagement 197468 Application Contactisnotadded
GenericIntegrationServerProcessARInvoicescanbecreatedandpostedwithno
10.1.600 FinancialManagement MultiSiteManagement 197917 Application TransactionDocumentType
10.1.600 FinancialManagement MultiSiteManagement 198075 Application MultiCompanyServerProcessInboundrecordsarenotreceived
MultiCompanyDirectServerProcessDuplicatekeyinErp.KeyBlockerrorsetting
10.1.600 FinancialManagement MultiSiteManagement 198723 Application StartingPOvalueatCompany
PayrollCheckEntryRestartCheckPrintformdoesnotshowthecorrectLastUsed
10.1.600 FinancialManagement Payroll 176969 Application Check
PayrollCheckEntry"Clearthisform?"warningmessageisnotshownwhenuser
10.1.600 FinancialManagement Payroll 180653 Application clicksclearbutton
10.1.600 FinancialManagement Payroll 186567 Application PayrollCheckEntryBLTesterdisplaysanerrorwheninvokingmethod
10.1.600 FinancialManagement Payroll 187619 Application EarningsReportDuplicatelinesmaketotalstobeincorrect
10.1.600 FinancialManagement Payroll 187691 Application PayrollCheckRegisterReportTaxAmountwithzerocausesblankspace
ExternalPayrollIntegrationUpdatemenusshouldnotberestrictedtoSecurity
10.1.600 FinancialManagement Payroll 188548 Application Managersonly
ExternalPayrollIntegrationExternalPayTypeMaintenanceloadsallofthePay
10.1.600 FinancialManagement Payroll 188860 Application Typeswhenitisopenfromcontextmenu
10.1.600 FinancialManagement Payroll 188995 Application PayrollCheckEntryEmployeePhotosdonotshowinPayrollCheckEntry
ExternalPayrollProcessingCorrecthelppagenotdisplayedwhenpressingF1on
10.1.600 FinancialManagement Payroll 189495 Application PayrollProcessingform
WorkersCompensationReportdisplays5decimalsonallColumns.Companyand
10.1.600 FinancialManagement Payroll 189613 Application Currencyareconfiguredtoshow2.
ExternalPayrollEmployeeIssuesselectingPayrollClasses,Frequencies,Pay
10.1.600 FinancialManagement Payroll 190411 Application MethodsandClassificationinListTab
ExternalPayrollProcessingTypeisdisplayedemptyafteropeningthePremium
10.1.600 FinancialManagement Payroll 190498 Application HoursCodeDDLintheHoursgird
ExternalPayrollProcessingEmployeedetailscanbemodifiedinListtabwhenthe
10.1.600 FinancialManagement Payroll 190536 Application Groupisclosed
PayrollCheckEntryWithholdinganadditionalamountgreaterthanthePay
10.1.600 FinancialManagement Payroll 190744 Application Amountcausesthecalculationoftaxestostallanddisplayanerror
ExternalPayrollProcessingSeveralerrorsdisplaywhendeletingarowinListTab
10.1.600 FinancialManagement Payroll 191499 Application withaninvalidID
10.1.600 FinancialManagement Payroll 191725 Application EarningsIssueswhenexportingreporttoExceldataonly

Page26
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description

10.1.600 FinancialManagement Payroll 192832 Application PayrollEmployeeValidationofMiddleInitialfor'invalidcharacters'toberemoved


ExternalPayrollProcessingUserneedstomanuallysavethegroupinorderto
10.1.600 FinancialManagement Payroll 195196 Application generatethehours

10.1.600 FinancialManagement Payroll 195672 Application ExternalPayrollIntegrationConversionAddconversionforexistingPayrollClasses


ExternalPayrollIntegrationConversionConvertexistingCSG(IEX)datatoExternal
10.1.600 FinancialManagement Payroll 195674 Application Payrollintegrationforallcompanies,regardlessoflicense
ADPTemplateConversionNeedtochangeDescriptiontoseeitbetterinSystem
10.1.600 FinancialManagement Payroll 195677 Application Monitor
10.1.600 FinancialManagement Payroll 196310 Application ExternalPayrollLayoutAddActionCreateADPExportFileLayout
10.1.600 FinancialManagement Payroll 197691 Application EarningsReportTaxAmountaszerocausesablankspace
PayrollCheckEntryTaxesexemptfrombothDeductionandPayTypeare
10.1.600 FinancialManagement Payroll 198028 Application calculatedasnegative

10.1.600 FinancialManagement Rebates,Promotionsand 176618 Application RebateContractEntryErrorappearswhenthereisonlyonePartorProductGroup


RebateContractEntryCustomeroverridedoesnotworkwithRebateFormCredit
10.1.600 FinancialManagement Rebates,Promotionsand 184596 Application Memo
GenerateRebateTransactionsIncorrectARInvoicecreationafterdummyschedule
10.1.600 FinancialManagement Rebates,Promotionsand 187053 Application isexecuted
WorkQueueCannotstartoneActivitybyclickingtheSelect>StartActivitybutton,
10.1.600 ProductionManagement DataCollection 183875 Application whenSelectforWorkJobDetailstabiscleared
EndActivityPartLocationinformationisdisplayedevenafterthematerialis
10.1.600 ProductionManagement DataCollection 185088 Application consumed
10.1.600 ProductionManagement DataCollection 185571 Application EndActivityIncorrectlycreatesanegativeMFGSTKtransaction
ReportQuantityMissingLaborDtl/LaborPartswhenenteringMESReportQuantity
10.1.600 ProductionManagement DataCollection 185762 Application forCoParts
EndActivityWIPrecordshouldbecreatedforAutoreceiveoperationswhenthe
10.1.600 ProductionManagement DataCollection 186346 Application demandisMaketoOrder
WorkQueueSystemisslowwhenmorethan10operationsareselectedtoend
10.1.600 ProductionManagement DataCollection 187371 Application theactivityinWorkQueue
EndActivityWhenyouendanactivity,WIPdoesnottakethevalueofCurrent
10.1.600 ProductionManagement DataCollection 187591 Application FieldifyoumadeanIssueMaterialbefore
10.1.600 ProductionManagement DataCollection 188017 Application StartActivityMESStarting2ndOperationdisplayswarningmessages
10.1.600 ProductionManagement DataCollection 188083 Application WorkQueueUnabletoEndActivitywithoutenteringaScrapReason
10.1.600 ProductionManagement DataCollection 188422 Application WorkQueueErrormessageisdisplayingwhenclickingDescription

10.1.600 ProductionManagement DataCollection 190657 Application EndActivityLaborhoursarenotcalculatedproperlywhenreportingsetuplabor


10.1.600 ProductionManagement DataCollection 196403 Application EndActivityDoesnotgenerateMFGCUSmovetransactionforFinalQty

Page27
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description

10.1.600 ProductionManagement Engineering 129962 Application CostingWorkbenchLoadCostDetailsgriddoesnotworkwithPasteInsert

10.1.600 ProductionManagement Engineering 182771 Application EngineeringWorkbenchDisplaysincorrectChinesetranslationforHours/Piece


10.1.600 ProductionManagement Engineering 185276 Application EngineeringWorkbenchRecalculateLowLevelCodedrequiredatcheckin
EngineeringWorkbenchWhenyouclickRefreshontaskandautoitjumpstothe
10.1.600 ProductionManagement Engineering 185380 Application firstrelatedtask
10.1.600 ProductionManagement Engineering 185829 Application MethodTrackerBOMofthesubassembliesarenotdisplayed
EngineeringWorkbenchAbletocheckinpartswithpullasassembly=trueand
10.1.600 ProductionManagement Engineering 185839 Application Qty/Parent=0ifthematerialisdragged&dropped
SummarizedBOMAddthecyclicalreferencevalidationintheSummarizedBOM
10.1.600 ProductionManagement Engineering 186240 Application report
EngineeringWorkbenchAltDescriptiondoesnotdisplayafteraltmethodis
10.1.600 ProductionManagement Engineering 186559 Application created
EngineeringWorkbenchDoesnotallowtocheckinarevisionforasubassembly
10.1.600 ProductionManagement Engineering 186606 Application materialinatemplatejob

10.1.600 ProductionManagement Engineering 188376 Application MfgLeadTimeCalculationAddtheTopLevelTimecalculationinfoinPartTracker

10.1.600 ProductionManagement Engineering 188601 Application BOMListingAddthecyclicalreferencevalidationintheBOMListingreport

10.1.600 ProductionManagement Engineering 189571 Application EngineeringWorkbenchAfterselectingPriceBreak,thepartisnotretrieved

EngineeringWorkbenchAfterchangingoperationsequencenumber,the
10.1.600 ProductionManagement Engineering 189673 Application AlternateMethodParentOperationandMaterialsequencenumberbecomezero

10.1.600 ProductionManagement Engineering 190050 Application MethodTrackerWhenthematerialhasRoHSthetrackerdoesnotdisplaythePart

10.1.600 ProductionManagement Engineering 190125 Application EngineeringWorkbenchUnabletomodifytheUnitCostofSubcontractopr


MfgLeadTimeCalculationReceiveTimeisnotcalculatedcorrectlyfor
10.1.600 ProductionManagement Engineering 190545 Application manufacturedparts

10.1.600 ProductionManagement Engineering 191265 Application MassPartReplace/DeleteDoesnotupdatetheECOMtlTabletothecorrectpart


EngineeringWorkbenchAfterGetDetailstheSerialNumbersRequiredWhen
10.1.600 ProductionManagement Engineering 191514 Application Shippingisnotselected
EngineeringWorkbenchErrormessagedisplaysafteraddingaPartwiththeMES
10.1.600 ProductionManagement Engineering 191694 Application Machinechecked
10.1.600 ProductionManagement Engineering 192034 Application AvailabilityReportonlypullsQuantityOnHandfromalastBin
10.1.600 ProductionManagement Engineering 192580 Application EngineeringWorkbenchErrormessageinXFileAttachtable

Page28
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


EngineeringWorkbenchOption'ApproveandCheckinAll'allowsyoutocheckin
10.1.600 ProductionManagement Engineering 193210 Application operationswithMachineMES=false
EngineeringWorkbenchCircularRedundancyValidationconsidershistorical
10.1.600 ProductionManagement Engineering 193288 Application ECOMtlrowsfromdifferentGroupID

10.1.600 ProductionManagement Engineering 193454 Application EngineeringWorkbenchErrordisplayswhenchangingthepartfromasubcontract

10.1.600 ProductionManagement Engineering 194086 Application AvailabilityReporterrorwhenchangingLanguageFormatsonControlPanel

10.1.600 ProductionManagement Engineering 194112 Application EngineeringWorkbenchCircularReferenceissue,applicationstopsworking

10.1.600 ProductionManagement Engineering 195650 Application WhereUsedReportDoesnotvalidatetheEffectiveDateandprintalltherevisions


EngineeringWorkbenchAddattachmentsfromtemplatesonlyifthereareno
10.1.600 ProductionManagement Engineering 195680 Application existingattachmentsinthePartEcorevs
EngineeringWorkbenchGetdetailsdoesnotconsidertheCopyConfiguratorID
10.1.600 ProductionManagement Engineering 198556 Application checkbox

10.1.600 ProductionManagement Engineering 199274 Application EngineeringWorkbenchCheckPartOutprocessnolongersavesEXUDData


InspectionSpecificationEWAformdoesnotallowyoutoenteraPassListorFail
10.1.600 ProductionManagement EnhancedQualityAssura 159811 Application ListthroughEWA

10.1.600 ProductionManagement EnhancedQualityAssura 186460 Application InspectionAttributeInitialValueissetfor2decimals,itshouldallow5decimals


10.1.600 ProductionManagement EnhancedQualityAssura 187274 Application SpecificationRoundsautomaticallytheInitialDecimalfield
InspectionResultsEntryErrorwhenclickEnterResultsButtonlinkedtoan
10.1.600 ProductionManagement EnhancedQualityAssura 191484 Application operationonaconfiguredpart
ExpenseReportContextMenuEmployeeSearchdoesnotfilterrecordsaccording
10.1.600 ProductionManagement ExpenseManagement 179058 Application toEnterExpenseflag
10.1.600 ProductionManagement ExpenseManagement 182087 Application ExpenseReportEmployeesearchisnotrestricted
GenerateAPInvoicesForExpensesAPInvoiceslinesaregeneratedalwayswiththe
10.1.600 ProductionManagement ExpenseManagement 195461 Application expenses'firstamount
ServiceCallCenterShipToPerson/ContactinfoisnotprintedontheServiceCall
10.1.600 ProductionManagement FieldService 185841 Application Ticketreport

10.1.600 ProductionManagement FieldService 187481 Application ServiceJobTrackerActualTotalcolumnTotalisnotbeingcorrectlycalculated


ServiceContractEntrySelectingNewLaborRatebeforesavingcontractmakesthe
10.1.600 ProductionManagement FieldService 187624 Application screenincorrect
MiscellaneousShipmentEntryDocumentcanbeeditedevenifLNconfiguration
10.1.600 ProductionManagement FieldService 187930 Application disableschangesafterprinting

Page29
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


ServiceContractEntrySerialnumbersaremissingwhenrenewingacontractthat
10.1.600 ProductionManagement FieldService 188134 Application hadlinesdeleted
ServiceContractEntryBasicSearchrequestedasSortOrderDescendingdisplays
10.1.600 ProductionManagement FieldService 188173 Application rowsfrom"bottom"oflist
ServiceContractEntryUnabletoupdateqtys,priceandbillingdatesonacontract
10.1.600 ProductionManagement FieldService 189773 Application renewalaftertheinvoiceiscreated

10.1.600 ProductionManagement FieldService 190250 Application ServiceCallCenterDefaultshippingcontactisnotclearedwhenshiptoentered


JobEntryApplicationdoesnotdefaulttherightrevisionwhentheparthasmulti
10.1.600 ProductionManagement JobManagement 152907 Application revisions
SupplierPurchasePointcontacthasafieldlengthof75characters,butonly50can
10.1.600 ProductionManagement JobManagement 160241 Application besaved
10.1.600 ProductionManagement JobManagement 160275 Application SupplierGroup"Tree"panedoesnothaveresizeoptioninEWA

10.1.600 ProductionManagement JobManagement 168774 Application SupplierGroupFunctionalityofGlobalVendGrupandGlobalLockcheckboxfields


SupplierMaintenanceUserisabletosaveSupplierinformationwithaninvalid
10.1.600 ProductionManagement JobManagement 172238 Application ShipViavalue
JobEntryDoesnotdisplayamaterialascompleteeventhoughitwasissuedafter
10.1.600 ProductionManagement JobManagement 174087 Application aDemandChange
BackflushLaborServeProcessOnlyprocessesrecordsthefirsttimeitrunsusing
10.1.600 ProductionManagement JobManagement 177606 Application thecontinuousmode
10.1.600 ProductionManagement JobManagement 178327 Application JobEntryUnabletodeleteaSchedulingResourceaddedtoaJob
JobEntryOpDescdoesnotshowcorrectoperation'sdescriptioninJobEntry,
10.1.600 ProductionManagement JobManagement 179042 Application insteadshowstheResourceGroupDescription
Inventory/WIPReconciliationReportProcessneverendsortakesmorethan10
10.1.600 ProductionManagement JobManagement 181217 Application hrstocomplete

10.1.600 ProductionManagement JobManagement 181711 Application JobEntrySubcontractpartdescriptionisnotupdatedwhenpartischanged

10.1.600 ProductionManagement JobManagement 182687 Application JobEntryCannotentertexttoChangeswindowwhenitappearsatthefirsttime


Inventory/WIPReconciliationReportInvoiceCOSTransactiondoesnottake
10.1.600 ProductionManagement JobManagement 184489 Rule divisionfromwarehouse

10.1.600 ProductionManagement JobManagement 184985 Application PlanningWorkbenchCheckboxofIgnorePOSuggestiondoesnotworkasexpected


10.1.600 ProductionManagement JobManagement 185075 Application JobEntryTreeviewdoesnotreflectchangesmadetothejob
SupplierErrordisplayedwhenenteringanycountrycodeinBank/RemitTo
10.1.600 ProductionManagement JobManagement 185207 Application SupplierBankAddressCountrycombobox

10.1.600 ProductionManagement JobManagement 185369 Application JobEntrySupplierPriceListsfunctionalitydoesnotworkinJobMaterials

Page30
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


JobTravelerErrorinSystemMonitorwhenaJob'sparthasPart.UserDate1field
10.1.600 ProductionManagement JobManagement 186205 Application blank
AutoJobFirmProcessDefinesincorrectlyRequiredDateforPlanasAssembly
10.1.600 ProductionManagement JobManagement 186261 Application DemandSubassemblies
JobEntryRequiredReferenceDesignatorscalculationintheJobMtldisplaysan
10.1.600 ProductionManagement JobManagement 186308 Application error
MethodsMasterAddthecyclicalreferencevalidationintheMethodsMaster
10.1.600 ProductionManagement JobManagement 186431 Application report
ProductionCalendarCannotimportBOintoServiceConnectduetoduplicate
10.1.600 ProductionManagement JobManagement 186761 Application MethodNames
SupplierGlobalsupplierisnotbeinglinkedcorrectlywhen1099configurationis
10.1.600 ProductionManagement JobManagement 186822 Application made
JobEntrySplitJobprocessdoesnotmovecorrectlyLaborQuantitywhenan
10.1.600 ProductionManagement JobManagement 186896 Application operationisnotcompleted

10.1.600 ProductionManagement JobManagement 186908 Application SupplierPrimaryBankisnotdisplayedfirstbydefaultinBank/RemitToDetailtab


10.1.600 ProductionManagement JobManagement 186997 Application JobPickListreportDoesnotprintusingEWA

10.1.600 ProductionManagement JobManagement 187169 Application JobAdjustmentShopLoadSQLTableLockrequesttimeoutperiodexceeded


Inventory/WIPReconciliationReportSTKPLThittingCOS/ContrainsteadofPLT
10.1.600 ProductionManagement JobManagement 187424 Rule STK
10.1.600 ProductionManagement JobManagement 187511 Application JobEntryAddcircularreferencevalidationsinJobEntry

10.1.600 ProductionManagement JobManagement 187525 Application JobTravelerGetandSetvaluesshouldbereplacedtoavoidinformationleakage

10.1.600 ProductionManagement JobManagement 187585 Application JobEntryErrordisplayswhenfirmedjobsforsomepartsareunengineered


JobEntryUsingBackflushoflaborEntrywithAutoReceiveautocreatesMFGSTK
10.1.600 ProductionManagement JobManagement 187702 Application transactionwithnocosts
JobEntryGetDetaildoesnotconsideranactivealternatepartfromaninactive
10.1.600 ProductionManagement JobManagement 187759 Application subassemblypart
SupplierVendAttrandVendCnAttrrecordsarenotdeletedwhenSupplier,
10.1.600 ProductionManagement JobManagement 187780 Application PurchasePointorPPContactaredeleted
JobReceipttoInventoryIfthereisnoDocumentTypeaLegalNumberiscreated
10.1.600 ProductionManagement JobManagement 187845 Application forthattransaction
10.1.600 ProductionManagement JobManagement 187963 Application QuoteEntryAddcircularreferencevalidationsinQuoteEntry
10.1.600 ProductionManagement JobManagement 188085 Application RevisionCompareDoesnotworkcorrectlywhencomparingoperations

10.1.600 ProductionManagement JobManagement 188092 Application JobClosingErrordisplayswhentryingtobackflushmaterialswithinactivebins

Page31
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


JobClosingUnabletoclosejobsforserialtrackedpartswithscraprejected
10.1.600 ProductionManagement JobManagement 188122 Application material
JobEntryMaterialBurdencostschangesonGetDetailsandbyupdatingthe
10.1.600 ProductionManagement JobManagement 188440 Application Qty/Parent
10.1.600 ProductionManagement JobManagement 188570 Application SupplierSupplierformsdonotsupportopeningwithVendornum
JobReceipttoInventoryDoesnotcalculatecorrectlysubcontractAvgandStdunit
10.1.600 ProductionManagement JobManagement 188619 Application costsforpartialreceipts

ProjectAnalysisExportBPAexecutedwithRegenerate=falsebringsincorrect
10.1.600 ProductionManagement JobManagement 188694 Application costs,afteratimedetailforajoblinkedtotheProjectismodified
ProjectAnalysisExport"SubcontractCalculatedCTC"isnotupdatedwiththePO
10.1.600 ProductionManagement JobManagement 188846 Application UnitPriceafterPOiscreated

10.1.600 ProductionManagement JobManagement 188896 Application ImportLaborScheduleParamsProcessIncorrectformat/assignofquickcodes


ProjectAnalysisExportSumofReimbursableandNonreimbursableexpensesare
10.1.600 ProductionManagement JobManagement 189025 Application displayinginthe"CalculatedCTCOtherDirectcosts"column
ProjectAnalysisExportNegativeexpenseisnotupdatingtheActualOtherDirect
10.1.600 ProductionManagement JobManagement 189048 Application Costfield
10.1.600 ProductionManagement JobManagement 189087 Application JobEntryLeadtimeisincorrectinthejobdetails
MattecIntegrationFilefailstoimportanddoesnotfinishorerrorout
10.1.600 ProductionManagement JobManagement 189115 Application subsequentfilestimeout
10.1.600 ProductionManagement JobManagement 189298 Application EmployeeEmployeestatus,changetoTerminated

10.1.600 ProductionManagement JobManagement 189523 Application JobEntryHoursfielddoesnotreturnto0,whensettingProdStd=0.00again


ProjectAnalysisExportRunningBPAwithRegenerate=falsecalculatesincorrect
10.1.600 ProductionManagement JobManagement 189739 Application LaborCostforFixedHoursOperations
10.1.600 ProductionManagement JobManagement 189794 Application SupplierErrorwhencreatinganewNamedSearchrecord
ProjectAnalysisExportBuildprojectanalysisfunctionalityaddsthecostofajob
twicetotheprojectcostwhenitisbuildingtoanotherjobthatalsoreferencesthe
10.1.600 ProductionManagement JobManagement 189855 Application project
ProjectAnalysisExportCalculatedCTChoursdoesnottaketimefromaJob,linked
10.1.600 ProductionManagement JobManagement 189943 Application toaProject,thatisnotlinkedtoaWBSPhase
10.1.600 ProductionManagement JobManagement 189973 Application JobEntry"Attemptedtodividebyzero"erroronGetDetailsscreen

JobClosingMaterialsnotbackflushedwhenrelatedtoasubassemblywhenthere
10.1.600 ProductionManagement JobManagement 190008 Application wasn'tanyquantitycompletedagainstthesubassembliesoperation

10.1.600 ProductionManagement JobManagement 190207 Application MattecIntegrationMESExporttoMattecprocessisnotexportingtheSetupURL

Page32
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


MattecIntegrationAvoidAbandontheProcessExecutionwhenanerroroccurs
10.1.600 ProductionManagement JobManagement 190336 Application duringaLaborDtlImport
JobEntryCannotaddOperationsandSubcontractoperationstoProjectJobsin
10.1.600 ProductionManagement JobManagement 190420 Application JobEntry

10.1.600 ProductionManagement JobManagement 190431 Application JobEntryErrorMessagedisplaysselectingaResequenceOperationoption


10.1.600 ProductionManagement JobManagement 190522 Application JobEntryUnabletoobtainlatestBOMversioninJobEntry
BackflushMaterialDoesnotcorrectlybackflushwhenEnableFiFoLayerscheck
10.1.600 ProductionManagement JobManagement 190575 Application boxistrue
JobClosingADJPURrelatedtoPURSUBusingthedivisionfromthewheretheAP
10.1.600 ProductionManagement JobManagement 190804 Application Invoiceisgeneratednotthejob
ShopLoad"Specifiedargumentwasoutoftherangeofvalidvalues"errorwhen
10.1.600 ProductionManagement JobManagement 190822 Application enteringlabor
MattecIntegrationLaborwithNegativeLaborHrs0.01iscreatedwhenClockIn
10.1.600 ProductionManagement JobManagement 191063 Application andClockouttimesarethesame
JobEntryGeterrorMessagewhentheGetdetailsfromajobhavematerialonthe
10.1.600 ProductionManagement JobManagement 191258 Application fly

10.1.600 ProductionManagement JobManagement 191272 Application JobEntryUndoAllChangescausingstackoverflowerrorandstopsappserver


JobReceipttoInventoryCalculatesincorrectlyLastCostPartsdisplayedonPart
10.1.600 ProductionManagement JobManagement 191320 Application Tracker
JobReceipttoInventoryLotalwaysdefaultstotheJobNumberevenwhenthe
10.1.600 ProductionManagement JobManagement 191361 Application UseJobNumberasLotDefaultscheckboxissetasfalse
10.1.600 ProductionManagement JobManagement 191370 Application LaborExpenseErrordisplayswhenExpenseLaborisentered
10.1.600 ProductionManagement JobManagement 191469 Application JobEntryErrordisplayswhenretrievefirmedjobs
10.1.600 ProductionManagement JobManagement 191519 Application PlanningContractErrordisplaysaftershipmentoflinkedSO
JobEntryWhencreatingajobandGetDetailsfromaspecificquote,thesystem
10.1.600 ProductionManagement JobManagement 191755 Application stopsprocessing
JobEntryPhantomPartswithPullAsAssemblyuncheckedonEWexploitsasa
10.1.600 ProductionManagement JobManagement 191892 Application simplematerialaftergetdetails

10.1.600 ProductionManagement JobManagement 192013 Application KanbanReceiptsIgnoretheAlternatemethod,andinsteadusetheMainrevision


10.1.600 ProductionManagement JobManagement 192022 Application Site(Plant)MfgSysSitecannotbedeleted
JobEntryUsingGetDetailsforTemplateQuotessetsrequieredqtystozerooran
10.1.600 ProductionManagement JobManagement 192071 Application invalidvalues
JobEntryWhencreatinganewjobandupdatingQtyPermarkssubcontract
10.1.600 ProductionManagement JobManagement 192175 Application operationascompleted

10.1.600 ProductionManagement JobManagement 192233 Application JobEntryUnabletoGetDetailsusingaJobtemplatewithainspectionplan

Page33
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


10.1.600 ProductionManagement JobManagement 192390 Application SupplierPriceListactionmenuitemopensSupplierPriceListasmodal
JobEntryGetDetails/JobMtltriggersanissueformaterialpartswhicharepartofa
10.1.600 ProductionManagement JobManagement 192540 Application PhantomBOM
JobEntryGetDetailsfromQuotedoesnotcopyallsubassembliesfromthesecond
10.1.600 ProductionManagement JobManagement 192642 Application templatequoteline
10.1.600 ProductionManagement JobManagement 192927 Application JobEntryProjecttabnotupdatedwhenselectingdifferentjobs
10.1.600 ProductionManagement JobManagement 193140 Application SupplierCannotenteraContactforalengthlargerthan30
10.1.600 ProductionManagement JobManagement 193184 Application JobEntryWhenPreventChangesisselected,anattachmentcanbeadded
JobEntryPullQtyisnotcalculatedcorrectlywhenthere'senoughonhandfora
10.1.600 ProductionManagement JobManagement 193278 Application subassembly
ImportLaborScheduleParamsProcessImportslabordetailswithincorrectStartand
10.1.600 ProductionManagement JobManagement 193540 Application Endtime
PlanningWorkbenchDoesnotdeleteasuggestionofchangewhenitisnolongera
10.1.600 ProductionManagement JobManagement 193593 Application discrepancy
10.1.600 ProductionManagement JobManagement 193902 Application JobEntryDuplicateerrorwhenrunningwithmultiplethreads
Site(Plant)ErrordisplayedwhenmanuallyenteringaMaintenanceSiteforthe
10.1.600 ProductionManagement JobManagement 194101 Application firsttime
JobEntryWithajobrelatedwithaProject,thenAssembly,Operationand
10.1.600 ProductionManagement JobManagement 194150 Application MaterialaredisabledfromActionsMenu

10.1.600 ProductionManagement JobManagement 194244 Application JobEntrySplitjobinnotcorrectlysplittingthetransactionofthesubcontracts


PlanningWorkbenchDoesnotdisplaytheconfiguredpartnamefromtheSales
10.1.600 ProductionManagement JobManagement 194248 Application Order
JobEntryGetdetailsprocessstopsrunningusingBOMwithmultiplePhantom
10.1.600 ProductionManagement JobManagement 194303 Application Assemblies
10.1.600 ProductionManagement JobManagement 194333 Application JobManagerQuantitycolumndisplaysanincorrectconversion

10.1.600 ProductionManagement JobManagement 194446 Application MattecIntegrationExporttoMattecdoesnotcorrectlyexportthePartCosts


ProductionPlannerWBDoesnotcorrectlyupdatequantitieswhenusingUOM
10.1.600 ProductionManagement JobManagement 194582 Application Conversions
10.1.600 ProductionManagement JobManagement 194670 Application ProductionDetailRawmaterialsectionisnotdisplayedinthereport
10.1.600 ProductionManagement JobManagement 194752 Application JobEntrySeveralUIissuesrelatedwithSerialNumbercheckboxes
10.1.600 ProductionManagement JobManagement 195058 Application JobEntryEstimatedScrap%behindtheJobOperationcannotbeused
JobEntryAdding2ndmaterialtosubassemblynodeinthetreeaddsittothe
10.1.600 ProductionManagement JobManagement 195129 Application Parent
PlanningWorkbenchChangingthepartonSalesOrdermadefromQuotedoubles
10.1.600 ProductionManagement JobManagement 195180 Application demandonjob
10.1.600 ProductionManagement JobManagement 195319 Application JobEntryUnitPriceisnotbeingcalculatedcorrectly

Page34
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description

10.1.600 ProductionManagement JobManagement 195326 Application Site(Plant)AfterdeletingMFGSYSSite,SiterecordisstilllistedonSearchscreen


10.1.600 ProductionManagement JobManagement 195920 Application KanbanReceiptsSubmitbuttonisnotcreatinglegalnumbers
JobManageronJobManager,clickingScheduledisplaysanObjectReference
10.1.600 ProductionManagement JobManagement 196012 Application Instanceerror
10.1.600 ProductionManagement JobManagement 196495 Application Erp.Lib.AllocationsDeadlockinPartAlloctable
10.1.600 ProductionManagement JobManagement 196496 Application JobEntryDeadlocksinAppserviceassemblyrelatedtoPartAlloc
10.1.600 ProductionManagement JobManagement 196497 Application JobEntryDeadlocksinpartallocfromJobMtlSharedlibrary
10.1.600 ProductionManagement JobManagement 196500 Application JobEntrysystemdeadlockonXfileAttch,variouslibraries
10.1.600 ProductionManagement JobManagement 196501 Application JobEntrysystemdeadlockonFSCallDt
JobEntryMissingmaterialsandoperationstoappendfromQuoteinJobEntry
10.1.600 ProductionManagement JobManagement 197262 Application whenloggedinGermanlanguage
JobReceipttoInventory"ReassignSerialNumbertoAssembly"doesnotletyou
10.1.600 ProductionManagement JobManagement 197304 Application doaSerialassignment

10.1.600 ProductionManagement JobManagement 197689 Application JobEntryGetDetailsdoesnotcollapseallthephantomassembliesforsomeparts

10.1.600 ProductionManagement JobManagement 197883 Application JobEntryAfteraclosedJobisopened,theJobtextboxandbuttongetdisabled


JobEntryGetDetailsprocessdisplaysanerrorwhenanoperationhasmorethan
10.1.600 ProductionManagement JobManagement 197956 Application oneinspectionplan

10.1.600 ProductionManagement JobManagement 198142 Application JobEntryValidateRegDesigatorspreventsjobsfrombeingengineeredinJobEntry


Inventory/WIPReconciliationReportInvoicetransactionsdonotshowwhen
10.1.600 ProductionManagement JobManagement 199207 Application filteringbyJobNum
SSRSTimePhaseMaterialRequirementReportLastlineofreporthasinvalid
10.1.600 ProductionManagement MaterialRequirementsP 148303 Application projectedbalance
10.1.600 ProductionManagement MaterialRequirementsP 171665 Application ProcessMRPMRPProcessgeneratestoomuchdemand
NewPOSuggestionsRFQSuggestiongeneratedfromStockorOtherRequisition
10.1.600 ProductionManagement MaterialRequirementsP 176265 Application Linesetssource"Quote:0"
10.1.600 ProductionManagement MaterialRequirementsP 176345 Application NewPOSuggestionsPO/Linesearchdoesnotalwaysworkcorrectly
NewPOSuggestionsUpdatedPartDescriptiontakenfromReqEntryisnot
10.1.600 ProductionManagement MaterialRequirementsP 182787 Application displayedwithinNewPOSuggestionMaterialListTab
TimePhasedInquiryTransferOrderSuggestioncheckboxconsiderstheTransfer
10.1.600 ProductionManagement MaterialRequirementsP 184857 Application OrdersasSuggestions
TimePhasedInquiryBalancevalueisnotcalculatedproperlyonBuyToOrderSO
10.1.600 ProductionManagement MaterialRequirementsP 185348 Application andPurchaseDirectJob
ProcessMRPError"JobOperationnotavailableforroughcutscheduling"
10.1.600 ProductionManagement MaterialRequirementsP 186174 Application displayedinlog

Page35
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


NewPOSuggestionsObjectreferenceerrorgeneratingPOfromSuggestionwith
10.1.600 ProductionManagement MaterialRequirementsP 186298 Application regularandBTOLine
10.1.600 ProductionManagement MaterialRequirementsP 186330 Application ProcessMRPGeneratesPOSuggestionstobuytoomuchmaterial
TimePhasedInquiryWhenapartontheflyisenteredonTimePhasedInquiryand
10.1.600 ProductionManagement MaterialRequirementsP 186347 Application Refreshiconisselected,errordisplays
GenerateSuggestionsPOSuggestionWarehouseisnotsetfromOrderRelease
10.1.600 ProductionManagement MaterialRequirementsP 186623 Application Warehouse
NewPOSuggestionsOnSubcontratSuggestion,SupplierPriceListdoesnotfocus
10.1.600 ProductionManagement MaterialRequirementsP 186735 Application onSubcontracttab
ProcessMRPProcessstopsformakedirectmaterialsthatwillsupplyajobwiththe
10.1.600 ProductionManagement MaterialRequirementsP 187333 Application samePartId
ProcessMRPNounfirmjobiscreatedforthe3rdreleaseoranorderlinefora
10.1.600 ProductionManagement MaterialRequirementsP 187804 Application configuredpart
NewPOSuggestionsNorowatposition1erroronSearchscreenwhenusing
10.1.600 ProductionManagement MaterialRequirementsP 188420 Application GroupByfunction
NewPOSuggestionsSuggestioncomingfromSOwithcustomerwithoutPrimary
10.1.600 ProductionManagement MaterialRequirementsP 188434 Application ShipToAddresscannotbeaddedasanewPOReleaseLine
GenerateSuggestionsCreatesSuggestionsaskingformorethanrequiredforLock
10.1.600 ProductionManagement MaterialRequirementsP 188447 Application QuantititesfromPOEntry
ProcessMRPError"Specifiedargumentwasoutoftherangeofvalidvalues"is
10.1.600 ProductionManagement MaterialRequirementsP 188835 Application displayed
ProcessMRPSupplierQtychangesto0onPurchaseOrdersconfirmedby
10.1.600 ProductionManagement MaterialRequirementsP 189110 Application ConfirmVia=Web
ProcessMRPDoesnotrespectLotSizesettingandcreatesmoreunfirmjobsthan
10.1.600 ProductionManagement MaterialRequirementsP 189198 Application expectedforconfiguredparts
ProcessMRPCreatesextrasuggestions,unfirmjobsandexpeditemanualjobs
10.1.600 ProductionManagement MaterialRequirementsP 189320 Application withoutconsideringminonhand

10.1.600 ProductionManagement MaterialRequirementsP 189595 Application ProcessMRPStopsprocessingduetotimingoutbecauseofalongschedulingtime


NewPOSuggestionsGeneratesuggestionupdatesUnitCostofthesubcontract
10.1.600 ProductionManagement MaterialRequirementsP 189902 Application operations
NewPOSuggestionsMultipleconfiguredBuytoOrderlinesarecombinedintoa
10.1.600 ProductionManagement MaterialRequirementsP 190131 Application singlePOlinelosingtheconfigurations
NewPOSuggestionsAftersettingSupplierID,Currencyvaluenotassigned(Non
10.1.600 ProductionManagement MaterialRequirementsP 190134 Application MultiCurrencyenvironment)
10.1.600 ProductionManagement MaterialRequirementsP 190982 Application NewPOSuggestionsHardcodederrorstringsexistinapplication
10.1.600 ProductionManagement MaterialRequirementsP 190983 Application NewPOSuggestionsNovalidationdonewhenenteringaPOLine
NewPOSuggestionsUpdatingUnitPricefromPartusingUOMandOverride
10.1.600 ProductionManagement MaterialRequirementsP 191170 Application conversion,changestheOurQtyandUnitPriceaswell

Page36
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


TimePhasedInquiryErrorwhenunselectingSuggestionscheckboxonPartwithno
10.1.600 ProductionManagement MaterialRequirementsP 191224 Application demand

10.1.600 ProductionManagement MaterialRequirementsP 192246 Application ProcessMRPMRPdoesnotfinishandtakesalltheprocessingRAMavailable


ProcessMRPPlanasassemblymaterialswithminlotsizeandmultipledefinedget
10.1.600 ProductionManagement MaterialRequirementsP 192276 Application incorrectOverrunQty
ForecastEntryError"Cannotfindpartofthepath"whenimportinginaForecast
10.1.600 ProductionManagement MaterialRequirementsP 192575 Application Proforecastfile
NewPOSuggestionsChangingQuantity,setsUnitPrice=DocUnitPricefor
10.1.600 ProductionManagement MaterialRequirementsP 192654 Application ForeignSupplierPOSug
TimePhasedMtlRequirementsReportdoesnotdisplayPartswithzeroOnHand
10.1.600 ProductionManagement MaterialRequirementsP 193381 Application Quantity
ProcessMRPForecastconsumptionissueoverproducingandendingwitha
10.1.600 ProductionManagement MaterialRequirementsP 193447 Application balanceabovetheSafetyStock
10.1.600 ProductionManagement MaterialRequirementsP 193557 Application ProcessMRPMRPcreatesuneededunfirmjobs
ProcessMRPRemovesincorrectlysuggestionsfromPartsontheflyrelatedto
10.1.600 ProductionManagement MaterialRequirementsP 193755 Application SalesOrders

ProcessMRPandPlanningworkbenchGetDetailsdoesnotrunmethodrulesfor
10.1.600 ProductionManagement MaterialRequirementsP 194164 Application noinputconfiguratorlinesthathavenothadconfigureclickedontheline
GenerateSuggestionsProvidetotheSuggestion,thesameUnitPricevalue
10.1.600 ProductionManagement MaterialRequirementsP 194218 Application assignedonlastPOgenerated
ProcessMRPEveryrunincreasestheshopload(ActualLoad,overloadandwhatif
10.1.600 ProductionManagement MaterialRequirementsP 194796 Application load)
ForecastEntryErrorwhenimportingfilewithForecastIntegrationforForecast
10.1.600 ProductionManagement MaterialRequirementsP 194882 Application Pro,inCloudenvironment

10.1.600 ProductionManagement MaterialRequirementsP 195115 Application MRPDoesnotdeletejobs,itonlycreatesachangesuggestiontocancelthejob


TimePhasedMtlRequirementsReportwhenSuggestionsareuncheckedbutthey
10.1.600 ProductionManagement MaterialRequirementsP 195188 Application stillappear
ProcessMRPJobsforProductConfiguratorPartswithdemandofmaketostockor
10.1.600 ProductionManagement MaterialRequirementsP 195208 Application maketojobarenotcreated
TimePhasedInquiryWhendoinginmemoryqueries,thestringfieldsneedtobe
10.1.600 ProductionManagement MaterialRequirementsP 195460 Application changedtoignorecase
10.1.600 ProductionManagement MaterialRequirementsP 195905 Application ProcessMRPMRPignorescutoffdateinsomeinstances
ProcessMRPRemovehardcoded12hourtimeoutinthreadinstantiationinorder
10.1.600 ProductionManagement MaterialRequirementsP 196625 Application toalwaysuseWCFtimeoutvaluesdefinedintheweb.config
ProcessMRPCannotGetDetailsonconfiguredpartswithphantomsforsome
10.1.600 ProductionManagement MaterialRequirementsP 196997 Application futurerequireddates

Page37
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


ProcessMultiLevelPeggingFailsandanerrordisplays"ViolationofPRIMARYKEY
10.1.600 ProductionManagement MaterialRequirementsP 198098 Application constraint'PK_PegSupMst'"

10.1.600 ProductionManagement MaterialRequirementsP 200088 Application ProcessMRPStopsprocessingforanspecificpartbecauseofcircularloops


MaintenanceJobEntryCannotuseSerialtrackedpartsasmaterialswhenusing
FullLowerLeverSerialTrackingastheonlyavailableoptioninMaintenanceJobsis
10.1.600 ProductionManagement PreventiveMaintenance 186245 Application FixedQuantity
MaintenanceRequestEntryCannotaccessTopicEntry,withContextMenu,
10.1.600 ProductionManagement PreventiveMaintenance 187317 Application withoutCaseManagementModuleonLicense

10.1.600 ProductionManagement PreventiveMaintenance 188914 Application MaintenancePlanProcessorCreatesmaintenancejobswithouttheirPlanNumber


MaintenanceJobEntryJobclosedcheckboxisunavailablewhenpreventchanges
10.1.600 ProductionManagement PreventiveMaintenance 194280 Application isenabled
EquipmentTrackerMaintenanceLogRetrievebuttonisdisabledifEquipment
10.1.600 ProductionManagement PreventiveMaintenance 194348 Application recordwastypedin
10.1.600 ProductionManagement PreventiveMaintenance 197407 Application MaintenancePlanProcessorMMEquipmentMaintenanceJobTemplates
ProjectCostPlusInvoiceReviewWhenselectingActions>RecalculateInvoice
10.1.600 ProductionManagement ProjectBilling 149098 Application menu,errorisdisplayed
EngineeringWorkbenchOperationattachmentsaddedfromOperation
10.1.600 ProductionManagement QualityAssurance 175562 Application maintenancearenotdisplayed
InspectionProcessingWIPQuantityofaSubcontractisnotdecreasedwhen
10.1.600 ProductionManagement QualityAssurance 182479 Application InspectionProcessingisdone
InspectionPendingFirstArticlesaredisplayedinthereportmorethanonetime,
10.1.600 ProductionManagement QualityAssurance 184527 Application onetimeforeachupdate
DMRProcessingOverrideConversionfromReceiptEntryisnotconsideredinDMR
10.1.600 ProductionManagement QualityAssurance 185417 Application Processing
WarehouseNovalidationbetweensitesthatindicatesthereisalreadyaStock
10.1.600 ProductionManagement QualityAssurance 186053 Application defaultwarehouse
DMRProcessingNoneoftheDMRmemocategoriesdisplayintheMemoCategory
10.1.600 ProductionManagement QualityAssurance 186312 Application dropdown
10.1.600 ProductionManagement QualityAssurance 186437 Tools CorrectiveActionApplicationbecamenonfunctionalinEWA
10.1.600 ProductionManagement QualityAssurance 186573 Application CorrectiveActionErrordisplayswhentryingtoopen

10.1.600 ProductionManagement QualityAssurance 186602 Application DMRProcessingBlankerrormessagedisplayswhentryingtodeleteaDMR


DMRProcessingTransactionsdonotconsidertheprimaryinventoryUOMforthe
10.1.600 ProductionManagement QualityAssurance 186824 Application MtlBurUnitCostcalculation
PurchaseOrderEntryPOcanbedeletedafterPOLineisaddedintoaReceipt
10.1.600 ProductionManagement QualityAssurance 187820 Application createdwithnoPOnumber

Page38
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


WarehouseNoerrormessageisdisplayedwhengivingincorrectvaluesforCycle
10.1.600 ProductionManagement QualityAssurance 188659 Application CountMethod
10.1.600 ProductionManagement QualityAssurance 188662 Application WarehouseDisplayedwindowheightisnotenough
10.1.600 ProductionManagement QualityAssurance 192126 Application DMRProcessingLockratedoesnotworkproperly

10.1.600 ProductionManagement QualityAssurance 192238 Application InspectionProcessingInspectionProcessingdoesnottakedefaultDocumentType


EngineeringWorkbenchWhengettingdetailsfromQuoteTemplateanerroris
10.1.600 ProductionManagement QualityAssurance 193905 Application displayed
NonconformanceSystempicksthefirstlineinsteadoftheonewiththeUOM
10.1.600 ProductionManagement QualityAssurance 195737 Application selected
InspectionPendingReportdisplaysasInspectionPendingtheinspectionsalready
10.1.600 ProductionManagement QualityAssurance 195997 Application approved
InspectionProcessingDocumentTypeshouldnotbedisplayediftheUserisnotan
10.1.600 ProductionManagement QualityAssurance 197277 Application AuthorizedUserforthatdocument
InspectionProcessingSystemcreatesthemfgstktransactionininspectionwithan
10.1.600 ProductionManagement QualityAssurance 200142 Application incorrectdate
SchedulingEngineFirstresourceisassignedforalltheblockswhenthenumberof
10.1.600 ProductionManagement Scheduling 155624 Application schedulingblocksishigherthantheresources
JobSchedulingBoardBoardignoresthematerialcontraintsifthereare
10.1.600 ProductionManagement Scheduling 172263 Application subassembliesusingthesamematerialastheASM0

10.1.600 ProductionManagement Scheduling 182761 Application MultiResourceSchedulingBoardResourcesgobacktotheoriginallocation


JobSchedulingBoard"FiniteCapacity"doesnotconsiderthesamejobloadwhen
10.1.600 ProductionManagement Scheduling 185099 Application schedulingusingsomeoptionsintheboards
MultiResourceSchedulingBoarddoesnotallowtomoveindividuallyscheduling
10.1.600 ProductionManagement Scheduling 185298 Application blocks

10.1.600 ProductionManagement Scheduling 185494 Application SchedulingEngineDoesnotconsiderSendAheadforBackwardScheduling


GlobalFiniteSchedulingGlobalScheduleloadthesameresourceindifferent
10.1.600 ProductionManagement Scheduling 185689 Application blocksevenwhentherearemoreresourcesavailable
ResourceSchedulingBoardListtabshowsdatesinsteadoftimesforStartTime
10.1.600 ProductionManagement Scheduling 186449 Application andEndTime
SchedulingEngineQueueTimeisnotcorrectlydisplayedifithasmorethan30
10.1.600 ProductionManagement Scheduling 187009 Application hours
JobSchedulingBoardErrordisplayswhenusingthemoveoption:JobAllJobsfor
10.1.600 ProductionManagement Scheduling 187592 Application regularjobswithsubassemblies
10.1.600 ProductionManagement Scheduling 187670 Application SchedulingEngineDaysoutcalculatesQueueTimeinexceptionsdays
SchedulingEngineDatesoffuturesuppliesareconsideredforJobMaterialswith
10.1.600 ProductionManagement Scheduling 187801 Application Qty/Parent=0

Page39
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


SchedulingEngineAutoconsumedoesnotreducethedaysoutfromthe
10.1.600 ProductionManagement Scheduling 187888 Application subcontractoperations
10.1.600 ProductionManagement Scheduling 188763 Application ResourceSchedulingBoardDoesnotallowtoUndoChanges
SchedulingEngineSchedulingshouldhonorcalendarexceptionswhenscheduling
10.1.600 ProductionManagement Scheduling 189516 Application resources
10.1.600 ProductionManagement Scheduling 189615 Application FillShopCapacityProcessProcessincreasesthedailycapacityperday
MultiResourceSchedulingBoardWhenusingdraganddropforjobs,itdoesnot
10.1.600 ProductionManagement Scheduling 190327 Application multiplytheproductionfactor
10.1.600 ProductionManagement Scheduling 190437 Application ResourceSchedulingBoardErrorisdisplayedwhenaresourceislocked
SchedulingEngineIfaJobthatalreadyhaslabordetailsisrescheduled,the
10.1.600 ProductionManagement Scheduling 191015 Application pendingloadisremovedfromtheshoploadtable

10.1.600 ProductionManagement Scheduling 191874 Application FillShopCapacityProcessQueryblocksShopCaptablewhendeletingoldrecords


SchedulingEngineFiniteHorizoncannotbeignoredtoallowschedulingfinitelyin
10.1.600 ProductionManagement Scheduling 193441 Application anydate
JobSchedulingBoardTakestheJobasontime(blue)insteadofoutoftime(red)
10.1.600 ProductionManagement Scheduling 193704 Application whenERPistranslatedtoDutch
CalculateGlobalSchedulingOrderError"Objectreference"displaysonlogsfor
10.1.600 ProductionManagement Scheduling 194753 Application specificjobs
SchedulingEngineSchedulesincorrectlysomeoperationswithfiniteresourcesuse
10.1.600 ProductionManagement Scheduling 195083 Application inmorethanonejob
10.1.600 ProductionManagement Scheduling 196279 Application SchedulingEngineCTPdoesnotpullqtycorrectly
10.1.600 ProductionManagement Scheduling 196282 Application SchedulingEnginePendingissuesrelatedtoschedulingresources
SchedulingEngineDoesnotschedulewhenusingoverlappingcalendarsonyour
10.1.600 ProductionManagement Scheduling 197051 Application resources
SchedulingEngineLoadamountsareincreasedwhenreschedulingajobandusing
10.1.600 ProductionManagement Scheduling 198303 Application Hungaryformatculture
SchedulingEngineDoesnotconsiderMakeDirectjobsDueDateaheadofmfg
10.1.600 ProductionManagement Scheduling 199836 Application LeadTime
Time&ExpenseApprovalTime&Expenserecorddetailstatusiconsarenot
10.1.600 ProductionManagement TimeManagement 143574 Application coloredcorrectlyintree

10.1.600 ProductionManagement TimeManagement 144508 Application TimeSheetEntryNavcontrolautomaticallydefaultsforthefirstemployee


TimeSheet&ExpenseApprovalLabortransactionsthatrequireapproval,arenot
10.1.600 ProductionManagement TimeManagement 153989 Application displayedinEWA
TimeSheetEntryUnabletosubmittimewhenhaving2Time&ExpensesEntry
10.1.600 ProductionManagement TimeManagement 167699 Application screensopen
TimeSheetEntryLaborRateisincorrectwhenusingmultipleresourcesonone
10.1.600 ProductionManagement TimeManagement 182086 Application operation

Page40
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description

10.1.600 ProductionManagement TimeManagement 185574 Application TimeSheetEntryPayHoursarenotcalculatedforclockoutduringlunchtime


TimeSheetEntryReduceslunchtimeforlaborandburdenhrseverytimelabor
10.1.600 ProductionManagement TimeManagement 185776 Application recordsarecreated
10.1.600 ProductionManagement TimeManagement 185854 Application TimeSheetEntryTime&ExpensesEntrydoesnotconsiderScrapQuantity

10.1.600 ProductionManagement TimeManagement 187015 Application TimeReportLaborTypecolumnlabelisnotfullydisplayedintheSSRSReport


TimeSheetEntryWhenaddinganewexpensecommentinTime&ExpenseEntry
10.1.600 ProductionManagement TimeManagement 187416 Application theExpenseTaxAmountis0.00
TimeSheetEntryAllowsabilitytodeleteTime&Expenserecordsifthelabordtl
10.1.600 ProductionManagement TimeManagement 187461 Application recordisstillinReviewJournal
TimeSheetEntryDisablestheReworkReasonfieldwhenReworkReasoncheckbox
10.1.600 ProductionManagement TimeManagement 187586 Application isfalseinCompanyConfig

10.1.600 ProductionManagement TimeManagement 187588 Application TimeSheetEntryDoesnotallowtheusertoSave/SubmitwithoutaScrapReason


TimeSheetEntryError:"Laborcannotbereportedtoanonlocationresource."is
10.1.600 ProductionManagement TimeManagement 187997 Application displayedwhenaddinganewweeklytime
TimeSheetEntryDoesnotapprovearecalllaborrecordwhentherearemore
10.1.600 ProductionManagement TimeManagement 188019 Application thanoneinthetree
TimeSheetEntryWhenaddinganewexpensecommentinTime&ExpenseEntry
10.1.600 ProductionManagement TimeManagement 188031 Application theExpenseTaxAmountis0.00
TimeSheetEntryWhensubmittingrecordwithoutinspectiondata,thescreenis
10.1.600 ProductionManagement TimeManagement 188096 Application clearedwhenpressing[No]invalidationmessage

10.1.600 ProductionManagement TimeManagement 188871 Application TimeSheetEntryDisplays24hrsaftershiftisoverforlaborandburdenhrs


TimeSheetEntryFortheHCMintegration,cannotdeleteLaborDtlrecordsthrough
10.1.600 ProductionManagement TimeManagement 189302 Application ServiceConnect
TimeSheetEntryRTUBlockinganddeadlocksonice.notificationtablesince
10.1.600 ProductionManagement TimeManagement 190761 Application migratingto10.1.400.15from400.14
TimeSheetEntryDoesnotconsiderLaborDtlfieldforcalculationsifitsstatusis
10.1.600 ProductionManagement TimeManagement 191259 Application None
10.1.600 ProductionManagement TimeManagement 191581 Application TimeSheetEntryDepartmentisnotbeingretreived
TimeSheetEntryQuestionblankmessagedisplayswhenaninvalidresourceis
10.1.600 ProductionManagement TimeManagement 191675 Application entered
TimeSheetEntryFortheHCMIntegration,IncorrecthoursexportedtoHCMwhen
10.1.600 ProductionManagement TimeManagement 192978 Application decimalsareusedinTimeDetail
TimeTypeShouldnotberequiredifavalidrolecodechargerateexistsforaT&M
10.1.600 ProductionManagement TimeManagement 193564 Application project

Page41
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


TimeSheetEntryDoesnotremoveASMINStransactionsafterdoingrecalland
10.1.600 ProductionManagement TimeManagement 194155 Application removinglabordetailswithnonconformance
TimeandExpenseAdjustingburdenhoursdoesnotincludeLaborQtyforthat
10.1.600 ProductionManagement TimeManagement 197248 Application operationinthejobtotals
TimeSheetEntryDoesnotallowtosubmitlaborrecordsforSerialNumber
10.1.600 ProductionManagement TimeManagement 198842 Application RequiredOperations
RMAProcessingCreditInvoicedefaultsthegroupfromPartMasterandnotfrom
10.1.600 SalesManagement CustomerRelationshipM 91230 Application theSalesOrder

10.1.600 SalesManagement CustomerRelationshipM 94494 Application CustomerAddingaBanktoaCustomerisallowedwithoutinputofaBankID


RMAProcessingNoreasoncodeissetinPartTranforRMAINSsononedisplaysin
10.1.600 SalesManagement CustomerRelationshipM 181218 Application thePartTranTracker
RMAProcessingUnabletodeleteRMAProcessingrecordonceithasaLegal
10.1.600 SalesManagement CustomerRelationshipM 182288 Application NumberLinesaved
RMAProcessingCreditMemoforOneTimecustomeriscreatedwithincorrect
10.1.600 SalesManagement CustomerRelationshipM 182560 Application data,errorsdisplay
GlobalAlertQuoterelatedGlobalalert1000and1030doesnottriggermemoor
10.1.600 SalesManagement CustomerRelationshipM 183165 Application email
SalespersonWorkbenchDoesnotallowtoupdatetasksfromsalespersons,
10.1.600 SalesManagement CustomerRelationshipM 184087 Application displaysincorrecttasks

10.1.600 SalesManagement CustomerRelationshipM 184727 Application CaseEntryUncompleteataskfromaprevioustasksetwilldeletetheactivetask

10.1.600 SalesManagement CustomerRelationshipM 186412 Application OrderTrackerBillToCustomerIDisnotdisplayedon1stMiscellaneousInvoice


10.1.600 SalesManagement CustomerRelationshipM 186488 Application PriceListPartUOMdefaultsInventoryUOMinsteadofSalesUOM

10.1.600 SalesManagement CustomerRelationshipM 186910 Application CustomerPrimaryBankisnotdisplayedfirstbydefaultinBanksDetailtab


CustomerCustomerrecordcanbedeletedeventhoughitreferstoaShipToon
10.1.600 SalesManagement CustomerRelationshipM 186926 Application theSalesOrder

10.1.600 SalesManagement CustomerRelationshipM 187006 Application CaseEntryInactivecontactisavailabletochooseasPerson/ContactinCaseEntry


10.1.600 SalesManagement CustomerRelationshipM 187007 Application SalesTerritoryRecordcannotbesavedcorrectlyinEWA
10.1.600 SalesManagement CustomerRelationshipM 187082 Application CustomerTrackerOrangestarnotplacedoverMemoicon
10.1.600 SalesManagement CustomerRelationshipM 187084 Application CustomerOrangestarnotplacedoverAttachmenticon
PriceListDiscountpricelistscanbedeletedevenwhenreferencedonaCustomer
10.1.600 SalesManagement CustomerRelationshipM 187283 Application orCustomerGroup
RMAProcessingQuantityandCustomerExt.PricearenegativeonSummary|
10.1.600 SalesManagement CustomerRelationshipM 187541 Application Creditstab

Page42
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


CustomerCustomergetsinholdafterpostingDepositBillingforsmalleramount
10.1.600 SalesManagement CustomerRelationshipM 187579 Application thanCreditLimit
TaskListWorkforceSearchdoesnotreturnallrecordswhenmorethan100
10.1.600 SalesManagement CustomerRelationshipM 187610 Application workforcerecords
10.1.600 SalesManagement CustomerRelationshipM 187741 Application TaskStatusErrordisplayswhentryingtodeletesingletask

10.1.600 SalesManagement CustomerRelationshipM 187827 Application RMAProcessingChangeFIFODatelogicoftheRMAReturnFIFOenhancement


CustomerGroupAddinganewDiscountPriceListtriggerserrorAvalidPriceList
10.1.600 SalesManagement CustomerRelationshipM 187835 Application isrequired
OrderTrackerNoBillToAddressisdisplayed,Customernotsetas"SameasSold
10.1.600 SalesManagement CustomerRelationshipM 187886 Application To"
CustomerCannotswitchbetweenopenscreens,onceyouopenascreenusing
10.1.600 SalesManagement CustomerRelationshipM 187972 Application ContextMenu
CaseEntryWhenchangingtasksetstheworkforceprimarymemberisnot
10.1.600 SalesManagement CustomerRelationshipM 188095 Application assignedtotherelatedTask

10.1.600 SalesManagement CustomerRelationshipM 188232 Application OrderTrackerReviewingaConfigurationjumpsfrom1stPagetolastPage


CustomerError"Incorrectsyntaxnearthekeyword'AND'"whensearchingall
10.1.600 SalesManagement CustomerRelationshipM 188236 Application typesofCustomers
CustomerTrackerInfofromJobstabdoesnotmatchwithJobreferringtoSales
10.1.600 SalesManagement CustomerRelationshipM 188998 Application Orderselected
CustomerUsingContextMenutocreateaQuotedisplaysincorrectdataIDinthe
10.1.600 SalesManagement CustomerRelationshipM 189423 Application QuoteCreated
CaseEntryDidn'tRetrievetheBankoftheCustomerwhencreatingtheSales
10.1.600 SalesManagement CustomerRelationshipM 189819 Application Order
CustomerSelectingCallLogfromContextMenu,createsaCallLogforprevious
10.1.600 SalesManagement CustomerRelationshipM 189898 Application Customer
CustomerIncorrectSyntaxSQLerrorwhenselectingTerritoryhavingaquotation
10.1.600 SalesManagement CustomerRelationshipM 190004 Application mark(')onitsID
CaseEntryOption"CreateQuote(HeaderandLine)"generatesaQuotewithouta
10.1.600 SalesManagement CustomerRelationshipM 190444 Application Projectvalue
CustomerError"InvalidWhereClause"whenopeningCustomerPartCrossRef
10.1.600 SalesManagement CustomerRelationshipM 190659 Application fromContextMenu
RMAProcessingError"AValidLegalNumberisrequired"whenadding/saving
10.1.600 SalesManagement CustomerRelationshipM 190871 Application morethan1Receipt
TaskListRemainsvisiblesubmittedrecordsalreadydeletedfromTimeand
10.1.600 SalesManagement CustomerRelationshipM 190929 Application ExpenseforProjects
PersonContactWithSearchscreenmaximized,noresultsarelistedonSearch
10.1.600 SalesManagement CustomerRelationshipM 191058 Application Resultsgrid

Page43
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


10.1.600 SalesManagement CustomerRelationshipM 191163 Application RMAProcessingUnabletodeleteRMAProcessingrecord
RMAProcessingRadiobuttonsonLegalNumberSearcharenotenabledwhen
10.1.600 SalesManagement CustomerRelationshipM 191702 Application Search&Selectcustomer
RMAProcessingDetailandReceiptgridsareshowingandallowingupdateto
10.1.600 SalesManagement CustomerRelationshipM 192150 Application columnsthatshouldbehidden
TaskDoesnotautopopulatetheAssignedTorecordeventhoughthecustomer
10.1.600 SalesManagement CustomerRelationshipM 192454 Application hasasalespersonassigned
10.1.600 SalesManagement CustomerRelationshipM 192837 Application CustomerPossibletogenerateduplicatePersonContactID's(PerConID)
CaseEntryQuotelinecreatedfromcaseisnotreceivingtheProductGroupsetup
10.1.600 SalesManagement CustomerRelationshipM 192900 Application onthepart
RMAProcessingAfterselectingalegalnumbertheCustomerBillTodisplayszero
10.1.600 SalesManagement CustomerRelationshipM 192901 Application oranumberinsteadofCustID
10.1.600 SalesManagement CustomerRelationshipM 193226 Application CustomerPossibledeadlockonShipTowhencreatingcustomer
10.1.600 SalesManagement CustomerRelationshipM 193415 Application CustomerTakestoomuchtimerefreshingscreenonShipTotab

10.1.600 SalesManagement CustomerRelationshipM 193861 Application CustomerUnabletouncheckCreditHoldwhen1090GlobalAlertisturnedon


10.1.600 SalesManagement CustomerRelationshipM 193952 Application CaseEntryAtCaseEntryinServiceContractsearch,returnsnothing
GlobalAlertGivesduplicatekeyerrorsbecauseAlertQueQueueNumSequence<
10.1.600 SalesManagement CustomerRelationshipM 194225 Application highestAlertnumonAlertQuetable
10.1.600 SalesManagement CustomerRelationshipM 194326 Application RMAProcessingRMACreditmemotakesincorrectpackingslip
CustomerOnQuotewhenyoucreateanewContactandenteraShiptothatdoes
notexistontheCustomer,theContactandtheShipToarecreatedbutyouarenot
10.1.600 SalesManagement CustomerRelationshipM 194372 Application abletoseethemonCustomerEntry
RMAProcessingOnSearchscreen,usingaStartingAtvalue,doesnotreturnany
10.1.600 SalesManagement CustomerRelationshipM 198128 Application SalesOrderrecords
10.1.600 SalesManagement CustomerRelationshipM 198838 Application CaseEntryAddtaskfunctionwilldisablethenexttask
10.1.600 SalesManagement CustomerRelationshipM 199120 Application CustomerCSFNetherlandsTAXidvalidation
DemandReconciliationSearchbuttonandBinocularsdonotretrieveallthe
10.1.600 SalesManagement DemandManagement 86052 Application recordsselected
10.1.600 SalesManagement DemandManagement 170076 Application DemandEntryChangingorderlinedoesnotcopyconfiguration
DemandEntryExt.PriceisnotcalculatedproperlywhenSalesOrderisgenerated
10.1.600 SalesManagement DemandManagement 185728 Application withTaxInclusive

10.1.600 SalesManagement DemandManagement 187101 Application DemandContractEntryCustomerPartCrossreferenceisnotretrievedcorrectly


DemandCumulativeVariancesReportSavedefaults/Getdefaultsactionsnobring
10.1.600 SalesManagement DemandManagement 188384 Application thedefaults
DemandEntryOrdercanbecreatedfromDemandEntywhenCustomerhasValid
10.1.600 SalesManagement DemandManagement 190239 Application SoldTo=False

Page44
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description

10.1.600 SalesManagement DemandManagement 190994 Application DemandEntryPartinformationisnotretrievedwhenenteringCustomerPartfirst


DemandEntryErrordisplayedwhenenteringacontractlinemorethanonceafter
10.1.600 SalesManagement DemandManagement 191521 Application thedemandisprocessedbyImportEDI
DemandEntryAssigninganincorrectCrossRefPartTypewhencheckingfor
10.1.600 SalesManagement DemandManagement 191641 Application ProductCodesinthePart
DemandEntryInfodisplayedonDemandReconciliationdoesnotmatchtheinfo
10.1.600 SalesManagement DemandManagement 192303 Application oftheContractitrefersto
10.1.600 SalesManagement DemandManagement 193045 Application MassPrintPackingSlipsShouldsupportincludePCIDDetails
DemandEntryNoLoggeneratedwhengeneratingSalesOrderwithsamePO
10.1.600 SalesManagement DemandManagement 194022 Application numberasanexistingone
DemandEntryIncorrectcontract\partdisplayswhenclickingonDemandReconcile
10.1.600 SalesManagement DemandManagement 194788 Application buttononcumulativetab

10.1.600 SalesManagement DemandManagement 196449 Application DemandNetChangeReportReturnsHundredsofpageswithnoorderinformation


DemandProcessingOnlydisplaysinfoofOrderRelease1,butnottheother
10.1.600 SalesManagement DemandManagement 198756 Application ReleasesofsameOrder
EDIInboundSalesOrdergeneratedwithReadyToProcess=True,differentas
10.1.600 SalesManagement EDI 184269 Application definedatCompanylevel
EDIInboundPOLineisnotassignedtodemandswhenanEDIfileisprocessedwith
10.1.600 SalesManagement EDI 188170 Application thesamepartondifferentlines

10.1.600 SalesManagement EDI 189398 Application EDIInboundOrdercreatedwithincorrectpricewhen'zeroprice'pricelistexists


EDIInboundCreatingOrderRelease,doesnotconsidertheShipBydatevalue
10.1.600 SalesManagement EDI 190932 Application definedonEDIFile
EDIInboundPriceDiscountdefaultszerowhenmultipledemandcontractdetails
10.1.600 SalesManagement EDI 191398 Application exist
10.1.600 SalesManagement EDI 191401 Application EDIInboundPKLocal010errorwhenhavingalotofdemandimported
EDIInboundCustomerPricevaluesetproperlyonDemand,butnotonDemand
10.1.600 SalesManagement EDI 191799 Application ContractnorSalesOrder
EDIInboundFirstlookatDeliveryDaysonCustomer'sShipTo,thenonCustomer's
10.1.600 SalesManagement EDI 198210 Application DemandDeliveryDays
EDIInboundDemandcreatedwithdefaultCurrencyvalue,insteadofDemand
10.1.600 SalesManagement EDI 198341 Application Contract'scurrency

10.1.600 SalesManagement OrderManagement 79914 Application OrderEntryMakinganOrderReleaseUnfirmwillnotremoveitssuggestion


OrderEntryAbletocreateaSalesorderwithan"invalidsoldto"Customerifit
10.1.600 SalesManagement OrderManagement 96766 Application comesfromaquote

Page45
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description

10.1.600 SalesManagement OrderManagement 103519 Application FulfillmentWorkBenchUnabletoallocatebylotforcustomermanagedBin


10.1.600 SalesManagement OrderManagement 106858 Application PartRemoveActions/Revisions/Changemenuitem
PartPrimaryBindropdownfieldinWarehouse>listtabdisplaysallbinsonthe
10.1.600 SalesManagement OrderManagement 131776 Application plant
10.1.600 SalesManagement OrderManagement 180458 Application PartDuplicatepartfunctionshouldnothaveSaaskeywordrestrictions
10.1.600 SalesManagement OrderManagement 182364 Application PartRefreshbuttondoesnotwork

10.1.600 SalesManagement OrderManagement 182416 Application FulfillmentWorkBenchShipViavalueisnotdisplayedonTransferOrders


RMADispositionsEnteringaWHSforaPlantnotassignedtothePartdoesnot
10.1.600 SalesManagement OrderManagement 182772 Application createPartPlantrecord
SalesOrderPickListSOPickLprintslargerthanalandscape11"x8.5"pagewhen
10.1.600 SalesManagement OrderManagement 184350 Application printeddirectlytoclient
OrderEntryErrordisplayedwhenchangingaConfigurableparttoConfigurable
10.1.600 SalesManagement OrderManagement 184352 Application PartwithSaveInputValuesinaline
OrderEntryCreatingHeaderofaNewOrder,displaysDestinationAddressof
10.1.600 SalesManagement OrderManagement 185091 Application CustomerofpreviousOrder
OrderEntryAttemptedtodividedbyzeroerrorwhenchangingSalesKitParams
10.1.600 SalesManagement OrderManagement 185181 Application value
OrderEntryChangingProductGroupofSalesKitOrderLine,doesnotupdate
10.1.600 SalesManagement OrderManagement 185206 Application Component'sProductGroup
PartNoClearConfirmationmessagedisplayd"Clearthisform?"whenchangesare
10.1.600 SalesManagement OrderManagement 185352 Application alreadysaved
10.1.600 SalesManagement OrderManagement 185371 Application OrderEntryCannotsetLineMiscChargeAmount=0.00
10.1.600 SalesManagement OrderManagement 185429 Application PartCannotsearchforanotherPartrecordifchangesarenotsaved
FulfillmentWorkBenchUnitPriceCurrencycolumnshowsforeigncurrencyvalue,
10.1.600 SalesManagement OrderManagement 185459 Application insteadofBaseCurrency
IncomingIntercompanyPOSuggestionsCompletelyshippedPOshowsaspartially
10.1.600 SalesManagement OrderManagement 185685 Application closed
SSRSSalesOrderAcknowledgmentReportSalesOrderisnotprintedwithupdated
10.1.600 SalesManagement OrderManagement 185763 Application MiscChargeDescriptionvalue
OrderEntryTaxisappliedtoSalesKitComponentseventhoughTaxType=Fully
10.1.600 SalesManagement OrderManagement 186054 Application Exempt
SSRSSalesOrderAcknowledgmentReportCurrencysymbolontotalslineissymbol
10.1.600 SalesManagement OrderManagement 186295 Application forbasecurrencynotordercurrency
RMADispositionsErp.Tables.RMADisperrordisplayedwhensavingrecordwith
10.1.600 SalesManagement OrderManagement 186401 Application UnitCost=UseCurrentCosts
10.1.600 SalesManagement OrderManagement 186414 Application OrderEntryCannotassigntheProjectIDwiththeSalesOrder

Page46
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


PartNavigationcontrolbarshowsthefirstpartonthelistinsteadofthecurrent
10.1.600 SalesManagement OrderManagement 186440 Application PartID

10.1.600 SalesManagement OrderManagement 186447 Application PriceListInquiryDiscountsfromdiscountpricelistsarenotdisplayedcorrectly


OrderEntryErrordisplayedwhensavingsalesorderafterconfiguringcomponent
10.1.600 SalesManagement OrderManagement 187098 Application forSalesKit
OrderEntryOrderLineDiscountnotappliedonRptFieldswhenusingTaxInclusive
10.1.600 SalesManagement OrderManagement 187104 Application andPriceGroup

10.1.600 SalesManagement OrderManagement 187168 Application Part"Index1","InputString",and"modifiedbyanotheruser"errorsdisplayed


PartCoPartsRevddlfieldbecomesdisabledonNewClickbyaddingmorethan
10.1.600 SalesManagement OrderManagement 187190 Application oneCoParttothejob
OrderEntryChangingProductGrouptoaProductGrouphavingnosalessite
10.1.600 SalesManagement OrderManagement 187386 Application changessiteonreleasetologgedinsite
OrderEntryTaxesarecalculatedincorrectlywhentherearemiscchargesinthe
10.1.600 SalesManagement OrderManagement 187550 Application orderandTaxcodeismanuallyadded

10.1.600 SalesManagement OrderManagement 187578 Application OrderEntryPriceinfoisnotdisplayedwhenhavingTaxInclusivemanuallyadded

10.1.600 SalesManagement OrderManagement 187583 Application FulfillmentWorkBenchGetWarehouseInfomethodneedstobeapublicmethod


RMATrackerEachrowisduplicatedinthetabofReceipts|internaltabSerial
10.1.600 SalesManagement OrderManagement 187584 Application Number
DeferredUpdateIfrecordsofPartQty/PartLotgetprocessedinadifferentprocess,
10.1.600 SalesManagement OrderManagement 187725 Application aninfiniteloopiscreatedthatspikestheCPU
OrderEntryAbandonedDeferredUpdatelogicshouldexcluderecordsfromactive
10.1.600 SalesManagement OrderManagement 187833 Application sessions
OrderEntryWarehouseassignedonCounterSaleisnotsetwhencreatingthe
10.1.600 SalesManagement OrderManagement 187905 Application ShippingPack

10.1.600 SalesManagement OrderManagement 188021 Application OrderEntryCreateDemandEntriesfunction,createdDemandmissinginformation


OrderEntryWarehouseassignedonCounterSaleisnotsetwhencreatingthe
10.1.600 SalesManagement OrderManagement 188078 Application ShippingPack
OrderEntryDiscount%valueremainswhenchangingtoaUOMvaluenotdefined
10.1.600 SalesManagement OrderManagement 188209 Application onaPriceList
OrderEntryFromWarehousevaluechangestoPrimaryWarehousevaluewhen
10.1.600 SalesManagement OrderManagement 188219 Application updatingSalesUnitPrice

10.1.600 SalesManagement OrderManagement 188248 Application PriceListInquiryIfonlyPartIDinfoisentered,pricinginfoisnotdisplayed

Page47
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


OrderEntryChangingtheexistingSalesOrdertoOneTimeShipTo,deletesNeed
10.1.600 SalesManagement OrderManagement 188258 Application ByandShipByvalues
10.1.600 SalesManagement OrderManagement 188283 Application PartPurchasedPartcanbesetasPhantomBOMthroughupdatableBAQ
PartUOMConversionUtilityProcesschangesPart'sInventoryUOM,butnotits
10.1.600 SalesManagement OrderManagement 188338 Application UOMClass

10.1.600 SalesManagement OrderManagement 188497 Application RefreshPartQuantitiesAndAllocationsTakes17hourstocompleteprocess

10.1.600 SalesManagement OrderManagement 188557 Application FulfillmentWorkBenchWavePickTicketdoesnothasaReportStyledefined


10.1.600 SalesManagement OrderManagement 188604 Application OrderEntryBookDetailscreatesanonexistentadditionalrecord
TaxTypeUpdatingTaxtypeafteraddingittoataxliabilitycancausemissed
10.1.600 SalesManagement OrderManagement 188736 Application validationsandmissbehavior
OrderEntryDiscountamountchangestozerowhenconfiguringapartinOrders
10.1.600 SalesManagement OrderManagement 188875 Application butnotQuotes
SSRSSalesOrderAcknowledgmentReportExt.Pricefieldshows5decimals;
10.1.600 SalesManagement OrderManagement 189034 Application CompanyandCurrencyareconfiguredtoshow2
OrderEntryUnabletoselecttheMakedirect,errordisplays:"Thispropertycannot
10.1.600 SalesManagement OrderManagement 189050 Application besettoanullvalue."

10.1.600 SalesManagement OrderManagement 189063 Application PartRemoveTrailingSpacewhencreatingPartfromActions/Duplicatefunction


OrderAllocationUpdatetoPartQtyneedstogothroughDeferredUpdatetoavoid
10.1.600 SalesManagement OrderManagement 189072 Application deadlock
10.1.600 SalesManagement OrderManagement 189088 Application UOMClassTypeTimedoesnotappearindropdownlist
SalesOrderPickListReleasesprintedseveraltimesonSalesOrderwithmultiple
10.1.600 SalesManagement OrderManagement 189185 Application Releases
OrderEntryOnConfigurationscreen,whenmovingtolastpage,firstPageis
10.1.600 SalesManagement OrderManagement 189192 Application displayed
OrderEntryChangingWarehouseonaCounterSalesOrderLine,OnHand
10.1.600 SalesManagement OrderManagement 189306 Application Quantityvaluedoesnotrefresh
OrderEntryBookDetailsonashippedorderlinearereversedwhenReadyissetto
10.1.600 SalesManagement OrderManagement 189528 Application falseandthenbacktotrue
PriceListInquiryBreakPriceisnotdisplayedifthePartbelongstoaPriceGroup
10.1.600 SalesManagement OrderManagement 189536 Application thathasQtyBreaks
OrderEntryDiscountamountisclearedoutwhenOrderQuantityischanged(also
10.1.600 SalesManagement OrderManagement 189624 Application whenotheradditionalfieldsarechanged)
OrderEntryFromWarehousevaluechangestoPrimaryWarehousevaluewhen
10.1.600 SalesManagement OrderManagement 189768 Application updatingProjectID
OrderEntryDeadlocksreportedduetounnecessaryUpdateLockinPartquery
10.1.600 SalesManagement OrderManagement 190067 Application whengettingthekitcomponents

Page48
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


SalesKitsSequenceoftheKitComponentsonkitdetailsisnotthesameasthey
10.1.600 SalesManagement OrderManagement 190173 Application aredisplayedontheBOM
OrderEntryTaxisnotrecalculatedafterclosingaLineandsettingReadyTo
10.1.600 SalesManagement OrderManagement 190206 Application Process=True
OrderEntryAmountvaluesarenotcalculatedproperlywhenchangingExchange
10.1.600 SalesManagement OrderManagement 190248 Application RateandOrder'sCurrency
OrderEntryUsertiedtoWorkForcewithoutaTerritoryselected,canworkwith
10.1.600 SalesManagement OrderManagement 190251 Application SalesOrders
RMADispositionsOpeningReasonEntryusingContextMenu,ReasonTypevalueis
10.1.600 SalesManagement OrderManagement 190424 Application notset

10.1.600 SalesManagement OrderManagement 190439 Application OrderEntryNotallowedtogenerateCounterSalesOrderforaNonStockSalesKit


OrderEntryError"Unabletocheckallocations"onCounterSOforSalesKitwith
10.1.600 SalesManagement OrderManagement 190448 Application noPrimaryBinonComponents
FulfillmentWorkBenchAllocationsaretimingoutwhenattemptingtolock
10.1.600 SalesManagement OrderManagement 190566 Application PartQty
10.1.600 SalesManagement OrderManagement 190672 Application OrderEntryDiscount%islostwhenNeedByDatechanged
10.1.600 SalesManagement OrderManagement 190705 Application OrderAllocationUpdatelockonPartQtycausingdeadlock
OrderEntryCommssionsarenotcalculatedproperlywhenSalespersonisremoved
10.1.600 SalesManagement OrderManagement 190798 Application andsetagain
SSRSSalesOrderAcknowledgmentReport"Ordendeventa"labelandSalesorder
10.1.600 SalesManagement OrderManagement 190839 Application numbernotfullydisplayed
OrderEntryNowarningmessagewhenaddingaSalesKitthathasanothersaleskit
10.1.600 SalesManagement OrderManagement 190849 Application ascomponent
PartUOMConversionUtilityConversiondoesnotupdate/clearexistingpart
10.1.600 SalesManagement OrderManagement 190872 Application specificUOMConversions
10.1.600 SalesManagement OrderManagement 190908 Application ScheduledShipmentsCalc_RptUserID=NULL,itshouldhaveUserIDvalue
TaxTypeGLControlenteredforTaxTypeEffectiveRatedisappearsafter
10.1.600 SalesManagement OrderManagement 190965 Application reopeningTaxType
OrderEntryAmountvaluesarenotcalculatedproperlyforMiscChargesandtaxes
10.1.600 SalesManagement OrderManagement 191006 Application whenchangingExchangeRateandOrder'sCurrency
10.1.600 SalesManagement OrderManagement 191122 Application RefreshPartQuantitiesAndAllocationsAttempttodividebyzeroerror
OrderEntryCreatingathirdpartyshiporderwithaShipTobyactionget
10.1.600 SalesManagement OrderManagement 191309 Application opportunity/quote
10.1.600 SalesManagement OrderManagement 191354 Application OrderEntryShipByTimeassignedatHeaderlevel,isnotsetonReleases
PartRemove"DemandEntry"fromrulethatverifiesexistingdemandswhen
10.1.600 SalesManagement OrderManagement 191358 Application settingPartasInactive
OrderEntryDeadlocksreportedonJobProdtablebyTitanwhenmultipleusers
10.1.600 SalesManagement OrderManagement 191365 Application addsaleskits

Page49
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


10.1.600 SalesManagement OrderManagement 191440 Application PartSomePurchasedPartshavethePhantomBOMselectedbydefault
10.1.600 SalesManagement OrderManagement 191533 Application OrderEntryDiscount%islostlinewhen'shipto'ischanged
QuoteEntryDiscountPriceListinaSalesKitComponentarenotdisplayedon
10.1.600 SalesManagement OrderManagement 191646 Application QuoteEntryKitDetails

10.1.600 SalesManagement OrderManagement 191757 Application PartPrimarybinfieldofnewWarehouseiscleareddependingofSaveclickorder


RMADispositionsBindefaultstoPrimaryBin,eventhoughitisinactive;error
10.1.600 SalesManagement OrderManagement 191789 Application displays
OrderEntryTaxAmountisnotcalculatedproperlyusingaManualTaxCalculation
10.1.600 SalesManagement OrderManagement 191804 Application andaFixedtaxamount
10.1.600 SalesManagement OrderManagement 191850 Application OrderEntryBookDtlandBookRelrecordsneedtobecreated
10.1.600 SalesManagement OrderManagement 192154 Application RMATrackerGridsshowcolumnsthatshouldbehidden
10.1.600 SalesManagement OrderManagement 192196 Application PartUnauthorizedsitecanbesavedforthePart
OrderEntryOpeningSalesOrderEntryfromContextMenu,OrderEntryscreen
10.1.600 SalesManagement OrderManagement 192295 Application opens,butinfoisnotrefreshed
OrderEntryPartDescriptionofKitComponentsshowsforeignlanguage
10.1.600 SalesManagement OrderManagement 192453 Application description
FulfillmentSystem.Data.EntityCommandExecutionException:Anerroroccurred
10.1.600 SalesManagement OrderManagement 192490 Application whilereadingfromthestoreprovider'sdatareader
10.1.600 SalesManagement OrderManagement 192527 Application OrderEntryComponentsofParentPricedSalesKitsarenotpriced
OrderEntryError"Invalidsiteforoneormorecomponentsofthissaleskit"when
10.1.600 SalesManagement OrderManagement 192632 Application changingSitevalue

10.1.600 SalesManagement OrderManagement 192752 Application ProFormaInvoiceReportPartDescriptionisnotprintedforKitcomponents


10.1.600 SalesManagement OrderManagement 192869 Application OrderEntryListpriceisnotsavedcorrectly
PartAddingapreviousdeletedSitealsobringsbackSharedWarehousestothat
10.1.600 SalesManagement OrderManagement 192874 Application Site
10.1.600 SalesManagement OrderManagement 192898 Application OrderAcknowledgeAddressdoesnotfitonthelowerwindowenvelope

10.1.600 SalesManagement OrderManagement 192977 Application FulfillmentWorkBenchOrdercanbewaveallocatedwithnoPackStation


PartMemosareduplicatedonoriginalPartwhencreatingPartbyActions/
10.1.600 SalesManagement OrderManagement 193164 Application Duplicate
RefreshPartQtyandAllocModifyreporttoshowwhenPartWhseandempty
10.1.600 SalesManagement OrderManagement 193349 Application WarehouseCode
10.1.600 SalesManagement OrderManagement 193418 Application OrderEntryBlockingonJobProdtablewhenordersareimported
OrderEntryWhenaShipToisconfiguredwithoutaShipVia,itshouldalwaysuse
10.1.600 SalesManagement OrderManagement 193647 Application thedefaultShipViasetforthecustomer
UOMClassUOMIDvalueisalwaysdisplayedinUPPERCASE,regardlessthecase
10.1.600 SalesManagement OrderManagement 193649 Application theUOMIDwascreated

Page50
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description

10.1.600 SalesManagement OrderManagement 193666 Application OrderEntryGetOpportunityQuotedoesnotretrievetheHeaderComments


OrderEntryOnBTOOrderLine,itisallowedtoupdateOrderQuantityvaluetoa
10.1.600 SalesManagement OrderManagement 193667 Application lowerone
OrderEntryOnSalesOrderKitDetails,"NoneSelected"isdisplayedonDiscount
10.1.600 SalesManagement OrderManagement 193678 Application PriceListwhenyoucreateanonstockSalesKit
OrderEntrySetting[LinktoPlaningContract]tofalsedoesnotremovethe
10.1.600 SalesManagement OrderManagement 193727 Application demandonthePlanningContract

10.1.600 SalesManagement OrderManagement 193742 Application CapableToPromiseErrordisplayedforPartstiedtonoinputconfigurationtypes

OrderEntryOrderQuantityfromKitComponentsissettoKitQtyinaCopied
10.1.600 SalesManagement OrderManagement 193744 Application OrderwhenareleaseisaddedtoanOrderLinedifferentthanSalesKit
10.1.600 SalesManagement OrderManagement 193831 Application PartErrorwhendeletingtheprimarywarehouse
IncomingIntercompanyPOSuggestionsProcessingICPOwithsamePONumber,
10.1.600 SalesManagement OrderManagement 193881 Application createsSalesOrderwithdifferentquantity

10.1.600 SalesManagement OrderManagement 194042 Application OrderEntryLockUnitPricechangesOrderQuantityforComponentSalesKits


OrderEntryTaxesarenotcalculatedproperlyonaLinewithUnitPrice=0.00and
10.1.600 SalesManagement OrderManagement 194147 Application DiscountAmt
Partw3wp.exeisconsumingalltheCPUduetoanerrorconditioncodethatleads
10.1.600 SalesManagement OrderManagement 194441 Application toaninfiniteloop

10.1.600 SalesManagement OrderManagement 194623 Application IncomingIntercompanyPOSuggestionsScreenisnotfollowingUIStandards


RMADispositionsCannotsaveaftercreatingarecordwithaJobthathasaParton
10.1.600 SalesManagement OrderManagement 194781 Application theflyasamaterial
FulfillmentWorkBenchMaterialQueueReportprintsallselectedSerialNumbers
10.1.600 SalesManagement OrderManagement 194819 Application oneachPart
10.1.600 SalesManagement OrderManagement 195074 Application FulfillmentWorkBenchCrossdockingoverallocatesaveragecostparts
OrderJobWizardJoboperation'sestimatedhoursandworkqueue'soperation
10.1.600 SalesManagement OrderManagement 195122 Application quantityincorrectinsomecases
IncomingIntercompanyPOSuggestionsErrorwhenRejectingupdatedPO
10.1.600 SalesManagement OrderManagement 195177 Application Suggestions
OrderEntryOnaReopenOrder,Taxcalculationdoesnotconsiderthe
10.1.600 SalesManagement OrderManagement 195438 Application MiscellaneousChargeamount
FulfillmentWorkBenchContractBinisnotdisplayedonaLinkToContract
10.1.600 SalesManagement OrderManagement 195533 Application demand

10.1.600 SalesManagement OrderManagement 195622 Application OrderEntryCounterSaledoesnotusecompanysequencetogeneratepacknums

Page51
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


OrderEntryLotNumberrequiredaftersettingLotNumbertoSalesKitComponent
10.1.600 SalesManagement OrderManagement 195686 Application onaCounterSales
OrderEntrySalesKitquantityandTotalvaluesarenotcalculatedaccordingto
10.1.600 SalesManagement OrderManagement 195867 Application UOMdefinition(RoundUp)
IncomingIntercompanyPOSuggestionsAfterRejectingupdatedPOSuggestion,
10.1.600 SalesManagement OrderManagement 196296 Application thePOcannotbeupdated
OrderEntryOrderisnotcreatedusingGetOpportunity/Quotefunctionon
10.1.600 SalesManagement OrderManagement 196330 Application Customerdefinedas:CheckDupPO
SSRSSalesOrderAcknowledgmentReportAddresssetonRelease,differentfrom
10.1.600 SalesManagement OrderManagement 196338 Application Header,isnotprintedonthereport

10.1.600 SalesManagement OrderManagement 196499 Application OrderEntryDeadlockonpartllocatOrderReltriggerlibrariesandtriggeritself


10.1.600 SalesManagement OrderManagement 196503 Application OrderEntryDeadlockonpartallocandmtlqueue
10.1.600 SalesManagement OrderManagement 196505 Application OrderEntryUnnecessaryexcessivelockingonPartSugg
10.1.600 SalesManagement OrderManagement 196615 Application OrderEntryIncorrectcalculationforExtPricewhenprintingthereport

10.1.600 SalesManagement OrderManagement 197067 Application OrderEntryDatesonlinesarechangedwhennotmatchingpreviousheaderdates

10.1.600 SalesManagement OrderManagement 197217 Application OrderEntryTaxamountisnotclearedwhenlineandTaxLiabilityaredeleted


CapableToPromiseJobOperInspentryisnotremovedcausingCTPcalctohangin
10.1.600 SalesManagement OrderManagement 197258 Application future
RefreshPartQtyandAllocTrackingMultipleUOMPartProcessissuggestingto
10.1.600 SalesManagement OrderManagement 197462 Application changeQuantityOnHandtothevaluefromPartBinUOM
OrderEntryDiscountfromPriceGroupdoesnotgetpickedupwhenLineQty
10.1.600 SalesManagement OrderManagement 198014 Application changed
IncomingIntercompanyPOSuggestionsErrorwhenloadingPOSuggestioninICPO
10.1.600 SalesManagement OrderManagement 198157 Application Suggscreen

DemandEntryAfterupdatingDemandHeadtargetentity,errordisplayswhen
10.1.600 SalesManagement ProductConfiguration 142994 Application usingDocRuleof"SetDemandHead.CustNumfieldoftargetentityto"1"value"
ConfiguratorRulesConfiguratorMethodRule'SetPartDefaults'errorsoutforkits
10.1.600 SalesManagement ProductConfiguration 155523 Application whenswappinginPartonFly

10.1.600 SalesManagement ProductConfiguration 160975 Application TestInputsUsesincorrectpartnumberandrevisionnumberforlaunchingtheUI


UserDefinableMethodWhenmethodnameexistsintheexpressionaspartof
10.1.600 SalesManagement ProductConfiguration 162479 Application anotherwordtheuserisunabletodeletethemethod
10.1.600 SalesManagement ProductConfiguration 163842 Application TestRulesRulefunctionsdonotdisplaytextintheTestResultsgrid
10.1.600 SalesManagement ProductConfiguration 163879 Application RunTimeSummarydisplaySavebuttonisdisabled
10.1.600 SalesManagement ProductConfiguration 164317 Application ConfiguratorRulesExcludefrompricingrulefunctionisalwaysexecuted

Page52
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


ConfiguratorRunTimeWarningmessageregardingtoKitComponentsisdisplayed
10.1.600 SalesManagement ProductConfiguration 166653 Application whencreatingaQuotefromCaseEntry

10.1.600 SalesManagement ProductConfiguration 167030 Application ConfiguratorDesignerDoesnotallowNegativeIncrementsonDecimalInputs


ConfiguratorPartCreationErrordisplayedwhenPromptforCheckoutoptionis
10.1.600 SalesManagement ProductConfiguration 167325 Application selectedonPartCreationtab
ConfiguratorRunTimeUnabletoreconfigurewhendeletingsubassembly'
10.1.600 SalesManagement ProductConfiguration 167837 Application elementswhichweremanuallyadded
ConfiguratorTestRulesWhenSwappingaPart,theSubConfigurationoftheNew
10.1.600 SalesManagement ProductConfiguration 169023 Application PartisnotpromptedonTestRulesSession
ConfiguratorCodeEditorErrormessagedisplayedwhenreopeningAdd
10.1.600 SalesManagement ProductConfiguration 170012 Application ReferencesScreenifwehaveusedOptions
10.1.600 SalesManagement ProductConfiguration 171696 Application ConfiguratorCodeEditorAddtooltiptoPages.PageSkip
ConfiguratorDesignerMaximum/Minimumdatesnotrefreshedafteran
10.1.600 SalesManagement ProductConfiguration 171739 Application exceptionandRefreshisselected
ConfiguratorDocument&MethodRulesColumnNameisEditableandalsoitis
10.1.600 SalesManagement ProductConfiguration 173670 Application notclearedfordifferententitiesonMethodRules
ConfiguratorCodeEditorReferenceAssemblyUIshowsindexoutofrange
10.1.600 SalesManagement ProductConfiguration 176527 Application exceptionanddoesnotrefreshcorrectly
ConfiguratorContextFunctionsFunctionsforPOdataandSupplierdonotpullthe
10.1.600 SalesManagement ProductConfiguration 176706 Application propervaluesinInspectionResults
ConfiguratorRulesChangingthetypeofcolumnarenotreset,thecompare
10.1.600 SalesManagement ProductConfiguration 177308 Application optionslike"greaterthan"
ConfiguratorDesignerCannotdeleteinputsthatarenotreferencedintheUDM
10.1.600 SalesManagement ProductConfiguration 180231 Application expressions
ConfiguratorRunTimeAmbiguousmatchfoundwhensavingconfiguratorinSales
10.1.600 SalesManagement ProductConfiguration 180326 Application OrderorQuoteEntry

10.1.600 SalesManagement ProductConfiguration 181188 Application ConfiguratorRunTimeKeepwhenrulesnotworkingwithConfiguratorontheFly


ConfiguratorDocumentRulesCodeeditorandexpressionbuilderneedsECC
10.1.600 SalesManagement ProductConfiguration 181242 Application CommentandDrawNumadded
ConfiguratorRunTime"SetOperationMasterDefaults"functionisnotretrieving
10.1.600 SalesManagement ProductConfiguration 181434 Application thenewvendornum
ConfiguratorDesignerGetSmartStringfunctiondoesnotworkwiththepreface
10.1.600 SalesManagement ProductConfiguration 182025 Application withpartoption
10.1.600 SalesManagement ProductConfiguration 183545 Application ConfiguratorDynamicListsListgridcolumnsneedcomboboxesadded
10.1.600 SalesManagement ProductConfiguration 183558 Application ConfiguratorLookUpObjectreferenceerrorwhenclickingNew
ConfiguratorEntryPartcreationdoesnotcreatethecorrectsequences
10.1.600 SalesManagement ProductConfiguration 183583 Application PcStruct.StructID

Page53
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


ConfiguratorPricingUnitPriceiscalculatedincorrectlywhenusingcomponent
10.1.600 SalesManagement ProductConfiguration 183782 Application pricinginMultiLevelconfigurators
EnterpriseConfiguratorServerProcessErrorwhensendingmethodrulesona
10.1.600 SalesManagement ProductConfiguration 185300 Application MultiLevelscenarioandprocessstops

10.1.600 SalesManagement ProductConfiguration 185723 Application VerifyConfigurationsTaskagentrestartsonadatabasewithalotofrecords


ConfiguratorRunTimeDisableDocumentrulesfromNoinputsconfiguratorsfrom
10.1.600 SalesManagement ProductConfiguration 185725 Application subassembliesaddedmannually
EnterpriseConfiguratorServerProcessKeepComponentWhenrulesarenot
10.1.600 SalesManagement ProductConfiguration 185741 Application honoredonthesalescompany
ConfiguratorFieldProperties"Specifiedcastisnotvalid"errorwheninitializinga
10.1.600 SalesManagement ProductConfiguration 185750 Application DateTimeEditorinput
ConfiguratorFieldPropertiesUnabletogetfieldpropertiesfromDateTimeInput
10.1.600 SalesManagement ProductConfiguration 185753 Application andunabletosetnulltoMaximumDateandMinimumDate
ConfiguratorRulesErrordisplayedwhentheTopParthasmorethanonerevision
10.1.600 SalesManagement ProductConfiguration 185837 Application withfutureeffectivedates

10.1.600 SalesManagement ProductConfiguration 186159 Application ConfiguratorUserDefinableFunctionsTabNameshouldnotdisplay"Panel"


ConfiguratorUserDefinableFunctionsParametersarenotaddedwhenclicking
10.1.600 SalesManagement ProductConfiguration 186332 Application Newicon
ConfiguratorContextFunctionsMissingDemandHeadNumber,
10.1.600 SalesManagement ProductConfiguration 186341 Application DemandLineNumber,POLineNumber,PONumbertoCode
ConfiguratorContextFunctionsAssemblySeqwhenisaddedaquoteassembly
10.1.600 SalesManagement ProductConfiguration 186372 Application configuredisalways0
ConfiguratorDesignerRadiosetselectstheincorrectoptionunlessclickingdirectly
10.1.600 SalesManagement ProductConfiguration 186734 Application ontheradiobutton
ConfiguratorLookUpIndexerrorwhentryingtochangeformatondecimals
10.1.600 SalesManagement ProductConfiguration 186742 Application columns
ConfiguratorDynamicListsDynamiclistisnotconsideringthevalueoftheinputs
10.1.600 SalesManagement ProductConfiguration 187071 Application whentherearetoomanyofthemonasinglecondition
ConfiguratorFieldPropertiesComboboxDescriptionisnotavailablefor
10.1.600 SalesManagement ProductConfiguration 187094 Application configuratorrulesordocumentrules
ConfiguratorRulesSetPartDefaultsrulefunctiondoesnotpullinthematerial
10.1.600 SalesManagement ProductConfiguration 187114 Application burdencostcorrectlyinquotes
ResourceGroupResourcesfromotherResourceGroupsarenotdisplayedinthe
10.1.600 SalesManagement ProductConfiguration 187284 Application treeviewwhenrefreshingthewindow
ConfiguratorRunTimeGetDetailsdoesnotworkwhenremovingtheelementsof
10.1.600 SalesManagement ProductConfiguration 187743 Application aSubassemblyandGettingDetailsagain

Page54
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


ConfiguratorRunTimeQuotestopsafterremovingtheelementsofaSubassembly
10.1.600 SalesManagement ProductConfiguration 187753 Application andGettingDetailsagain
ResourceGroupDonotallowmovingaresourcealreadyassignedtoaJobtoa
10.1.600 SalesManagement ProductConfiguration 187988 Application differentSite
ConfiguratorEventsErrorwhenafieldchangedeventisselectedfromadateinput
10.1.600 SalesManagement ProductConfiguration 188131 Application field
10.1.600 SalesManagement ProductConfiguration 188214 Application ConfiguratorCodeEditorTargetEntitiesthatweredeletedkeepappearing
ConfiguratorDesignerErrorwhensettingradiosetvisiblefromanonfieldchanged
10.1.600 SalesManagement ProductConfiguration 188513 Application event
ConfiguratorImport/ExportWhenexportingaconfiguratortoanexistingXMLfile
10.1.600 SalesManagement ProductConfiguration 188683 Application avalidationismissing
ConfiguratorImport/ExportDoesnotshowexceptionatConfiguratorimporting
10.1.600 SalesManagement ProductConfiguration 188904 Application withoutAssemblypath
ConfiguratorSalesKitsErrordisplayedwhenPartCreationisenableandKeepwhen
10.1.600 SalesManagement ProductConfiguration 188966 Application conditionisset
ConfiguratorLookUpErrorwhenimportingpreviousimportedCSVfilethathas
10.1.600 SalesManagement ProductConfiguration 189095 Application beenmodified
10.1.600 SalesManagement ProductConfiguration 189105 Application ConfiguratorPricingApplicationstopsMultilevelPricingComponent
ConfiguratorPricingRulesActionsarenotreflectedintheUnitPriceusing
MultilevelPricingComponentwitharulefunctiontochangethepartofa
10.1.600 SalesManagement ProductConfiguration 189326 Application subassembly
ConfiguratorDesignerEpicorAppstopswhenaDynamicListisassignedtothe
10.1.600 SalesManagement ProductConfiguration 189440 Application sameinput
ConfiguratorPricingQuotelinediscountamountisnotupdatedafterreconfig
10.1.600 SalesManagement ProductConfiguration 189506 Application whenthepartnumberchanges
ConfiguratorSalesKitsInputsvaluesarenotupdatedwhenconfiguredfromKit
10.1.600 SalesManagement ProductConfiguration 189533 Application Details
ConfiguratorDynamicListsDynamicListconditionsnottestedcorrectlyusing
10.1.600 SalesManagement ProductConfiguration 189546 Application "Old"valueinsteadof"NEW"
ConfiguratorPricingAssemblymaterialsunitpricearenotincludedafterthe3rd
10.1.600 SalesManagement ProductConfiguration 190243 Application subassemblyforcomponentpricing
EnterpriseConfiguratorDirectServerProcessErroroutsendingPORelupdatesto
10.1.600 SalesManagement ProductConfiguration 190542 Application mfgcompany
EnterpriseConfiguratorDirectServerProcessInputsfromadditionallinesaddedto
10.1.600 SalesManagement ProductConfiguration 190677 Application linkedordersarelost
ConfiguratorPricingDiscount%isnotupdatedwhenswappingapartvia
10.1.600 SalesManagement ProductConfiguration 190716 Application Configurator
ConfiguratorPricingAssemblymaterialsUnitPricenotcorrectforcomponent
10.1.600 SalesManagement ProductConfiguration 190918 Application pricing;itsusingtheASMprice

Page55
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


10.1.600 SalesManagement ProductConfiguration 190993 Application ConfiguratorEntryNotabletoaddmemos

10.1.600 SalesManagement ProductConfiguration 191697 Application ConfiguratorSalesKitsSaveButtononSingleLevelConfigurationonSalesKit


10.1.600 SalesManagement ProductConfiguration 191756 Application ConfiguratorDynamicListsDoesnotsaveinformationpastedfromExcel
ConfiguratorRunTimeErrorwhenmultipleuserssavethesameconfiguration
10.1.600 SalesManagement ProductConfiguration 192134 Application simultaneously
ConfiguratorPartCreationTestrulesandGettingDetailsfromaconfiguredpart
10.1.600 SalesManagement ProductConfiguration 192800 Application withsaveinputvalueserrors
ConfiguratorPartCreationCreatesanewconfiguredpartwithoutthe
10.1.600 SalesManagement ProductConfiguration 192983 Application PartRev.ProcessModeonitsrevision
ConfiguratorRulesCompareoptionslike"greaterthan"displayerrorwithmax
10.1.600 SalesManagement ProductConfiguration 193041 Application numberofcharacterserror
ConfiguratorRulesAfterremovingaruleaction,cannotresequencetheorderof
10.1.600 SalesManagement ProductConfiguration 193216 Application otherruleactions
ConfiguratorEventsForaconfiguredkitPageOnloadedeventrunsasecondtime
10.1.600 SalesManagement ProductConfiguration 193286 Application afterleavingthepage
RegenerateConfigurationsAfterapproving,aconfiguratorprocesswillnot
10.1.600 SalesManagement ProductConfiguration 193501 Application completeinsomedatabases
ConfiguratorPricingDiscount%isnotupdatedwhenswappingapartvia
10.1.600 SalesManagement ProductConfiguration 193534 Application configuratorwithECC
ConfiguratorEntryError"Inputstringwasnotinacorrectformat."whenusing
10.1.600 SalesManagement ProductConfiguration 194098 Application French(Canada)language
ConfiguratorDesignerStopsprocessingwithexceptionswithmultipageapproved
10.1.600 SalesManagement ProductConfiguration 194289 Application configurator
10.1.600 SalesManagement ProductConfiguration 194511 Application ConfiguratorDesignerCannotdeleteblankpage;Indexerrorisdisplayed
10.1.600 SalesManagement ProductConfiguration 195250 Application ConfiguratorSalesKitsErrorinXMLdocument(1,2)
ConfiguratorEWAConfiguratorcomboboxesdonotrecognizekeyboardvaluesto
10.1.600 SalesManagement ProductConfiguration 195529 Tools locateclosestmatchedrecord
10.1.600 SalesManagement ProductConfiguration 195985 Application ConfiguratorDesignerCannotdeleteblankpageindex;Errorisdisplayed
ConfiguratorRulesForSaleskitstheredruleexistsicondisappearswhen
10.1.600 SalesManagement ProductConfiguration 196194 Application refreshingthescreen
EnterpriseConfiguratorServerProcessErrorswhenrunfromasalescompany
10.1.600 SalesManagement ProductConfiguration 196829 Application whenmultipleconfiguratorsareapprovedinmfgcompany
EnterpriseConfiguratorServerProcessDoesnottransferreferenceassemblies
10.1.600 SalesManagement ProductConfiguration 196948 Application datacorrectly
ConfiguratorDynamicListsDynamicListshouldonlybeshownwhenthecondition
10.1.600 SalesManagement ProductConfiguration 196996 Application ismet
EnterpriseConfiguratorServerProcessStopsprocessingwhenrunningtheprocess
10.1.600 SalesManagement ProductConfiguration 197172 Application foralotofcompaniesatsametime

Page56
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


ConfiguratorDynamicListsWhenrefreshdynamiclistclearsacombobox,itcan
10.1.600 SalesManagement ProductConfiguration 197809 Application resultinobjecterror

10.1.600 SalesManagement ProductConfiguration 198821 Application ConfiguratorEntryWhenavalueendswith0thesystemdoesnotpulldata


ProductConfiguratorAnyconfiguredlinethathasmultiplereleasesendsupwitha
10.1.600 SalesManagement ProductConfiguration 199553 Application jobwithanemptyMethodofManufacturingwhenMRPisrun

10.1.600 SalesManagement ProductConfiguration 200045 Application ConfiguratorRunTimeSmartStringinputvaluecanonlybeofacertainlength

10.1.600 SalesManagement ProjectManagement 144738 Application ProjectEntryCurrencyconversionexchangerecordwasnotfoundforcurrency


ProjectEntryCreateWBSPhaseJobbuttondoesnotlinkPlanningContracttonew
10.1.600 SalesManagement ProjectManagement 158956 Application Job
ProjectEntryObjectReferencewhenImportnewWBSPhasefromMSProject
10.1.600 SalesManagement ProjectManagement 159453 Application whenCreateWBSPhasecheckboxisnotselected
10.1.600 SalesManagement ProjectManagement 172503 Application ProjectEntryOnHandQtycalculationisincorrect
10.1.600 SalesManagement ProjectManagement 172955 Application ProjectEntryImportedProjectcaninterchangeJobsbetweenWBSPhases

10.1.600 SalesManagement ProjectManagement 176926 Application ProjectTrackerMore.../Summary/ProjecttabisexcludingtheODCintheTotal


ProjectEntryManualCTCODCOtherDirectCostisclearedafterrunningBuild
10.1.600 SalesManagement ProjectManagement 178910 Application ProjectAnalysistwice
ProjectAnalysisExportIfajobisnotlinkedtoaWBSphase,BuildProjectAnalysis,
10.1.600 SalesManagement ProjectManagement 178966 Application recalculatesitasifitwasanewjob
ProjectEntryAllowschangingfromaProjectInvoicingMethodthatallows
10.1.600 SalesManagement ProjectManagement 180171 Application differentcustomerstoonethatdoesnot
10.1.600 SalesManagement ProjectManagement 180572 Application ProjectEntryUsercanselectSitesthatuserdoesnothaveauthorization
ProjectEntryWhenrunningBuildProjectAnaylsisfordifferentProjects
10.1.600 SalesManagement ProjectManagement 182421 Application simultaneously,Ultraisgettingtimeouterrors
ProjectEntryShouldnotbeallowedimportprojectfilewhenitsjobsarerelatedto
10.1.600 SalesManagement ProjectManagement 184640 Application otherprojects
ProjectEntryDonotallowchangingthesalesorderwhenithasadifferent
10.1.600 SalesManagement ProjectManagement 186066 Application customerthanthepreviouslySOaddedintheproject
ProjectEntryProjecthasincorrectamountinCalculatedCTCwhenchoosingunit
10.1.600 SalesManagement ProjectManagement 186829 Application price/100
ProjectEntrySalesOrderisnotbeingunlinkedfromTime&Materialswhen
10.1.600 SalesManagement ProjectManagement 186835 Application projectlevelinvoicingmethodischanged
ProjectEntrySelectingathirdBurdenSetdifferenttothefirstsearchresultcauses
10.1.600 SalesManagement ProjectManagement 188046 Application aduplicatesequencenumber
10.1.600 SalesManagement ProjectManagement 188552 Application ProjectEntryBuildProjectAnalysisisnotsuccessfulforcertainprojects

Page57
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


ProjectEntryProjectJobsappeartobescheduledwhencreatedwithOrderJob
10.1.600 SalesManagement ProjectManagement 188749 Application Wizard
ProjectEntryAssigningaSOtoaCustomerShipmentorMilestoneBillingProject
10.1.600 SalesManagement ProjectManagement 188940 Application setstheProjectContractCustomer
ProjectEntryErrorismissingwhendeletingaWBSPhasewhichataskor
10.1.600 SalesManagement ProjectManagement 189250 Application milestoneislinkedto
ProjectEntryAbletoassignaSalesOrderalreadylinkedinadifferentProject
10.1.600 SalesManagement ProjectManagement 189265 Application InvoicingMethod

10.1.600 SalesManagement ProjectManagement 189834 Application ProjectEntryLaborandBurdenCostfieldsarereportingaincorrectquantity

10.1.600 SalesManagement ProjectManagement 189980 Application ProjectTrackerErrordisplayswhenclickingRetrievebuttoninJobTracker


InvoiceRevenueCapturedeventhoughtheCaptureRevenueRecognition>
10.1.600 SalesManagement ProjectManagement 190434 Application RecognitionMethodissettoManual
ProjectEntryErrorwhentryingtoduplicateaProjectbyselectingCreateWBS
10.1.600 SalesManagement ProjectManagement 190471 Application PhaseJobscheckbox
CaptureRevenue&COSRecognitionActualBurdenRecognitionfromBurden
10.1.600 SalesManagement ProjectManagement 191441 Application ActualPercentagedoesnotwork
ProjectEntryCustomerNumisdefaultediftheinvoicingmethodisdefinedasCost
10.1.600 SalesManagement ProjectManagement 191477 Application PlusinCompanyConfiguration

10.1.600 SalesManagement ProjectManagement 193444 Application ProjectEntryRevenueRecognitiondoesnotupdatetheInvoiced/ShippedColumns


ProjectEntryWIPODCarebookedtotheWIPMaterialaccountuponManual
10.1.600 SalesManagement ProjectManagement 193793 Application Revenue
ProjectEntryBuildAnalysisgivesObjectreferencenotsettoaninstanceofan
10.1.600 SalesManagement ProjectManagement 195524 Application objectinsomecases

10.1.600 SalesManagement ProjectManagement 196346 Application ProjectEntryBuildProjectAnalysisprocessdisplayserrorsforspecificprojects

10.1.600 SalesManagement ProjectManagement 196672 Application ProjectEntryBuildProjectAnalysiscalculatesincorrectlyActualBurdenHrs

10.1.600 SalesManagement ProjectManagement 199140 Application ProjectEntryActualBurdenHoursareclearedwhenaJobiscompletedorclosed


ProjectEntryRevenuerecognitionworkbenchdoesnotallowrecognitionofjob
10.1.600 SalesManagement ProjectManagement 200044 Application costsifthejobiscompleted

10.1.600 SalesManagement QuoteManagement 85635 Application PartTrackerDisplayssameCostingMethodforPlantsthathaveadifferentone


10.1.600 SalesManagement QuoteManagement 171544 Tools Opportunity/QuoteEntryEWAIssueswithattachmentinMfgDetailstab
Opportunity/QuoteEntryDiscounttakesDiscountPriceListwhentheBestCase,
10.1.600 SalesManagement QuoteManagement 181431 Application WorstCaseorConfidencevaluesarechanged

Page58
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


Opportunity/QuoteEntryConfigurebuttonneedstobedisabledfor
10.1.600 SalesManagement QuoteManagement 183454 Application configurationontheflyNICconfigurators

10.1.600 SalesManagement QuoteManagement 183662 Application Opportunity/QuoteEntryErrorwhenappendingdetailswithpartmrp001


Opportunity/QuoteEntryGetDetailsshoulddisablerevisionwhenisnot
10.1.600 SalesManagement QuoteManagement 186448 Application approvedlikeinJobEntry
Opportunity/QuoteEntryWithoutCRMLicense,CustomerandContactarenot
10.1.600 SalesManagement QuoteManagement 186496 Application loadedautomaticallywhenyousearchandselectthem
10.1.600 SalesManagement QuoteManagement 186588 Application PurchaseOrderTrackerTaxinformationmissingonPOTracker
Opportunity/QuoteEntryQuoteOrderWizarddoesnotconsidertheAuto
10.1.600 SalesManagement QuoteManagement 187024 Application Invoice/ERSOrdercheckboxflagged

10.1.600 SalesManagement QuoteManagement 187066 Application Opportunity/QuoteEntryResource'sLaborCostisnotpresentinLineWorksheet


JobTrackerErrordisplayswhenclickingRetrieveinJobTracker/Part
10.1.600 SalesManagement QuoteManagement 187193 Application Locations/WIPTab
Opportunity/QuoteEntryForconfiguredpartsmanualchangeofdiscount
10.1.600 SalesManagement QuoteManagement 187339 Application amountchangesto0whenSaved
10.1.600 SalesManagement QuoteManagement 187515 Application PartTrackerColumnnamesshouldbeWarehouseinsteadofWareHse
Opportunity/QuoteEntryTasksgetcorruptedifyouchangethecustomerrecord
10.1.600 SalesManagement QuoteManagement 187747 Application oncethisissaved
Opportunity/QuoteEntrySetstozeroCrewSizesvalueswithdrag/drop
10.1.600 SalesManagement QuoteManagement 188044 Application operationswithonlyresourcerequirements
Opportunity/QuoteEntryDiscountiscalculatedincorrectlyandPotentialisnot
10.1.600 SalesManagement QuoteManagement 188242 Application roundedproperly
JobTrackerJCmultiplejobmiscchargelinespostedonsingleinvoicedonot
10.1.600 SalesManagement QuoteManagement 188287 Application updatejobcorrectly
Opportunity/QuoteEntryBPMthatsetsquantityincopiedquotelinesnot
10.1.600 SalesManagement QuoteManagement 188664 Application workingwithjobcommentsfields

10.1.600 SalesManagement QuoteManagement 188962 Application Opportunity/QuoteEntryUnabletounquoteaquoteafterchangingtheShipTo


10.1.600 SalesManagement QuoteManagement 189084 Application Opportunity/QuoteEntryQuoteLineDiscountisnotpopulating
Opportunity/QuoteEntryTablespecificattachmentsarebeingattachedtoother
10.1.600 SalesManagement QuoteManagement 189181 Application table
Opportunity/QuoteEntryWhenaddingaNewTaskandselectingaNextTask,
10.1.600 SalesManagement QuoteManagement 189225 Application errorisdisplayed:NextTaskSeqreferencesinvalidvalue

10.1.600 SalesManagement QuoteManagement 189249 Application Opportunity/QuoteEntryUnabletomanuallycreateacontractrenewalquote


Opportunity/QuoteEntryWhentheOverridecheckboxisselectedthediscount%
10.1.600 SalesManagement QuoteManagement 189324 Application isnotupdatedaccordingwiththediscountpricelist

Page59
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description

10.1.600 SalesManagement QuoteManagement 189467 Application Opportunity/QuoteEntryDoesnotRetrievecommentswhencreateanOrder


Opportunity/QuoteEntryDoesnotapplythePriceListDiscountwithdefault
10.1.600 SalesManagement QuoteManagement 189867 Application quantity

Opportunity/QuoteEntryQuote'sCreateSalesOrderprocessisgeneratingSales
10.1.600 SalesManagement QuoteManagement 189928 Application OrderswithLine'sReleaseMakeDirect&BuytoOrderFlagssetincorrectly
Opportunity/QuoteEntryMilestonetaskcannotbemarkaswonifthefirstline
10.1.600 SalesManagement QuoteManagement 191168 Application hasaqtyofzero

10.1.600 SalesManagement QuoteManagement 191323 Application JobTrackerDoesnotretriveOprSeq,OprandSecintheSerialNumberTab


Opportunity/QuoteEntryIndexerrorafterchangingthepartnumberonaquote
10.1.600 SalesManagement QuoteManagement 191708 Application line
Opportunity/QuoteEntryErrorwhentherearemorethan1linewithdifferent
10.1.600 SalesManagement QuoteManagement 192431 Application UOMclass
10.1.600 SalesManagement QuoteManagement 192751 Application Opportunity/QuoteEntryUnabletochangeCustomerContact
Opportunity/QuoteEntryMultipliestheExchangeRatioBaseUnitPriceevenif
10.1.600 SalesManagement QuoteManagement 193372 Application theCurrencyoftheQuoteandonthepricelististhesame
Opportunity/QuoteEntryGetDetailsfunctionbringsmaterialcostsfroman
10.1.600 SalesManagement QuoteManagement 193923 Application incorrectSalesSiteCost
10.1.600 SalesManagement QuoteManagement 194743 Application Opportunity/QuoteEntryRunQtyisnotincludingtheScrapqtyor%
Opportunity/QuoteEntryPricePerdisappearswhenyouchangeUOMwhenyou
10.1.600 SalesManagement QuoteManagement 194907 Application setSalesunitpriceonPartEntry
10.1.600 SalesManagement QuoteManagement 195813 Application JobTrackerActualcostsareincorrectlycalculated
Opportunity/QuoteEntryPrimarySalespersondoesntkeepvaluesentthrough
10.1.600 SalesManagement QuoteManagement 196201 Application ServiceConnectwhenaddinganewQuote
Opportunity/QuoteEntryWhenCRMlicenseisnotavailabletheSalesPerson
10.1.600 SalesManagement QuoteManagement 196771 Application shouldnotbevalidated
10.1.600 SalesManagement QuoteManagement 196815 Application Opportunity/QuoteEntryMaterialScrapaddeddoesnotwork
Opportunity/QuoteEntryIftheCustomerShipToIDisremoved,alltheSales
10.1.600 SalesManagement QuoteManagement 198088 Application Personaddedinthetasksaredeleted
SSRSQuoteWorksheetReportMtlBurdencostisdisplayedincorrectlyin
10.1.600 SalesManagement QuoteManagement 198511 Application EstimatingSummaryforpartsection
Opportunity/QuoteEntryDoesnotRetrievetheDiscountsoftheCustomerGroup
10.1.600 SalesManagement QuoteManagement 198841 Application forsaleskitparentpricing
Opportunity/QuoteEntryPartretrieveonNewLineclearsdiscountpercentage
10.1.600 SalesManagement QuoteManagement 201227 Application populatedfromHeader
MoveMaterialRequestNumberoflabelstoprintisnotretrievingthelabels
10.1.600 SupplyChainManagement AdvancedMaterialMana 163784 Application accordingwithlabeltypesetup

Page60
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


10.1.600 SupplyChainManagement AdvancedMaterialMana 185021 Application MoveWIPErrordisplayedwhenselectingOperationdropdownlist
MaterialRequestQueueStockPOreceiptputawaydoesnothonornegative
10.1.600 SupplyChainManagement AdvancedMaterialMana 185600 Application inventorysettings

10.1.600 SupplyChainManagement AdvancedMaterialMana 186398 Application MoveInventoryRequestAbletomoveinventorytothesameWarehouseandBin


MaterialRequestQueueDoesnotcreatelotnumberonJobReceiptToInventory
10.1.600 SupplyChainManagement AdvancedMaterialMana 186838 Application whenProcessbuttonisselected
MaterialRequestQueueJobnumbervaluedoesnotdisplaywhenprocessing
10.1.600 SupplyChainManagement AdvancedMaterialMana 187978 Application transactionrecord
MoveMaterialRequestErrorwhenmovingMaterialtoWhse/Bindifferentthan
10.1.600 SupplyChainManagement AdvancedMaterialMana 188013 Application thedefault
ProcessByIDSameTransactionRecordopenedfromdifferentscreens,duplicates
10.1.600 SupplyChainManagement AdvancedMaterialMana 188614 Application OrderQuantityvalue
MaterialRequestQueueIssueMaterialremainsopen,itshouldcloseafter
10.1.600 SupplyChainManagement AdvancedMaterialMana 189976 Application completingprocess
GetRequestNumberofpiecesenteredexceedsthenumberofpiecesremaining
10.1.600 SupplyChainManagement AdvancedMaterialMana 192425 Application ontheoperation

10.1.600 SupplyChainManagement AdvancedMaterialMana 194589 Application GetRequestCannotrequestagreaterquantitythanrequiredforthematerial


MoveWIPRequestDoesnotallowdoingMoveWiprequests,error"Thereisno
10.1.600 SupplyChainManagement AdvancedMaterialMana 194902 Application outstandingWIPbalanceforthisoperation"

10.1.600 SupplyChainManagement AdvancedMaterialMana 200503 Application MaterialRequestQueueKanbanmaterialqueueisnotfillingtomaxquantity


HHGeneralShipping/ReceivingDifferentnamesforthemenuItem,theactual
10.1.600 SupplyChainManagement HandheldMES 167005 Application applicationandhelp
HHMenuIconsintherightsideoftheHandheldlookdisabledandimagesarenot
10.1.600 SupplyChainManagement HandheldMES 172101 Application clear
HHMasterPackGridlayoutshouldberevisedtoshow'Pack/Lineetc'asopposed
10.1.600 SupplyChainManagement HandheldMES 173476 Application to'Company/MasterPacknumber'
10.1.600 SupplyChainManagement HandheldMES 186459 Application HHPickedOrdersErrorwhenshippingPackreferringtoSerialNumbers
10.1.600 SupplyChainManagement HandheldMES 188672 Application HHJobReceipttoInventoryScreenclosesafterprocessingatransaction
HHProcessByQueueIDLookupbuttonshouldpopulateToLocationforPO
10.1.600 SupplyChainManagement HandheldMES 188867 Application Receipts
HHJobReceipttoJobFocusissetincorrectlyafterenteringjobnumberalso
10.1.600 SupplyChainManagement HandheldMES 190679 Application generalUIlayoutissues
HHPackoutError"Entryexceedsfieldsmaximumlength"workingwithaCopy
10.1.600 SupplyChainManagement HandheldMES 191876 Application ReportStyle
HHProcessByQueueIDOnCMPSHPtransactions,itisallowedtomovemore
10.1.600 SupplyChainManagement HandheldMES 192508 Application itemsthanthoseavailable

Page61
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


HHProcessByQueueIDValuesarenotcalculatedproperlywhenusingProduct
10.1.600 SupplyChainManagement HandheldMES 194435 Application CodesforsamePart,differentUOMs
HHCustomerMassShipmentError"Rowhasbeenmodified"processingSales
10.1.600 SupplyChainManagement HandheldMES 195501 Application OrderwithnoShipViavalue
HHConfirmCustomerShipmentConfirmisnotinvoicingpackswhenordermarked
10.1.600 SupplyChainManagement HandheldMES 197519 Application asAutoInvoice
CountCycleMaintenanceNoUOMlineisontheprintedblanktagsiftheSheets
10.1.600 SupplyChainManagement InventoryManagement 68254 Application optionwasselected
CalculateABCCodesMinABCcodeisnotbeingconsideredforABCcode
10.1.600 SupplyChainManagement InventoryManagement 90459 Application calculation
10.1.600 SupplyChainManagement InventoryManagement 122406 Application CalculateABCCodesNewbuttondoesnotaddrowtofiltertab
SupplierMaintenanceUserisabletosaveBankinformationwithaninvalidBank
10.1.600 SupplyChainManagement InventoryManagement 165499 Application Branchcode
QuantityAdjustmentBinsearchcanretrievebinsusingtheincorrectunitof
10.1.600 SupplyChainManagement InventoryManagement 174004 Application measure
CostAdjustmentAdjustmenttoLotAvgpartwheretwoCostIDsarepresentonly
10.1.600 SupplyChainManagement InventoryManagement 177938 Application calculatesforcurrentsitequantity
TransferOrderEntryCreatingTransferOrdersusingSingleLineperTransferOrder,
10.1.600 SupplyChainManagement InventoryManagement 181187 Application generatesanadditionalrecordwithnoLines
PackageControlPCIDUnabletoprintaPCIDusingPackageControlID,erroris
10.1.600 SupplyChainManagement InventoryManagement 181975 Application displayed
CountCycleMaintenanceCycleinfodisplayeddoesnotmatchtherecordselected
10.1.600 SupplyChainManagement InventoryManagement 181999 Application fromBAQSearchscreen
JobReceipttoSalvageAfterAdapterhandlernottriggeredformethod
10.1.600 SupplyChainManagement InventoryManagement 183670 Application ReceiptsFromMfgAdapterOnChangeSalvageJobSeq
10.1.600 SupplyChainManagement InventoryManagement 184131 Application TransferOrderEntryBinvalueisnotdisplayedonLine/Listtab
QuantityAdjustmentSerialNumbersreceivedfromMultiCompanyarenot
10.1.600 SupplyChainManagement InventoryManagement 184945 Application retrieved
PackageControlIDJobReceiptToInventoryErrorwhenenteringaNonLabelPrint
10.1.600 SupplyChainManagement InventoryManagement 185013 Application ControlledGenericPCIDwithPackageControlStatusWIPFG
10.1.600 SupplyChainManagement InventoryManagement 185578 Application QuantityAdjustmentErrorwhenintroducingannonexistingreasoncode
CalculateABCCodes"PlantStockValuation"textisdisplayedintheReportHeader
10.1.600 SupplyChainManagement InventoryManagement 185583 Application whenusingtheSiteStockValuationoption
PackageControlLabelTypePCIDErrorisdisplayedaftercreatingthesamelabel
10.1.600 SupplyChainManagement InventoryManagement 185739 Application typetwotimes

10.1.600 SupplyChainManagement InventoryManagement 185791 Application PackageControlIDTypeConfigPCIDPositionsarenotdisplayedcorrectly


PackageControlLabelTypePCIDPackagecodeddlisemptyifpackagecodes
10.1.600 SupplyChainManagement InventoryManagement 185840 Application definedonUOMclass

Page62
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


CalculateABCCodesReportdisplaysblankinsteadofreportingNorecords
10.1.600 SupplyChainManagement InventoryManagement 186246 Application selectedatSystemMonitor
10.1.600 SupplyChainManagement InventoryManagement 186253 Application CalculateABCCodesGridofthefilteracceptsrepeatedelements
SSRSStockStatusReportNetValueisnotequaltoReportTotalsminusNegative
10.1.600 SupplyChainManagement InventoryManagement 186352 Application Balance

10.1.600 SupplyChainManagement InventoryManagement 186409 Application InventoryTransferToWarehousedisplaysautomaticallyafterselectPart


10.1.600 SupplyChainManagement InventoryManagement 186552 Application PartWarehouse/Binisresetaftersaving
InventoryTransferCtrl+SisnottriggeringSearchwindowwithfieldsWarehouse
10.1.600 SupplyChainManagement InventoryManagement 186596 Application andBin
10.1.600 SupplyChainManagement InventoryManagement 186604 Application JobReceipttoSalvageIndexerrorafterclickingtwiceonAssemblybutton
SSRSPartsMissingABCCodeReportReportcannotbeprintedorgeneratedin
10.1.600 SupplyChainManagement InventoryManagement 186993 Application EWA
PackageControlPCIDControlStaticPCIDStatusnotsettoEMPTYonPack
10.1.600 SupplyChainManagement InventoryManagement 187086 Application shipping.RemainsasBusy
IssueMaterialPartwithitsparticularUOMcanbeissuedtoanotherpartwitha
10.1.600 SupplyChainManagement InventoryManagement 187207 Application differentUOM
CountCycleMaintenanceCosmeticissues:'Inputstringwasnotinacorrect
10.1.600 SupplyChainManagement InventoryManagement 187347 Application format'errorandtaborder
ManagedInventoryStockStatusReportTakesmorethan1hourtogeneratethe
10.1.600 SupplyChainManagement InventoryManagement 187497 Application report

10.1.600 SupplyChainManagement InventoryManagement 187674 Application PackageControlPCIDWeightfieldsarenotsetcorrectlyafterPCIDStaticisEMPTY


JobReceipttoJobIfthereisnoDocumentTypeaLegalNumberiscreatedforthat
10.1.600 SupplyChainManagement InventoryManagement 187844 Application transaction
10.1.600 SupplyChainManagement InventoryManagement 187893 Application IssueMaterialDocumentTypecanbecleared
CostAdjustmentIfthereisnoDocumentType,aLegalNumberiscreatedforthat
10.1.600 SupplyChainManagement InventoryManagement 187894 Application transaction
StockStatusReportUpdatingUnitCostvalue,makesUnitCosttobedisplayedas
10.1.600 SupplyChainManagement InventoryManagement 187896 Application 0.00inStockStatusReport
QuantityAdjustmentIfthereisnoDocumentType,aLegalNumberiscreatedfor
10.1.600 SupplyChainManagement InventoryManagement 187903 Application thattransaction
TransferOrderEntryAssignLegalNumberisnotenabledandthedocumentcanbe
10.1.600 SupplyChainManagement InventoryManagement 187933 Application editedafterprinted
PartTransactionHistoryTrackerContractIdisnotdisplayedifthematerialwas
10.1.600 SupplyChainManagement InventoryManagement 188016 Application backflushedfromJobClosing
PartTransactionHistoryTrackerOpeningLotTrackerfromContextMenu,screen
10.1.600 SupplyChainManagement InventoryManagement 188055 Application openswithnoinfo

Page63
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


PackageControlPCIDWhenINVOICEispostandPCIDhasINVOICEDstatus,error
10.1.600 SupplyChainManagement InventoryManagement 188098 Application isdisplayed
PackageControlPCIDInactivePackageCodescanbeselectedandassignedtoa
10.1.600 SupplyChainManagement InventoryManagement 188174 Application labeltype
PackageControlPCIDGenericLabeltypesforPCIDwithPickedordergets
10.1.600 SupplyChainManagement InventoryManagement 188237 Application corruptedafterremovingapack
PackageControlPCIDPCIDprintmethodisusingthedefaultreportprinterinstead
10.1.600 SupplyChainManagement InventoryManagement 188263 Application ofdefaultlabelprinter

10.1.600 SupplyChainManagement InventoryManagement 188541 Application MassIssuetoMfgMaterialshowsnegativequantitywhenselectingMassIssueAll

10.1.600 SupplyChainManagement InventoryManagement 188829 Application PackageControlPCIDInvoicesarenotdisplayedcorrectlyontheLinedetail


InventoryTransferInventoryMovementReportTotalCostshows2decimals
10.1.600 SupplyChainManagement InventoryManagement 189097 Application insteadof5
WarehouseBinSearchDoesnotdisplaybininformationfromPartTrackerwhen
10.1.600 SupplyChainManagement InventoryManagement 189171 Application usingcontextmenu
TransferOrderEntryTFOrderDtlupdatetoPartQtyneedstogothrough
10.1.600 SupplyChainManagement InventoryManagement 189397 Application DeferredUpdate

10.1.600 SupplyChainManagement InventoryManagement 189885 Application LotPartDescriptionvalueisnotrefreshedwhenswitchingbetweenPartIDvalues


TransferOrderEntryManuallyclosingTransferOrderLinesdoesnotsetTransfer
10.1.600 SupplyChainManagement InventoryManagement 190124 Application OrderasClosed
TransferOrderEntryTransferOrderfromSuggestiondoesnotconsiderLeadTime
10.1.600 SupplyChainManagement InventoryManagement 190540 Application definedatSitelevel
SSRSStockStatusReportPartIDandDescriptionvaluesarenotprintedonreport
10.1.600 SupplyChainManagement InventoryManagement 190859 Application wheretotalsumofitems=0
InventoryTransferDecimalvariancebetweenInterPlantTansfertransactionsfrom
10.1.600 SupplyChainManagement InventoryManagement 190884 Application differentFIFOLayers
IssueMaterialIgnoresconversionfactorswhenissuingmaterialswithdifferent
10.1.600 SupplyChainManagement InventoryManagement 190923 Application UOMsinsameUOMClass
SSRSStockStatusReportUnitCostisnotcalculatedproperlyonPartspassing
10.1.600 SupplyChainManagement InventoryManagement 191425 Application throughReturnMaterialprocess
10.1.600 SupplyChainManagement InventoryManagement 191450 Schema SerialNumberSNTran.FSAssetClassCodefieldistooshort
SSRSStockStatusReportUnitCostisthevaluesetonJobReceiptToSalvage
10.1.600 SupplyChainManagement InventoryManagement 191505 Application process,notthecalculatedafterprocessiscompleted

10.1.600 SupplyChainManagement InventoryManagement 191563 Application UOMSplit/MergeCheckforQOHnotoccuringafterchangeofUOMonSplitQty


10.1.600 SupplyChainManagement InventoryManagement 192029 Application TransferOrderEntrySecondPartisdisplayingarepeatedPart

Page64
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


StockStatusReportWord"warning"isdisplayedagainattheendoftheUOM
10.1.600 SupplyChainManagement InventoryManagement 192240 Application Conversionmessage
10.1.600 SupplyChainManagement InventoryManagement 192355 Application JobTrackerWIPQuantitydoesnotsplitwhenJobissplit
10.1.600 SupplyChainManagement InventoryManagement 192378 Application StockStatusReportPDFMappingisincorrectinStockStatus
StockStatusReportActivityAsofCutoffDatedatashowntwiceforPartswith
10.1.600 SupplyChainManagement InventoryManagement 192563 Application activityondifferentwarehouse/Bins
IssueMaterialAllowsamaterialtobeissuedtoajobfromaSiteandWarehouse
10.1.600 SupplyChainManagement InventoryManagement 192574 Application whichthatpartisnotsetup
StockStatusReportDoesnotconsidertheissueMiscellaneousMaterialforparts
10.1.600 SupplyChainManagement InventoryManagement 192839 Application withlotFIFOasCostingMethod
CountTagEntryError"ValuewaseithertoolargeortoosmallforanInt32"using
10.1.600 SupplyChainManagement InventoryManagement 192932 Application French(Canada)Region/Language
IssueMaterialDoesnotcompletewhentheQuantityislessthantheRequiredQty
10.1.600 SupplyChainManagement InventoryManagement 192938 Application buttheIssuedCompleteischecked
StockStatusReportWhenprintingtheStockStatusReportsortedby
10.1.600 SupplyChainManagement InventoryManagement 192970 Application Warehouse/Part,thecolumnheadingsareoff

10.1.600 SupplyChainManagement InventoryManagement 194166 Application PackageControlPCIDPkgMaterialTypeandPkgTypescreenslookidentical

ProjectRevenueRecognitionWhenProjectRevRecJournalReversalissetto'Next
10.1.600 SupplyChainManagement InventoryManagement 194367 Application Period',reversalCOSjournalsarenotbeingposted,asdoneforrevenuejournals

IssueMaterialDisplaysincorrectlyavalidationformaterialwithdifferentUOM
10.1.600 SupplyChainManagement InventoryManagement 194639 Application ClasseveniftheclasssharessameUOMCodewithotherUOMClass
StockStatusReportCanshowtheincorrectcostsforaLotAvgpartinmultiplesites
10.1.600 SupplyChainManagement InventoryManagement 194946 Application withdifferentCostID
MassIssuetoMfgDoesnotcalculatecorrectlyQtyIssuedafterselectingIssueAll
10.1.600 SupplyChainManagement InventoryManagement 195045 Application Buttonforpartialmassissues
PackageControlMaintenancePCIDSearchscreennotabidingbyMaxRowsto
10.1.600 SupplyChainManagement InventoryManagement 196210 Application retrieve
10.1.600 SupplyChainManagement InventoryManagement 196546 Application MassReturnfromMfgDoesnotallowpartialquantities
PartScheduleSearchingaSpecificPartusingStartingAtFielddoesnotwork
10.1.600 SupplyChainManagement PurchaseScheduling 166461 Application properly
GeneratePurchaseSchedulesBacklogforsecondcontractwasincludedinthelast
10.1.600 SupplyChainManagement PurchaseScheduling 187760 Application scheduleonfirstcontract
PurchaseOrderEntryPurchaseCodenotpopulatedinlinewhengeneratedfrom
10.1.600 SupplyChainManagement PurchasingManagement 122394 Application PoSuggestions
PurchaseOrderEntryContainerDueandContainerPromiseDatesaredisplayed
10.1.600 SupplyChainManagement PurchasingManagement 162871 Application sincethePOisapproved

Page65
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


PurchaseMultiUOMWorkbenchOnHandQuiantitywasdisplayedinZerowhen
10.1.600 SupplyChainManagement PurchasingManagement 163247 Application thereisinventoryinStock
PurchaseMultiUOMWorkbenchDoesnotdisplaytheUOMdemandandUOM
10.1.600 SupplyChainManagement PurchasingManagement 163251 Application SupplyonworkBenchgrid
PurchaseMultiUOMWorkbenchBalancewasnotcalculatedforJobsandPO
10.1.600 SupplyChainManagement PurchasingManagement 163276 Application suggestions
10.1.600 SupplyChainManagement PurchasingManagement 168394 Application ChangePOSuggestionsNotAbletoUpdatetheUnitPriceinEWA
RequisitionEntryAfterResetDispatching,"cannotupdate"errorisdisplayedwhen
10.1.600 SupplyChainManagement PurchasingManagement 169404 Application dispatchagainEWA
10.1.600 SupplyChainManagement PurchasingManagement 171439 Application PurchaseOrderEntryIOMvaluedissapearsinReleasestab
SupplierMaintenanceUserisabletosaveBillinginformationwithaninvalid
10.1.600 SupplyChainManagement PurchasingManagement 172252 Application Countrycode
PurchaseOrderEntryPhaseIDinformationisnotretreivedfromajoblinkedtoa
10.1.600 SupplyChainManagement PurchasingManagement 176177 Application WBSPhaseinProject
PurchaseOrderEntrySalesOrdersearchforminPurchaseOrderEntrydoesnot
10.1.600 SupplyChainManagement PurchasingManagement 181183 Application retrieveinformationcorrectly
SupplierPriceListError"UnabletocompletePasteOperation"wheninserting
10.1.600 SupplyChainManagement PurchasingManagement 182334 Application recordsfromListtab
PurchaseOrderEntryCannotsearchforanotherPOrecordifchangesarenot
10.1.600 SupplyChainManagement PurchasingManagement 184521 Application made
SupplierPriceListNotabletotypeanythingonManufacturerfieldwhilecreating
10.1.600 SupplyChainManagement PurchasingManagement 184535 Application SupplierPart
PurchaseOrderEntryContextmenuoptionsmissingforMfg,MfgPart,Supplier
10.1.600 SupplyChainManagement PurchasingManagement 184540 Application Part
PurchaseOrderEntryPOReleaseiscreatednotreferringtotheSitetheSales
10.1.600 SupplyChainManagement PurchasingManagement 184710 Application Order(BTO)wasgenerated
PurchaseOrderEntryIncorrectSearchFormopenedfromReleases>Asm
10.1.600 SupplyChainManagement PurchasingManagement 185064 Application dropdowncontextmenusearch
10.1.600 SupplyChainManagement PurchasingManagement 185445 Application PurchaseOrderEntryPagenumbersareincorrectwhendoingMassPrint
PurchaseOrderEntryWhenaPOlineorRelisVoided,itshouldbeexcludedfrom
10.1.600 SupplyChainManagement PurchasingManagement 185733 Application TotalsandTaxCalculations
PurchaseOrderEntryIncorrectUnitPricevaluehavingForeignSupplierPriceList
10.1.600 SupplyChainManagement PurchasingManagement 185824 Application inBaseCurrencyPO
PurchaseOrderEntryWhenaTaxIdwasaddedinLine/MischChrgesTaxwith
10.1.600 SupplyChainManagement PurchasingManagement 185850 Application Pasteinsert,theapplicationclosed
SupplierPriceListPriceBreaksaddedtoSubcontract/PriceBreaksarealso
10.1.600 SupplyChainManagement PurchasingManagement 186406 Application displayedinParts/PriceBreaks

10.1.600 SupplyChainManagement PurchasingManagement 186975 Application PurchaseOrderEntryInvalidcolumnnamewhenSearchingforPOwithSupplier

Page66
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


PurchaseOrderEntryInspectionRequiredcheckboxisnotcheckedforJob
10.1.600 SupplyChainManagement PurchasingManagement 187068 Application Materials
SupplierChangingtheCurrencyCodeonaSupplierdoesnotupdatetheSupplier
10.1.600 SupplyChainManagement PurchasingManagement 187157 Application PriceListcurrencycode
PurchaseOrderEntryNorecordsselectedreportresultifMassPrintisprinted
10.1.600 SupplyChainManagement PurchasingManagement 187357 Application afterStandardPrint
PurchaseOrderEntryAddinganinspectionpartwithReadytoprocessenabled
10.1.600 SupplyChainManagement PurchasingManagement 187404 Application generatesPODetailInspconstrainterror

10.1.600 SupplyChainManagement PurchasingManagement 187575 Application SupplierPriceListPOPartnotloadedwhenopeningfromPO/Actionsmenu


POIncorrectzDataaboutPObusinessobjectleadstoinabilitytocreateanew
10.1.600 SupplyChainManagement PurchasingManagement 187929 Application BPMdirectiveonseveralmethodsofPObusinessobject
RequisitionEntryDispatchingafterdeletingarejectedrequestresultsin'row
10.1.600 SupplyChainManagement PurchasingManagement 188028 Application modifiedbyanotheruser'
SSRSOpenPurchaseOrderReportReportTotalsarenotprintedonreportwith
10.1.600 SupplyChainManagement PurchasingManagement 188084 Application severalpages
PurchaseOrderEntryWithLockCurrencyExchangeRate,Rateisstillobtained
10.1.600 SupplyChainManagement PurchasingManagement 188486 Application fromExchangeRateEntry
PurchaseOrderEntrySupplierQtydoesnotchangewhenchangingtoadifferent
10.1.600 SupplyChainManagement PurchasingManagement 188642 Application Part
QualifiedManufacturerNodetailson"ManufacturerPartNummustbeunique"
10.1.600 SupplyChainManagement PurchasingManagement 188967 Application error

10.1.600 SupplyChainManagement PurchasingManagement 189073 Application PurchaseOrderEntryLeadtimedoesnotpullthenewestSupplierPriceList


SSRSPurchaseOrderReportUnitPricefieldshows2Decimals;Companyand
10.1.600 SupplyChainManagement PurchasingManagement 189190 Application Currencyareconfiguredtoshow5

10.1.600 SupplyChainManagement PurchasingManagement 189291 Application PurchaseOrderEntryPMPMSetPOTotalAndTaxDefaultsshouldbeautorun


PurchaseOrderEntryDuplicateofPOofJobMaterialOTFPart,generatesPOLine
10.1.600 SupplyChainManagement PurchasingManagement 189629 Application BuyFor=Inventory
PurchaseOrderEntryPMPMSetPOTotalAndTaxDefaultsdisplayserrorwhen
10.1.600 SupplyChainManagement PurchasingManagement 189847 Application ProductGroupdoesnotexist
PurchaseOrderEntryInspectionFlagwasselectedforManufacturerPartthat
10.1.600 SupplyChainManagement PurchasingManagement 190236 Application doesnotrequireInspection
PurchaseOrderEntryError'RecordNotFound'displayswhenopeningChangePO
10.1.600 SupplyChainManagement PurchasingManagement 190651 Application Suggestions
PurchaseOrderEntry"InspectionRequired"checkboxsetincorrectlyinPOLinefor
10.1.600 SupplyChainManagement PurchasingManagement 190799 Application ManufacturerPart
10.1.600 SupplyChainManagement PurchasingManagement 191530 Application RequisitionEntryCreatinganewLine,theLinestabisnotfocused

Page67
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


10.1.600 SupplyChainManagement PurchasingManagement 191590 Application PurchaseOrderEntryAbletoselectOurQtyonPurchaseOrderContracts
SupplierPriceListDifferentDescriptionforaPartcanbesetinParts/Listtabusing
10.1.600 SupplyChainManagement PurchasingManagement 191790 Application PasteInsert

10.1.600 SupplyChainManagement PurchasingManagement 192224 Application SupplierPriceListNotAbleToPaste/InsertSupplierPartgridusingExcelFunction


10.1.600 SupplyChainManagement PurchasingManagement 192622 Application SupplierPriceListPartbuttondisabledafterloadingaSPLfromPOEntry
PurchaseOrderEntryLinkedPurchaseOrdercanbeunapprovedwithAllowLinked
10.1.600 SupplyChainManagement PurchasingManagement 192841 Application POChangesflagoff
10.1.600 SupplyChainManagement PurchasingManagement 193080 Application RequisitionEntryRemoveVendorIDnullrowrule
10.1.600 SupplyChainManagement PurchasingManagement 193081 Application RequisitionEntryImplementDisableOverridePriceListRowRuleinServer
SupplierPriceListMultipleSuppliersdisplayedwhenopeningSPLfromPart
Actionsmenu;alsoPartandSubcontractOperationinformationdisplayedatsame
10.1.600 SupplyChainManagement PurchasingManagement 193709 Application time
PurchaseOrderEntryMiscellaneousChargewithnegativeamount,notapplied
10.1.600 SupplyChainManagement PurchasingManagement 194362 Application properly
PurchaseOrderEntryExceptionwhenclosingPOwithTaxwithaheaderMisc
10.1.600 SupplyChainManagement PurchasingManagement 194478 Application Chargebutnolines
RequisitionEntryAbilitytoDispatchrequisitionistiedtothedefaultRequestor
10.1.600 SupplyChainManagement PurchasingManagement 194791 Application value

10.1.600 SupplyChainManagement PurchasingManagement 194883 Application RequisitionEntryAddnewfieldstodisplayCreatedByandCreatedOnfields


PurchaseOrderEntryConversionFactorsetonSupplierPriceListisnotapplied
10.1.600 SupplyChainManagement PurchasingManagement 194892 Application accordingtodatesetonPO
PurchaseOrderEntryUnabletochangePartIdforJobMaterialinPurchaseOrder
10.1.600 SupplyChainManagement PurchasingManagement 198523 Application Entry
PurchaseOrderEntryPOcannotbeunapprovedifReleasedoesnothaveaGL
10.1.600 SupplyChainManagement PurchasingManagement 198900 Application Accountvalue

10.1.600 SupplyChainManagement PurchasingManagement 199346 Application PurchaseOrderEntryAbletosaveinvalidaccountforpurchasetootherrelease


TransferOrderShipmentEntrySNbuttonstatus(Enabled/Disabled)dependson
10.1.600 SupplyChainManagement Shipping/Receiving 88368 Application theorderofadditionofthelines
SSRSProFormaInvoiceFieldsDepositBalance,RoundingandTotalareina
10.1.600 SupplyChainManagement Shipping/Receiving 103250 Application incorrectarea

10.1.600 SupplyChainManagement Shipping/Receiving 116866 Application ReceiptEntryCannotselectBinforawarehousewhendoingMassReceiptforaPO


ContainerLandedCostEntryNoactionperformedafterclickingonPObutton,
10.1.600 SupplyChainManagement Shipping/Receiving 157428 Application SearchformisnotdisplayedonEWA
ContainerLandedCostEntrySplitaShippedContaineranditcreatesanewoneas
10.1.600 SupplyChainManagement Shipping/Receiving 168352 Application 'Shipped'withnogreenEpishape

Page68
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


ContainerLandedCostEntryErrorsaredisplayedoncontainerwhenaddinglinesif
10.1.600 SupplyChainManagement Shipping/Receiving 172985 Application containerisalreadyshipped
ReceiptEntryCompletedreceiptsarestilldisplayedintheAddIntercompany
10.1.600 SupplyChainManagement Shipping/Receiving 179021 Application Receiptmenu
CustomerShipmentEntryCannotaddalinetoaPackfromaSOwithdifferent
10.1.600 SupplyChainManagement Shipping/Receiving 179838 Application ShipTowhenAllowChangeShippingAddress=TRUE
StageShipConfirmEntryStartingAtdoesnotsetsearchresultinfirstsearchrow
10.1.600 SupplyChainManagement Shipping/Receiving 180203 Application usingSortByPackNumber
ContainerLandedCostEntryPOSearchresultsarelistedinascendingorder,
10.1.600 SupplyChainManagement Shipping/Receiving 180329 Application insteadofdescendingorder
ReceiptEntryUnabletoCaseObjecterrorwhencreatinganewNamedSearch
10.1.600 SupplyChainManagement Shipping/Receiving 181162 Application record
ContainerLandedCostEntryUnnecessarywarningtellingusertoupdateshipment
10.1.600 SupplyChainManagement Shipping/Receiving 181196 Application lineswithzerovolume

10.1.600 SupplyChainManagement Shipping/Receiving 181715 Application ContainerLandedCostEntryRename"ContainerID"labellocatedatLinelevel


ContainerReceiptEntryWhencompanysettingsaresettowarnonsupplierprice,
10.1.600 SupplyChainManagement Shipping/Receiving 182098 Application nowarningisgiven
ContainerLandedCostEntryVolumeandWeightfieldsatheaderareloadedwith
10.1.600 SupplyChainManagement Shipping/Receiving 183413 Application baseUOMfromUOMclass
ContainerLandedCostTrackerNavigationbarinLines>DetailtabisnamedasLine
10.1.600 SupplyChainManagement Shipping/Receiving 183433 Application anditdisplaysReleases

10.1.600 SupplyChainManagement Shipping/Receiving 183468 Application ContainerReceiptEntryPartialReceiptusingdifferentUOMsisnotabletosave


10.1.600 SupplyChainManagement Shipping/Receiving 183766 Application SupplierShipmentClassInconsistentdropdownlistforChargeID
SSRSContainerLandedCostReportIndirectCostsofdifferentCurrenciesarenot
10.1.600 SupplyChainManagement Shipping/Receiving 183980 Application displayedproperly
ReceiptEntryUnitCostlostwhensettingLottoalottrackedpartfromaJob
10.1.600 SupplyChainManagement Shipping/Receiving 184095 Application Materialinamiscellaneousreceipt
ContainerLandedCostTrackerShipmentLineisdisplayingReleasefromPOLine
10.1.600 SupplyChainManagement Shipping/Receiving 184712 Application insteadofLinenumberfromPO
ContainerLandedCostTrackerReceiveddisplayedinsteadofAllReceivedin
10.1.600 SupplyChainManagement Shipping/Receiving 184719 Application Receipt>Contentstab
SupplierShipmentClassVolumeandWeightfieldsshowdifferentinformationfor
10.1.600 SupplyChainManagement Shipping/Receiving 184966 Application decimals

TransferOrderShipmentEntryCheckAllocationsneedstosupportthechange
10.1.600 SupplyChainManagement Shipping/Receiving 185217 Application allowinguserstoshipthesametransferlinemultipletimesonsamepack

Page69
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


CustomerShipmentEntryValidBinerroronnewShipLineafterbeingclearedon
10.1.600 SupplyChainManagement Shipping/Receiving 185246 Application previousShipLine
CustomerShipmentEntryShippedquantityisnotsetcorrectlyonKitParentwhen
10.1.600 SupplyChainManagement Shipping/Receiving 185368 Application createpackfrompicked&2+releasespickedforakit
ReceiptEntryReceivedselectionfromMassReceiptscreenisnotpassedthrough
10.1.600 SupplyChainManagement Shipping/Receiving 185421 Application ReceiptEntryforIntercompanyReceipts
CustomerShipmentEntryMassShipmentPackingSlipshowskitlinesoutof
10.1.600 SupplyChainManagement Shipping/Receiving 185512 Application sequence
SSRSProFormaInvoiceReportCustomerCrossReferenceasSecondaryReference,
10.1.600 SupplyChainManagement Shipping/Receiving 185514 Application doesnotprintsCustomerinfo
ReceiptEntryReceiptwithnoPONumbercreatesaReceiptLineofType=
10.1.600 SupplyChainManagement Shipping/Receiving 185549 Application PurchaseOrder

StageShipConfirmEntryStatusbarnotsettoReadyatActions>ShipConfirmif
10.1.600 SupplyChainManagement Shipping/Receiving 185740 Application Orderhasflag"ShipOrderComplete"settotrueandShipmentispartial
ContainerLandedCostTrackerPercentageandTypefieldsarenotdisplayedin
10.1.600 SupplyChainManagement Shipping/Receiving 185847 Application Header/IndirectCosts/Detailstab

10.1.600 SupplyChainManagement Shipping/Receiving 186309 Application BillofLadingEntryGenerateisaddingpackswithdifferentshiptostosameBOL


SubcontractorShipmentEntryAftersettingSNto1stSubcontractOp,sameSNcan
10.1.600 SupplyChainManagement Shipping/Receiving 186421 Application besetmanuallyto2ndSubcontractOp
CustomerShipmentEntryMemoiconisdisabledwhentypinginShippingPackfor
10.1.600 SupplyChainManagement Shipping/Receiving 186557 Application thefirsttime
ContainerLandedCostEntryWhenaddingmultipleindirectcoststhefocusisset
10.1.600 SupplyChainManagement Shipping/Receiving 186738 Application backtothefirstindirectcost
10.1.600 SupplyChainManagement Shipping/Receiving 186833 Application ReceiptEntryItdoesnotaskifyouwanttocreateanewLotNumber

10.1.600 SupplyChainManagement Shipping/Receiving 186909 Application CustomerShipmentSummaryPackIdcolumnisnotsortedindescendingorder


ContainerLandedCostEntryEWAIndirectCostdoesnotupdatewithmoreof
10.1.600 SupplyChainManagement Shipping/Receiving 186967 Application oneline
ContainerLandedCostEntryEWAContextMenudoesnotbringthevalues
10.1.600 SupplyChainManagement Shipping/Receiving 186976 Application automatically

10.1.600 SupplyChainManagement Shipping/Receiving 187019 Application ReceiveTransferOrderTransferOrderLinenumberisnotstoredonPartTrantable


CustomerShipmentEntryWhenreclosingapackusingcalculatetaxesonship,
10.1.600 SupplyChainManagement Shipping/Receiving 187368 Application error'StringwasnotrecognizedasavalidDateTime'
10.1.600 SupplyChainManagement Shipping/Receiving 187406 Application CustomerShipmentEntryFailurelabelisdisplayedasFaliure
10.1.600 SupplyChainManagement Shipping/Receiving 187490 Application ReceiveTransferOrderItisallowedtoreceivebeforeEarliestApplyDate

Page70
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


ReceiptEntryJobSubcontractandJobMaterialhavedifferentbehaviorson
10.1.600 SupplyChainManagement Shipping/Receiving 187596 Application Inventory
DropShipmentEntryUnitCostinforeigncurrencyonPOdefaultsintoDrop
10.1.600 SupplyChainManagement Shipping/Receiving 187758 Application Shipmentwithbasecurrencyamount
ReceiptEntryIfthereisnoDocumentTypeaLegalNumberiscreatedforthat
10.1.600 SupplyChainManagement Shipping/Receiving 187906 Application transaction
CustomerShipmentEntryDocumentcanbeeditedevenifLNconfiguration
10.1.600 SupplyChainManagement Shipping/Receiving 187926 Application disableschangesafterprinting
SubcontractorShipmentEntryDocumentcanbeeditedevenifLNconfiguration
10.1.600 SupplyChainManagement Shipping/Receiving 187931 Application disableschangesafterprinting
MasterPackShipmentEntryFormclearsifLNisduplicatedandthedocumentcan
10.1.600 SupplyChainManagement Shipping/Receiving 187935 Application beeditedafterprinted
10.1.600 SupplyChainManagement Shipping/Receiving 187947 Application CustomerShipmentEntryInvalidLabelTypesarenotvalidated
PackagingCodeError"PackageCodeisrequired"whenusingfunctionofPaste
10.1.600 SupplyChainManagement Shipping/Receiving 188089 Application InsertonListtab
10.1.600 SupplyChainManagement Shipping/Receiving 188171 Application ContainerReceiptEntryRoundingissuewithoverrideconversion
ContainerLandedCostEntryMltBurUnitCostdoesnotdisplayanyvalue,after
10.1.600 SupplyChainManagement Shipping/Receiving 188194 Application addaIndirectCosttotheContainer
ReceiptEntryManagedBinsetupasPrimaryBinorReceivingBinisdefaultedas
10.1.600 SupplyChainManagement Shipping/Receiving 188208 Application BinvalueforaPOStandard
StageShipConfirmEntryInvoicedDateofOldPackisusedtocompareEarlyApply
10.1.600 SupplyChainManagement Shipping/Receiving 188243 Application Date,insteadoftoday'sdate
ContainerLandedCostEntryLineDutyvalueisduplicatedwhenapplying
10.1.600 SupplyChainManagement Shipping/Receiving 188423 Application Disbursement
BillofLadingEntryLinkPack/MPfunctionallowstohaveaShipToaddress
10.1.600 SupplyChainManagement Shipping/Receiving 188439 Application differentthanShipPackaddress

10.1.600 SupplyChainManagement Shipping/Receiving 188471 Application ReceiptEntryValidOurQuantityerrorappearswhenreceivingaLinefromaPO


10.1.600 SupplyChainManagement Shipping/Receiving 188670 Application CustomerShipmentEntryUserisabletoaddaPCIDforaVOIDPack
10.1.600 SupplyChainManagement Shipping/Receiving 188869 Application StageShipConfirmEntryMultiplePackcreatesidenticalASNDocuments
ReceiptEntryIce.Lib.Framework.UIExceptionerrorwhenaddingaClosedPOLine
10.1.600 SupplyChainManagement Shipping/Receiving 188894 Application (status=Voided)

10.1.600 SupplyChainManagement Shipping/Receiving 188970 Application CustomerShipmentEntryCannotshipsaleskitorderduetoseveralissues


CustomerShipmentEntryErrorwhenshippingtwoPacksreferringtoSalesOrders
10.1.600 SupplyChainManagement Shipping/Receiving 189023 Application markedasAutoInvoice
10.1.600 SupplyChainManagement Shipping/Receiving 189024 Application CustomerShipmentEntryMessageisnotclearwhenrepackaPCID
SSRSProFormaInvoiceReportExt.Pricefieldshows5decimals;Companyand
10.1.600 SupplyChainManagement Shipping/Receiving 189031 Application Currencyareconfiguredtoshow2

Page71
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


CustomerShipmentEntryError"Modifiedbyanotheruser"whenprintingfrom
10.1.600 SupplyChainManagement Shipping/Receiving 189468 Application PackOuttabbeforeShipping
10.1.600 SupplyChainManagement Shipping/Receiving 189581 Application ReceiptEntryPromptedforLegalNumbereveniftheLNisunassigned
CustomerShipmentEntryPerformanceproblemwhenshippingpackwithlines
10.1.600 SupplyChainManagement Shipping/Receiving 189944 Application referencingdifferentordershavingmanyreleases
TransferOrderShipmentEntryPackageCodeisnotupdatedwithSearchinaPack
10.1.600 SupplyChainManagement Shipping/Receiving 190002 Application thatwaspreviouslysaved
CustomerShipmentEntryErrorwhenshippingtwoPacksreferringtoSalesOrders
10.1.600 SupplyChainManagement Shipping/Receiving 190065 Application withAutoInvoiceunselected
10.1.600 SupplyChainManagement Shipping/Receiving 190138 Application ReceiveTransferOrderEWAActions/ReceiveAlloptionisdisabled
CustomerShipmentEntryAutoInvoicingdoesnotworkwhenshippedanSTATIC
10.1.600 SupplyChainManagement Shipping/Receiving 190142 Application PCID
CustomerShipmentEntryShipDtl.LabelTypeisnotusedwhenaddingaGENERIC
10.1.600 SupplyChainManagement Shipping/Receiving 190695 Application labeltype
CustomerShipmentEntryTotalNetWeightisnotcalculatedaccordingtothe
10.1.600 SupplyChainManagement Shipping/Receiving 190696 Application quantityofitemsonPack
CustomerShipmentEntryOnPackOut,Length,WidthandHeightvaluesare
10.1.600 SupplyChainManagement Shipping/Receiving 190706 Application prompted,butnotsaved
ReceiptEntryCompleteflagnotsetwhenreceivingasupplier/customermanaged
10.1.600 SupplyChainManagement Shipping/Receiving 190810 Application PO
CustomerShipmentEntryError'Packstatusisnot'OPEN'or'CLOSED'when
10.1.600 SupplyChainManagement Shipping/Receiving 191081 Application stagingpack
ContainerLandedCostTrackerErrordisplayswhentrackingaContainerthatisnot
10.1.600 SupplyChainManagement Shipping/Receiving 191305 Application Shipped

10.1.600 SupplyChainManagement Shipping/Receiving 191341 Application StageShipConfirmEntryShippingisnotallowedifEarliestApplyDate=Today


10.1.600 SupplyChainManagement Shipping/Receiving 191382 Application ContainerLandedCostEntrySchemachangeforvolumefields
10.1.600 SupplyChainManagement Shipping/Receiving 191383 Schema ReceiptEntrySchemachangeforvolumefields
StageShipConfirmEntryUnShipConfirmactiondeletesUnitPricevaluesfrom
10.1.600 SupplyChainManagement Shipping/Receiving 191480 Application ShipDtltable
ReceiptEntryIssueswhenusingthePObuttonandLine/Relbuttonswithclosed
10.1.600 SupplyChainManagement Shipping/Receiving 191547 Application POLinesonthedetailscreen
ReceiptEntryNotallowedtochangeArrivalDateifEarliestApplyDateisbeing
10.1.600 SupplyChainManagement Shipping/Receiving 191900 Application applied
10.1.600 SupplyChainManagement Shipping/Receiving 192133 Application SSRSMiscellaneousShippingLabelsReportDMRLabelisnotprinted
TransferOrderShipmentEntryValuesdisplayedonSearchscreenarenotordered
10.1.600 SupplyChainManagement Shipping/Receiving 192292 Application properly
CustomerShipmentEntryVoidedserialnumbercannotbeshippedifwarehouse
10.1.600 SupplyChainManagement Shipping/Receiving 192544 Application ons#doesnotmatchshipfromwarehouse

Page72
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


CustomerShipmentEntryShippingaMultiUOMPart,byPackOut,isconsidered
10.1.600 SupplyChainManagement Shipping/Receiving 192646 Application asaPartialShipment
10.1.600 SupplyChainManagement Shipping/Receiving 192750 Application CustomerShipmentEntryPackwithID=0canbecreated
SSRSPackingSlipReportTotalvaluesarenotcalculatedproperlyhavingTax
10.1.600 SupplyChainManagement Shipping/Receiving 192762 Application InclusivePricing
CustomerShipmentEntryLotFifoQuantityisnotroundedaccordingtoUOM
10.1.600 SupplyChainManagement Shipping/Receiving 192831 Application definitiongivingnegativeFIFOonhandQuantityerror
CustomerShipmentEntryErrorwhenclosingapackwhenloggedtoaworkstation
10.1.600 SupplyChainManagement Shipping/Receiving 192960 Application withManifestenabled
CustomerShipmentEntryQuantityCheckforBuytoOrder(BTO)Shipmentnot
10.1.600 SupplyChainManagement Shipping/Receiving 192979 Application roundedcorrectly
CustomerShipmentEntryReleasenotClosedwhenShippedCompleteandhaving
10.1.600 SupplyChainManagement Shipping/Receiving 193271 Application PackspendingtoClose
10.1.600 SupplyChainManagement Shipping/Receiving 193284 Application ReceiptEntryReceivedQuantityandInventoryQuantitydonotmatch
CustomerShipmentEntryTaxexemptionswithtaxcategoriesarenotsupported
10.1.600 SupplyChainManagement Shipping/Receiving 193377 Application whentaxesarecalculatedinCSE
ContainerReceiptEntryDutyvalueiscalculatedwithExchangeRateofPODate,
10.1.600 SupplyChainManagement Shipping/Receiving 193500 Application insteadofArrivalDate

10.1.600 SupplyChainManagement Shipping/Receiving 193506 Application TransferOrderShipmentEntryDuplicatePlantTran.TranNumvaluesgenerated


ReceiptEntryReceivingICPOLinesseparately,makeslastLineasOpen,and
10.1.600 SupplyChainManagement Shipping/Receiving 193823 Application SuggestionasUpdRel
StageShipConfirmEntryReshippingaTransferOrder,duplicatesShippedQtyon
10.1.600 SupplyChainManagement Shipping/Receiving 193850 Application TransferOrder
ReceiptEntryPOLinetobereceived,issetasPURSTKeventhoughithas
10.1.600 SupplyChainManagement Shipping/Receiving 193955 Application InspectionRequired=True
10.1.600 SupplyChainManagement Shipping/Receiving 194015 Application ReceiptEntryAttemptedtodividebyzeroerror
10.1.600 SupplyChainManagement Shipping/Receiving 194052 Application CustomerShipmentEntryObjectreferenceerror
CustomerShipmentEntryPickedOrderScreendoesnotappearif
10.1.600 SupplyChainManagement Shipping/Receiving 194057 Application MtlQueue.SelectedByEmpID='Printed"
TransferOrderShipmentEntryCannotshiptransferorderwhenMtlQueueEntry
stillexists,error'ReferencedbyatleastoneMaterialQueue.Cannotclosethis
10.1.600 SupplyChainManagement Shipping/Receiving 194109 Application TransferOrder.'

CustomerShipmentEntryMessage"Lotisrequired"isnotdisplayedwhena
10.1.600 SupplyChainManagement Shipping/Receiving 194229 Application shipLineiscreatedinPackOutwithlottrackedpartandLotasempty

10.1.600 SupplyChainManagement Shipping/Receiving 194237 Application CustomerShipmentEntryPackgetFreightedtwiceifstagedafterbeingfreighted

Page73
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


ContainerLandedCostEntryShipmentIDinContainerLandedCostEntryscreenis
generatedassequentialnumberacrossallthecompanies;Itshouldbeseparate
10.1.600 SupplyChainManagement Shipping/Receiving 194344 Application seriesforeachcompany
ReceiptEntryFIFOonhandquantityerror.TransactionQtyfieldnotrounding
10.1.600 SupplyChainManagement Shipping/Receiving 194535 Application properly
BillofLadingEntryOnPack/MPSelectionscreenfilteringbyCustomer,has
10.1.600 SupplyChainManagement Shipping/Receiving 194537 Application Customerfielddisabled
StageShipConfirmEntryCannotshiptransferorderwhenMatlQueueEntrystill
existsgetting'ReferencedbyatleastoneMaterialQueue.Cannotclosethis
10.1.600 SupplyChainManagement Shipping/Receiving 194652 Application TransferOrder.'
ReceiptEntryUnfriendlyerrormessagewhenchangingArrivalDateforReceipt
10.1.600 SupplyChainManagement Shipping/Receiving 194672 Application withLegalNumberassigned
TransferOrderShipmentEntryError'Nullableobjectmusthaveavalue'when
10.1.600 SupplyChainManagement Shipping/Receiving 194744 Application ShippingTFOrderthatwasUnShippedandUnstaged

10.1.600 SupplyChainManagement Shipping/Receiving 194765 Application CustomerShipmentEntryPickedOrdersisnothandlingpickedPCID'sproperly


StageShipConfirmEntryInvoiceShipmentProcessresultsinincorrectresultsif
10.1.600 SupplyChainManagement Shipping/Receiving 194887 Application calledmorethanonetimeonthesameinstance
StageShipConfirmEntryInvoicedDateofOldPackisusedtocompareEarlyApply
10.1.600 SupplyChainManagement Shipping/Receiving 195056 Application Date,insteadoftoday'sdate

10.1.600 SupplyChainManagement Shipping/Receiving 195060 Tools PackingSlipWhenautoprintingpackingslipstheReportIdissometimesblank


CustomerShipmentEntryShouldbecheckingourReceivedQtyinIUMinsteadof
10.1.600 SupplyChainManagement Shipping/Receiving 195289 Application QtyReceivedinSupplierUOMwhenshippingBTOorder
CustomerShipmentEntryCostisassignedtoSalesKitPartwhenShippingPackis
10.1.600 SupplyChainManagement Shipping/Receiving 195318 Application unshipped
10.1.600 SupplyChainManagement Shipping/Receiving 196059 Application ContainerLandedCostEntryWarningmessageisdisplayingincorrectly
ContainerLandedCostEntryDisbursingLateCostchargerecalculatesBase
10.1.600 SupplyChainManagement Shipping/Receiving 196170 Application DisbursevaluetoForeignCurrency

10.1.600 SupplyChainManagement Shipping/Receiving 196171 Application ContainerLandedCostEntryErrorgeneratedwhenusingPasteInsertfunction


ReceiptEntryInventoryMovementReportdoesnotprintLinesofPackingSlip
10.1.600 SupplyChainManagement Shipping/Receiving 196278 Application havingseveralPOnumbers
ContainerReceiptEntryIncorrectUOMconversionpulledtoscreenwhenitwas
10.1.600 SupplyChainManagement Shipping/Receiving 196451 Application previouslyoverrideninPOEntry
10.1.600 SupplyChainManagement Shipping/Receiving 196498 Application CustomerShipmentEntryDeadlockonshipdtltriggerrelatedtopartalloc
10.1.600 SupplyChainManagement Shipping/Receiving 196504 Application ReceiptEntryDeadlockonXfileattchandmtlqueue
TransferOrderShipmentEntryAllowsenteringaWhse/Binthatdoesnotbelongs
10.1.600 SupplyChainManagement Shipping/Receiving 196600 Application totheSite/Part

Page74
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


10.1.600 SupplyChainManagement Shipping/Receiving 196610 Application PackingSlipNontranslatablestringcanbetranslated

CustomerShipmentEntryShippingQuantityincorrectfororderlineoftrack
10.1.600 SupplyChainManagement Shipping/Receiving 196782 Application multipleUOMpartwithOrderQtyindifferentUOMthanInventoryUOM
CustomerShipmentEntryKITCUSCostvaluecalculatedbasedonComponentCost
10.1.600 SupplyChainManagement Shipping/Receiving 197148 Application offirstLot
StageShipConfirmEntryUnShipConfirmwillnotsucceediflanguageinusehasa
10.1.600 SupplyChainManagement Shipping/Receiving 197206 Application translatoinforSTAGE
CustomerShipmentEntryError"Cannotupdatemiscellaneouscharges"when
10.1.600 SupplyChainManagement Shipping/Receiving 197259 Application ShippingwithoutSaving
StageShipConfirmEntrySubmitstageshipconfirmprocessnotinitializing
10.1.600 SupplyChainManagement Shipping/Receiving 197344 Application variables
CustomerShipmentEntryTaxesnotcalculatedwhenTaxCodeismanuallyadded
10.1.600 SupplyChainManagement Shipping/Receiving 197345 Application toSO
CustomerShipmentEntryError"Recordforupdate"whenaddingSalesKitOrder
10.1.600 SupplyChainManagement Shipping/Receiving 197640 Application LineusingShipAllbutton
CustomerShipmentEntryDoesnotrefreshShipmentquantitywhenchangingthe
10.1.600 SupplyChainManagement Shipping/Receiving 197710 Application releasenumber
CustomerShipmentEntryMassShiploosesAutoInvoiceflagifnoQuantity
10.1.600 SupplyChainManagement Shipping/Receiving 198401 Application enteredinfirstrow
ReceiptEntryError"Inputstringwasnotinacorrectformat"usingaPackSlip
10.1.600 SupplyChainManagement Shipping/Receiving 198503 Application valuecontainingadot"."
CustomerShipmentEntryPackforserialtrackedlineinoutboundtrackedsite
10.1.600 SupplyChainManagement Shipping/Receiving 198611 Application cannotbedeletediforderlinelinkedtocontract

10.1.600 SupplyChainManagement Shipping/Receiving 198616 Application CustomerShipmentEntryShippedCompleteisnotclearedwhenOrderQtyis1


CustomerShipmentEntryCannotpackaserialtrackedkitcomponentasfirst
10.1.600 SupplyChainManagement Shipping/Receiving 198656 Application componentonPackout
CustomerShipmentEntryUnpackingandrepackingapickedPCIDcanresultina
10.1.600 SupplyChainManagement Shipping/Receiving 198699 Application partialPCIDgettingpacked&shipped
CustomerShipmentEntryJobNumberisnotupdatedwhenOurShipQtycomes
10.1.600 SupplyChainManagement Shipping/Receiving 199054 Application fromdifferentJobs
CustomerShipmentEntryCaseissueswhenprocessingPickedOrderswiththe
10.1.600 SupplyChainManagement Shipping/Receiving 199349 Application samePCIDbutwithadifferentcase
BuyerWorkbenchRFQDecisionWizardhasduplicateQuantityfields,oneon
10.1.600 SupplyChainManagement SupplierRelationshipMa 166368 Application screenandanotheronadialogbox
RFQEntryBuyerdropdowndoesnotfilteraccordingtowhatbuyersthecurrent
10.1.600 SupplyChainManagement SupplierRelationshipMa 175010 Application userisauthorized

Page75
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


RFQEntryError"Inputstringwasnotinacorrectformat"whenaddinglinefrom
10.1.600 SupplyChainManagement SupplierRelationshipMa 175014 Application summarygrid

10.1.600 SupplyChainManagement SupplierRelationshipMa 179395 Application BuyerWorkbenchEWADecisionWizardSupplierAttributesfilterdoesnotwork


10.1.600 SupplyChainManagement SupplierRelationshipMa 185268 Application RFQEntrySupplierWizardAtributesdoesnotrespectExcludeoption

10.1.600 SupplyChainManagement SupplierRelationshipMa 185444 Application SupplierResponsesNextbuttondisabledonSupplierResponseSearchscreen


SupplierResponses"StartingAt"filtertriggersanerrorwhenvalueenteredis
10.1.600 SupplyChainManagement SupplierRelationshipMa 185594 Application alphanumeric
RFQEntryAddinganRFQLineusingPartsearchscreendoesnotretrievethe
10.1.600 SupplyChainManagement SupplierRelationshipMa 187552 Application UOMsandClassinformation
10.1.600 SupplyChainManagement SupplierRelationshipMa 187654 Application RFQEntryAllowscreationofPOwithPlanInspectionNotApproved
10.1.600 SupplyChainManagement SupplierRelationshipMa 189979 Application RFQEntryResponsefromSuppliernotbeingupdated
10.1.600 SupplyChainManagement SupplierRelationshipMa 190069 Application RFQEntryEWAPartdisapearswhencreatingLine
SupplierResponsesSearchResultsdonotshowsameresultsusingSortByand
10.1.600 SupplyChainManagement SupplierRelationshipMa 192432 Application StartingAtfilters
10.1.600 SupplyChainManagement SupplierRelationshipMa 194215 Application RFQEntryEWAAttributesoptiondoesnotworkwhencreatingnewRFQ
10.1.600 SupplyChainManagement SupplierRelationshipMa 195453 Application BuyerWorkbenchPOLine/RelofOnTheFlyPartsarenotlisted
SupplierResponsesCreatePOwith2linesforsamesuppliergives'Violationof
10.1.600 SupplyChainManagement SupplierRelationshipMa 196394 Application PRIMARYKEYconstraint'PK_PODetail'
SupplierResponsesSearchFilter"StartingAt"doesnotworkwhencombinedwith
10.1.600 SupplyChainManagement SupplierRelationshipMa 196453 Application RFQNumberfilter
SupplierResponsesWhencreatingaPOwithmultiplelines,ifyouleaveanyline
withQty0,itreturnsawarning,butstillcreatesthePOwiththoselineswithaQty
10.1.600 SupplyChainManagement SupplierRelationshipMa 197388 Application insteadofstoppingalltheprocess

10.1.600 SystemWideEnhancements ProductLifecyleManage 188927 Application PLMIntegrationMaterialswithattachmentsareimportedassubassemblies


PLMIntegrationOperationsarenotimportediftheyareaddedinlowlevel
10.1.600 SystemWideEnhancements ProductLifecyleManage 188950 Application assemblieswithintherevision
10.1.600 ToolsandTechnologies AdminConsole 155767 Tools SetupEnvironmentMobileAccessExtensionsTabhasinvalidtaborder
10.1.600 ToolsandTechnologies AdminConsole 172041 Tools SetupEnvironmentSSRSerrormessageismissingsomespaces
SetupEnvironmentAppServerinstallshouldcalculatediskrequirementsduring
10.1.600 ToolsandTechnologies AdminConsole 177270 Tools validationphase
10.1.600 ToolsandTechnologies AdminConsole 180254 Tools EpicorSmartClientandEWAfieldsshouldbewipedout
10.1.600 ToolsandTechnologies AdminConsole 181680 Tools SetupEnvironmentPathisdisplayedincorrectsymbols
10.1.600 ToolsandTechnologies AdminConsole 183368 Tools Somefilesarenotbeingremovedwhenyouuninstalltheadminconsole
10.1.600 ToolsandTechnologies AdminConsole 184262 Tools CancellingTaskAgentinstallopensuptheConfigurator
10.1.600 ToolsandTechnologies AdminConsole 185062 Tools PasswordisnotsavedinApplicationServerproperties
10.1.600 ToolsandTechnologies AdminConsole 186207 Tools AdminConsoleUpdatefailstorun

Page76
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


SetupEnvironmentMessagewarningapppoolmustberestartedneedstobe
10.1.600 ToolsandTechnologies AdminConsole 186216 Tools modified
10.1.600 ToolsandTechnologies AdminConsole 186425 Tools DatabaseMigrationDBmigrationCLtoolissues
SetupEnvironmentNeedvalidationwhenExtensionNameisthesamethan
10.1.600 ToolsandTechnologies AdminConsole 186597 Tools ApplicationName
10.1.600 ToolsandTechnologies AdminConsole 187281 Tools SetupEnvironmentYoucanonlycreate1helpsiteperApplicationServer
10.1.600 ToolsandTechnologies AdminConsole 187295 Tools EpicorlogoinEACmustbechangedtomatchthenewcompanybrand
SetupEnvironmentSetupEnvironmentCLtoolisnotregisteringnewappserversin
10.1.600 ToolsandTechnologies AdminConsole 187296 Tools EAC
10.1.600 ToolsandTechnologies AdminConsole 187297 Tools DatabaseRandommessagewhenyouattempttoaddanewdatabase
SetupEnvironmentSSRSReportServerLocationfieldisnotpopulatedusing
10.1.600 ToolsandTechnologies AdminConsole 187300 Tools SQL2016

10.1.600 ToolsandTechnologies AdminConsole 187361 Tools SetupEnvironmentErrordescriptionmissingfromSetupEnvironmentmessage


10.1.600 ToolsandTechnologies AdminConsole 187364 Tools Error"Couldnotfindpath..."wheninstallingServerManagersnapin
SetupEnvironmentEWAweb.configfileiscreatedwithanincorrectAppserver
10.1.600 ToolsandTechnologies AdminConsole 187757 Tools URLusingthesetupenvironmentUIfrompublishedextensions
IntheDatabaseServerManagerthe'MigrateEpicorDatabase'actionshouldbe
10.1.600 ToolsandTechnologies AdminConsole 188071 Tools renamedto'MigrateEpicor9Database'
SetupEnvironmentMismatcherrorwhenEWAisinstalledusingpublished
10.1.600 ToolsandTechnologies AdminConsole 188212 Tools extensionsinstaller
10.1.600 ToolsandTechnologies AdminConsole 188347 Tools SetupEnvironment"Manager"usermustnotbeaddedasdefaultuser
SetupEnvironmentError"HTTPstatuserror503:Servertoobusy"isdisplayed
10.1.600 ToolsandTechnologies AdminConsole 188374 Tools whenSSRSisconfigured
SetupEnvironmentDeploymentversiontextboxshouldbealignedwithother
10.1.600 ToolsandTechnologies AdminConsole 188502 Tools textboxes
SetupEnvironmentCannotupgradeappserverfrom400.xto500afterappserver
10.1.600 ToolsandTechnologies AdminConsole 188503 Tools snapinisinstalled
10.1.600 ToolsandTechnologies AdminConsole 188564 Tools SetupEnvironmentTypoinsetupenvironment
UnblockuserfromadminconsolewhenyoutrytologinyougetaServiceModel
10.1.600 ToolsandTechnologies AdminConsole 188591 Tools error
10.1.600 ToolsandTechnologies AdminConsole 188665 Tools UnabletoinstallinfoWorkerandHelpusingPublishExtensions
10.1.600 ToolsandTechnologies AdminConsole 188850 Tools UnderDBManagerusingInstallandImportitfailstheImport
SetupEnvironmentIfAppserverBinding=HTTPSSLtheLoadUserProfilepropertyis
10.1.600 ToolsandTechnologies AdminConsole 189186 Tools settoFalse
SetupEnvironmentAdminconsoledoesnotunassignapreviouslysetcustom
10.1.600 ToolsandTechnologies AdminConsole 189205 Tools accountforanapppoolfortheAppserver
10.1.600 ToolsandTechnologies AdminConsole 189293 Tools SetupEnvironmentCannotcreateEpicorHelpsiteusingCLtool

Page77
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description

10.1.600 ToolsandTechnologies AdminConsole 189323 Tools SetupEnvironmentUpdatingEducationviaCLlinesaysHelpisbeingupdated


10.1.600 ToolsandTechnologies AdminConsole 189421 Tools SetupEnvironmentUsername/Passwordmustbedisabled

10.1.600 ToolsandTechnologies AdminConsole 190141 Tools SetupEnvironmentEWAURLnotdisplayedproperlyafter301>500upgrade


SetupEnvironmentUnabletodeployApplicationServerifselectingShared
10.1.600 ToolsandTechnologies AdminConsole 190343 Tools AssembliesLocation
SetupEnvironmentSetupEnvironmentUI.exehidesafterclickingOKinwarning
10.1.600 ToolsandTechnologies AdminConsole 190668 Tools message
SetupEnvironmentSetupenvironmentUI.exestopsworkingusingincomplete
10.1.600 ToolsandTechnologies AdminConsole 190805 Tools action(commandline)

SetupEnvironmentWhendoingaReleasetoreleaseupgrade(inplaceupgrade)
10.1.600 ToolsandTechnologies AdminConsole 190888 Tools VersionValuenodeinsysconfigisleftwiththeoriginalvalue(i.e.400.1)
10.1.600 ToolsandTechnologies AdminConsole 191010 Tools SetupEnvironmentExistentEMAsitesarenotlistedforremoval
ParentScopeNodemustbeanApplicationServerScopeNodeerrorisdisplayed
10.1.600 ToolsandTechnologies AdminConsole 191036 Tools whentriedtochangeuserinadminconsole
SetupEnvironment<addkey="ThrowLockExceptions"value="true"/>shouldbe
10.1.600 ToolsandTechnologies AdminConsole 191072 Tools settoFALSE

10.1.600 ToolsandTechnologies AdminConsole 191322 Tools SetupEnvironmentUnabletocreateAppServerwithSharedAssemblyLocation


SetupEnvironmentIncorrectmessageisdisplayedwhenEWAsiteisbeing
10.1.600 ToolsandTechnologies AdminConsole 191476 Tools updated
SetupEnvironmentSupportidealrelativepathsandmultiplepathsinthe
10.1.600 ToolsandTechnologies AdminConsole 191802 Tools applicationserversettinginthesetupenvironment
10.1.600 ToolsandTechnologies AdminConsole 191972 Tools SetupEnvironment"MB"insteadof"mb"inspaceerror
SetupEnvironmentManualchangestotheassemblyFileSystemelementofthe
10.1.600 ToolsandTechnologies AdminConsole 192140 Tools web.configarenotpickedupbysetupenvironment
SetupEnvironmentDoesnotremoveCustomDirectorypathifweb.configis
10.1.600 ToolsandTechnologies AdminConsole 192972 Tools changed

10.1.600 ToolsandTechnologies AdminConsole 193409 Tools SetupEnvironmentRemovedllsthatareinserver\binfromserver\Assemblies


10.1.600 ToolsandTechnologies AdminConsole 193653 Tools SetupEnvironmentSSLCertificateSubjectNamewhenselectdiftabs

10.1.600 ToolsandTechnologies AdminConsole 194197 Tools TAconfigurationbuttoninEACisnotlookingforTAinstallerinUpdatesfolder


SetupEnvironmentValidateWCFcertificationcheckboxresetsvaluewhentabis
10.1.600 ToolsandTechnologies AdminConsole 194804 Tools changed
SetupEnvironmentProcesstocreateAppServerischeckingforexistenceof.Net
10.1.600 ToolsandTechnologies AdminConsole 200729 Tools 3.5.1.weshouldnotdisplayaserror

Page78
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


10.1.600 ToolsandTechnologies AdminConsole 200746 Tools SetupEnvironmentAutoUpdatefailswith502BadGatewayerror

10.1.600 ToolsandTechnologies AdvanceQuality 187545 Application IQSAQMintegrationbatchfilesmissingDELstatementforERP_EMPLOYEE


10.1.600 ToolsandTechnologies AdvanceQuality 188751 Application IQSReceiptofLotTrackedPartfailsonsecondreceipt
IQSServiceConnectdoesnotcompleteInspectionandDMRProcessingfiles,
10.1.600 ToolsandTechnologies AdvanceQuality 190469 Application errorsaredisplayed
IQSChangetheserviceconnectworkflowtosendtheRMAquantityreceived,not
10.1.600 ToolsandTechnologies AdvanceQuality 190789 Application thefullquantityoftheRMA
10.1.600 ToolsandTechnologies AdvanceQuality 190996 Application IQSInactiveBininEpicorapplicationmakingittoIQS
10.1.600 ToolsandTechnologies AdvanceQuality 193217 Application IQSCannotloadalltheproductstoIQSwhenlinebreak

10.1.600 ToolsandTechnologies AdvanceQuality 194354 Application IQSMassSynchronizationisnotexportingPartswithoutarevisionintoCSVfiles


10.1.600 ToolsandTechnologies Attachments 148324 Tools ProblemwithSysconfigsettingtoautoassignuniquefilenames

10.1.600 ToolsandTechnologies Attachments 184905 Tools AttachmentsAttachmentsdeletedfrominvoiceheaderwhencustomerisdeleted


10.1.600 ToolsandTechnologies Attachments 187287 Tools AttachmentsCausesissueswithhttps
Whenattachmentfileiscreatedin"JobAsmbl",removeprocessisnotcreating
10.1.600 ToolsandTechnologies Attachments 188696 Tools "deleted"folder
IntheFrenchversionofE10,theDMattachmentfieldcaptionsarespreadingover
10.1.600 ToolsandTechnologies Attachments 188761 Tools intotheselectionfields
ErrorwhentryingtoduplicateaProjectandtheCreateWBSPhaseJobcheckboxis
10.1.600 ToolsandTechnologies Attachments 192707 Tools selected

10.1.600 ToolsandTechnologies BAQDesigner 166268 Tools QuerytoobjectcolumnmappingisnotcreatedforExternalUpdatablequery


10.1.600 ToolsandTechnologies BAQDesigner 166837 Tools CorrectQueryIDandDescriptionfieldssizingonGenerateASPform
10.1.600 ToolsandTechnologies BAQDesigner 171762 Tools Incorrectbehaviorof"Checkallfieldsasupdatable"button

10.1.600 ToolsandTechnologies BAQDesigner 178334 Tools AllowsChoiceof"OptionFields"forcolumnsthatcauseerroronexecution

10.1.600 ToolsandTechnologies BAQDesigner 178352 Tools PlanningWorkbenchPartialselectionrecorddoesnotworkonBAQsearch


10.1.600 ToolsandTechnologies BAQDesigner 180273 Tools MappingswithcustomexpressionsaredeletedonselectionofnewBO
WhentheabilitytocreatedSampleDataforacrystalBAQReportwasremovedin
Epicor10theBAQReport>Optionsscreenwasnotaddressed.Itstillrequestsa
10.1.600 ToolsandTechnologies BAQDesigner 181437 Tools SampleDataDirectorybeentered.

10.1.600 ToolsandTechnologies BAQDesigner 182030 Tools AllowsUsertoPickOptionFieldsfromSubqueriesandthendisplayeerrors


ExternalBAQTestConnectionisonlyexecutedforthefirstBAQloadedand
10.1.600 ToolsandTechnologies BAQDesigner 183596 Tools skippedforthefollowingones

Page79
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


ExternalBAQExternalBAQDesignerformmustbereopenedtogetqueryobjects
10.1.600 ToolsandTechnologies BAQDesigner 183599 Tools ifinitiallyconnectionwasbroken

10.1.600 ToolsandTechnologies BAQDesigner 183712 Tools ErrorsonqueryexecutionifspecificinvalidAdvancedGroupByexpressionisused


SubQuery'sResultSetRowsoptionisignoredifRowsToReturnoptionisseton
10.1.600 ToolsandTechnologies BAQDesigner 183723 Tools Analyzetab
UnclearerrormessagetextonattempttorunBAQwithunexistedsubqueryin
10.1.600 ToolsandTechnologies BAQDesigner 184390 Tools calculatedfieldexpression
10.1.600 ToolsandTechnologies BAQDesigner 184490 Tools BAQConstantsandttResultshouldnotappearinthethis.Db.hint
10.1.600 ToolsandTechnologies BAQDesigner 184580 Tools PreventuserfromusingIsSummarytableflaginmultisubqueryqueries
Appearance/behavioroftheformswhichareusedinTableCriteriaFilterValue
10.1.600 ToolsandTechnologies BAQDesigner 185379 Tools shouldbecorrected
ExternalTheerroroccurswhenaqueryisdesignedagainstcasesensitiveMSSQL
10.1.600 ToolsandTechnologies BAQDesigner 185708 Tools server
10.1.600 ToolsandTechnologies BAQDesigner 185972 Tools CheckSyntaxfalsenegativeforvariablelikeTip.TipTitleinexpression
10.1.600 ToolsandTechnologies BAQDesigner 186438 Tools Workflowpackageslistisnotloaded
NosettingaUBAQWorkflowinCompanyMaintenanceshowsblankWorkflows
10.1.600 ToolsandTechnologies BAQDesigner 186759 Tools whencreatinganewWorkflowinBAQ
Whenyouselecttheupdatablecheckboxandpresssave,thewindow'Analyze
10.1.600 ToolsandTechnologies BAQDesigner 186787 Tools Message'isnotdisplayed

10.1.600 ToolsandTechnologies BAQDesigner 187234 Tools EBAQusedDatasourcebasedonAccessdb(viaOleDbprovider)doesnotwork


10.1.600 ToolsandTechnologies BAQDesigner 187308 Tools EBAQ.ExceptionoccurredduringattempttoaddOracletable
UBAQItispossibletotypecustomtextinbusinessobjectandupdatemethod
10.1.600 ToolsandTechnologies BAQDesigner 187309 Tools textboxes
10.1.600 ToolsandTechnologies BAQDesigner 187715 Tools UpdatableBAQErrorimportingUpdatablequeryversion3.1.3.0into500
ExternalDatasourcesExceptionoccurredduringattempttoimportExternal
10.1.600 ToolsandTechnologies BAQDesigner 187726 Tools Datasourcewithselectedtargetcompany

10.1.600 ToolsandTechnologies BAQDesigner 188041 Tools ImportBAQwithstoredESCcredentials;additionalcredentialswindowappears


10.1.600 ToolsandTechnologies BAQDesigner 188043 Tools Secondimportofthesamequeryfailedwithexception
ExternalDatasourcesSkipFilteroptionisnotsavedinCompanyMaintenance
10.1.600 ToolsandTechnologies BAQDesigner 188177 Tools routine
ImportofescupdatablequerybreaksunexpectedlyifdefaultESCserverisnot
10.1.600 ToolsandTechnologies BAQDesigner 188179 Tools definedforcurrentcompany
IncorrectworkflowpackagenameisautomaticallygeneratedonEnterWorkflow
10.1.600 ToolsandTechnologies BAQDesigner 188806 Tools form(package\workflow)
10.1.600 ToolsandTechnologies BAQDesigner 189246 Tools UnwantedCheckTableRelationswarningonsave

Page80
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


ExecutiveQueryExecutiveQueryMappingerrorwithdecimalorintegerfields:A
10.1.600 ToolsandTechnologies BAQDesigner 189744 Tools validMappingvalueisrequired
Erorr'Companycolumnisnotvalid'onattempttoloadExternalBAQinordinary
10.1.600 ToolsandTechnologies BAQDesigner 190110 Tools BAQdesigner
Error'Themultipartidentifier...couldnotbebound'onaddingofiScaladatabase
10.1.600 ToolsandTechnologies BAQDesigner 190189 Tools tableontocanvas

Expecting2value(s)forthekeybeingindexed,butreceived1value(s)'erroron
10.1.600 ToolsandTechnologies BAQDesigner 190195 Tools attempttoaddallrequiredfieldsfromBOdataset(ExpressionEditor)
QuerydesignerservicepassesparameterstoiScalaininvalidformatifFinish
10.1.600 ToolsandTechnologies BAQDesigner 190204 Tools regionalsettingsareactive
ExecutiveQueryWhenaskedtoaddnewrecordandselecting"No"anerroris
10.1.600 ToolsandTechnologies BAQDesigner 190739 Tools displayed
GetNewbuttonisnotdisabledinordinaryBAQwhenUpdatableattributechanged
10.1.600 ToolsandTechnologies BAQDesigner 191379 Tools backandforth
10.1.600 ToolsandTechnologies BAQDesigner 191456 Tools It'spossibletodeleteKeyFieldrecordviaBOUpdateC#Expressiondialog
RecordNotFoundErroronattempttoimportexternalBAQwithunexisted
10.1.600 ToolsandTechnologies BAQDesigner 191542 Tools datasourcetype
10.1.600 ToolsandTechnologies BAQDesigner 192053 Tools Listtabcontentisunreadable(e.g.onUpdatableFieldInitialExpression)
10.1.600 ToolsandTechnologies BAQDesigner 192065 Tools Crosscompanyqueryfailsifcontainsrestrictedcolumns
10.1.600 ToolsandTechnologies BAQDesigner 192331 Tools InvalidcriteriaparenthesishandlinginBAQDesigner
10.1.600 ToolsandTechnologies BAQDesigner 192376 Tools Date01thruDate05UserOptionsnotcarryingto.rdl
UnnecesarySettingsshouldberemovedonceatableisremovedfromdesign
10.1.600 ToolsandTechnologies BAQDesigner 192491 Tools surface

10.1.600 ToolsandTechnologies BAQDesigner 192718 Tools ChangesmightbelostbecauseClearConfirmationisnotdisplayedonClear


10.1.600 ToolsandTechnologies BAQDesigner 193333 Tools UnabletousenotsharedBAQinsearchform
AlterBAQimportimlementationsothatnonGSMwouldalwaysimporttocurrent
10.1.600 ToolsandTechnologies BAQDesigner 194167 Tools company
CheckSyntaxerrorforautogeneratedQuerytoObjectexpressionofproperly
10.1.600 ToolsandTechnologies BAQDesigner 194601 Tools created/migrated'date'typeUD

10.1.600 ToolsandTechnologies BAQDesigner 194636 Tools ExecutiveQueryNotabletoscheduleExecutiveQuery=CubeMaintenance


ExecutiveQueryUnabletocreateExecutiveQueryusingsystemBAQwithempty
10.1.600 ToolsandTechnologies BAQDesigner 194673 Tools CompanyCode
InitialexpressioneditorbuttonandgridcolumnshouldbedisabledwhileBOand
10.1.600 ToolsandTechnologies BAQDesigner 195017 Tools methodarenotspecified
DirectivesarenotregeneratedautomaticallyonBOchange
10.1.600 ToolsandTechnologies BAQDesigner 195464 Tools (Erp.Tablesets.KanbanPartSearchRowisuseddespitePartBO)

Page81
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


BPMdirectivesaremarkedasoutdatedduetocompilationerrorsifUDfieldisused
10.1.600 ToolsandTechnologies BAQDesigner 195657 Tools inObjecttoQueryexpression
extBAQiScalaintegrationToday(orotherdatebased)constantcannotbeparsed
10.1.600 ToolsandTechnologies BAQDesigner 195937 Tools backintoresultsetbyextBAQengineifreturnedfromiScala
ExternalBAQ'UnabletoexecutedirectSQLquery'erroronattempttoexecute
10.1.600 ToolsandTechnologies BAQDesigner 196147 Tools querywithItemListtypeparameter

10.1.600 ToolsandTechnologies BAQDesigner 196149 Tools Incorrectlistofvaluesisdisplayedforthenewlycreateddropdownlistparameter


10.1.600 ToolsandTechnologies BAQDesigner 196150 Tools Parameter'sDisplay/ValueColumnvaluesarenotsaved
Mappingrecordwithinvalidexpression(ttResult.Tip_Tip)isunexpectedlydeleted
10.1.600 ToolsandTechnologies BAQDesigner 196377 Tools onsave
BAQcontainingonlyinnerjoinsgeneratesSQLquerywithcrossjoinindesigntime
10.1.600 ToolsandTechnologies BAQDesigner 196579 Tools andruntime
Cannotusedropdownqueryparameterofdatetype(thevaluecannotbeselected
10.1.600 ToolsandTechnologies BAQDesigner 196797 Tools andbuttonsaredisabled)
10.1.600 ToolsandTechnologies BAQDesigner 196850 Tools Cannotsetdefaultvaluefordatetime/dateparameter

10.1.600 ToolsandTechnologies BAQDesigner 196851 Tools Errormessageappearswhendoubleclickingtreenodeinexpressioneditor


CalculatedFieldSQLEditor'Objectreferencenotset'errorondoubleclickin
10.1.600 ToolsandTechnologies BAQDesigner 196913 Tools Functionstree
Error"acolumnisneitheraDataColumnnoraDataRelationfortableResults"
10.1.600 ToolsandTechnologies BAQDesigner 197039 Tools occursontestinganupdatablequery
10.1.600 ToolsandTechnologies BAQDesigner 197346 Tools ErrorsoccuronmultiplerefreshofDesignerform
ExternalBAQiScalaError'Connectionstringisempty'apponattempttorunGet
10.1.600 ToolsandTechnologies BAQDesigner 197449 Tools QueryExecutionPlanaction

10.1.600 ToolsandTechnologies BAQDesigner 197732 Tools Seconddropdownparameteronaformisunavailableuntilthefirstoneisselected


10.1.600 ToolsandTechnologies BAQDesigner 198642 Tools Rightjoinreturnsincorrectdata
ExternalBAQStringwasnotrecognizedasavalidDateTimeerroronquery
10.1.600 ToolsandTechnologies BAQDesigner 199122 Tools executionifparameter'stypewaschangedviaTableCriteriatab
10.1.600 ToolsandTechnologies BAQDesigner 200219 Tools Compilationerroronattempttosaveupdatablequerywith"="inID
UnexpectederroronattempttorightclickShowMessageactionresultdisplayedas
10.1.600 ToolsandTechnologies BAQDesigner 200542 Tools agriditem
BAQUpgradeBPMdirectivedeactivatedduetocompilationerror(notallcode
10.1.600 ToolsandTechnologies BAQDesigner 200656 Tools pathsreturnavalue)butcanbemanuallycompiled
Error"Incorrectsyntaxnearthekeyword'group'"occursifquerycontainsgrouping
10.1.600 ToolsandTechnologies BAQDesigner 200952 Tools andfilteringbybothtablefieldandaggregatecalcfield
Actionswhennothingwasdoneshouldnotbesavedandnotavailableto
10.1.600 ToolsandTechnologies BPM 150994 Tools undo\redo

Page82
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


IncorrectredframevalidationofFill/UpdateTableactionsonchangingtypeof
10.1.600 ToolsandTechnologies BPM 157272 Tools tablesetvariable

10.1.600 ToolsandTechnologies BPM 170157 Tools CreateNewworkflowshouldnotonlyselecttheworkflow,butmakeitvisible


Selectingamethodordatadirectivedisplaysanerrorwhentheclientissetto
10.1.600 ToolsandTechnologies BPM 177957 Tools developermode
WorkflowDesignerUnwantedexpressionseemstobesaveddespiteuser'schoice
10.1.600 ToolsandTechnologies BPM 185316 Tools butactuallyit'snotsaved
SelectWorkflowFirstworkflowpackageinthelistandchosenworkfloware
10.1.600 ToolsandTechnologies BPM 185319 Tools highlightedsimultaneously
10.1.600 ToolsandTechnologies BPM 186458 Tools BPMDataformdoesnotworkonconditionfalsebranch
10.1.600 ToolsandTechnologies BPM 186987 Tools FieldsinSelectTable\Fielddialogscannotbesortedbyorder
10.1.600 ToolsandTechnologies BPM 187504 Tools Validationincorrectlycomplainsaboutholds

10.1.600 ToolsandTechnologies BPM 187783 Tools BPMDataFromdesignercallContextBpmDatafielddoesnotshownintestmode

10.1.600 ToolsandTechnologies BPM 187785 Tools ExceptionwhileclearingdefaultvaluefordatetimefieldinBPMDataFromdesigner

10.1.600 ToolsandTechnologies BPM 189209 Tools BPMUpgradeleavesunupgradedBPMcustomizationassembliesinthedatabase


Unexpectederroronimportoutdateddirectives(only)ifthere'renoappropriate
10.1.600 ToolsandTechnologies BPM 189950 Tools recordsinBpMethodtable
10.1.600 ToolsandTechnologies BPM 189956 Tools ChangesdoneinBPMWorkflowDesignerarelostafterExitbuttonclick
UnabletocastobjecterrorandabnormalWorkflowDesignerterminationon
10.1.600 ToolsandTechnologies BPM 191743 Tools attempttousenullabletypevariable
RestorecontextmenuforBPMcodeeditorattheExpressionformandCustom
10.1.600 ToolsandTechnologies BPM 191886 Tools Codeaction
AttempttouseUDFieldfromatablesetvariableinthequeryofFillbyQueryaction
10.1.600 ToolsandTechnologies BPM 192070 Tools leadstocompileerror
Nonexistenttableargument'ttTip'isreferencederrorondatatagexistscondition
10.1.600 ToolsandTechnologies BPM 192980 Tools validation
10.1.600 ToolsandTechnologies BPM 193323 Tools Duplicatevariablecanbecreated
Bindingtypeisnotsupportederrorontablesetvariabletypechangeifitisusedin
10.1.600 ToolsandTechnologies BPM 193682 Tools FillTableaction
WorkflowDesignerVariablesTypedropdownlistisopenedtwiceiftherearetwo
10.1.600 ToolsandTechnologies BPM 193776 Tools tablesetvariables

10.1.600 ToolsandTechnologies BPM 193948 Tools BPMHoldconditiononrelatedobjectdoesnotworkcorrectlyfornewrecord


Memoryleakconfirmedin3.1.400.15;Heapsizeisdramaticallyincreasedduring
10.1.600 ToolsandTechnologies BPM 194266 Tools client(workstation)execution

Page83
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description

10.1.600 ToolsandTechnologies BPM 194310 Tools AutoPrintBPMdoesnotallowuseofaUDfieldtosettheDynamicPrintQuantity


10.1.600 ToolsandTechnologies BPM 194618 Tools BPMDataFormmandatoryfieldsarenotcheckedonserverside

Exceptionoccursonattempttocompiledirectivewhenthere'sexternaldllwhich
10.1.600 ToolsandTechnologies BPM 198102 Tools namespacediffersfromstandardone(e.g.System.Colelctions.Immutable)
BPMDesignerAlreadylistedassemblyisavailableforselectioniffilterisused
10.1.600 ToolsandTechnologies BPM 198227 Tools (leadstounhandlederror)
Error'Thetypeornamespacenamedoesnotexist'occursonattempttoimport
10.1.600 ToolsandTechnologies BPM 198470 Tools directive
Resultofexpressioncannotbeassignedtovariable'erroroncompilationwhen
10.1.600 ToolsandTechnologies BPM 198473 Tools differentcontracttablesetvariablefieldisused
10.1.600 ToolsandTechnologies BPM 198577 Tools x64SomeWorkflowDesignertabsnamesareempty
WorkflowDesignerError'Objectreferencenotset'onattempttoopenExpression
10.1.600 ToolsandTechnologies BPM 198637 Tools Editor

IfyourightclicktoinsertaCallContextfieldinsideofaBPMDataFormMessage,
10.1.600 ToolsandTechnologies BPM 199235 Tools youwillreceivea"Objectreferencenotsettoaninstanceofanobject."error.
Error'Holdcannotbeimported'whentwononexistedholdtypesareusedin
10.1.600 ToolsandTechnologies BPM 200594 Tools Conditionaction

10.1.600 ToolsandTechnologies BusinessActivityManage 184871 Tools SSRSRenderFormatnotsetforAutoPrintreportswhenprintactionisAutoPreview


10.1.600 ToolsandTechnologies BusinessActivityManage 191243 Tools NullReferenceexceptionwhenlogginginAutoPrint
ECCCustomerReconfigureofpartwithoutsavingquotedoesnotupdate
10.1.600 ToolsandTechnologies CommerceConnect 185989 Application discounts
ECCCustomerEditingofanexistingquoteandreconfigureofapartrevertingpart
10.1.600 ToolsandTechnologies CommerceConnect 186290 Application numberback
ECCTaxexemptionsarenotbeentakenintoaccountwhentheSOiscreatedin
10.1.600 ToolsandTechnologies CommerceConnect 187763 Application ECC
ECCCustomerOrdersfromwebthatareintendedtobeonaccountarerequiringa
10.1.600 ToolsandTechnologies CommerceConnect 187979 Application creditcardname
ECCCustomerStockinquiry(MSQ)needstoreturnpriceofaconfiguredpart
10.1.600 ToolsandTechnologies CommerceConnect 189668 Application change;CDMneedstoreturnorderbaseprice
ECCCustomerQuotesinmulticurrenciesdifferentthanwhatisreturnedinstock
10.1.600 ToolsandTechnologies CommerceConnect 189671 Application inquiry
ECCCustomerTaxescalculatedincorrectly,whentherearekitswithtax
10.1.600 ToolsandTechnologies CommerceConnect 189797 Application categories/taxexemptionandtheorderhasaShippingcharge
ECCCustomerQuotesalesrepunabletoupdatediscountafterzeroingoutthe
10.1.600 ToolsandTechnologies CommerceConnect 189926 Application discount

Page84
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description

10.1.600 ToolsandTechnologies CommerceConnect 191191 Application ECCCustomerOrdercreationdisplayserrorSystem.Data.SqlClient.SqlException


10.1.600 ToolsandTechnologies CommerceConnect 191378 Application ECCCustomerWebSalesRepIDisnotsaved

10.1.600 ToolsandTechnologies CommerceConnect 192136 Application ECCCustomerConfiguredsubassemblydoesnotlaunchproperlyviaecommerce

10.1.600 ToolsandTechnologies CommerceConnect 193570 Application ECCCustomerAddressdoesnotprintonSOAwhenorderiscreatedfromweb


10.1.600 ToolsandTechnologies CommerceConnect 195445 Tools ConfiguratorpartcreationdoesnotworkfromanECCsite
10.1.600 ToolsandTechnologies CommerceConnect 196145 Application ECCCustomerProductGroupnotsenttoECCforsaleskitparts
ECCCustomerRequestforQuoteoncomponentpricedkitreturnserrorinGQR
10.1.600 ToolsandTechnologies CommerceConnect 196368 Application response
10.1.600 ToolsandTechnologies CommerceConnect 198735 Application ECCCustomerPricing&discountingissueswhenpreventrepricing=Y
ECCCustomerCustomeraddressupdateresponseinvalid,resultsinwebaddress
10.1.600 ToolsandTechnologies CommerceConnect 201160 Application arenotupdated
BAQConversiononUpgradeUpdatableQueryDirectivesmaynotbeprocessed
10.1.600 ToolsandTechnologies Conversions 182108 Tools correctlyinsomecircumstances

10.1.600 ToolsandTechnologies Conversions 184059 Tools DatabaseMigrationMessageforupgradingDBatsamelevelshouldbechanged


DatabaseMigrationMobility_UDMigration.sqlConversionfailedwhenconverting
10.1.600 ToolsandTechnologies Conversions 185023 Tools thenvarcharvalue'XXXXX'todatatypeint
DatabaseMigration10.1.400.9PGtoSQLmigrationroundedrecordnumeric
overflowmessagedoesnotshowthebeforevalue.itjustdisplaystheaftervaluein
10.1.600 ToolsandTechnologies Conversions 185031 Tools themessage
DatabaseMigrationSeedpreparationscriptisnotexecutedduringdatabase
10.1.600 ToolsandTechnologies Conversions 187646 Tools upgradefrom10.0.600.3to10.1.500

10.1.600 ToolsandTechnologies Conversions 188429 Tools DatabaseMigrationAdjustthelogictochangethetitleofDBmigrationwindow


10.1.600 ToolsandTechnologies Conversions 188431 Tools BAQMigrationKeyfieldsarenotcorrectlymigratedforparticularUBAQ
DatabaseMigrationCustomerReportsissuewithlosingUDdataonmigrationfrom
10.1.600 ToolsandTechnologies Conversions 188511 Tools 9.05interminto10.1

10.1.600 ToolsandTechnologies Conversions 188531 Tools BAQDBMigrationUpdatableUDfieldmappingisnotmigratedcorrectlyfromE9


DatabaseMigrationE9Progressto10.1.500.0migrationfailsbecauseofinvalid
10.1.600 ToolsandTechnologies Conversions 188666 Tools columnname
10.1.600 ToolsandTechnologies Conversions 188732 Tools BAQconversiontaskdisplaysincorrectpercentageduringwork
DatabaseMigrationCommandlineLogisnotcreatedwhendatabasealready
10.1.600 ToolsandTechnologies Conversions 188941 Tools exists
DatabaseMigrationCustomMenusreportedlyunusableafterupgradefrom
10.1.600 ToolsandTechnologies Conversions 190568 Tools 10.0.700.2to10.1.400.13

Page85
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


OpenEdgeMigrationMigrationgetsstuckinacustomerdatabasewhenmigrating
10.1.600 ToolsandTechnologies Conversions 190686 Tools Memo

10.1.600 ToolsandTechnologies Conversions 191642 Tools DatabaseMigrationSecColumn.SchemaNameisnotpopulatedduringMigration


ChgLog.SchemaNamehaveblankintheChgLog.SchemaNamefieldaftermigration
10.1.600 ToolsandTechnologies Conversions 192135 Tools fromE9
DatabaseMigrationAftermigration,2rowsforcompanyarecreatedwith
10.1.600 ToolsandTechnologies Conversions 192156 Tools differentnamespacesinacustomChangeLogRDD
DatabaseMigrationErrorrunningscript
Ice.Internal.Task.SQLScripts.UDSeedData.sqlinConversionWorkbenchtask
10.1.600 ToolsandTechnologies Conversions 192598 Tools UD10.1.500after9.05migration
10.1.600 ToolsandTechnologies Conversions 192816 Tools DatabaseMigrationError"Liccnfg"shouldberemoved
10.1.600 ToolsandTechnologies Conversions 193229 Tools DatabaseMigrationNeedsconsistencyinmigrationerrormessages
DatabaseMigrationUpdatableuserdefinedfieldsarenotdisplayedonUpdate
10.1.600 ToolsandTechnologies Conversions 193462 Tools Processingtabaftermigration
10.1.600 ToolsandTechnologies Conversions 195203 Tools DatabaseMigrationMSMExternalSystemDropDown
10.1.600 ToolsandTechnologies Conversions 196620 Tools DatabaseMigrationAddSLStabletotheUDMigrationList
10.1.600 ToolsandTechnologies Conversions 197887 Tools DatabaseMigrationUsingCLIdoesnotunzipDBMigration.zip
DatabaseMigrationDashboardAssemblyMenuItemsareconvertedincorrectlyas
10.1.600 ToolsandTechnologies Conversions 199061 Tools DashboardComboisreferencingtheoldnamingconvention

BPMConversionE9directivecontaininganytoanyconditionshowsupasanany
10.1.600 ToolsandTechnologies Conversions 200057 Tools toanyconditioninsteadofanytoanotherforspecificsettingofanyinE9
BAQConversionFailswitherror'System.ArgumentException:Atleastoneobject
10.1.600 ToolsandTechnologies Conversions 200483 Tools mustimplementIComparable.'
ConversionWorkbenchInsert_ERP_SysSequence.sqlErp.SalesTaxfailsiftaxcode
10.1.600 ToolsandTechnologies Conversions 201169 Tools startswithAVAandisnotAvalara
CustomizationEngineUnabletocompleteATEscript.Identicalnamedcontrols
10.1.600 ToolsandTechnologies CustomizationEngine 132527 Tools created
10.1.600 ToolsandTechnologies CustomizationEngine 149997 Tools Tablosesfocuswhencustomizationisdeployed
CustomizationMaintenance"SYS"basedfieldsarenotproperlydescribedinList
10.1.600 ToolsandTechnologies CustomizationEngine 155768 Tools sheet
AddaTesttabandbelowthatadd2moretabs,tab1andtab2.SerialNumber
10.1.600 ToolsandTechnologies CustomizationEngine 171452 Tools TrackerMenu.Focusshiftsto1stTab(firsttimeonly).
Exceptionerrordisplayedgeneratingwebformafteracustomizationissavedfor
10.1.600 ToolsandTechnologies CustomizationEngine 172205 Tools thefirsttimeandtheformhasnotberestarted.
Errordisplayedwhen2CustomizationsareloadedintoCustomizationMaintenance
10.1.600 ToolsandTechnologies CustomizationEngine 175876 Tools andthefirstoneupdated;andthenthechangesareSaved

Page86
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


AEPVerticalizationforJobTrackerMiscellaneousShippingLinestablescrollbar
10.1.600 ToolsandTechnologies CustomizationEngine 176133 Tools missing
10.1.600 ToolsandTechnologies CustomizationEngine 178833 Tools ErrorwhenthesameSimpleSearchisaddedtwicetoaCustomization
10.1.600 ToolsandTechnologies CustomizationEngine 179375 Tools OnlyfirstrecordselecteddisplaysdataindropdownofExtendedUDfields
10.1.600 ToolsandTechnologies CustomizationEngine 180077 Tools PersonalizationCannotordergridcolumnsasneeded
10.1.600 ToolsandTechnologies CustomizationEngine 180160 Tools NotpossibleforcustomcodetohideChangeLogActioninFormloadevent
10.1.600 ToolsandTechnologies CustomizationEngine 180267 Tools EpiTextBoxboundtonvarchar(max)columnshiftspositionatruntime
10.1.600 ToolsandTechnologies CustomizationEngine 182698 Tools FormcustomizationobjreferrorinCreateOrUpdateDesignersmethod
10.1.600 ToolsandTechnologies CustomizationEngine 182835 Tools PersonalizationPersonalizationpurgeselecteddoesnotwork
PersonalizationCRMCalllogcausesexceptionwhenusingTools>Optionsand
10.1.600 ToolsandTechnologies CustomizationEngine 183111 Tools cannotsethotkeys
Customizationsavedondualmonitordoesnotdisplaywhenbroughtuponsingle
10.1.600 ToolsandTechnologies CustomizationEngine 183160 Tools monitor
WhentheMaskInputofaNumberControlischanged(forexample,from
nn,nnn.nnnnnton,nnn.nnnnn),noCompileErrorsarereceivedwhenTestCodeis
10.1.600 ToolsandTechnologies CustomizationEngine 183381 Tools run.However,whentheCustomizationruns,Errorisreceived:
10.1.600 ToolsandTechnologies CustomizationEngine 184207 Tools Deletingcontroltemporarilyinterfereswithtestingcustomizationcode
10.1.600 ToolsandTechnologies CustomizationEngine 184276 Tools ErrorwhenattemptingtosetupSimpleSearchwithUserFileAdapter
PersonalizationMakingaFormFontChangeusingellipsisforFontselectiondoes
10.1.600 ToolsandTechnologies CustomizationEngine 184279 Tools notsave
10.1.600 ToolsandTechnologies CustomizationEngine 185362 Tools Namespacedonotconvertduringmigration
10.1.600 ToolsandTechnologies CustomizationEngine 185381 Tools VerifyingaworkingE9customizationgivesobjectreferenceerror
WhenBusinessLogicMethodCallisusedtoaddthePartAdapter'sBOMethod
calledGetListByPlantSearchtoaCustomization,thefollowingerrorsarereceived
10.1.600 ToolsandTechnologies CustomizationEngine 185382 Tools whenTools>TestCodeisselected
CloudCustomerscannotcustomizeBasewhenbothBaseandadditionalLayerare
10.1.600 ToolsandTechnologies CustomizationEngine 185533 Tools Available

10.1.600 ToolsandTechnologies CustomizationEngine 188573 Tools AllCompaniesCustomizationisvisibleinsteadofcompanyspecificwithsamename

10.1.600 ToolsandTechnologies CustomizationEngine 189511 Tools CustomizationRetrieveButtondoesnotworkonsomeembeddeddashboards


InObjectExplorer,theAdapterstab,the.NetCodeExamplelabelisoverlapping
10.1.600 ToolsandTechnologies CustomizationEngine 189808 Tools anotherlabel
IssuewhencustomizingaHandheldMenu'sTransferOrderShipfunctio;
App.HHTransferOrderShipments.HHTransferOrderShipme,witherror"StartIndex
10.1.600 ToolsandTechnologies CustomizationEngine 189949 Tools cannotbelessthanzero."
10.1.600 ToolsandTechnologies CustomizationEngine 190574 Tools CustomObjectExplorershowsmethodsthatarenotnecessarilyavailable
CustomizationinMemoEntrydonotretriveJobNumberfromKey1whenarecord
10.1.600 ToolsandTechnologies CustomizationEngine 191144 Tools isadded

Page87
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description

CustomizationverificationError'Thetypeornamespacename'BO'doesnotexist
10.1.600 ToolsandTechnologies CustomizationEngine 191447 Tools inthenamespace'Ice.Proxy'(areyoumissinganassemblyreference?)

WhenanExtendedUD(EXUD)ColumnisaddedtotheInvcDtltableandHiddenby
defaultischecked,thatEXUDColumnisHiddeninARInvoiceEntry>Summarytab,
theInvoiceLinesgrid.However,ifyouwanttounhidethatEXUDColumn,youcan
unchecktheHiddencheckboxinthe(Collection),butthatchangedoesnotsave.
10.1.600 ToolsandTechnologies CustomizationEngine 192659 Tools Thatis,theEXUDColumnremainsHidden.

10.1.600 ToolsandTechnologies CustomizationEngine 193208 Tools Error"TypeMismatch"comparisononUD07whenusingFKVsandSubKeyViews


EpiNumericEditorisnotapplyingtheformatculturecorrectlytoits"Value"
10.1.600 ToolsandTechnologies CustomizationEngine 196019 Tools property
10.1.600 ToolsandTechnologies CustomizationEngine 200202 Tools POTrackercustomizationissueduringupgradefrom500to600
CustomerShippingPerformanceErrordisplaysbyclosingformwithrefresh
10.1.600 ToolsandTechnologies Dashboards 175066 Tools immediatelypressedbefore
NotabletoaddaNewQuery,aftercreatingadashboardwithanexistentIDand
10.1.600 ToolsandTechnologies Dashboards 177514 Tools thenmodifyingittoanonexistentone
PiechartsonDashboardslosesvalues"Label/Slicestyle",wheneveradashboardis
10.1.600 ToolsandTechnologies Dashboards 181026 Tools deployed
Whentwosimilardashboardsareopenedsimultaneouslyfordifferentcompanies
thentheresultsonthedashboardsaredifferentfromwhentheyareopened
10.1.600 ToolsandTechnologies Dashboards 182674 Tools standalone
10.1.600 ToolsandTechnologies Dashboards 182902 Tools DashboardCopyofSystemDashboardGiveserroronDeploy
TrackerViewvaluecomparisonsdoesnotworkcorrectyagainstdatabaseDateTime
10.1.600 ToolsandTechnologies Dashboards 183187 Tools columns
GaugeviewsarenotupdatedwhenitsrelatedGridhasbeenpreviouslyfiltered
10.1.600 ToolsandTechnologies Dashboards 184082 Tools throughasubscriptionwithasecondBAQ
DefinitionIdthatisrequiredtotypewhilecopyingdashboardsallowsentering
10.1.600 ToolsandTechnologies Dashboards 184088 Tools definitionIDsbeginningwihnumericvalues
10.1.600 ToolsandTechnologies Dashboards 184343 Tools DashboardBrowsefiltercriteriaisnotavailablewhenBAQisExternal
10.1.600 ToolsandTechnologies Dashboards 184346 Tools Requestopenwithtobeavailablefromdashboardruntime
10.1.600 ToolsandTechnologies Dashboards 185434 Tools Dashboardserverversioncheckperformance
Errorwhentryingtomodifyadashboardwhenit'salreadyopened,onDashboard
10.1.600 ToolsandTechnologies Dashboards 185772 Tools Maintenance
10.1.600 ToolsandTechnologies Dashboards 187824 Tools Embeddedappbuiltdashboardwithnavdoesnotsubscribetohostedform

10.1.600 ToolsandTechnologies Dashboards 187850 Tools BAQcolumnsfromapivotsubquerynotavailableinDashboardgridproperties


10.1.600 ToolsandTechnologies Dashboards 188229 Tools Publishedviewscannotbesaved

Page88
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


Applicationerroronadashboardwithemptycustomizedtrackerview,witha
10.1.600 ToolsandTechnologies Dashboards 188787 Tools controlboundedtoacolumn
ApplicationerrorwhenenteringavalidpathonReportfileonaDashboardwith
10.1.600 ToolsandTechnologies Dashboards 189307 Tools ReportLink
10.1.600 ToolsandTechnologies Dashboards 189312 Tools IncorrectvalidationforReportFilefieldonaDashboardwithReportLink
Hyphens("")indashboardnamesarechangedtounderscoresfordashboard
10.1.600 ToolsandTechnologies Dashboards 189441 Tools assemblyname
LabelTheYAxislabelisincorrectlydisplayed(showingattheXAxis)andXAxis
10.1.600 ToolsandTechnologies Dashboards 189610 Tools labelisnotshown
10.1.600 ToolsandTechnologies Dashboards 190517 Tools Incorrectfocusbehavioronadashboard
10.1.600 ToolsandTechnologies Dashboards 190718 Tools Dashboarddoesnotdeployifithasarowrulethatequatestoasymbol

DashboardassemblyerroriftheBAQcriteriafiltervaluecontainsabracketinthe
10.1.600 ToolsandTechnologies Dashboards 190721 Tools FilterValue.Error:SomeBAQs(<baqname>)missingfromcurrentCompany
KoreanLanguagecannotbedisplayedindropdownlistinDashboardtracker
10.1.600 ToolsandTechnologies Dashboards 194540 Tools createdbyuser
10.1.600 ToolsandTechnologies Dashboards 195039 Tools PropertyVisibledoesnotworkonDashboardTrackerView
IncorrectsearchonDashboardifDecimalsymbolforNumbersinRegionalSettings
10.1.600 ToolsandTechnologies Dashboards 195544 Tools is'comma'
10.1.600 ToolsandTechnologies Dashboards 200852 Tools Unabletoaddanewpaneltoamobiledashbard
Using/logfileswitchinIce.Tool.DataModelGenerator.CL.exestillcreateslogin
10.1.600 ToolsandTechnologies DatabaseAdministration 188864 Tools defaultlocation
incorrectresultswhenusingacombinationofmutiplewordsandwildcardinthe
10.1.600 ToolsandTechnologies EnterpriseSearch 175968 Tools searchcriteria
10.1.600 ToolsandTechnologies EnterpriseSearch 181272 Tools GlobalURLCheckboxfromCompanyMaintenancedoesnotworkproperly
WhendoingsearchesonModernShelltheSearchresultsforhasdouble
10.1.600 ToolsandTechnologies EnterpriseSearch 182575 Tools quotes
10.1.600 ToolsandTechnologies EnterpriseSearch 184611 Tools HttpsbindingsdonotrequireDNSIdentity
10.1.600 ToolsandTechnologies EnterpriseSearch 184613 Tools RemovewarninginSetSQLServerforEnterpriseSearch
10.1.600 ToolsandTechnologies EnterpriseSearch 184879 Tools SystemBAQ'scannotbeusedinQuickSearches
10.1.600 ToolsandTechnologies EnterpriseSearch 184941 Tools RefreshBAQontemplatefailswithexception
10.1.600 ToolsandTechnologies EnterpriseSearch 184942 Tools ShowIndexLogactioninEpicorSearchManagerfailswithexception
10.1.600 ToolsandTechnologies EnterpriseSearch 184949 Tools Replaceexistingflashbasedcopy/pastelibrarywithmoremodernoption
10.1.600 ToolsandTechnologies EnterpriseSearch 184950 Tools BAQselectionwizardinEpicorSearchManagerneedstobelarger
10.1.600 ToolsandTechnologies EnterpriseSearch 184951 Tools ResultsinBAQselectionwizardappearasduplicates
EpicorSearchAnywherewindowsapplicationgetsascripterrorandsearcheswill
10.1.600 ToolsandTechnologies EnterpriseSearch 184956 Tools notrun
10.1.600 ToolsandTechnologies EnterpriseSearch 185759 Tools AdvancedCopydoesnotworkinFirefox
10.1.600 ToolsandTechnologies EnterpriseSearch 186740 Tools Notapplyingsamecontextmenusecurityasdoesbaseapplication

Page89
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


10.1.600 ToolsandTechnologies EnterpriseSearch 187385 Tools UnabletoclickPreviouswithouthavingaSearchIndexName
10.1.600 ToolsandTechnologies EnterpriseSearch 187466 Tools Outofmemoryerrorbuildingsearchindexes
10.1.600 ToolsandTechnologies EnterpriseSearch 187536 Tools Unabletocreateanindexusingextensionsinstaller

10.1.600 ToolsandTechnologies EnterpriseSearch 188916 Tools AfterUpdateESfrom400to500EpicorSearchIndexerservicedoesnotrun


10.1.600 ToolsandTechnologies EnterpriseSearch 188928 Tools CannotupdateEnterpriseSearchfrom10.1.400.xto10.1.500.0

10.1.600 ToolsandTechnologies EnterpriseSearch 188929 Tools Unabletodeployoverexistinginstallorreindexsearchdatausing10.1.500


Onlargesearchdatabases,duplicatecheckingfailscausingsearchesforduplicates
10.1.600 ToolsandTechnologies EnterpriseSearch 189818 Tools tofail
EnterpriseSearchwillnotworkforsomeuserswhenusingSinglesignon.This
occursforuserswhohaveaPasswordExpiresvalue(inthepast)intheiruser
10.1.600 ToolsandTechnologies EnterpriseSearch 191084 Tools record.
ErrorcreatingESdatabasewhendeployingifmodelDBlargerthan10megby
10.1.600 ToolsandTechnologies EnterpriseSearch 193756 Tools default
UninstallProcessforEntepriseSearchfails,whenyouclickNewbuttonandyoutry
10.1.600 ToolsandTechnologies EnterpriseSearch 196464 Tools touninstallES

10.1.600 ToolsandTechnologies EnterpriseSearch 198628 Tools ESCmdreportserrorsonrebuildindexduetomismatchoflogicwithserver

10.1.600 ToolsandTechnologies EnterpriseSearch 198839 Tools IndexWizardAftersettimeoutgreaterthan300cannolongermodifyindex

10.1.600 ToolsandTechnologies ESCAdminConsole 190198 Tools csv2xmlgeneratesincorrectxmlifduplicatecolumnsexistintheinputcsvfile

10.1.600 ToolsandTechnologies ESCAdminConsole 190638 Tools Subwfschemagenerationfailsifschemacontainssequenceandchoiceelements


MessageMapdoesnotworkafterrenamingMessageTypes(TypenameorAction)
10.1.600 ToolsandTechnologies ESCAdminConsole 190730 Tools andSenders(SendernameorSubname)
10.1.600 ToolsandTechnologies ESCAdminConsole 191386 Tools TokenService.svcfailstoimport
SystemAsyncpoollosespartofqueuedmessagesifreceivedfromanotherdeleted
10.1.600 ToolsandTechnologies ESCAdminConsole 192058 Tools AsyncPool

Adminconsolestopsprocessingwhendeleting'Documenttype'withexisting
10.1.600 ToolsandTechnologies ESCAdminConsole 193237 Tools BusinessattributesinDocumenttracking>View>Filterwindow

10.1.600 ToolsandTechnologies ESCAdminConsole 193238 Tools AdminConsolemaystopprocessingontheOutputorInputchannelsnodes

10.1.600 ToolsandTechnologies ESCAdminConsole 195011 Tools AccessViolationerroroccurson"XMLfilter"commandinDocumentTrackingview


ProcessstaysinPendingstatusifXMLmessageattachedtotheTaskischanged;
10.1.600 ToolsandTechnologies ESCAdminConsole 195012 Tools ValueofTaskTimeout<>0

Page90
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


DTActivitydialogincorrectlyevaluatesStepdurationforWaitingforconflicting
10.1.600 ToolsandTechnologies ESCAdminConsole 195759 Tools lock(Manager)trace
Samplexmlgeneratorcreatesxmlwithincorrectstructurefor
10.1.600 ToolsandTechnologies ESCAdminConsole 197076 Tools StructuralBOmResponse.xsd
Backup/RestoreoperationdoesnotrestoreMessageMapusingSenderorMessage
10.1.600 ToolsandTechnologies ESCAdminConsole 197282 Tools Typewithwhitespaceattheendofname
InfoPrompt:SCignoresvalueofSpecifiedPropertieswhenprocesses
10.1.600 ToolsandTechnologies ESCDESRouter 193838 Tools CallContext.BpmDataheader

10.1.600 ToolsandTechnologies ESCDESRouter 200064 Tools EncryptionMethodChangetoTLS1.2onWebsitecausesSCnottobeabletoLogin


10.1.600 ToolsandTechnologies ESCInputChannel 191387 Tools Inputchannelworksincorrectlywhen'Filepath'isn'tdefined
InputFTPchannel(nativeimplementation)canstopprocessingwhenconnectionis
10.1.600 ToolsandTechnologies ESCInputChannel 193585 Tools unstable

10.1.600 ToolsandTechnologies ESCInputChannel 196485 Tools Csv2xmlConversionforSFTPinputchanneldoesnotworkforatabdelimitedfile


Input/outputchannel'scsv2xmlconversionconfigurationwith'Tab'or'Space'
10.1.600 ToolsandTechnologies ESCInputChannel 196915 Tools delimitersisincorrectlyrestored
10.1.600 ToolsandTechnologies ESCMapper 195846 Tools XMLMappercausesplatform6.7tostoprunning
WhenXMLcontainsschemadescriptionalongwithdatathatschemadescription
10.1.600 ToolsandTechnologies ESCOther 168824 Tools onlyisusedtogenerateXSD
10.1.600 ToolsandTechnologies ESCOther 180630 Tools .NETsummaryinfotobecorrectedforgenericreferencesinAC
10.1.600 ToolsandTechnologies ESCOther 184070 Tools IncorrectpartofthemessageschemaisshowninXPathbuilderbydefault
10.1.600 ToolsandTechnologies ESCOther 188104 Tools ScaMessengerSrvtakingup19GBram
10.1.600 ToolsandTechnologies ESCOther 189991 Tools Someofbuiltintrackingviewsworkincorrectly

10.1.600 ToolsandTechnologies ESCOther 190802 Tools fixedwidth2xmlgeneratesincorrectxmlifduplicateddataexistsintheinputfile

10.1.600 ToolsandTechnologies ESCOther 191277 Tools Subwfschemagenerationfailsifschemacontainssequenceandchoiceelements


Webservicewithmethodsthathavesimilarnames(onlyuppercase/lowercase
10.1.600 ToolsandTechnologies ESCOther 192111 Tools differences)isnotimportedcorrectly
10.1.600 ToolsandTechnologies ESCOther 192182 Tools ErrorwhenpassingdataforBPMformthroughCallContextIn

10.1.600 ToolsandTechnologies ESCOther 192232 Tools SpecifyingnondefaultCompany/PlantdoesnotworkforE10WCF(anybinding)


AttempttoconfigureBusinessrecipientsforDynamicchannelleadstoError:"Listof
10.1.600 ToolsandTechnologies ESCOther 192784 Tools Recipientsisempty"
Improvementsforspecifyingcompany/plantintheCompanyIDnodeforE10
10.1.600 ToolsandTechnologies ESCOther 192864 Tools WEB/NETreferences

10.1.600 ToolsandTechnologies ESCOther 192920 Tools RequiredattributewithunsignedInttypeisignoredwhencreatingsamplexml

Page91
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


Cannotimporta.wadlschemaofaRESTreferenceifitisavailablethroughhttps://
10.1.600 ToolsandTechnologies ESCOther 194502 Tools protocol
10.1.600 ToolsandTechnologies ESCOther 195936 Tools Unnecessarywarningsareshownduringconnectivitybackup
Samplexmlgeneratorshouldrecognizeandprocesscorrectlyxsdschemaswith
10.1.600 ToolsandTechnologies ESCOther 196927 Tools minLength/maxLengthrestrictionelement
10.1.600 ToolsandTechnologies ESCOther 201450 Tools Importfromdirectory(WebandNET)selectionstateisnotsaved
OutputChannels:orderfileisnotupdatedfordisabledoutputchannelsuntilSC
10.1.600 ToolsandTechnologies ESCOutputChannel 185372 Tools servicesshutdown
ErrorwhenOutputchannelsstateischangedon'Enable'underheavy
loading.Descr:"ErrorinPreprocessXML,plugin'Out'notfoundinplugins
10.1.600 ToolsandTechnologies ESCOutputChannel 192057 Tools collection."
Addingmultipleemailaddressesintotheemailtemplateresultsinoutputchannel
10.1.600 ToolsandTechnologies ESCOutputChannel 193332 Tools failure

10.1.600 ToolsandTechnologies ESCWorkflowDesigner 174127 Tools EnsureServicesConnectedmethodinWFDesignerinsomecasesworksincorrectly


WFDIssuesdisplayingasyncpoolsafterdelete/renameoperationsintheprocess
10.1.600 ToolsandTechnologies ESCWorkflowDesigner 189509 Tools properties
10.1.600 ToolsandTechnologies ESCWorkflowDesigner 191513 Tools Subwfschemagenerationfailsifmainschemacontainsattributes
10.1.600 ToolsandTechnologies General 177047 Application Companyexistsonatablebutisnotusedinthequerywhereclause
MESMenuWorkQueue:RequestMovetoggledisdisabledwhenendingactivities
10.1.600 ToolsandTechnologies General 179686 Application fromtheMES
MESMenuEndActivitydoesnotexecutetheAutoJobReceipttoJobandtheIssue
10.1.600 ToolsandTechnologies General 181815 Application Qtyremainswithzero

10.1.600 ToolsandTechnologies General 182872 Application DatabasePurgeandSummarizeAssumesChangeLogSchemaNamealways"Erp"


CompanyAPInvoiceDatesSetUpfieldsdefaultblankaftermigratingto10.1.100
10.1.600 ToolsandTechnologies General 186422 Application orabove
PlantConfigurationControlInvalidDefaultUOMerrorwhensettingdefaultUOM
10.1.600 ToolsandTechnologies General 187465 Application onSiteofnewCompany
10.1.600 ToolsandTechnologies General 187736 Application SecurityCodeSomeSCMRelatedMenuhasaduplicatedSecurityCode
10.1.600 ToolsandTechnologies General 188072 Application MESMenuReportQuantityformdoesnotdisplaytheUOMs
ServiceBusFrameworkDoesnotuseallpossibleconnectionsettingsforService
10.1.600 ToolsandTechnologies General 188450 Tools Bus
Conversion1210failswithanerror"Objectreferencenotsettoaninstanceofan
10.1.600 ToolsandTechnologies General 189068 Application object"
10.1.600 ToolsandTechnologies General 189111 Application FixMigratePatchFldBankTran.sqlupgradescript
PlantConfigurationControlAbilitytosetmanagedbinsasdefaultvalueforSite
10.1.600 ToolsandTechnologies General 189758 Application WarehouseDefaults

Page92
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


MESMenuLaborHoursarenotadjustedaccordingtotheClockIn/Outallowance
10.1.600 ToolsandTechnologies General 189782 Application time
SalesOrderBacklogReportError"ValidPeriodEndDatesarerequired"setting
10.1.600 ToolsandTechnologies General 190698 Application Period1asDynamic
10.1.600 ToolsandTechnologies General 191943 Application MESMenuCurrentWorktabinMESdoesnotretrievetheResourceID

10.1.600 ToolsandTechnologies General 192777 Application PlantConfigurationControlBinsearchshowsinactivebinsandotherissues


PreProdenvironmentconsuesalargeamountofRAMandCPUwhenTaskAgent
10.1.600 ToolsandTechnologies General 195670 Application started
AgileManifestPotentiallyphantompackscreatedinXMLwithcasenumber
10.1.600 ToolsandTechnologies General 198209 Application sequenceoutoforder
10.1.600 ToolsandTechnologies General 199886 Application SQLResolveSQLinjectionswarningsfromthesonarquberesults

10.1.600 ToolsandTechnologies GeneralFramework 129560 Tools SearchFrameworkCtrl+sinacomboboxwithinagridlaunchessearchtwice


10.1.600 ToolsandTechnologies GeneralFramework 143557 Tools TurningRibbononandoffdisablesNewMenuitems
Colon":"shownonthe"ElementID"searchbuttondoesnotmatchwithallsearch
10.1.600 ToolsandTechnologies GeneralFramework 150233 Tools buttonsofE10,shoulduse"..."

10.1.600 ToolsandTechnologies GeneralFramework 155326 Tools ConversionWorkbenchAfterrightclickingonstatuscolumn,errordisplays


10.1.600 ToolsandTechnologies GeneralFramework 156808 Tools ConversionWorkbenchSortbyRunSequenceisincorrect
10.1.600 ToolsandTechnologies GeneralFramework 160618 Tools MemooptionisdisabledwhenTrackerisopenedviacontextmenu
ConversionWorkbenchRunLogpanescrolldoesnotallowtoviewingthewhole
10.1.600 ToolsandTechnologies GeneralFramework 161775 Tools logtextandstrangenotallignedfield
10.1.600 ToolsandTechnologies GeneralFramework 161933 Tools ClientAutoupdateissuesduringanetworkdisruption
10.1.600 ToolsandTechnologies GeneralFramework 169950 Tools WebFrameworkGriddoesnothonorselectedcurrency'sdecimals
10.1.600 ToolsandTechnologies GeneralFramework 170178 Tools IconsonPerformanceandDiagnosticsToolshouldbeimproved
10.1.600 ToolsandTechnologies GeneralFramework 172821 Tools EpiControlsEpiTreeViewincorrectBehavior
10.1.600 ToolsandTechnologies GeneralFramework 176382 Tools Errordisplayswhenpastingavalueandthefocusisonthetreeviewarea

10.1.600 ToolsandTechnologies GeneralFramework 176643 Tools UnlockAccountunderActionsmenushouldbedisabledifuserisnotlocked


10.1.600 ToolsandTechnologies GeneralFramework 176698 Tools Arrowsmustbechangedforrealarrows,notdashesand"<",">"symbols
10.1.600 ToolsandTechnologies GeneralFramework 176727 Tools SearchFrameworkValuelistisdisabledwhenyouchangeCriteriaType

10.1.600 ToolsandTechnologies GeneralFramework 176831 Tools Thetipoftheday,itstextisusingquestionmarksinsteadoftheapostrophes


10.1.600 ToolsandTechnologies GeneralFramework 177120 Tools FixinvalidXMLcommentsinEpicor.ServiceModel
10.1.600 ToolsandTechnologies GeneralFramework 178163 Tools CompanyPermitsentryoffreeformcountrywhichbypassescontrols
EpiControlsepiCombodisplaysValueMemberinsteadofDisplaywhenEpiBinding
10.1.600 ToolsandTechnologies GeneralFramework 179052 Tools isDecimal
10.1.600 ToolsandTechnologies GeneralFramework 179521 Tools NoAppServertodatabaseversioncheckoccurs

Page93
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


10.1.600 ToolsandTechnologies GeneralFramework 180284 Tools SessionSettingsshouldnotbeallowedtosetpublicly
10.1.600 ToolsandTechnologies GeneralFramework 180561 Tools DateFunctionisdisplayedonallDatatypesnotonlywhenDateisselected
10.1.600 ToolsandTechnologies GeneralFramework 180609 Tools WebFormsImagecannotbeuploadedusingimageservice
10.1.600 ToolsandTechnologies GeneralFramework 180933 Tools ServerFileDownloadisnotusableinEWA
Sequencehasreachedthemaximumerrormessagewhenthemaxvalueofa
10.1.600 ToolsandTechnologies GeneralFramework 182380 Tools sequenceoftheIce.SysSequencetablehasbeenreached
LoggingFrameworkApplicationServerSettings/MaxLogFiledoesnotapplythe
10.1.600 ToolsandTechnologies GeneralFramework 182644 Tools correctvalue
RadiobuttonsArenotdisabledonUIwhen'ReadOnly'optionissetforaUIfrom
10.1.600 ToolsandTechnologies GeneralFramework 182821 Application menumaintenance
ExternalFileReferenceMissingreferentialIntegritywhendeletingXFileReftable
10.1.600 ToolsandTechnologies GeneralFramework 182948 Tools recordagainstXFileAttch
Searchoption'Next100'adds1recordtodisplayorreduceslistorresutsif
10.1.600 ToolsandTechnologies GeneralFramework 183480 Tools groupingisused

10.1.600 ToolsandTechnologies GeneralFramework 183516 Tools SysActivityLogtableisnotupdatedwhenlogonfailureoccursfromchangeusericon


DataDictionaryViewerAddmoredetailedinformationabouttable
10.1.600 ToolsandTechnologies GeneralFramework 183529 Tools erp.bankbaldeferredinDataDictionary
10.1.600 ToolsandTechnologies GeneralFramework 183772 Tools VerifytheVersionoftheSnapinswheninstalled
ExtendedUDTableMaintenanceTableisnotsyncedafterregenDMwhen
10.1.600 ToolsandTechnologies GeneralFramework 183987 Tools table.columnisrecreated
FavoritespanelisusingCurcompValuefromdatabaseinsteadofcurrentlyselected
10.1.600 ToolsandTechnologies GeneralFramework 184068 Tools CompanytoshowfavoriteelementsperCompany
EpiControlsEnablingofGroupByfeatureinEpiUltraGridleadstodramatic
10.1.600 ToolsandTechnologies GeneralFramework 184091 Tools increaseinmemoryconsumption
Instantiatinganadapterwithadisposedtransactionresultsina
10.1.600 ToolsandTechnologies GeneralFramework 184119 Tools NullReferenceException

10.1.600 ToolsandTechnologies GeneralFramework 184191 Tools AuthenticationparametershouldbestandardizedinXMLforcommandlinetools


ServiceDesignerDBnulldatetimelinkfieldretrievedas'19000101'insteadofa
10.1.600 ToolsandTechnologies GeneralFramework 184280 Tools whitespace

10.1.600 ToolsandTechnologies GeneralFramework 184370 Tools UserCodesUnfriendlyServersideerrorwhenuserchangesAutoSequencesetting


DataDirectiveErrorwhentryingtoexecuteAutoPrintBartenderreportusing
10.1.600 ToolsandTechnologies GeneralFramework 184619 Tools DataDirective

10.1.600 ToolsandTechnologies GeneralFramework 184688 Tools ExtendedUDTableMaintenanceCannotAddDateTimecolumnswithinitialvalues


TriggerProcessingTriggersarenotruninsecondValidate<TLinqRow>asrowis
10.1.600 ToolsandTechnologies GeneralFramework 184929 Tools UnchangedafterfirstValidate

Page94
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


10.1.600 ToolsandTechnologies GeneralFramework 184962 Tools EpiComboWithLinksValueList.Tagdoesnotupdatewhenrefreshingform
10.1.600 ToolsandTechnologies GeneralFramework 185696 Tools EpiControlsCannotaddEpiGridPanelcontrolstoE10customizations
EpiControlsUnhandledexceptionrandomlyappearsinConversionWorkbenchand
10.1.600 ToolsandTechnologies GeneralFramework 186199 Tools SystemMonitor

10.1.600 ToolsandTechnologies GeneralFramework 186497 Tools MESMenuPopsupSystemMonitorscreenwhenenteringwithanuser/password


10.1.600 ToolsandTechnologies GeneralFramework 186826 Tools EpiControlsErrordisplayedwhenaddinganewHeaderTaxCode
10.1.600 ToolsandTechnologies GeneralFramework 187064 Tools ErrordisplayedwhenRegDM,onlythefirsttime
UDTableEntryFullSyncCheckboxforinExtendedUDMaintenancequerygridhas
10.1.600 ToolsandTechnologies GeneralFramework 187192 Tools nomeaningandneedstoberemovedfromthegriddisplay

CoreFrameworkServicesInvalidlogonwindowdisplayshowmanyminutes
10.1.600 ToolsandTechnologies GeneralFramework 187286 Tools accountwillbelockeddifferentthanLockoutuntilvalueinuseraccountform
DMdllsmustberemovedfromLocalClientsfoldersinceitcausesBPMtowork
10.1.600 ToolsandTechnologies GeneralFramework 187326 Tools incorrectly
CoreFrameworkServicesIncorrectbehaviorusingincrementallockoutinaccount
10.1.600 ToolsandTechnologies GeneralFramework 187350 Tools lockoutpolicy
10.1.600 ToolsandTechnologies GeneralFramework 187450 Tools ExtendedUDTableMaintenanceErrorwhenBytesdatatypeisselected
CoreFrameworkServicesLockoutpolicydoesnotworkwhen"changeuser"is
10.1.600 ToolsandTechnologies GeneralFramework 187533 Tools used
ContextMenu"Like"valuescreatedinCustomizationDataTools(CustomLike
10.1.600 ToolsandTechnologies GeneralFramework 187553 Tools Columns)nothonoredbyContextMenus
EpiControlsPastingatextattheendofatextfieldinanenabledgridalways
10.1.600 ToolsandTechnologies GeneralFramework 187662 Tools overridestheexistingtext
10.1.600 ToolsandTechnologies GeneralFramework 187910 Tools SearchFrameworkDisabledClearResultsbuttononBAQSearch
CreationofViewsforBase/UDtablesfailswhenBasetablecontains
10.1.600 ToolsandTechnologies GeneralFramework 188023 Tools ForeignSysRowIDcol
CoreFrameworkServicesAccountisunlockedwhencounterisreachedusingonly
10.1.600 ToolsandTechnologies GeneralFramework 188086 Tools incrementallockout

10.1.600 ToolsandTechnologies GeneralFramework 188251 Tools EducationbuttonshoeswhenyoudonothaveEducationsetupforthatcompany


ProjectAnalysisExportSubmittingmultipleBPAprocesscauseserror"Processis
alreadyrunning,cannotstartanotherprocess"evenifdifferentProjectIDsareused
10.1.600 ToolsandTechnologies GeneralFramework 188335 Tools foreachBPAprocess
EnableMultipleDNSEntriesInSANCertificatevalue="True"/ismissingin
10.1.600 ToolsandTechnologies GeneralFramework 188442 Tools template.sysconfigfile
SearchFrameworkQuickSearchwithComboandButtonValue/Description
10.1.600 ToolsandTechnologies GeneralFramework 188490 Tools inconsistency

Page95
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


BizRuleEngineErrorwhentttableissenttovalidateafterchangeset37689is
10.1.600 ToolsandTechnologies GeneralFramework 188540 Tools applied
SearchFrameworkUnabletomodifyaNamedSearchsetasDefaultandSingle
10.1.600 ToolsandTechnologies GeneralFramework 188563 Tools ValueAutoSelect
10.1.600 ToolsandTechnologies GeneralFramework 188897 Tools TenancySecurityissueswithSysMonitorservice
10.1.600 ToolsandTechnologies GeneralFramework 188909 Tools ConversionWorkbenchRowsarelostwhenconversionsarerun
ICEMemoryLeakEpicor.Hosting.Operationholdingreferencesto
10.1.600 ToolsandTechnologies GeneralFramework 189056 Tools Ice.Lib.ChgLogHandler
ExtendedPropertiesUIsearchdoesnotselecttablecorrectlyiftableexistsbothin
10.1.600 ToolsandTechnologies GeneralFramework 189080 Tools ICEandERP
DisablingallowmultiplesessionsmeansloggingintoSocialEnterpriseclosedE10
10.1.600 ToolsandTechnologies GeneralFramework 189127 Tools session
10.1.600 ToolsandTechnologies GeneralFramework 189488 Tools FixobsoletewarningsrelatedtoNextValuelibrary
ExtendedUDTableMaintenance"Tableinsync"doesnotchangeto"Tablenot
10.1.600 ToolsandTechnologies GeneralFramework 189534 Tools synced"whenFormat,LabelorInitialvaluearechanged

10.1.600 ToolsandTechnologies GeneralFramework 190253 Tools EpiControlsTabOrderofCustomControlslostafteruserdisplaysadialog


"Illegalquerysyntax"Errorappearsonloginwhenauserisconfiguredwiththe
10.1.600 ToolsandTechnologies GeneralFramework 190551 Tools Maori(NewZeland)culture
SearchFrameworkBAQvaluefromBAQtypenamedsearchdoesnotremainon
10.1.600 ToolsandTechnologies GeneralFramework 190642 Tools thefieldwhenhavingmorethan1namedsearch
SearchFrameworkValueisnotsetonNamedSearchfieldonanautoexecutable
10.1.600 ToolsandTechnologies GeneralFramework 190648 Tools namedsearch

10.1.600 ToolsandTechnologies GeneralFramework 190650 Tools SearchFrameworkSizeofsearchdialogwhenusingautoexecutablenamedsearch


StoredProceduresGLControlenteredforTaxTypeEffectiveRatedisappearsafter
10.1.600 ToolsandTechnologies GeneralFramework 190773 Tools reopeningTaxType
ConversionWorkbenchTask30ConvertsExecutiveQueriesandProcessSetsdoes
10.1.600 ToolsandTechnologies GeneralFramework 191066 Tools notcomplete
10.1.600 ToolsandTechnologies GeneralFramework 191174 Tools DataModelGeneratortoolcreatinglogswithoutspecifiedformat
10.1.600 ToolsandTechnologies GeneralFramework 191178 Tools UDMapCompanyVisibility/TenancyIsolation

10.1.600 ToolsandTechnologies GeneralFramework 191481 Tools SearchFrameworkQSreturningcalculatedcolumndisplayserroruponexecution


10.1.600 ToolsandTechnologies GeneralFramework 191491 Tools TransactionHistoryTrackerCopytoExcelrunsOutofmemory

Page96
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description

ContextMenuUnabletousetheBPMHoldsMenuwithinacustomcontextmenu
althoughithasbeenconfiguredtousethecorrectprocess(Ice.UI.BpHoldsEntry),
thesystemopenstheHoldTypeMaintenanceformasopposedtothe
HoldAttachEntryForm,ifItryusingtheIce.UI.HoldAttachEntryFormasaprocess
thenthesystemdisplaysanerrormessageofMenuIDIce.UI.HoldAttachEntryForm
10.1.600 ToolsandTechnologies GeneralFramework 191510 Tools isnotvalidforcurrentuser.
SystemActivityLoghasinconsitencydatetimes(localtimeonsomeentries,UTCon
10.1.600 ToolsandTechnologies GeneralFramework 191599 Tools others)
SearchFrameworkNamedSearchisnotautoexecutedimmediatelyafterclosing
10.1.600 ToolsandTechnologies GeneralFramework 191817 Tools NamedSearchoptions,ifit'snotthefirstonecreated
SearchFrameworkFieldsfromadeletednamedsearchremainonthenextexisting
10.1.600 ToolsandTechnologies GeneralFramework 191819 Tools namedsearch
IftheuserismarkedasSSOrequiredyoushouldnotbeabletoswitchintothe
10.1.600 ToolsandTechnologies GeneralFramework 191821 Tools account
10.1.600 ToolsandTechnologies GeneralFramework 192634 Tools Largepayloadsoverhttpfailtoserialize
10.1.600 ToolsandTechnologies GeneralFramework 192643 Tools UpdateECCtousedefaulthttpsbinding
RibbonviewWhenselectedandscreensareopenedfromthecontextmenuand
10.1.600 ToolsandTechnologies GeneralFramework 192660 Tools closedthemiddlescreensystemdisplaysanerror
CoreFrameworkServicesExtendedUDTableMaintenanceallowsforinitialvalue
10.1.600 ToolsandTechnologies GeneralFramework 192736 Tools widerthantheformat
EpiControlsOnnewforminstance,unabletopasteajobnumberinthejobfield
10.1.600 ToolsandTechnologies GeneralFramework 192985 Tools usingCTRL+V
10.1.600 ToolsandTechnologies GeneralFramework 193249 Tools RaisedUIExceptiondoesnotresetconsecutiveevents
10.1.600 ToolsandTechnologies GeneralFramework 193276 Tools MemobuttongetsdisabledwhenRibbonviewisactivated/deactivated
10.1.600 ToolsandTechnologies GeneralFramework 193354 Tools Databaseconnectiontracemissingclosingstatement
ConversionWorkbenchMoveconversionthathaveUD10.1.XintheconversionID
10.1.600 ToolsandTechnologies GeneralFramework 193420 Tools toAutoRunConversionsarea
CoreFrameworkServicesUDcolumnnamevalidationshouldtemporarilyallow
10.1.600 ToolsandTechnologies GeneralFramework 193453 Tools "VNACGroup"and"VNACType"
Error"Salesorderclosed"whenperforminga"read"operationusigntheCash
10.1.600 ToolsandTechnologies GeneralFramework 193754 Tools ReceiptAPI
CoreFrameworkServicesServerloggingfailswhenmultipleprocessesarewriting
10.1.600 ToolsandTechnologies GeneralFramework 193833 Tools tothesamelogfile
10.1.600 ToolsandTechnologies GeneralFramework 193859 Tools ICEBuild10.1.500.6conversionsfail
SearchFrameworkNamedsearch,quicksearchtypeisnotautoexecuted
10.1.600 ToolsandTechnologies GeneralFramework 194053 Tools immediatelyafterclosingthenamedsearchoptions
EpicorapplicationstopsrunningwhenPasteInsertisusedinSystemAgent
10.1.600 ToolsandTechnologies GeneralFramework 194195 Tools Maintenanceform

Page97
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


WhenSubTaskLaunchercreatestheRunTaskimplitusestheconstructorthatuses
10.1.600 ToolsandTechnologies GeneralFramework 194232 Tools cachedchannels;thismaycauseissues
Ice.Lib.Framework.EpiTransaction'doesnotcontainadefinitionfor'GetByID'and
noextensionmethod'GetByID'acceptingafirstargumentoftype
10.1.600 ToolsandTechnologies GeneralFramework 194239 Tools 'Ice.Lib.Framework.EpiTransaction'couldbefound
ExternalCompanyMaintenanceAddvalidationthatExtCompanyIDmustmatch
CompanyonfiveExternalSystems(ECC_CUSTOMER,ECC_SUPPLIER,PLM,GENERIC,
10.1.600 ToolsandTechnologies GeneralFramework 194780 Tools MOBILE)

10.1.600 ToolsandTechnologies GeneralFramework 195241 Tools RibbonViewBecomesunusableafterusing"Showwindowsstacked"option


10.1.600 ToolsandTechnologies GeneralFramework 195532 Tools EpiControlsPasteUpdateOptioncouldnotbedisableforreadonlygrids
10.1.600 ToolsandTechnologies GeneralFramework 195621 Tools AdminSessionBOGetListmethoddoesnothonorwhereclause
10.1.600 ToolsandTechnologies GeneralFramework 196486 Tools TimePhasedMtlRequirementsErrorwhenstartedinEWA
10.1.600 ToolsandTechnologies GeneralFramework 197303 Tools Appserverlogsstoprollingover

10.1.600 ToolsandTechnologies GeneralFramework 197316 Tools ContextMenuObjectReferenceerrorwhenopeningcontextmenufromJobEntry


SearchFrameworkQuicksearchfrom10.0whenupgradedto10.1hasproblems
10.1.600 ToolsandTechnologies GeneralFramework 198017 Tools withmultiplecriteria
ConversionWorkbenchUnabletorunconversion1190;error"Objectreference
10.1.600 ToolsandTechnologies GeneralFramework 198026 Application notsettoaninstanceofanobject"
Errorwhenspecifictextvalueissavedandtracingisenabled:Hexadecimalvalue
10.1.600 ToolsandTechnologies GeneralFramework 198641 Tools 0x1E,isaninvalidcharacter
SearchFrameworkQSQuickSearchcriteriadoesnotworkcorrectlywithUnion
10.1.600 ToolsandTechnologies GeneralFramework 198707 Tools BAQs
10.1.600 ToolsandTechnologies GeneralFramework 199138 Tools FolderDialogreturnsthecompletepathinsteadofrelative

SearchFrameworkQSWhenaQuickSearchisaddedtoContextMenu
10.1.600 ToolsandTechnologies GeneralFramework 199233 Tools Part.PartNum,BPMHoldsisremovedfromtherightclickOpenWithPopupMenu
10.1.600 ToolsandTechnologies GeneralFramework 199936 Tools DisableBPM.BOandBPM.DTduringConversiontaskexecution
ExtendedPropsMaintshouldallowforUDCodeTypesagainstbasepackageUD
10.1.600 ToolsandTechnologies GeneralFramework 200931 Tools columns
10.1.600 ToolsandTechnologies HelpSystem 181830 Tools HelpSystemF1doesnotstartHelpfromEpiGLControliffieldisdisabled

HelpSystemerp.bankbaldeferredwasatableaddedinEpicor10.1butitisnot
10.1.600 ToolsandTechnologies HelpSystem 183469 Tools includedinthecustomerfacingschemachangedocumentationforEpicor10.1
10.1.600 ToolsandTechnologies HelpSystem 199522 Tools HelpSystemEpicorAboutLogoshouldbeupdated

10.1.600 ToolsandTechnologies ICEInstallations 155888 Tools E10.1ClientinstallPromptsanautoupdateofallotherE10clientsonworkstation


10.1.600 ToolsandTechnologies ICEInstallations 190879 Tools DeploymentAutoUpdatefailsifrunfromversionbefore10.1.500

Page98
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


DeploymentUpdateDatabasemessagewith"Ok"and"Cancel"optionscanbe
10.1.600 ToolsandTechnologies ICEInstallations 192309 Tools confusing
10.1.600 ToolsandTechnologies InformationWorker 180849 Tools SwitchIWtouseEnterpriseLIcenseratherthanDefaultuserlicense
InitialMessageforAutocreationofCRMcallfromEmailpointstoinvalidpathin
10.1.600 ToolsandTechnologies InformationWorker 181056 Tools menu
10.1.600 ToolsandTechnologies InformationWorker 181268 Application OutlookCRMCallsareincorrectassociatedwithinactivecontacts
10.1.600 ToolsandTechnologies InformationWorker 186225 Tools Variousformsopenandcloseinsteadofstayingopen
10.1.600 ToolsandTechnologies InformationWorker 190381 Tools Emailaddressfieldisnotvalidatedcorrectly
10.1.600 ToolsandTechnologies InformationWorker 190382 Tools Errorvaluedoesnotmatchifemailaddressisblank
10.1.600 ToolsandTechnologies InformationWorker 190414 Tools IncompleteerrorwhenyoutrytouninstallIW
10.1.600 ToolsandTechnologies InformationWorker 195635 Application OutlookCustomerscannotbesynchronizedinOutlook2016
10.1.600 ToolsandTechnologies InformationWorker 199394 Tools UpdateEpicorLogo
10.1.600 ToolsandTechnologies Licensing 183776 Tools LicenseCountsshowsincorrectlyinAdminConsole
ChangeinLicensecapabilityReportMonitorrunningunderanylicenseshoulduse
10.1.600 ToolsandTechnologies Licensing 185681 Tools thesamelicenseasacquiredbytheinitiallogon
LicenseUtilityOldlicenseImportToolshouldberemovedsincenewtool
10.1.600 ToolsandTechnologies Licensing 186839 Tools AdminLicense.exewascreated
10.1.600 ToolsandTechnologies Licensing 186841 Tools LicenseUtilityToolexportsincorrectly.licfile

10.1.600 ToolsandTechnologies Licensing 189189 Tools LicenseUtilityExtra<modules>nodeintemplateinAdmionLicense.exetool


10.1.600 ToolsandTechnologies Licensing 189200 Tools LicenseUtilityIfyouomit/LogFileargumentAdminLicensedoesnotwork
LicenseUtilityTenantIDcanbeassignedtoaNonMultitenantlicenseusing
10.1.600 ToolsandTechnologies Licensing 189539 Tools AdminLicense.exe
10.1.600 ToolsandTechnologies Licensing 190667 Tools RunningAdminLicensetoolnotasGSMshouldlogsecurityissue
LicenseUtilityObjectreferenceerrorwhenCSFsectionisincludedinthexmlbutis
10.1.600 ToolsandTechnologies Licensing 191031 Tools notconfiguredinAdminLicensetool
LicenseUtilityAdminLicensetooldoesnotcreatelogfilewhenaninvalidpathis
10.1.600 ToolsandTechnologies Licensing 191138 Tools specified

10.1.600 ToolsandTechnologies Licensing 192161 Tools ShellMenuListofSocialUsersdoesnotappearwhentyping'@'inmessage

ChangeinLicensecapabilityAllowexternallicensedmodulestoflowthroughto
10.1.600 ToolsandTechnologies Licensing 192959 Tools theAdminConsoletoallowuserstoenableanddisablemodules
ChangeinLicensecapabilityAddPackagecontrolabbreviationintheframework
10.1.600 ToolsandTechnologies Licensing 195432 Tools code
ShellMenuEnsurethatCapsLockwarningisconsistentlydisplayed(classicand
10.1.600 ToolsandTechnologies Menus 169161 Tools EWA)
ShellMenuTooloptionslocatedatthebottomofthescreenarenottranslated
10.1.600 ToolsandTechnologies Menus 174709 Tools correctly(onlyshellissue)

Page99
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


10.1.600 ToolsandTechnologies Menus 176183 Tools ShellMenuClosingthemenus"page"closestheUIjustopened
MenuMaintenanceFor2allcompaniesdashboardsondifferentcompanieswith
thesameIDandamenuforeachoneofthem,thelastdeployofoneofthe2
10.1.600 ToolsandTechnologies Menus 177757 Tools dashboards,willappearonbothmenus
ShellMenuTappingonafavoritetiletoexpanditdoesnotdisplaythecontents
10.1.600 ToolsandTechnologies Menus 178583 Tools correctly
MenuMaintenanceProgramdisplayserrorsifthereareusersindatabasewith
10.1.600 ToolsandTechnologies Menus 179083 Tools samenames
10.1.600 ToolsandTechnologies Menus 179601 Tools ShellMenuOrderorRearrangedFavoritesTilesnotmaintained
10.1.600 ToolsandTechnologies Menus 182745 Tools SerialMatchingAddabilitytorunfromMESmenu
10.1.600 ToolsandTechnologies Menus 184209 Tools ShellMenuSlowperformanceofMenuSearch
ShellMenuMenuSearchshouldalsomoveuptothefirstiteminthelistafteritis
10.1.600 ToolsandTechnologies Menus 184730 Tools used

10.1.600 ToolsandTechnologies Menus 185440 Tools ShellMenuTilegroupsorderontheModernMenuisnotsavedwhenrearranged


ContextMenuMaintenancePersonalizingaMenuItemcausesit'sbaseconfigto
10.1.600 ToolsandTechnologies Menus 185737 Tools belostinthecustomxmlfile
ClassicMenuConnectasanewuserdoesnotlaunchtheApplicationafteryou
10.1.600 ToolsandTechnologies Menus 187105 Tools enterthenewpassword
ShellMenuWhenchanginglanguage,Homepageisnottranslateduntilyougo
10.1.600 ToolsandTechnologies Menus 187499 Tools backtoEnglish
10.1.600 ToolsandTechnologies Menus 187612 Tools MenuMaintenanceDashboarddropdownwidthisthesizeofthescreen
10.1.600 ToolsandTechnologies Menus 187829 Tools ShellMenuUnabletoexpandCompanytreeusingchangeuseroption
ShellMenuIntheMenu,AddtoFavoritesandAddtoHomebuttonsdonot
10.1.600 ToolsandTechnologies Menus 188057 Tools appearwhenrightclickingmultipletimesonaform
10.1.600 ToolsandTechnologies Menus 189257 Tools MenuMaintenanceMenuPerformanceCanvasLinktypedoesnotwork
10.1.600 ToolsandTechnologies Menus 189259 Tools MenuMaintenanceIncorrectEWAstatusonacreatedmenu
10.1.600 ToolsandTechnologies Menus 189420 Tools ShellMenuUnabletoopenformsafterpreviouslyopening/closing
ShellMenuWhenrunningTaskListandthenCustomizedSubProcessCaseEntry
fromtheMenu,theCaseEntryCustomizationalwaysdisplays.However,when
runningTaskListfromaFavorites,theCaseEntryCustomizationdoesnotalways
10.1.600 ToolsandTechnologies Menus 189745 Tools display.
MenuMaintenanceExcludedWebaccessstatusonMenumaintenance,fora
10.1.600 ToolsandTechnologies Menus 189785 Tools dashboardwithahyphen''

10.1.600 ToolsandTechnologies Menus 190594 Tools ShellMenuCannotconsistentlycreateaTileGroupwithTilesforchosenfavorites


10.1.600 ToolsandTechnologies Menus 190796 Tools ShellMenuLittlesearchmenustillswhenchangingtheuser
ShellMenuLoginDialogdoesnotprovideuserfeedbacktoshowthatthelogin
10.1.600 ToolsandTechnologies Menus 191271 Tools actionwasaccepted

Page100
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


MenuMaintenanceParentMenuIDiscasesensitiveandcausesdisplayissueswith
10.1.600 ToolsandTechnologies Menus 191516 Tools menus
ShellMenuForaSSOuserMenudoesnotchangetotheselectedlanguagewhen
10.1.600 ToolsandTechnologies Menus 192149 Tools user'sdefaultlanguageischanged
10.1.600 ToolsandTechnologies Menus 192356 Tools ShellMenuCurrentcompanyindicatorisnotupdatedcorrectly
ShellMenuShellclientcloseswithanerrorwhenchangingdescriptionofEpicor
10.1.600 ToolsandTechnologies Menus 192379 Tools tile
MenuMaintenanceSecuritylistHeaderforcolumninchargeofWebaccess
10.1.600 ToolsandTechnologies Menus 193201 Tools restrictionisincorrectlyrepresented
10.1.600 ToolsandTechnologies Menus 194097 Tools ShellMenuFormmenugriddoesnotrefreshcorrectly
ContextMenuMaintenanceUnabletochooseCashGrp.GroupIDfromContext
MenuMaintenance.Column'LikeID'isconstrainedtobeunique.Value
10.1.600 ToolsandTechnologies Menus 194121 Tools 'CashGrp.GroupID'isalreadypresent
10.1.600 ToolsandTechnologies Menus 194274 Tools MenuMaintenanceDisplaySequencenotuniquetocompany
PartSalesUnitPricedoesnotdisplaywarningwhenvaluesetisgreaterthanthe
10.1.600 ToolsandTechnologies OpenActivePlanner 194740 Application allowed
TracingAccesstothepath'Epicor\Log'isdeniedwhentraceisenableandtheuser
10.1.600 ToolsandTechnologies Performance/Diagnostics 192954 Tools isEWA
TaskListDisplaysanerrorwhennavigatingonTab>List,afterrefreshingtheTask
10.1.600 ToolsandTechnologies ProcessManagement 177827 Tools TreefromQuoteEntry
TaskAgentServiceReportsshouldnotbepurgediftheyhavenotbeenprintedor
10.1.600 ToolsandTechnologies ProcessManagement 181423 Tools previewed
10.1.600 ToolsandTechnologies ProcessManagement 181712 Tools SystemAgentEndpointbindingfieldshouldbemoved

10.1.600 ToolsandTechnologies ProcessManagement 184795 Tools SystemAgentSchedulingaprocesssetdoesnotconsistentlyexecutetheprocess

10.1.600 ToolsandTechnologies ProcessManagement 186424 Tools SystemAgentSchedulePatterndoesnotdisplayinformationwhenListtabisused

10.1.600 ToolsandTechnologies ProcessManagement 187608 Tools SystemAgentTaskAgentRuledoesnotsavechangesunderAppServersettings


SystemMonitorGSM/SMappearsthatotherusersTaskcanbedeletedbutthey
10.1.600 ToolsandTechnologies ProcessManagement 188504 Tools arenot
TaskAgentServiceCommandlineUpdateactionisnotupdatingtaskagent
10.1.600 ToolsandTechnologies ProcessManagement 188917 Tools properties
10.1.600 ToolsandTechnologies ProcessManagement 190855 Tools TaskAgentServicecancelledtasksremaininsystasktableasactive
TaskAgentServiceTaskAgentServiceConfiguration.exeshutsdownusing""or"/"
10.1.600 ToolsandTechnologies ProcessManagement 190934 Tools (CLtool)
TaskAgentServiceUsername/PasswordcanbesetintaskagentCLtoolevenwhen
10.1.600 ToolsandTechnologies ProcessManagement 190960 Tools Windows/HttpsWindowsisused

Page101
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


SystemAgentViewtaskparameterswillbringintheincorrectdetailswhenitem
10.1.600 ToolsandTechnologies ProcessManagement 191992 Tools existsinmorethanonecompany
TaskAgentServiceRuntaskservicedoesnotdisposeoflazycreatedobjects
10.1.600 ToolsandTechnologies ProcessManagement 193439 Tools leavingthemforthecoreFWtodispose
SystemMonitorFileDownloadReportDataUnabletoParsetheuseridentifier
10.1.600 ToolsandTechnologies ProcessManagement 193758 Tools fromthereportdatapath
SystemAgentSystemagentintervalschedulesettoexecuteevery30secondsis
10.1.600 ToolsandTechnologies ProcessManagement 194874 Tools executingeverytwominutesinstead
TaskAgentServiceDeadlockonSysAgentTaskParamwhenlaunchingmultiple
10.1.600 ToolsandTechnologies ProcessManagement 195723 Tools SubmitToAgentcalls

10.1.600 ToolsandTechnologies ProcessManagement 195747 Tools TaskLibNonthreadsafeconstructorisusedtogettheavailableMEFplugins

10.1.600 ToolsandTechnologies ProcessManagement 196683 Tools SystemAgentReportStylerecordnotfoundARInvoiceFormduringautoprint


SystemMonitorTasksfromallcompaniesinamultitenantenvironmentdonot
10.1.600 ToolsandTechnologies ProcessManagement 196864 Tools showupfortheuser,itonlyshowsthecurrentloggedincompany

SystemAgentViewtaskparametersshouldnotbeenabledorshoulddisplayan
10.1.600 ToolsandTechnologies ProcessManagement 197254 Tools errorifthescheduledtaskwasnotsubmittedinthecurrentcompany
PurchaseOrderEntry"Waitoperationtimedout"errorgeneratedwhenprinting
10.1.600 ToolsandTechnologies PurchasingManagement 193627 Tools PO
ReportDataDefinitionNewTable/Relationshipcontextualmenushouldnotbe
10.1.600 ToolsandTechnologies ReportsFramework 169412 Tools enabledonSystemRDD
Email/Faxreportoptionshouldsupportbothcommaandsemicolonasanemail
10.1.600 ToolsandTechnologies ReportsFramework 172743 Tools separatoroption
ReportDataDefinitionDecimalcolumnsshouldbedisabledifdatatypeisnot
10.1.600 ToolsandTechnologies ReportsFramework 173048 Tools decimal

10.1.600 ToolsandTechnologies ReportsFramework 175011 Tools ReportDataDefinitionFieldRptLanguageIDismissingintablesuseradds


ReportDataDefinitionExcludingallcolumnsexceptyourlinksandUDsdoesnot
10.1.600 ToolsandTechnologies ReportsFramework 176045 Tools showdatainthetablecreatedbythereport
10.1.600 ToolsandTechnologies ReportsFramework 177863 Tools RoutingPossibletosaveanemptyRoutingRule
10.1.600 ToolsandTechnologies ReportsFramework 179893 Tools ReportStyleErrorwhenclickingSyncDatasetbutton
10.1.600 ToolsandTechnologies ReportsFramework 181149 Tools ErroroninitialRunwithnonUSRegionsetting

10.1.600 ToolsandTechnologies ReportsFramework 184315 Tools GenerateEDIDefinitionbuttonshouldbedisabledwhenXMLFileoptionisselected


10.1.600 ToolsandTechnologies ReportsFramework 184441 Tools GenerateEDIDefinitionshouldonlybeavailableforGSMinmultitenant
10.1.600 ToolsandTechnologies ReportsFramework 185690 Tools ReportStyleReportSearchresultsCanAutoPrintismisleading
10.1.600 ToolsandTechnologies ReportsFramework 186243 Tools ErrorwhenopeningClientPrinterdialogonAutoPrint

Page102
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


ReceiptEntryErrorwhenprintingreportfromReportStylecopiedfromanother
10.1.600 ToolsandTechnologies ReportsFramework 187278 Tools one
10.1.600 ToolsandTechnologies ReportsFramework 187446 Tools RemoveunsupportedFaxtabfromreporting
10.1.600 ToolsandTechnologies ReportsFramework 191023 Tools EDIreportsdonotworkifclientdoesnothaveaccesstotheservershare
10.1.600 ToolsandTechnologies ReportsFramework 191436 Tools Clientprintersdialogtakestoolongtoopen
AfterrunningSyncDatainERP10.1.400foranewreportstyleforthePOForm,
10.1.600 ToolsandTechnologies ReportsFramework 191527 Tools errordisplayswiththeSQLaddedafterthesync
10.1.600 ToolsandTechnologies ReportsFramework 193886 Tools BCCignoredwhensendingemailsinAdvancedPrinting
10.1.600 ToolsandTechnologies ReportsFramework 194002 Tools ChangeLogReportdoesnotshowtheuser
CustomercopyaPOFormRDDfromstdandduplicatenewstylefromstdSSRS
POFormreporttobecustomizedreport.Newtables/columnsinRDDhavenotbeen
updatedinPOFormSSRSreportrdlfilesautomaticallyafterrun"SyncDataset"in
10.1.600 ToolsandTechnologies ReportsFramework 194958 Tools reportstylemain.
SQLServerReportingServicesIncorrectQuerycreatedinARFormsubreportafter
10.1.600 ToolsandTechnologies ReportsFramework 196413 Tools syncRDDandRDLfile
OrderbyrequirestouseDB.ColumnNameandselectparameterrequiresNameof
10.1.600 ToolsandTechnologies RESTFramework 185183 Tools thecolumnthatshowstheservice
10.1.600 ToolsandTechnologies RESTFramework 185811 Tools CustomerCustIDcolumncanbeusedin$selectbutnotin$filter

10.1.600 ToolsandTechnologies RESTFramework 186836 Tools UnabletouseREST,NoassemblyfoundcontaininganOwinStartupAttribute


10.1.600 ToolsandTechnologies RESTFramework 186843 Tools Clientsmaycacheresponsesforsameurl,differentheaders
10.1.600 ToolsandTechnologies RESTFramework 187714 Tools RESTHelpUIdoesnotopeniftheURLhasAPIwithcapitalletter
10.1.600 ToolsandTechnologies RESTFramework 187986 Tools ODATA$filterwithdatetimeconstantdoesnotwork
10.1.600 ToolsandTechnologies RESTFramework 196591 Tools Unabletousesomeoperatorsandreplacefunctionisnotsupported
10.1.600 ToolsandTechnologies RESTFramework 196906 Tools AddsupportofGetNewforRESTUBAQs
10.1.600 ToolsandTechnologies RESTFramework 197406 Tools ChangesarenotresfreshedinBaqSvc
10.1.600 ToolsandTechnologies RESTFramework 197596 Tools UnabletocallGetRowswithPOSvc(standardmethod)
10.1.600 ToolsandTechnologies RESTFramework 197770 Tools Unabletoopenservicessuggestedintokenauthenticationsection
10.1.600 ToolsandTechnologies SDK 181232 Tools ICESDKandDevUtilitiesICEExplorershouldsupportthemes
ICESDKandDevUtilitiesRemoveusageofobsoletemembersof
10.1.600 ToolsandTechnologies SDK 185025 Tools UltraGridExcelExporter
IncorrectmessagewhennonsecuritymanagertriestodeleteassignedCompany
10.1.600 ToolsandTechnologies SecurityFramework 180857 Tools fromanotheruser
10.1.600 ToolsandTechnologies SecurityFramework 182198 Tools NonSecurityManagershouldnotbeabletologintoAdminConsole
10.1.600 ToolsandTechnologies SecurityFramework 183765 Tools Numberofloginsisnotdecreasingwhen"Changeuser"optionisused
10.1.600 ToolsandTechnologies SecurityFramework 185019 Tools SM/GSMcanseeanddeletecompaniesthattheydonothaveaccessto

10.1.600 ToolsandTechnologies SecurityFramework 188362 Tools UsingSSOwithout"RequireSingleSignOn"flag,option"changeuser"isavailable


10.1.600 ToolsandTechnologies SecurityFramework 190245 Tools UserSecurityObjectreferencenotsettoaninstanceofanobject

Page103
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


UserSearchEnteredvalueonafieldwithStartsWithconditionisnotclearedafter
10.1.600 ToolsandTechnologies SecurityFramework 191945 Tools clickingNewSearch

10.1.600 ToolsandTechnologies SecurityFramework 191986 Tools IssueswithUpdateExtforSystemMenu/SecurityRecordswithBlankCompany


MenuSecurityReportReportdisplaysparameterizedquery'(@p1...errormessage.
10.1.600 ToolsandTechnologies SecurityFramework 193293 Tools NotabletorunMenuSecurityReportinSaaSenvironment

10.1.600 ToolsandTechnologies SecurityFramework 193456 Tools UsercanlogintoMESasmanytimesasdesiredwithexpired/clearedpassword

ProcessSecurityUnabletochangeprocesssecurityon
10.1.600 ToolsandTechnologies SecurityFramework 194370 Tools bo.PaymentEntry.CreateCheckswithinProcesssecurityUIforsomeconditions
Abletoinsertrecordforacompanythatdoesnothaveaccess(usingRESTandBL
10.1.600 ToolsandTechnologies SecurityFramework 195841 Tools Tester)
10.1.600 ToolsandTechnologies SecurityFramework 198313 Tools UserSecurityAbletoremoverecordsofcompanywithoutaccess
ProcessSecurityUnabletoopenbo.Customerservice;Applicationloses
10.1.600 ToolsandTechnologies SecurityFramework 198567 Tools connection
ProcessSecurityObjectreferencetryingtogetnexttipwhenuserdoesnothave
10.1.600 ToolsandTechnologies SecurityFramework 199355 Tools accesstotheservice
10.1.600 ToolsandTechnologies SocialEnterprise 165203 Tools UnabletocreateUserinESE
10.1.600 ToolsandTechnologies SocialEnterprise 180629 Tools Columnsarestillloadedevenwhentheyarenotvisible
10.1.600 ToolsandTechnologies SocialEnterprise 180955 Tools DuplicateMessageswhenchangingfromonecompanytoanother
10.1.600 ToolsandTechnologies SocialEnterprise 182013 Tools Logoutmethodinuserprofilesendsouttwosetsofcookies
10.1.600 ToolsandTechnologies SocialEnterprise 183523 Tools Adderrorhandlingtodealwithinvalidclientsettingsuserproperty
10.1.600 ToolsandTechnologies SocialEnterprise 183524 Tools Folder/ESEshouldnotbehardcodedinpathtosignalrhub
10.1.600 ToolsandTechnologies SocialEnterprise 183526 Tools RemovesupportforAutoRefreshwhenESEisembeddedinE10

10.1.600 ToolsandTechnologies SocialEnterprise 183785 Tools ForgotpassworddisplaysanerrorevenwhenthereisanSMTPaccountvalid


ForgotpasswordlinklooksdisabledbutstillworksinIE,EdgewhenselectinganERP
10.1.600 ToolsandTechnologies SocialEnterprise 183797 Tools Source
Files,textandpageelementscanbedraggedanddroppedevenwhenuserisnot
10.1.600 ToolsandTechnologies SocialEnterprise 183802 Tools loggedin
10.1.600 ToolsandTechnologies SocialEnterprise 183876 Tools Dailydigestisnotsentafterthefirsttime
10.1.600 ToolsandTechnologies SocialEnterprise 183948 Tools Inactiveusersshouldnotreceivemailalertsordailydigest
10.1.600 ToolsandTechnologies SocialEnterprise 184002 Tools CannotremovelastownerofapublicgroupinGroupManagement
10.1.600 ToolsandTechnologies SocialEnterprise 184019 Tools CreateNotificationSourcepageismissinghomebutton
10.1.600 ToolsandTechnologies SocialEnterprise 184021 Tools Forgotpassword/setpasswordtokenfailswhentokenhas/
10.1.600 ToolsandTechnologies SocialEnterprise 184041 Tools Selectingtextinacolumnoutofviewinmainpagetriggersaswipe
10.1.600 ToolsandTechnologies SocialEnterprise 184083 Tools UnableopenanddownloadChinesefilenameattachment

Page104
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description

10.1.600 ToolsandTechnologies SocialEnterprise 184175 Tools MultiTenantRefreshingasglobaladminincorrectlyreturnsyoutomainpage


MultiTenantTenantadminshouldnotconfigureMailServeroptionsorESE
10.1.600 ToolsandTechnologies SocialEnterprise 184177 Tools WebsiteURL
10.1.600 ToolsandTechnologies SocialEnterprise 184184 Tools NeedtoseparatetheESEWEbsiteURLinto2values
10.1.600 ToolsandTechnologies SocialEnterprise 184205 Tools IsPremiumCheckneedstobetenancyaware
10.1.600 ToolsandTechnologies SocialEnterprise 184208 Tools 404errorwhenServerSourceIDleftblank

10.1.600 ToolsandTechnologies SocialEnterprise 184214 Tools ConditionfieldinNotificationruleshouldnotallowselectionofrelatedtablefields


DataNotificationsNotificationrulemessagedoesnotappearinnotifiation
10.1.600 ToolsandTechnologies SocialEnterprise 184218 Tools messagesearchcolumn
10.1.600 ToolsandTechnologies SocialEnterprise 184219 Tools NotificationstabonUserProfiledoesnotrefreshonunfollowoflastrule
ChangingcompanyinModernshellshowsInvalidURImessageonSocialtileif
10.1.600 ToolsandTechnologies SocialEnterprise 184222 Tools changingtoacompanywithESEnotconfigured

10.1.600 ToolsandTechnologies SocialEnterprise 184223 Tools UsinganErpusertologintoESEwillloadexisitingESEuserwithsamename


10.1.600 ToolsandTechnologies SocialEnterprise 184224 Tools E10userwithoutemailaddresscannotbeautocreatedinESE
10.1.600 ToolsandTechnologies SocialEnterprise 184225 Tools Defaultbioforautocreatedusershouldbechanged
DataNotificationsDatabaseupgradehangsiftherearerelatedtablesdefinedin
10.1.600 ToolsandTechnologies SocialEnterprise 184455 Tools notificatoinprofile
10.1.600 ToolsandTechnologies SocialEnterprise 184607 Tools HttpsbindingsdonotrequiretheDNSIdentity
10.1.600 ToolsandTechnologies SocialEnterprise 184897 Tools MustsupportanonymousSMTP
10.1.600 ToolsandTechnologies SocialEnterprise 184898 Tools MultitenantSocialEnterpriseshouldhideTwitteractivity

10.1.600 ToolsandTechnologies SocialEnterprise 185378 Tools AddvalidationtoinitialUserIdfieldinEpicorSocialextensioninAdminConsole

10.1.600 ToolsandTechnologies SocialEnterprise 186845 Tools ESEcannotloginwheninitialuseraccounthasaspecialcharacterinthepassword


Inmultitenantconfiguration,MessageQueueProcessorcallsmethodsthatwindup
10.1.600 ToolsandTechnologies SocialEnterprise 187017 Tools withincorrecttenantid
10.1.600 ToolsandTechnologies SocialEnterprise 187318 Tools CannotdeployorupgradeexistingSocialinstallationin10.1.500
10.1.600 ToolsandTechnologies SocialEnterprise 188554 Tools CannotconnecttoESEfromE10whenE10Useridcontainsonlynumerics

DataNotificationsPreprocessingmessagedirectivesdonotworkbecause
10.1.600 ToolsandTechnologies SocialEnterprise 188571 Tools notificationsareonlygeneratediftheprimarytablehasrowsinit
10.1.600 ToolsandTechnologies SocialEnterprise 189164 Tools AfterupdatingESEfrom400to500ESEwebsiteisnotdeployedcorrectly
10.1.600 ToolsandTechnologies SocialEnterprise 190734 Tools Text"InitialUserPasswordisrequired"isduplicated
Postmessageformallowspostmessagetoappeartocompletewithoutsaving
10.1.600 ToolsandTechnologies SocialEnterprise 190866 Tools message
10.1.600 ToolsandTechnologies SocialEnterprise 191018 Tools RemoteDeploymentofSocialEnterpriseSetsinvalidappserverURL

Page105
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


SignalRconnectionfromCDCLogReadertoWebsitecancauseservertorunoutof
10.1.600 ToolsandTechnologies SocialEnterprise 191021 Tools tcpports
10.1.600 ToolsandTechnologies SocialEnterprise 193903 Tools Notification.S\eEarchandSearchHeaderneedstightersecurity
ExpandadministrationAuthorizationfortenantadmintoenforcesametenantas
10.1.600 ToolsandTechnologies SocialEnterprise 193904 Tools incomingdata
10.1.600 ToolsandTechnologies SocialEnterprise 193906 Tools Multitenantloginscreenshouldnotprovidelistofnotificationsources
10.1.600 ToolsandTechnologies SocialEnterprise 193909 Tools ServerSideDataCachesneedtobemodifiedtoincludetenantIDinkey
10.1.600 ToolsandTechnologies SocialEnterprise 193915 Tools Authorizechecksforpremiumlicenseneedtobetenantaware

10.1.600 ToolsandTechnologies SocialEnterprise 194293 Tools IndexoutofboundsexceptionwhenselectingarowinadashboardfromaSysCube


AddvalidationruletopreventcreationofuserinMTfortenantidthatdoesnot
10.1.600 ToolsandTechnologies SocialEnterprise 194993 Tools exist
UninstallProcessForEpicorSocialfails,whenyouclickNewbuttonandyoutryto
10.1.600 ToolsandTechnologies SocialEnterprise 196459 Tools uninstallESE
10.1.600 ToolsandTechnologies SocialEnterprise 196551 Tools Inviteuserstogroupformbuttonsonlyvisibleafterresizingbrowser
10.1.600 ToolsandTechnologies SocialEnterprise 196651 Tools CannotconfigureserverorAppPoolwithcustommachineaccount
10.1.600 ToolsandTechnologies SocialEnterprise 197176 Tools CDCLogreaderservice,ifSQLgoesdown,cannotbestopped
SolutionElementEntryDataTableIDisdisplayedastheParentTableName,notthe
10.1.600 ToolsandTechnologies SolutionWorkbench 123150 Tools DBTable
SolutionElementEntryUsingtheCopyDeliveredElementsoptionleavestheform
10.1.600 ToolsandTechnologies SolutionWorkbench 148750 Tools partiallypopulatedcausingerrors

10.1.600 ToolsandTechnologies SolutionWorkbench 150234 Tools SolutionTypeEntryTabnameshouldbecorrected(missingspace)orchanged

10.1.600 ToolsandTechnologies SolutionWorkbench 177765 Tools DifferentrecordsareaddedontrackingsolutiondependingontheSolutionType


SolutionWorkbenchshouldinstallUpdatedBaseMenuIDwhereCustomizations
10.1.600 ToolsandTechnologies SolutionWorkbench 181376 Tools weredeployedasitdidinE10.0
10.1.600 ToolsandTechnologies SolutionWorkbench 182500 Tools SolutionTypeEntryCreatinganewrecordcausesaserversideerror

ErroronimportinSW10.1ofBPMdirectivesCannotcreateunknowntype'{clr
10.1.600 ToolsandTechnologies SolutionWorkbench 187091 Tools namespace:Ice.Lib.Bpm.Arguments;assembly=Ice.Lib.Bpm.Shared}TablesetTypeInfo'

10.1.600 ToolsandTechnologies SolutionWorkbench 188663 Tools AddaReportStylethenaReportDataDefinitioninasolutiondisplaysanerror


10.1.600 ToolsandTechnologies SolutionWorkbench 188883 Tools CannotaddadashboardsetforCGCCodetoaSolution
10.1.600 ToolsandTechnologies SolutionWorkbench 190808 Tools ImportofZDataTablecreatesaduplicateZLinkColumnifitalreadyexists
10.1.600 ToolsandTechnologies SolutionWorkbench 193935 Tools CreatedBytextboxshouldbeReadOnly
10.1.600 ToolsandTechnologies SolutionWorkbench 194982 Tools UnabletoinstallsolutionwithUDElements

Page106
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


TaxConnectIncorrectTaxDatesenttoAvalarawhenthesameOrderNumis
10.1.600 ToolsandTechnologies TaxConnect 199716 Application alreadypostedinvoicewithinvoicereference
10.1.600 ToolsandTechnologies Themes 137181 Tools Decimalpointisnotvisibleonadisabledtextboxusingthedefaulttheme
Groupbarwhencollapseddoesnothighlightwhenitisclickedupon;workswhen
10.1.600 ToolsandTechnologies Themes 182671 Tools themesaredisabled
HandHeldstopsworkingwhenremotedesktopisclosedandreopenedagain;
10.1.600 ToolsandTechnologies Themes 196415 Tools Systmerrror:Keynotfound
TranslationMaintenancePasteUpdateandPasteInsertarenotsupportedonthe
10.1.600 ToolsandTechnologies Translation 181231 Tools TranslationMaintenanceUI
SpanishTranslationAddanewTranslationforthetitleofanewreportandsome
10.1.600 ToolsandTechnologies Translation 184858 Tools incorrectTranslation
10.1.600 ToolsandTechnologies WebAccess 138052 Tools EWA,ContainerLandedCost,IssuesworkingwithContainerShipments
10.1.600 ToolsandTechnologies WebAccess 141549 Tools EWAConfigurationPartCreationfromSmartStringfails

10.1.600 ToolsandTechnologies WebAccess 144321 Tools WebFormsErrorwhenDeployingtoEWAapreviouslydeployedconfigurator


WebFrameworkCashReceiptEntryEWA:Errorwhenselectinginvoicesfor
10.1.600 ToolsandTechnologies WebAccess 155096 Tools ElectronicInterface
10.1.600 ToolsandTechnologies WebAccess 155146 Tools WebFrameworkEnglish/USlanguagedoesnotshowinEWA
10.1.600 ToolsandTechnologies WebAccess 157352 Tools IncorrectconversiontoEWAComponents
WebFrameworkAttachmentsuploadedfromEWAarenotusingtheattachment's
10.1.600 ToolsandTechnologies WebAccess 158637 Tools settingscorrectly
WebFrameworkCodegeneratorsometimesconvertsEpiString.GetString
10.1.600 ToolsandTechnologies WebAccess 161347 Tools referencesincorrectly

10.1.600 ToolsandTechnologies WebAccess 162084 Tools WebFrameworkPasswordontheCustomReportsformisnotmaskedinEWA


WebFormsJobandAsmbuttonsonReceiptEntryshouldbeInactivewhenadding
10.1.600 ToolsandTechnologies WebAccess 163076 Tools NewReceiptLine
10.1.600 ToolsandTechnologies WebAccess 165435 Tools WebFormsDashboardSummarizeBydoesnotfunctionproperlyinEWA
WebFramework"NeverSave"optionfrom"ActiveFormSettings"functionalityis
10.1.600 ToolsandTechnologies WebAccess 167806 Tools notfullyworking
ReviewJournal[EWA]CansavecorrupteddataasfieldsarenotdisabledandUI
10.1.600 ToolsandTechnologies WebAccess 168073 Tools issuesmaketheformunusable
10.1.600 ToolsandTechnologies WebAccess 168828 Tools WebFormsSeveralissuesonJobStatusdashboard
10.1.600 ToolsandTechnologies WebAccess 170445 Tools WebFrameworkArrayisnotconvertedcorrectly
WebFrameworkFirefoxloadsEWAhomepageincorrectlyafterrefreshingthe
10.1.600 ToolsandTechnologies WebAccess 172302 Tools webbrowser
10.1.600 ToolsandTechnologies WebAccess 175252 Tools WebFrameworkNullreferenceexceptioninset_Selectedfunction
10.1.600 ToolsandTechnologies WebAccess 177139 Tools WebFrameworkBAQreportscannotbeprintedinEWA
10.1.600 ToolsandTechnologies WebAccess 177523 Tools WebFormsEmptycomboboxonatrackerviewfromadashboard

Page107
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


WebFrameworkCallcontextsubscriberinformationfromdashboardisnotbeing
10.1.600 ToolsandTechnologies WebAccess 177556 Tools displayedinEWAwhenitisimplementedinaBPMprocess
10.1.600 ToolsandTechnologies WebAccess 177593 Tools WebFormsNotabletosaveemptyUDfieldsonacustomizedwebform
WebFrameworkQuicksearchesinFirefoxarenotretrievingtheselectedvalueto
10.1.600 ToolsandTechnologies WebAccess 177637 Tools theformtheywerecalledfrom
WebFrameworkEpicomboDataRetrievedDelegatenotgettingtriggeredwhen
10.1.600 ToolsandTechnologies WebAccess 177944 Tools newepicomboisactivated
WebFormsCustomODBCreportpagingdoesnotworkifithasanyparameter,it
10.1.600 ToolsandTechnologies WebAccess 179693 Tools willalwaysloadthefirstpage
WebFormsRadiobuttonsarenothonoredwhentheyarepartofasecond
10.1.600 ToolsandTechnologies WebAccess 180266 Tools configurationonamultilevelconfiguration
WebFormsWarning"Youcannotselectmorethan5serialnumbers"when
10.1.600 ToolsandTechnologies WebAccess 180290 Tools selectinglessthan5serialnumbers,onIssueMaterial
WebFormsWhenselectingSerialNumbersonIssueMaterialonlythelastone
10.1.600 ToolsandTechnologies WebAccess 180293 Tools remainsselected
WebFormsAssetTrackerDepreciationtabdoesnothaveDepreciationSchedule
10.1.600 ToolsandTechnologies WebAccess 180444 Tools gridandRetrievebutton
WebFormsEpiDateTimeEditorcontrolshowsincorrecttimeforcolumnswith
10.1.600 ToolsandTechnologies WebAccess 181112 Tools {datetime}format
WebFormsInPurchaseOrderrelease,G/LAccountfielddoesnotrecognize
10.1.600 ToolsandTechnologies WebAccess 181602 Tools accountcodewith4thSegmentvalue
WebFormsHeadersforReportParameterspartmissedinEWAReports(Trial
10.1.600 ToolsandTechnologies WebAccess 182397 Tools Balancereport)

10.1.600 ToolsandTechnologies WebAccess 182678 Tools WebFrameworkJScriptcauseserrorduetocasesensitiveproperty'snames


WebFormsOnmultilevelconfigurations,issueappearswhenpagingbackward
10.1.600 ToolsandTechnologies WebAccess 183151 Tools intoanewconfiguration
WebFormsFinancialreportsdonotworkinEWAduetoanunexpectedmessage
10.1.600 ToolsandTechnologies WebAccess 183227 Tools onpreviewing
WebFrameworkOutboundEDIreportsarenotgeneratedintheconfigured
10.1.600 ToolsandTechnologies WebAccess 183300 Tools outputlocationfromthecorrespondingreportstyle
WebFrameworkWebdashboardsdoesnotsupportmorethan1autohidden
10.1.600 ToolsandTechnologies WebAccess 184039 Tools verticaltrackerpanels

10.1.600 ToolsandTechnologies WebAccess 184079 Tools WebFormsPossibletoenteranyvalueonacomboboxfromaconfiguration

10.1.600 ToolsandTechnologies WebAccess 184368 Tools WebFrameworkProblemswithselecting/submittingmultipletimeentries


10.1.600 ToolsandTechnologies WebAccess 184369 Tools WebFrameworkMissingSummariesinTimeandExpenseform

Page108
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description

10.1.600 ToolsandTechnologies WebAccess 184604 Tools WebFormsTimeandExpenseWBSPhaseValidationobjreferrorinFirefox(only).


WebFormsForTimeApprovalitispossibleinEWAtohighlightmultiplerowsand
10.1.600 ToolsandTechnologies WebAccess 184731 Tools approveinIE11butnotinFirefox

10.1.600 ToolsandTechnologies WebAccess 184895 Tools WebFrameworkIssueswithchangedeventsonradiobuttonsandcheckboxes


WebFormsGLAccountEditorshowserrorifselectingsegmentsfromindividual
10.1.600 ToolsandTechnologies WebAccess 184938 Tools search
10.1.600 ToolsandTechnologies WebAccess 184959 Tools WebFrameworkSystemMonitordoesnotload
WebFormsSavedImagecannotbedisplayedifyoutypedirectlythenameofthe
10.1.600 ToolsandTechnologies WebAccess 184990 Tools ImageontheImageNamefield
10.1.600 ToolsandTechnologies WebAccess 185069 Tools WebFormsIssuesfromthe"InvoicePaymentSelection"webform
WebFrameworkWhenacombonearthebottomofthescreenisopened,the
10.1.600 ToolsandTechnologies WebAccess 185087 Tools popupshoulddisplayabove
10.1.600 ToolsandTechnologies WebAccess 185167 Tools WebFormsUDfieldsdonotsavevaluesfromEWA
10.1.600 ToolsandTechnologies WebAccess 185350 Tools WebFrameworkCannotprintpreviewBAQReportsthathavefilters
WebForms'Unabletogetproperty'toString'ofundefinedornullreference'
10.1.600 ToolsandTechnologies WebAccess 185358 Tools messagewhenaddinganoperationtoaJob
WebFormsFiltersfromRebatecontractSummaryreportandRebatetransaction
10.1.600 ToolsandTechnologies WebAccess 185438 Tools reportarenotworkingfromEWA
WebFormsImageMaintenanceImagesearchdialogdoesnotrefreshthe
10.1.600 ToolsandTechnologies WebAccess 185506 Tools previewimageforexistingimages
10.1.600 ToolsandTechnologies WebAccess 185515 Tools WebFormsUnabletoreopenPurchaseOrderreleaseEWA
WebFrameworkEpiRowChangedeventisnotrunaftervalueinComboboxis
10.1.600 ToolsandTechnologies WebAccess 185729 Tools changed
WebFormsParameterswebpagedialogdoesnotworkasexpected,onIntrastat
10.1.600 ToolsandTechnologies WebAccess 185770 Tools DetailsTracker
WebFrameworkSomeReportparametersarenotsetwhenthereportsare
10.1.600 ToolsandTechnologies WebAccess 186167 Tools launchedfromEWA
WebFormsUnexpectedmessageunselectingserialnumbersin"SelectSerial
10.1.600 ToolsandTechnologies WebAccess 186249 Tools Numbers"dialog
10.1.600 ToolsandTechnologies WebAccess 186400 Tools WebFormsCustomerShipmentCannotaddanewline
WebFrameworkRebateContractSummarydoesnotdisplaythesamedataasin
10.1.600 ToolsandTechnologies WebAccess 186419 Tools SmartClient
10.1.600 ToolsandTechnologies WebAccess 186428 Tools WebFormsNotabletochangeTypeonLinefromPOEntry
WebFormsExitEWAgracefullywitherrormessageifuserdoesnothaveaccessto
10.1.600 ToolsandTechnologies WebAccess 186846 Tools menu

Page109
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description

WebFrameworkIncorrectsyntaxnear')'whenIselectOrderEntrytoopenatlogin
10.1.600 ToolsandTechnologies WebAccess 187331 Tools whenusingpropertiesManualSaveorAutoSavefromweb.config
WebFrameworkErrorsdisplaywhencreatingaNamedSearchanddeletingit
10.1.600 ToolsandTechnologies WebAccess 187355 Tools leavingemptyfields,thentryingtoaddanewNamedSearch
WebFramework"ControlSetting:Unabletomatchrow0toadatabaserow"
10.1.600 ToolsandTechnologies WebAccess 187363 Tools messagewhencreating2namedsearcheswithsameID
WebFrameworkWhenclickingonDetailtabfromNamedSearches,the
10.1.600 ToolsandTechnologies WebAccess 187366 Tools breadcrumbsarenotshown
WebFrameworkNamedsearchtakesparametersfromthelatestcreatednamed
10.1.600 ToolsandTechnologies WebAccess 187367 Tools search
WebFramework"Unabletogetproperty'ldx'ofundefinedornullreference"
messagewhenselectingavailablequicksearchonnamedsearchoptions,onsales
10.1.600 ToolsandTechnologies WebAccess 187369 Tools orderentry
WebFrameworkDisabledradiobuttonsevenifyouhaveacustomer,onNamed
10.1.600 ToolsandTechnologies WebAccess 187383 Tools Search
10.1.600 ToolsandTechnologies WebAccess 187409 Tools WebFrameworkDisabledNextbuttononBAQSearch
10.1.600 ToolsandTechnologies WebAccess 187412 Tools WebFrameworkNamedSearchQuickSearchtypedoesnotworkonEWA

10.1.600 ToolsandTechnologies WebAccess 187417 Tools WebFrameworkReturnAllRowsisnotselectedbydefaultonNamedSearch


10.1.600 ToolsandTechnologies WebAccess 187518 Tools WebFrameworkF1keytoopenHelpdoesnotworkonForecastEntry
10.1.600 ToolsandTechnologies WebAccess 187528 Tools WebFrameworkMemoentrywebformdisplayserroronwebgeneration

WebFrameworkUDfieldswithdateTimedatatypeboundtoanepidatetimeEditor
10.1.600 ToolsandTechnologies WebAccess 187634 Tools controlinacustomizedwebformdonotworkasinsmartclient
WebFrameworkUnabletosetproperty'CallContextDataSet'ofundefinedornull
10.1.600 ToolsandTechnologies WebAccess 187682 Tools referenceerrorwhencallinganinfoprompt
10.1.600 ToolsandTechnologies WebAccess 187761 Tools WebFrameworkCannotimportaForecastonForecastEntry
10.1.600 ToolsandTechnologies WebAccess 187908 Tools WebFrameworkUnexpectedRowModcolumnonBasicandBAQsearches
10.1.600 ToolsandTechnologies WebAccess 187991 Tools WebFrameworkQuickSearchesdonotworkonEWA
WebFormsError"TheDisplayMemberisrequired"displaysafteraddinganew
10.1.600 ToolsandTechnologies WebAccess 188004 Tools quicksearchvalueitem(InternetExplorer)
10.1.600 ToolsandTechnologies WebAccess 188073 Tools EWAat10.1.500.0willnotdeployoverexisting10.1.400.xinstallation
10.1.600 ToolsandTechnologies WebAccess 188112 Tools WebFormsCannotundocheckoutonEngineeringWorkbench

10.1.600 ToolsandTechnologies WebAccess 188345 Tools WebFrameworkAbletoentertextonanintegertypeUDfield,onadashboard


WebFormsErrorswhenretrievingandnotabletosavenewuseronUserAccount
10.1.600 ToolsandTechnologies WebAccess 188535 Tools Maintenance

Page110
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


WebFrameworkPrintbuttonappearsdisabledwhenyouopenanyreport
10.1.600 ToolsandTechnologies WebAccess 188639 Tools launcherinEWA

WebFrameworkGriddisappearsafterupdatingUDrowsandcolumnbecomes
10.1.600 ToolsandTechnologies WebAccess 188754 Tools updatableeventhoughthegridisnotmarkedasupdatable(Webdashboards)
WebFrameworkNotabletoupdateafieldusingacontrolfromacustomized
10.1.600 ToolsandTechnologies WebAccess 188768 Tools TrackerViewonawebdashboard
WebFrameworkunexpected"Cannotchangetothatcompany"messageappears
10.1.600 ToolsandTechnologies WebAccess 188824 Tools afterEWAtimeoutisreachedwhentherearenowebformsopen
10.1.600 ToolsandTechnologies WebAccess 188826 Tools WebFormsPasswordPolicywebformdoesnotopen
WebFrameworkCustommessageforexpiredsessionsinEWAdoesnotappear
10.1.600 ToolsandTechnologies WebAccess 188973 Tools usingfirefox
10.1.600 ToolsandTechnologies WebAccess 189046 Tools WebFormsCompanyMaintenancewebformopensbutisnotfunctional

WebFormsMessage'InvalidlengthforaBase64characterorstring'whentrying
10.1.600 ToolsandTechnologies WebAccess 189118 Tools tocreateanewImagewithcategoryandsubcategoryonImageMaintenance
10.1.600 ToolsandTechnologies WebAccess 189119 Tools WebFormsFolderisnotdisplayedonExportDirectory,onImageExport
10.1.600 ToolsandTechnologies WebAccess 189122 Tools WebFormsIncorrectformatforexportedimage
WebFormsImportImageCategory/SubcategoryInfofromFilepathisnotseton
10.1.600 ToolsandTechnologies WebAccess 189123 Tools ImportImagesfromImageMaintenance
WebFrameworkKeyeddecimalpointmaynotberecognizeddependingon
culture;pastingofnegativenumericsdoesnotenforcesamevalidationsasSmart
10.1.600 ToolsandTechnologies WebAccess 189512 Tools Client
10.1.600 ToolsandTechnologies WebAccess 189596 Tools WebFormsOnGLBookform,theREGLAccountdoesnotacceptchanges
WebFormsControlsfromthe"AccountLockoutPolicy"webformaredrawn
10.1.600 ToolsandTechnologies WebAccess 189599 Tools unexpectedly
WebFrameworkFieldformatisnothonoredwhenyoufillanumericfieldby
10.1.600 ToolsandTechnologies WebAccess 190092 Tools pressingandholdinganumerickey
WebFrameworkGridbecomesupdatableafterupdatingafieldonthetracker
10.1.600 ToolsandTechnologies WebAccess 190427 Tools view(WebDashboards)
WebFrameworkFiltersarenotcorrectlyhonoredonaBasicNamedsearchifthey
10.1.600 ToolsandTechnologies WebAccess 190644 Tools areexecutedconsecutively

10.1.600 ToolsandTechnologies WebAccess 190646 Tools WebFrameworkNextsearchbuttondoesnothonorthemaximumrowsreturned


WebFrameworkAutoexecuteforNamedSearches(QuickSearchtype)isnot
10.1.600 ToolsandTechnologies WebAccess 190652 Tools functionalonwebforms
10.1.600 ToolsandTechnologies WebAccess 190661 Tools WebFrameworkMissingdropdownsonSalesOrderLineQuickSearch

10.1.600 ToolsandTechnologies WebAccess 190707 Tools WebFormsErrorsaredisplayedwhenusingconfigurationswithradiosets

Page111
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


10.1.600 ToolsandTechnologies WebAccess 190841 Tools WebFormsUserscannotaccessaPerformanceCanvaslinkfromamenu
WebFrameworkEnsurethatuserswithout"requireSSO"flagactiveseethesame
10.1.600 ToolsandTechnologies WebAccess 190853 Tools options(changeuser/password)asSmartClient
WebFormsErrorwhenusing"UserIDStartsWith:"or"UserNameStartsWith:"
10.1.600 ToolsandTechnologies WebAccess 190991 Tools fieldstoperformasearchonUserAccountSecurityMaintenance
WebFrameworkMessage'Inputstringwasnotinacorrectformat'displayed
10.1.600 ToolsandTechnologies WebAccess 191030 Tools whensavinganemptyUDfield

10.1.600 ToolsandTechnologies WebAccess 191142 Tools WebFormsChangestoEpiRadioSetonconfigurationsneedtobehandledinEWA


WebFrameworkMissingGroup,ProjectIDandTerritorycombosonnamedsearch
10.1.600 ToolsandTechnologies WebAccess 191736 Tools quicksearchtype

10.1.600 ToolsandTechnologies WebAccess 191820 Tools WebFrameworkNextbuttonchangeswhenusingNamedSearchBAQType


WebFrameworkRowhasbeenmodifiedbyanotheruserandcouldnotbe
10.1.600 ToolsandTechnologies WebAccess 191824 Tools updatedwhendeletinganamedsearch
WebFrameworkPastingnumericvalueswithmorethanthealloweddecimal
10.1.600 ToolsandTechnologies WebAccess 191832 Tools positionsonnumericfieldscausesanunexpectedrounding
WebFrameworkUnexpectedincrementsforpastednumericvalues;occursonly
10.1.600 ToolsandTechnologies WebAccess 191833 Tools fornumericfieldswithingrids
WebFrameworkAutoHiddentrackerpanelisnotshownifit'slocatedonatab
10.1.600 ToolsandTechnologies WebAccess 191909 Tools fromadashboard
10.1.600 ToolsandTechnologies WebAccess 192222 Tools WebFrameworkSecurityIssueforuserswithnomenuaccess
WebFrameworkFirefoxdoesnotdisplaythe"Changeuser"optionwhentheuser
10.1.600 ToolsandTechnologies WebAccess 192364 Tools refreshesthebrowser
WebFrameworkVerticaltrackerpanelisoverlappedoverthegridwhenit'sona
10.1.600 ToolsandTechnologies WebAccess 192403 Tools tab
10.1.600 ToolsandTechnologies WebAccess 192446 Tools WebFrameworkServerFileDownloadformdoesnotdownloadthefile
WebFrameworkTrackerViewisnotupdatedwhenmovingthroughrowsofthe
10.1.600 ToolsandTechnologies WebAccess 192557 Tools grid
10.1.600 ToolsandTechnologies WebAccess 192573 Tools WebFrameworkBAQsarenotshownonBAQsearchtab
10.1.600 ToolsandTechnologies WebAccess 192775 Tools WebFrameworkCrystalreportdoesnotworkinEWA
WebFormsCannotdisplayChinesecharactersfromacustommessageboxin
10.1.600 ToolsandTechnologies WebAccess 192782 Tools EWA,characterisdisplayedinsmartclient

10.1.600 ToolsandTechnologies WebAccess 193294 Tools WebFormsBAQparameterslinkedtosecondBAQdon'tshowinWebDashboards

10.1.600 ToolsandTechnologies WebAccess 193572 Tools WebFormsConfigurationformwillnotopenforOnTheFlyconfigurationsforECC


10.1.600 ToolsandTechnologies WebAccess 193613 Tools WebformsEWAcannotdisplayChinesemenu

Page112
ChangeListResolvedIssues EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


WebFrameworkTrackerviewisnotupdatedwiththeinfoofthegridandittakes
10.1.600 ToolsandTechnologies WebAccess 193703 Tools toolongwhenyoutrytomovethroughthelines
WebFrameworkIssueswithdisplayandfocusofahiddentrackerview,whenit's
10.1.600 ToolsandTechnologies WebAccess 193719 Tools onasecondtabfromadashboard

10.1.600 ToolsandTechnologies WebAccess 193962 Tools WebFormsDashboardfilteredonsecondlevelviewdoesnotworkproperly


WebFormsInWeeklytimewhenweentertheproject,WBSPhasedropdown
10.1.600 ToolsandTechnologies WebAccess 193981 Tools includesallPhasesregardlessofProject
WebFrameworkTrackerviewlayoutissmashedonEWAwhenfieldlabelsare
10.1.600 ToolsandTechnologies WebAccess 195071 Tools overlapedandnotsetasinvisible
WebFrameworkNumericfieldsdecimalmarkerisnotrecognizedbasedonthe
10.1.600 ToolsandTechnologies WebAccess 195209 Tools currentculturefromalphanumerickeyboard
WebFrameworkDropDownListcontrolisdisplayedongridasTextBoxwhenyou
10.1.600 ToolsandTechnologies WebAccess 195304 Tools addafilteratGridViewlevel
ICEWebFormsCustomizedCashReceiptEntryOnEpicorEWAnotpopulatingall
10.1.600 ToolsandTechnologies WebAccess 197984 Tools fields

10.1.600 ToolsandTechnologies WebAccess 198086 Tools WebFrameworkCombosarenotresizingproperlyoncustomerconfiguration


10.1.600 ToolsandTechnologies WebAccess 198297 Tools WebFrameworkAddsupportforCustomWebBrowserDialog
10.1.600 ToolsandTechnologies WebAccess 200427 Tools WebFrameworkBlankmessageboxplusComboBoxesnotloading
WebFrameworkDifferentnumberformatonDashboardinWebinterface
10.1.600 ToolsandTechnologies WebAccess 200765 Tools comparedtoWindowsclient

Page113
ChangeListApplicationEnhancements EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


BankStatementProcessingEnhancedImportingbankstatementsinBTRS
10.1.600 FinancialManagement CashManagement 196031 Application format(Epic766)
10.1.600 FinancialManagement CSFAll 190254 Application TaxEnhancedTaxboxesbyEffectiveRate(Epic1257)
10.1.600 FinancialManagement CSFAll 196893 Application JPK_MAGXMLEnhancedReportStockMovements(Epic1222)
10.1.600 FinancialManagement CSFAll 196894 Application JPK_WBXMLEnhancedBankStatementreport(Epic1223)
10.1.600 FinancialManagement CSFAPAC 189053 Application AddedPeriodStockMovementreport;Costs
10.1.600 FinancialManagement CSFArgentina 131332 Application ARElectronicInvoiceAddednewfunctionality
ShipViamaintenanceDocumentNumberfieldnowallowsatleast20
10.1.600 FinancialManagement CSFArgentina 191934 Application characters
10.1.600 FinancialManagement CSFAustralia 188271 Application ABAformatscannowbeusedwithbasecurrencynotequaltoAUD
10.1.600 FinancialManagement CSFAustralia 188272 Application ABAformatsnowsupportWitholdingTaxes
10.1.600 FinancialManagement CSFChina 184825 Application CNBookingVoucherRevisionarenowsupported

10.1.600 FinancialManagement CSFChina 187779 Application Exportvalueofthetwofields(collectorandmanager)onGTIfilecouldbeblank


10.1.600 FinancialManagement CSFChina 188461 Application TaxinvoicetypeisnowsupportedinGTIexport
10.1.600 FinancialManagement CSFChina 191204 Application AddednewversionofGTI
10.1.600 FinancialManagement CSFColombia 186774 Application DailyInvoicingReportAddednewreport
10.1.600 FinancialManagement CSFColombia 188580 Application GLAuxiliaryReportImprovedreport

10.1.600 FinancialManagement CSFColombia 189669 Application FixedAssetOverviewTerceroAddedabilitytoenterTERCEROtoFixedAssets


10.1.600 FinancialManagement CSFColombia 189670 Application OnetimeIDcreationprocessenhancementEnhancedUIandusability
10.1.600 FinancialManagement CSFEMEA 189645 Application UsesCorrespondingBankAccountsinSEPAPayments(Epic997)
10.1.600 FinancialManagement CSFIndia 193071 Application EnhancedPeriodStockMovementreport
10.1.600 FinancialManagement CSFIndia 193512 Application EnhancedStockAgingReport
10.1.600 FinancialManagement CSFIndia 195339 Application GSTAddednewGSTR1report
ReportGSTR2Addednewfunctionality:abilitytoparseandimportGSTR2file,
10.1.600 FinancialManagement CSFIndia 195411 Application processcontentsbycomparimgagainstAPinvoices
10.1.600 FinancialManagement CSFJapan 189986 Application ConsumptionTaxReportingAddednewreport
10.1.600 FinancialManagement CSFJapan 192614 Application BillingStatementEnhancements(Epic699)
10.1.600 FinancialManagement CSFJapan 192617 Application EnhancedAPShimePaymentCycle(Epic1293)

10.1.600 FinancialManagement CSFJapan 193839 Application ConsumptionTaxReporting:EnhancedConversionprogramforPatchFields


10.1.600 FinancialManagement CSFMalaysia 189810 Application EnhancedLMWextensions(Epic1161)
ARElectronicInvoiceReportChangedreportaccordingtogovernment
10.1.600 FinancialManagement CSFMexico 187122 Application requirements
ElectronicInternationalTradeCFDIComplementV1.0ExtendedElectronic
10.1.600 FinancialManagement CSFMexico 187636 Application Invoiceaccordingtogovernmentrequirements
LabelonVATDeclarationExportTabandReportchangedfrom"5bPreload"to
10.1.600 FinancialManagement CSFNetherlands 200543 Application "5bDomestic/EUPurchasesAllRates"

Page114
ChangeListApplicationEnhancements EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


LockexchangerateforDetractiontaxpaymentImprovedfunctionality:
10.1.600 FinancialManagement CSFPeru 186282 Application detractionsarepaidconsideringthesameexchangerateastheinvoice
10.1.600 FinancialManagement CSFPeru 186303 Application DetractionandRetentiontaxaremutuallyexclusive(Epic428)
DetractionTaxroundingtonearestnumberImprovedfunctionality:support
10.1.600 FinancialManagement CSFPeru 186435 Application calculationofDetractionamountsasintegers
10.1.600 FinancialManagement CSFPeru 186548 Application SalesElectronicReportsAddednewfileformatforexporttoSUNAT
PurchaseElectronicReports8.1and8.2Addednewfileformatsforexportto
10.1.600 FinancialManagement CSFPeru 186609 Application SUNAT
10.1.600 FinancialManagement CSFPeru 187121 Application ARElectronicInvoicePrintoutAddednewreport
10.1.600 FinancialManagement CSFPeru 187560 Application KardexReportPECorrectionsImprovedreposrtprocessing
AllowARBoEtobecreatedwithdifferentBillToImprovedfunctionality:when
invoiceisturnedintoabillofexchnageitcanbeissuedforadifferentcustomer
10.1.600 FinancialManagement CSFPeru 189747 Application whowillpaythatinvoice
10.1.600 FinancialManagement CSFPeru 193005 Application ElectronicRetentionandPerceptionCertificatesAddednewreports
10.1.600 FinancialManagement CSFPoland 189881 Application JPK_FAXMLReceivablesandVATReport(Epic1220)
10.1.600 FinancialManagement CSFPoland 190111 Application JPK_KRXMLAccountingReport(Epic1203)
10.1.600 FinancialManagement CSFPoland 190170 Application JPK_VATXMLReportVATforPurchaseandSales(Epic1221)

JPK_VATXMLReportVATforPurchaseandSales(Epic1221)MovedSAFT
10.1.600 FinancialManagement CSFPoland 196431 Application UserDefinedCodesforCSFPolandTaxTypeMaintenancetoSolution
JPK_FAXMLReceivablesandVATReport(Epic1220)SalesOrderEntry
10.1.600 FinancialManagement CSFPoland 197943 Application Polandexportinformation
JPK_VATXMLReportVATforPurchaseandSales(Epic1221)AdoptedBAQs
10.1.600 FinancialManagement CSFPoland 198472 Application forStructuredOutputReporting
JPK_KRXMLAccountingReport(Epic1203)AdoptedBAQsforStructured
10.1.600 FinancialManagement CSFPoland 198474 Application OutputReporting
JPK_FAXMLReceivablesandVATReport(Epic1220)AdoptedBAQsfor
10.1.600 FinancialManagement CSFPoland 198475 Application StructuredOutputReporting
JPK_WBXMLBankStatementreport(epic1223)AdoptedBAQsforStructured
10.1.600 FinancialManagement CSFPoland 198476 Application OutputReporting
JPK_MAGXMLReportStockMovements(epic1222)AdoptedBAQsfor
10.1.600 FinancialManagement CSFPoland 198482 Application StructuredOutputReporting
JPK_FAXMLReceivablesandVATReport(Epic1220)CreatedReportStructure
10.1.600 FinancialManagement CSFPoland 199004 Application Definition
JPK_KRXMLAccountingReport(Epic1203)CreatedReportStructure
10.1.600 FinancialManagement CSFPoland 199005 Application Definition
JPK_VATXMLReportVATforPurchaseandSales(Epic1221)CreatedReport
10.1.600 FinancialManagement CSFPoland 199006 Application StructureDefinition

Page115
ChangeListApplicationEnhancements EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


JPK_MAGXMLReportStockMovements(epic1222)CreatedReportStructure
10.1.600 FinancialManagement CSFPoland 199007 Application Definition
JPK_WBXMLBankStatementreport(epic1223)CreatedReportStructure
10.1.600 FinancialManagement CSFPoland 199008 Application Definition
JPK_WBXMLBankStatementreport(epic1223)CorrectedBAQforBank
10.1.600 FinancialManagement CSFPoland 199568 Application Balancevalues
10.1.600 FinancialManagement CSFPoland 200310 Application JPK_FAXMLReceivablesandVATReport(Epic1220)
10.1.600 FinancialManagement CSFPoland 200312 Application JPK_KRXMLAccountingReport(Epic1203)
10.1.600 FinancialManagement CSFPoland 200314 Application JPK_VATXMLReportVATforPurchaseandSales(Epic1221)
10.1.600 FinancialManagement CSFPoland 200317 Application JPK_MAGXMLReportStockMovements(epic1222)
10.1.600 FinancialManagement CSFPoland 200319 Application JPK_WBXMLBankStatementreport(epic1223)
10.1.600 FinancialManagement CSFSweden 187968 Application EUSalesListReport(SKV574008)(Epic1197)

10.1.600 FinancialManagement CSFSweden 190683 Application EUSalesListReport'VATNumber'ColumnnowchangedtotwoColumns


10.1.600 FinancialManagement CSFSweden 192863 Application ExtendedPO3BankingInterface(Epic315)
10.1.600 FinancialManagement CSFTaiwan 175114 Application CSFTaiwanPapercopyofEInvoiceisnowsupported
10.1.600 FinancialManagement CSFTaiwan 188349 Application TWBookingVoucher
10.1.600 FinancialManagement CSFThailand 188585 Application MonthlyVATreportnowincludesPaymentTimetax

10.1.600 FinancialManagement CSFThailand 194064 Application CSFThailandPayerTypeisnowsupportedforAPinvoicesandpayments


10.1.600 FinancialManagement CSFThailand 194070 Application CSFThailandAPPaymentsAddedInvoicereference
10.1.600 FinancialManagement CSFThailand 194773 Application EnhancedDateControl
10.1.600 FinancialManagement CSFThailand 194785 Application EnhancedARInvoicelegalformats

10.1.600 FinancialManagement CSFVietnam 187177 Application CSFVietnamLedgerreportImplementedchangestomeetnewrequirements


10.1.600 FinancialManagement CSFVietnam 188274 Application CSFVietnamPurchasingInvoiceList:AddedLegalNumberfield
10.1.600 FinancialManagement CSFVietnam 188574 Application CSFVietnamCashbookscannowbeprintedinForeignCurrency
10.1.600 FinancialManagement CSFVietnam 190054 Application UpliftedPostingrulesfrom10.0.700.4
10.1.600 FinancialManagement CSFVietnam 191099 Application EnhancedPeriodStockMovementreport
10.1.600 FinancialManagement CSFVietnam 192194 Application ResolvedVNGLReportcomplianceissues
CashReceiptEntryIEXlockboxfunctionalityimplementedstandardcode(Epic
10.1.600 FinancialManagement AccountsPayable 197680 Application 1264)
10.1.600 FinancialManagement CashManagement 197444 Application BankAccountAddedpositivepayenhancement(Epic1266)
BankAccountAddedpositivepayAddRemoteID(RID)andBatchID(BID)and
10.1.600 FinancialManagement CashManagement 197586 Application defaultPositivePayElectronicInterfaceperBankAccount
BankAccountAddedpositivepayUIwhichexportspositivepayinformationfor
10.1.600 FinancialManagement CashManagement 197587 Application banks.
BankAccountAddedpositivepayBankofAmericaexportfiletemplate
10.1.600 FinancialManagement CashManagement 197588 Application electronicInterface

Page116
ChangeListApplicationEnhancements EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


BankAccountAddedpositivepayWellsFargoexportfiletemplateelectronic
10.1.600 FinancialManagement CashManagement 197589 Application Interface
BankAccountAddedpositivepayChaseexportfiletemplateelectronic
10.1.600 FinancialManagement CashManagement 197590 Application Interface

10.1.600 FinancialManagement CashManagement 197591 Application BankAccountAddedpositivepayFleetexportfiletemplateelectronicInterface


BankAccountAddedpositivepayGenericexportfiletemplateelectronic
10.1.600 FinancialManagement CashManagement 197592 Application Interface
BankAccountAddedpositivepayBankofBostonexportfiletemplate
10.1.600 FinancialManagement CashManagement 197593 Application electronicInterface
BankAccountAddedpositivepayUnionBankofCaliforniaexportfiletemplate
10.1.600 FinancialManagement CashManagement 197594 Application electronicInterface
BankAccountAddedaconversionscripttomigrateexistingCSGcustomerdata
10.1.600 FinancialManagement CashManagement 198831 Application tonewpositivepayfields
Conversionprogram10800Nowavailableasuserrunnableoptionalconversion
10.1.600 FinancialManagement GeneralLedger 181157 Application forE10.1
PostingrulesconversionprogramNowconfiguredintheUIinsteadof
10.1.600 FinancialManagement GeneralLedger 187088 Application ConversionParams.xml(Epic1259)

10.1.600 FinancialManagement GeneralLedger 189569 Application JournalEntry.CustomersandSuppliersintaxableGLJournals(Epic1258)


10.1.600 FinancialManagement GeneralLedger 197764 Application EnhancedSaaSCompatiblePostingRulesImport
ExternalPayrollIntegrationAddednewLicenseforADP/restrictthecurrent
10.1.600 FinancialManagement Payroll 194327 Application LicenseofExternalPayrolltonotcreatetheADPTemplate
RMAProcessingNowdefaultsthecorrectOrderinfowhenselectinganinvoice
10.1.600 SalesManagement CustomerRelationshipMana 184462 Application withmultiplepacksperline
JobReceipttoInventoryAvgCostcopartsforconcurrentandsequentialjobs
10.1.600 ProductionManagement JobManagement 185603 Application nowdisplaysamecosts
BackflushLaborServeProcessEnhancedlogfileforthisprocesstogivemore
10.1.600 ProductionManagement JobManagement 188008 Application details

BackflushLaborServeProcessAddedanoptiontoreporttheBackFlushLabor
10.1.600 ProductionManagement JobManagement 188770 Application TransactionagainsttheEmployeethattriggerthebackflush.
10.1.600 ProductionManagement JobManagement 197629 Application HCM/ERPSite(Plant)Addedfieldsandvalidations
10.1.600 ProductionManagement JobManagement 197630 Application HCM/ERPEmployeeAddedfieldsandvalidations
10.1.600 ProductionManagement JobManagement 198562 Application MattecIntegrationAddedpulsespercycletotheprocesssheet
10.1.600 ProductionManagement MaterialRequirementsPlann 152593 Application ProcessMRPPOSuggestionscreatednowconsiderSupplierShipVia
SchedulingEngineAddedflexibilitytoSchedulingbyallowingtheusertoset
10.1.600 ProductionManagement Scheduling 185987 Application thedefaultschedulingtimeattheSitelevel.

Page117
ChangeListApplicationEnhancements EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


HCM/ERPAddedPayHourstoHoursSummarysectionandaddthePayHours
10.1.600 ProductionManagement TimeManagement 185826 Application toWeeklyTime.
10.1.600 ProductionManagement TimeManagement 197631 Application HCM/ERPTimeSheetEntryAddedvalidations
HCM/ERPTimeSheetEntryUpdatedLabormethodtopushLabordatato
10.1.600 ProductionManagement TimeManagement 197632 Application HCM
10.1.600 ProductionManagement TimeManagement 198921 Application TimeSheetandExpenseApprovalAddedPayHoursfieldtoListview.
SalespersonWorkbenchEnhancedtoremovelockafternavigatingbetween
10.1.600 SalesManagement CustomerRelationshipMana 193215 Application tabsandreviewingrecords
ConfiguratorRulesColumnswithbooleantypenowonlyselect"equalto""not
10.1.600 SalesManagement ProductConfiguration 177303 Application equalto"inrules
ConfiguratorExpressionBuilderAddedabilitytogetparenthesisintoan
10.1.600 SalesManagement ProductConfiguration 185027 Application expressionforcalculations
ConfiguratorDesignerIntegratedQbuild2ddynamicImageviewerinthebase
10.1.600 SalesManagement ProductConfiguration 192411 Application configurator
ProjectAnalysisExportBuildProjectAnalysisnowcontinuesitsprocesswhena
10.1.600 SalesManagement ProjectManagement 177909 Application projecthaserrors
PLMIntegrationNonXMLfileisnolongergeneratedwhenapreviousID
10.1.600 SystemWideEnhancements ProductLifecyleManagemen 173254 Application alreadyexistsinthePLMExportDirectory.
IQSSupplierandCustomerforPurchasingPointsarenolongercreating
10.1.600 ToolsandTechnologies AdvanceQuality 188562 Application duplicatekeys
10.1.600 ToolsandTechnologies General 146182 Schema CoPartReplacedLocaltablesusedforCoPartwithDBfields
ConversionWorkbenchAddedabilitytorunUserConversionWorkbenchfor
10.1.600 ToolsandTechnologies General 184772 Application onecompany(notforall)
10.1.600 FinancialManagement APExtPymtSchedules(EN1 EN750 Application PurchasingTermsMaintenanceAddedUIChanges
10.1.600 FinancialManagement APExtPymtSchedules(EN1 EN751 Application APInvoiceEntryAddedUIChanges
10.1.600 FinancialManagement APExtPymtSchedules(EN1 EN752 Application PurchasingTermsEnhancedGeneratePaymentSchedule

10.1.600 FinancialManagement APExtPymtSchedules(EN1 EN754 Application APInvoiceEnhancedPaymentScheduleforMiscInvoiceandDebitMemos


10.1.600 FinancialManagement APExtPymtSchedules(EN1 EN755 Application APInvoiceTrackerAddedmoredetailtoPaymentSchedule
10.1.600 FinancialManagement APExtPymtSchedules(EN1 EN756 Application APPostedInvoiceUpdateAddedPaymentSchedule
AgedPayablesReportPaymentScheduleAmtofeachinvoiceisnowdisplayed
10.1.600 FinancialManagement APExtPymtSchedules(EN1 EN758 Application accordingtotheAgingselected
10.1.600 FinancialManagement APExtPymtSchedules(EN1 EN841 Application CreatedConversionProgramforTerms/Invoices
10.1.600 FinancialManagement APExtPymtSchedules(EN1 EN999 Application APInvoiceRemovedActionsMenuoptionforPaymentSchedule
10.1.600 FinancialManagement APTaxatLineLevel(EN9) EN249 Application APInvoiceLineChargesseparateTaxRecords

10.1.600 FinancialManagement APTaxatLineLevel(EN9) EN267 Application APInvoiceManualCalculatedTaxeschangesfortaxlinesinAPInvoice


10.1.600 FinancialManagement APTaxatLineLevel(EN9) EN309 Application APInvoiceAddedUIchangestoLineChargeTax
10.1.600 FinancialManagement APTaxatLineLevel(EN9) EN325 Application CompanyConfigurationMovedTaxFieldstonewTaxTab

Page118
ChangeListApplicationEnhancements EpicorERP10.1.600

Release FunctionalArea Module Job Type Description

10.1.600 FinancialManagement APTaxatLineLevel(EN9) EN420 Application APInvoiceAddedabilitytochangeTaxLiabilityafterlineshavebeenadded


10.1.600 FinancialManagement APTaxatLineLevel(EN9) EN516 Application APInvoiceLineTaxesAddedTotalsummaryinLineTaxDetail
PO/APTaxAddedmessagewhenswitchingPO/APTaxReportedatLineLevel
10.1.600 FinancialManagement APTaxatLineLevel(EN9) EN558 Application checkboxonandoff
10.1.600 FinancialManagement APTaxatLineLevel(EN9) EN602 Application LineChargesseparateTaxRecordsPosting
10.1.600 FinancialManagement APTaxatLineLevel(EN9) EN604 Application HeaderChargesseparateTaxRecordsPosting
10.1.600 FinancialManagement APTaxatLineLevel(EN9) EN643 Application APInvoiceTrackerAddedDetailTaxTabatLineLevel
10.1.600 FinancialManagement APTaxatLineLevel(EN9) EN666 Application APInvoiceTrackerAddedDetailTaxTabatHeaderMiscChargeTax
10.1.600 FinancialManagement APTaxatLineLevel(EN9) EN668 Application APInvoiceTrackerAddedDetailTaxTabatMiscChargeTaxLine
10.1.600 FinancialManagement APTaxatLineLevel(EN9) EN745 Application APInvoiceTrackerLineTaxesAddedTotalsummaryinLineTaxDetail
APCopyRecurringInvoiceEnhancedsothatHeader/LineMiscChargetaxes
10.1.600 FinancialManagement APTaxatLineLevel(EN9) EN856 Application arecopiedfromnewtables
APInvoiceandTrackerAddedTotalsummaryinHeaderandLineChargeTax
10.1.600 FinancialManagement APTaxatLineLevel(EN9) EN893 Application Detail

10.1.600 FinancialManagement APTaxatLineLevel(EN9) EN92 Application CompanyConfigurationAddednew"PO/APTaxReportedatLineLevel"flag


10.1.600 FinancialManagement APTaxatLineLevel(EN9) EN93 Application APInvoiceAddedUIchangestoLineTax
10.1.600 FinancialManagement APTaxatLineLevel(EN9) EN94 Application APInvoiceSystemCalculatedTaxeschangesfortaxlinesinAPInvoice
10.1.600 FinancialManagement APTaxatLineLevel(EN9) EN95 Application APInvoiceHeaderChargesseparatetaxrecords

10.1.600 FinancialManagement APTaxatLineLevel(EN9) EN96 Application PostingRulesEnhancedtosupportpostingtaxlinelevelrecordsforAPInvoice


10.1.600 FinancialManagement APTaxatLineLevel(EN9) EN97 Application APInvoiceEnhancedPostingEnginetosupporttaxlinelevel
10.1.600 FinancialManagement ARExtPymtSchedules(EN1 EN1385 Application ARInvoiceRemovedActionsMenuoptionforPaymentSchedule
10.1.600 FinancialManagement ARExtPymtSchedules(EN1 EN307 Application SalesOrderAddedUIchangestoaddPaymentSchedule
10.1.600 FinancialManagement ARExtPymtSchedules(EN1 EN310 Application TermsMaintenanceAddedPaymentScheduleFunctionality
10.1.600 FinancialManagement ARExtPymtSchedules(EN1 EN311 Application ARPostedInvoiceUpdateAddedPaymentScheduleforUpdate
10.1.600 FinancialManagement ARExtPymtSchedules(EN1 EN312 Application ARInvoiceTrackerAddedmoredetailtoPaymentSchedule
10.1.600 FinancialManagement ARExtPymtSchedules(EN1 EN315 Application TermsMaintenanceAddedUIchangestoaddPaymentSchedule
10.1.600 FinancialManagement ARExtPymtSchedules(EN1 EN317 Application SalesOrderTrackerAddedUIchangestoaddPaymentSchedule
10.1.600 FinancialManagement ARExtPymtSchedules(EN1 EN418 Application ARInvoiceAddedUIchangestoaddPaymentSchedule
10.1.600 FinancialManagement ARExtPymtSchedules(EN1 EN423 Application SalesOrderEnhancedPaymentScheduleGeneration
AgedReceivablesReportPaymentScheduleAmtofeachinvoiceisnow
10.1.600 FinancialManagement ARExtPymtSchedules(EN1 EN520 Application displayedaccordingtotheAgingselected
CustomerStatementReportPaymentScheduleAmtofeachinvoiceisnow
10.1.600 FinancialManagement ARExtPymtSchedules(EN1 EN521 Application displayedaccordingtotheAgingselected
10.1.600 FinancialManagement ARExtPymtSchedules(EN1 EN555 Application TermsPaymentScheduleforDueonDayTermTypes
10.1.600 FinancialManagement ARExtPymtSchedules(EN1 EN585 Application ARInvoiceEnhancedPaymentScheduleforShipmentInvoices
10.1.600 FinancialManagement ARExtPymtSchedules(EN1 EN586 Application ARInvoiceEnhancedPaymentScheduleforDropShipmentInvoices
10.1.600 FinancialManagement ARExtPymtSchedules(EN1 EN609 Application ARInvoiceEnhancedPaymentScheduleforCreditMemo/Invoices

Page119
ChangeListApplicationEnhancements EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


CashReceiptEntryAddedcolumntoSelectionInvoicestodisplayamountof
10.1.600 FinancialManagement ARExtPymtSchedules(EN1 EN641 Application thenextscheduledue
10.1.600 FinancialManagement ARExtPymtSchedules(EN1 EN664 Application ARPostedInvoiceUpdateAddedUIchangestoPaymentSchedule
PaymentProposalReport/PaymentEntryAddedoptiontoshowinvoiceswith
10.1.600 FinancialManagement FinancialEnhancements(EN EN233 Application discountsavailableandwhicharenotdueyet
MiscellaneousChargeAddedcheckboxoptiontoallowdiscountsornotfor
10.1.600 FinancialManagement FinancialEnhancements(EN EN234 Application charge

10.1.600 FinancialManagement FinancialEnhancements(EN EN238 Application InvoiceEntryARAddedabilitytodeletemultipleinvoicesinasinglestep


CustomerTrackerAddedabilityforInvoiceHeaderLevelTrackerfor
10.1.600 FinancialManagement FinancialEnhancements(EN EN239 Application Open/Closed/Alltabs
InvoiceEntryAPAddedoptioninCompanytoWarn/Stop/Noneentering
10.1.600 FinancialManagement FinancialEnhancements(EN EN240 Application InvoicesintheFuture
10.1.600 FinancialManagement FinancialEnhancements(EN EN243 Application GenerateShipmentInvoicesAddedoptiontoincludeDropShipments
PostingEngineManufacturingVariancesarenowsplitupforeachcost
10.1.600 FinancialManagement FinancialEnhancements(EN EN244 Application component
10.1.600 FinancialManagement FinancialEnhancements(EN EN424 Application JournalEntryAddedan'OnHold'option
CustomerTrackerAddedNetInvoiceTotalfieldintheAgingsectiontoinclude
10.1.600 FinancialManagement FinancialEnhancements(EN EN427 Application CreditMemoandMiscInvoice
InvoiceEntryARAddedabilitytomanuallyselectonlyoneServiceCallto
10.1.600 FinancialManagement FinancialEnhancements(EN EN431 Application invoice

10.1.600 FinancialManagement TaxesonPOReleases(EN16 EN223 Application POEntryChangedUItoshownewdetail/listviewsfortaxesonreleases


10.1.600 FinancialManagement TaxesonPOReleases(EN16 EN236 Application LineTaxessummaryAddedfunctionality
10.1.600 FinancialManagement TaxesonPOReleases(EN16 EN245 Application POEntryChangedPOReleasesystemtaxcalculations
10.1.600 FinancialManagement TaxesonPOReleases(EN16 EN264 Application CompanyConfigurationAddedTaxestab
10.1.600 FinancialManagement TaxesonPOReleases(EN16 EN266 Application Detail/ListviewAddedTotalReleaseTaxesabovetheview
10.1.600 FinancialManagement TaxesonPOReleases(EN16 EN313 Application TaxEngineAddedchangesforPOMiscChargessystemtaxcalculation
10.1.600 FinancialManagement TaxesonPOReleases(EN16 EN323 Application ConversionProgramAddedforNewMiscChargesTaxestables
10.1.600 FinancialManagement TaxesonPOReleases(EN16 EN326 Application DeductibleAmountfieldAddedtoPOReleaseTax
10.1.600 FinancialManagement TaxesonPOReleases(EN16 EN327 Application NavigationbarAddedtoLineTaxestab
10.1.600 FinancialManagement TaxesonPOReleases(EN16 EN334 Application Detail/ListviewsAddedforHeaderandLineMiscellaneouscharges
10.1.600 FinancialManagement TaxesonPOReleases(EN16 EN437 Application Detail/ListviewsAddedforHeaderandLineMiscChargeTaxes
10.1.600 FinancialManagement TaxesonPOReleases(EN16 EN441 Application POEntrychangesAddedformiscchargetaxcalculations

10.1.600 FinancialManagement TaxesonPOReleases(EN16 EN476 Application TaxEnginechangesAddedforPOMiscChargesmanualtaxcalculation


POMiscChargeTaxTecordsAddedabilitytohandleoldrecordswithSeq0in
10.1.600 FinancialManagement TaxesonPOReleases(EN16 EN503 Application POEntry

Page120
ChangeListApplicationEnhancements EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


CreatedBy,CreatedOn,ChangedByandChangedOncolumnsRevisedonvarious
10.1.600 FinancialManagement TaxesonPOReleases(EN16 EN600 Application POTables
10.1.600 FinancialManagement TaxesonPOReleases(EN16 EN688 Application InclusiveTaxesAddedEpishapeonLineandReleaseTaxes
10.1.600 FinancialManagement TaxesonPOReleases(EN16 EN689 Application NavigationsandtotalsAddedtoMiscChargeTaxes

10.1.600 FinancialManagement TaxesonPOReleases(EN16 EN990 Application PurchaseOrderEntryRemovedcodereferencesforMiscellaneousChargeCode


10.1.600 FinancialManagement TaxesonQuotes(EN6) EN1016 Application TaxPointandTaxRateSetforquotes
10.1.600 FinancialManagement TaxesonQuotes(EN6) EN255 Application CompanyAddednewflagtoenabletaxescalculationsonQuotes
10.1.600 FinancialManagement TaxesonQuotes(EN6) EN256 Application TaxEngineEnhancedtocalculateExclusiveTaxesonQuotes
10.1.600 FinancialManagement TaxesonQuotes(EN6) EN257 Application TaxEngineEnhancedtocalculateInclusiveTaxesonQuotes
10.1.600 FinancialManagement TaxesonQuotes(EN6) EN258 Application NewtabAddedtoshowQuoteLineTaxes
10.1.600 FinancialManagement TaxesonQuotes(EN6) EN259 Application TaxestabAddedonQuoteHeader
10.1.600 FinancialManagement TaxesonQuotes(EN6) EN260 Application AvalaraSupportAddedforTaxesonQuotes
10.1.600 FinancialManagement TaxesonQuotes(EN6) EN299 Application OpportunityQuoteEntryAddedUIChangestomeetmaxsizestandard
10.1.600 FinancialManagement TaxesonQuotes(EN6) EN314 Application QuoteEntryAddedlogicfornewfields
10.1.600 FinancialManagement TaxesonQuotes(EN6) EN318 Application QuoteTrackerChangedtomatchnewQuoteEntrylayout
10.1.600 FinancialManagement TaxesonQuotes(EN6) EN328 Application QuoteSummaryRedesignedpanel
10.1.600 FinancialManagement TaxesonQuotes(EN6) EN329 Application QuoteHeaderDetailResignedpanel
10.1.600 FinancialManagement TaxesonQuotes(EN6) EN330 Application ManufacturingRevisiontabAddedtabunderLines
10.1.600 FinancialManagement TaxesonQuotes(EN6) EN332 Application SalesOrderEntryChangedUItostandardizewithQuoteUIchanges
10.1.600 FinancialManagement TaxesonQuotes(EN6) EN335 Application QuoteLineDetailRedesignedpanel

10.1.600 FinancialManagement TaxesonQuotes(EN6) EN442 Application ConversionCreatedaconversionprogramforallquotetaxrelatedfields


10.1.600 FinancialManagement TaxesonQuotes(EN6) EN534 Application MakeReadytoProcessDependentfromTaxCalculations
10.1.600 FinancialManagement TaxesonQuotes(EN6) EN634 Application QuotesUpdatedQuotethataffecttaxescalculations(Exclusive)
10.1.600 FinancialManagement TaxesonQuotes(EN6) EN635 Application ImplementtaxInclusive"switch"onQuoteEntryUI
10.1.600 FinancialManagement TaxesonQuotes(EN6) EN747 Application QuoteAddedTaxRelateditemsinQuotesetupMenu
10.1.600 FinancialManagement TaxesonQuotes(EN6) EN942 Application HeaderandLinetaxtabsResolvedissues
10.1.600 FinancialManagement TaxesonQuotes(EN6) EN995 Application SystemTaxUpdateAddedlogicforEpiShapeandCheckbox
10.1.600 FinancialManagement TaxesonReceipts(EN4) EN1007 Application ConversionProgramforContainers
10.1.600 FinancialManagement TaxesonReceipts(EN4) EN130 Application AddedTaxesonDutiesforContainerLandedCostEntry
ConversionProgramAddedconversionforTaxDefaultsonuninvoiced
10.1.600 FinancialManagement TaxesonReceipts(EN4) EN131 Application receipts
10.1.600 FinancialManagement TaxesonReceipts(EN4) EN132 Application ChangeAPInvoicetopopulateTaxrelateddefaultsfromReceipt
10.1.600 FinancialManagement TaxesonReceipts(EN4) EN1336 Application ContainerReceiptEntryShowTaxInclusivePricing
10.1.600 FinancialManagement TaxesonReceipts(EN4) EN1391 Application ContainerReceiptAddedWarningMessagewhenupdatingprice
ContainerLandedCostTrackerModifiedtobringinlinewithContainer
10.1.600 FinancialManagement TaxesonReceipts(EN4) EN1409 Application ReceiptsEntry/ContainerLandedCostsEntry
10.1.600 FinancialManagement TaxesonReceipts(EN4) EN1410 Application ContainerReceiptsRemoveTotalstabfromLine>Detail

Page121
ChangeListApplicationEnhancements EpicorERP10.1.600

Release FunctionalArea Module Job Type Description

10.1.600 FinancialManagement TaxesonReceipts(EN4) EN1411 Application ContainerReceiptsChangeReceiptTypefromradiobuttontodropdownlist


10.1.600 FinancialManagement TaxesonReceipts(EN4) EN321 Application AddNew"Header"tabonReceiptEntry
10.1.600 FinancialManagement TaxesonReceipts(EN4) EN322 Application RearrangeLinesDetailtabinReceiptEntry
10.1.600 FinancialManagement TaxesonReceipts(EN4) EN324 Application ReceiptLineAddedTaxFieldsandTaxTab
10.1.600 FinancialManagement TaxesonReceipts(EN4) EN333 Application IndirectCostsAddedTaxFieldsandTaxtab
10.1.600 FinancialManagement TaxesonReceipts(EN4) EN499 Application ContainerShipmentHeaderAddedTaxestab
10.1.600 FinancialManagement TaxesonReceipts(EN4) EN500 Application ContainerShipmentHeaderAddedTaxfieldsandTaxtab
10.1.600 FinancialManagement TaxesonReceipts(EN4) EN501 Application ContainerShipmentIndirectCostsAddedtaxfieldsandTaxtab

10.1.600 FinancialManagement TaxesonReceipts(EN4) EN502 Application ReceiptEntrychangedtohandlesystemcalculatedtaxes(posttaxengine)

10.1.600 FinancialManagement TaxesonReceipts(EN4) EN505 Application PreparedReceiptEntrytoallowmanualupdateofLinetaxes(pretaxengine)


PreparedReceiptEntrytoallowmanualupdateofIndirectCoststaxes(pretax
10.1.600 FinancialManagement TaxesonReceipts(EN4) EN506 Application engine)
10.1.600 FinancialManagement TaxesonReceipts(EN4) EN531 Application AddedNew"Header"tabonReceiptEntry
10.1.600 FinancialManagement TaxesonReceipts(EN4) EN543 Application ModifiedTaxTabstomatchnewstandards
10.1.600 FinancialManagement TaxesonReceipts(EN4) EN560 Application RearrangedLinesDetailtabinContainerReceiptEntry
10.1.600 FinancialManagement TaxesonReceipts(EN4) EN561 Application AddedTaxtabtoContainerReceiptHeader
10.1.600 FinancialManagement TaxesonReceipts(EN4) EN566 Application AddedCompanyflagtoIncludeDutiesonTaxableAmount

10.1.600 FinancialManagement TaxesonReceipts(EN4) EN572 Application PreparedContainerLCEntrytohandlesystemcalculatedtaxes(pretaxengine)


PreparedContainerLCEntrytoallowmanualupdateofLinetaxes(pretax
10.1.600 FinancialManagement TaxesonReceipts(EN4) EN574 Application engine)
PreparedContainerLCEntrytoallowmanualupdateofIndirectCoststaxes(pre
10.1.600 FinancialManagement TaxesonReceipts(EN4) EN575 Application taxengine)

10.1.600 FinancialManagement TaxesonReceipts(EN4) EN576 Application ContainerLCEntrychangedtohandlesystemcalculatedtaxes(posttaxengine)


10.1.600 FinancialManagement TaxesonReceipts(EN4) EN71 Application AddednewflagatcompanytoenabletaxescalculationsonReceipts
10.1.600 FinancialManagement TaxesonReceipts(EN4) EN72 Application AddedTaxFieldsandTaxtabtoReceiptHeader
10.1.600 FinancialManagement TaxesonReceipts(EN4) EN74 Application AddedTotalstabtoContainerShipmentHeader
EnhancedtoprinttaxesonContainerLandedCostReport(breakdownby
10.1.600 FinancialManagement TaxesonReceipts(EN4) EN76 Application supplier)

10.1.600 FinancialManagement TaxesonReceipts(EN4) EN79 Application PreparedReceiptEntrytohandlesystemcalculatedtaxes(pretaxengine)

10.1.600 FinancialManagement TaxesonReceipts(EN4) EN80 Application PreparedReceiptEntrytoallowmanualupdateofHeadertaxes(pretaxengine)


10.1.600 FinancialManagement TaxesonReceipts(EN4) EN83 Application EnhancedContainerReceiptEntryscreentoskipTaxEngine
10.1.600 FinancialManagement TaxesonReceipts(EN4) EN85 Application TaxesonDutiesforStandardReceipts

Page122
ChangeListApplicationEnhancements EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


RevisedCreatedBy,CreatedOn,ChangedByandChangedOncolumnsonvarious
10.1.600 FinancialManagement TaxesonReceipts(EN4) EN874 Application ReceiptTables

10.1.600 FinancialManagement TaxesonReceipts(EN4) EN976 Application ReceiptEntryAddedabilitytoShowTaxInclusivePricingforReceiptLines


10.1.600 FinancialManagement TaxesonSOAckReport(EN EN349 Application AddedTaxestoSOAcknowledgementReport
10.1.600 FinancialManagement TaxesonSOAckReport(EN EN350 Application AddedLineTaxTotaltoProFormaInvoice
10.1.600 FinancialManagement TaxesonSOAckReport(EN EN351 Application AddedlinetaxtotaltoARInvoicereport
10.1.600 ProductionManagement DeferLotAttributeEntry(EN EN450 Application AddedcompanysettingsfortrackingoptionsforLotAttributes
10.1.600 ProductionManagement DeferLotAttributeEntry(EN EN451 Application Added"DeferLotAttributesEntry"optionalongthesystem
10.1.600 ProductionManagement DeferLotAttributeEntry(EN EN452 Application Addedpartsettingsandlogicfortrackingoptionsforlotattributes
10.1.600 ProductionManagement DeferLotAttributeEntry(EN EN645 Application Createdscripttoconvertoldlotattributesfieldsintothenewones
10.1.600 ProductionManagement DeferLotAttributeEntry(EN EN646 Application Added"DeferLotAttributes"logicforInspection
10.1.600 ProductionManagement DeferLotAttributeEntry(EN EN647 Application Added"DeferLotAttributes"logicforPurchaseReceipts(smartclient)
10.1.600 ProductionManagement DeferLotAttributeEntry(EN EN649 Application Added"DeferLotAttributes"logicforJobReceipts(smartclient)

10.1.600 ProductionManagement DeferLotAttributeEntry(EN EN652 Application Added"DeferLotAttributes"logicforQuantityAdjustments(SmartClient)


10.1.600 ProductionManagement DeferLotAttributeEntry(EN EN653 Application Added"DeferLotAttributes"logicforInventoryTransfer(SmartClient)
10.1.600 ProductionManagement DeferLotAttributeEntry(EN EN654 Application Added"DeferLotAttributes"logicforShipments(SmartClient)
10.1.600 ProductionManagement DeferLotAttributeEntry(EN EN656 Application Added"DeferLotAttributes"logicforInventoryCounts
10.1.600 ProductionManagement DeferLotAttributeEntry(EN EN658 Application Added"DeferLotAttributes"logicforReturnMaterial
10.1.600 ProductionManagement DeferLotAttributeEntry(EN EN695 Application Changed"ReturnMaterial"labelto"RMA"toavoidconfusion
LegalNumberMaintenanceDisabldenew"GenerateOn"optionforcertain
10.1.600 ProductionManagement LegalNumberEnhancements EN1358 Application NumberTypes
LegalNumberMaintenanceAddednewConfigurationoptionsforLegal
10.1.600 ProductionManagement LegalNumberEnhancements EN806 Application Numbergeneration
CashReceiptEntryAddedLegalNumberActionMenuoptionsandnew
10.1.600 ProductionManagement LegalNumberEnhancements EN807 Application functionalityforGeneration/Void
10.1.600 ProductionManagement LegalNumberEnhancements EN814 Application APInvoiceTrackerAddedoptiontosearchbyLegalNumber
10.1.600 ProductionManagement LegalNumberEnhancements EN815 Application LoggedInvoiceTrackerAddedoptiontosearchbyLegalNumber
10.1.600 ProductionManagement LegalNumberEnhancements EN817 Application APPostedInvoiceUpdateAddedoptiontosearchbyLegalNumber
10.1.600 ProductionManagement LegalNumberEnhancements EN818 Application PaymentTrackerAddedoptiontosearchbyLegalNumber

10.1.600 ProductionManagement LegalNumberEnhancements EN820 Application APPaymentInstrumentTrackerAddedoptiontosearchbyLegalNumber

10.1.600 ProductionManagement LegalNumberEnhancements EN821 Application ARPaymentInstrumentTrackerAddedoptiontosearchbyLegalNumber


10.1.600 ProductionManagement LegalNumberEnhancements EN823 Application JournalDetailTrackerAddedoptiontosearchbyLegalNumber
BankAdjustmentEntryAddedLegalNumberActionMenuoptionsandnew
10.1.600 ProductionManagement LegalNumberEnhancements EN825 Application functionalityforGeneration/Void
10.1.600 ProductionManagement LegalNumberEnhancements EN826 Application JournalEntryEnhancedLegalNumberfunctionality

Page123
ChangeListApplicationEnhancements EpicorERP10.1.600

Release FunctionalArea Module Job Type Description

10.1.600 ProductionManagement LegalNumberEnhancements EN836 Application ARInvoiceEntryAddednewfunctionalityforLegalNumberGeneration/Void

10.1.600 ProductionManagement LegalNumberEnhancements EN837 Application APInvoiceEntryAddednewfunctionalityforLegalNumberGeneration/Void


LoggedInvoiceEntryAddedLegalNumberActionMenuoptionsandnew
10.1.600 ProductionManagement LegalNumberEnhancements EN838 Application functionalityforGeneration/Void
LoggedInvoiceApproveandVoidEntryAddedoptiontosearchbyLegal
10.1.600 ProductionManagement LegalNumberEnhancements EN924 Application Number
10.1.600 ProductionManagement ManufacturingEnhancement EN285 Application ReportQuantityReportqtynowdisplayspreviouslycompletedqtys
EmployeeAddaflagtodonotalwayscreateresourcesautomaticallyfor
10.1.600 ProductionManagement ManufacturingEnhancement EN287 Application employees.
10.1.600 ProductionManagement MICRCheckPrinting(EN201 EN1345 Application AddedClientPrintingoptiontocomplywithSaaS
10.1.600 ProductionManagement MICRCheckPrinting(EN201 EN767 Application AddedSignatureandLogotoMICRCheckPrinter
10.1.600 ProductionManagement MICRCheckPrinting(EN201 EN768 Application AddedMICRCheckPrinterMaintenance
10.1.600 ProductionManagement MICRCheckPrinting(EN201 EN769 Application AddedMICRCheckPaymentMethod
10.1.600 ProductionManagement MICRCheckPrinting(EN201 EN770 Application CheckisnowprintedwithMICRLine,LogoandSignature
10.1.600 ProductionManagement MICRCheckPrinting(EN201 EN771 Application AddedMICRCheckreportstyle
10.1.600 ProductionManagement MICRCheckPrinting(EN201 EN773 Application BankAddedSignatureandLogo
10.1.600 ProductionManagement MICRCheckPrinting(EN201 EN911 Application AddedMIRCCheckReport(rdl/Internal)
10.1.600 ProductionManagement MICRCheckPrinting(EN201 EN989 Application AddedLicenceforMICRChecks
ConfiguratorDesignerImplementedtheabilitytodynamicallychangeimage
10.1.600 SupplyChainManagement Configurator2DViewer(EN EN548 Application whenmappedinputschange
ConfiguratorDesignerImplementedtheabilitytodynamicallychangeimage
10.1.600 SupplyChainManagement Configurator2DViewer(EN EN549 Application whenanExpressionchangesmappedinputs.
ConfiguratorDesignerModifiedthecodegeneratortomakethe2Dimages
10.1.600 SupplyChainManagement Configurator2DViewer(EN EN589 Application availabletoaruntimesession
ConfiguratorDesignerImplementedthedisplayoftheimageduringa
10.1.600 SupplyChainManagement Configurator2DViewer(EN EN591 Application reconfigurationsessionorSavedInputsscenario.

10.1.600 SupplyChainManagement Configurator2DViewer(EN EN592 Application ConfiguratorDesignerImplementedthestoringofthe2DDesigntimeimages


10.1.600 SupplyChainManagement Configurator2DViewer(EN EN593 Application ConfiguratorEntryImport/Exportconfiguratorswith2DDesigns
ConfiguratorDesignerImplementedmappingsupportforotherObject
10.1.600 SupplyChainManagement Configurator2DViewer(EN EN878 Application propertydatatypesnotjustdecimalones.

10.1.600 SupplyChainManagement Configurator2DViewer(EN EN933 Application ConfiguratorEWADisableddeploytoEWAforconfigurator'swith2DViewers


ConfigurationEntryDuplicateconfigurationoptionnowalsocopiesthe2d
10.1.600 SupplyChainManagement Configurator2DViewer(EN EN934 Application ImageandviewertothenewconfigurationID
10.1.600 SupplyChainManagement ECCInterface(EN181) EN1401 Application ECCExtendedmessagingforDDAandMSQ
10.1.600 SupplyChainManagement ECCInterface(EN181) EN509 Application UDfieldandmessages

Page124
ChangeListApplicationEnhancements EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


10.1.600 SupplyChainManagement ECCInterface(EN181) EN510 Application CUSRmessage
10.1.600 SupplyChainManagement ECCInterface(EN181) EN511 Application LOCmessage
10.1.600 SupplyChainManagement ECCInterface(EN181) EN513 Application CRQUfurtherupdates(addingsalesreps)
10.1.600 SupplyChainManagement ECCInterface(EN181) EN514 Application CUSextensionsdeliveryandpaymentmethods
10.1.600 SupplyChainManagement ECCInterface(EN181) EN515 Application CUCOaddresses
10.1.600 SupplyChainManagement ECCInterface(EN181) EN834 Application ECCRMAprocessingofUDfields
10.1.600 SupplyChainManagement ECCInterface(EN181) EN835 Application ECCExtendedcustommessagehandling
10.1.600 SupplyChainManagement ECCInterface(EN181) EN902 Application ECCneedstoreturnorderupdatemessagestoaspecificURL
10.1.600 SupplyChainManagement SalesForceIntegration(EN1 EN853 Application CompanyConfigurationchangesforSFDCIntegration
10.1.600 SupplyChainManagement SalesForceIntegration(EN1 EN854 Application SalesforceSynchronizationProcessAddedUI

10.1.600 SupplyChainManagement SalesForceIntegration(EN1 EN855 Application SynchronizeCustomersandCustomerContactsbetweenSFDCandEpicorERP


10.1.600 SupplyChainManagement SalesForceIntegration(EN1 EN857 Application SynchronizeQuotesbetweenSFDCandEpicorERP
10.1.600 SupplyChainManagement SalesForceIntegration(EN1 EN858 Application SynchronizePartsbetweenSFDCandEpicorERP
10.1.600 SupplyChainManagement SalesForceIntegration(EN1 EN970 Application SFDCPartMaintenancechanges
10.1.600 SupplyChainManagement SalesForceIntegration(EN1 EN974 Application SFDCCustomerMaintenance
10.1.600 SupplyChainManagement SalesForceIntegration(EN1 EN975 Application SFDCQuoteEntryChanges
10.1.600 SupplyChainManagement SCMEnhancements(EN184 EN271 Application CountCycleTagsgeneratedforpartsinanonnettablebin
10.1.600 SupplyChainManagement SCMEnhancements(EN184 EN276 Application PartAddedCreatedByandCreatedDate
MiscellaneousShipmentEntryAddedPhonenumbertoscreenandtofreight
10.1.600 SupplyChainManagement SCMEnhancements(EN184 EN278 Application XMLforInternationalshipments
10.1.600 SupplyChainManagement SCMEnhancements(EN184 EN331 Application RFQEntrydoesnotdisplaytheItemTypeinthelinedetailscreen
10.1.600 SupplyChainManagement SCMEnhancements(EN184 EN457 Application FulfillmentWorkBenchAddedpartdescriptiontogrids
NewPOSuggestionsSuggestionsearchnowliststhepurchasepointandthe
10.1.600 SupplyChainManagement SCMEnhancements(EN184 EN470 Application filtersnowallowtofilterbysupplierandpurchasepoint
10.1.600 ToolsandTechnologies SocialEnterprise(E10T38) E10T39 Tools ExternalGroupAddedabilitytolimitaccesstoSocialEnterprise
10.1.600 ToolsandTechnologies DocStarIntegration(E10T26 E10T265 Tools AddedDocStaroptionstoCompanyMaintenanceUI
10.1.600 ToolsandTechnologies DocStarIntegration(E10T26 E10T267 Tools AddedDocStarsupporttoattachmentmetadata
10.1.600 ToolsandTechnologies DocStarIntegration(E10T26 E10T270 Tools Metadataupdatedtoaddusernameandtableinformation
10.1.600 ToolsandTechnologies DocStarIntegration(E10T26 E10T282 Tools AddedattachmentsheettoCompanyConfigurationUI

Whenanattachmentisupdatedinthedocstarrepository,usersshouldhavethe
10.1.600 ToolsandTechnologies DocStarIntegration(E10T26 E10T312 Tools abilitytodecideiftheywantreplaceafileorsavethefileasanewversion

10.1.600 ToolsandTechnologies DocStarIntegration(E10T26 E10T313 Tools OpenDocstarviacontextmenuwhenclientsystemdirectcopyisselected


10.1.600 ToolsandTechnologies DocStarIntegration(E10T26 E10T314 Tools Contenttype/documenttypesecurityforfolders
10.1.600 ToolsandTechnologies DocStarIntegration(E10T26 E10T315 Tools UserleveloptiontoviewdocStarrepository
ChangeddropdownonDocumenttypeMaintenanceUItomoveDocStarasthe
10.1.600 ToolsandTechnologies DocStarIntegration(E10T26 E10T561 Tools firstiteminsteadoflastinthelist

Page125
ChangeListApplicationEnhancements EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


ChangedMenuMaintenancetoallowchoiceofcustomreportsbasedon
10.1.600 ToolsandTechnologies ReportsFramework E10T103 Tools multipleBAQs

DevelopednewElectronicComplianceMaintenanceformtoallowcreationofan
10.1.600 ToolsandTechnologies ReportsFramework E10T109 Tools XMLorJSONoutputstructurewithmappingstoaReportDataDefinition
ReportDataDefinitionformenhancedtoallowchoiceof1ormoreBAQsand/or
ElectronicInterfacesasthe"tables"tocreateadatasourceforacustomSSRS
10.1.600 ToolsandTechnologies ReportsFramework E10T300 Tools reportorstructuredfile
EnhancedtheReportStyletoallowReportDataDefinitionCriteriaSetsand
10.1.600 ToolsandTechnologies ReportsFramework E10T35 Tools ElectronicComplianceDefinitionstobechosen.
ModifiedSolutionWorkbench"Report"choicetoautomaticallypackageor
10.1.600 ToolsandTechnologies ReportsFramework E10T53 Tools installallobjectsrelatedtothechosenreport
CreatedaDynamicSubmissionformasmechanismforusersubmissionof
10.1.600 ToolsandTechnologies ReportsFramework E10T95 Tools ReportsandCompliancefiles.
10.1.600 ToolsandTechnologies RESTService(E10T237) E10T239 Tools RESTUBAQGetNew
EnsuredallCoreserverAssembliesrelatedtolicensingandsecurityaresigned
10.1.600 ToolsandTechnologies Security(E10T541) E10T542 Tools withaprivatekeythatisnotshared.
MultiCompanyDirectServerProcessCountryIDvalueisnolongeroverridden
10.1.600 FinancialManagement MultiSiteManagement 183328 Application inChildCustomer,whenParentCustomerupdatesinfo

10.1.600 FinancialManagement MultiSiteManagement 193432 Application MultiCompanyDirectServerProcessincreasedverboselogginginformation


MultiCompanyDirectServerProcessVerrbosemodeXMLforMCDirectisnow
10.1.600 FinancialManagement MultiSiteManagement 193440 Application onlywrittenonce

MultiCompanyDirectServerProcessAddedathirdlogginglevelandsplitout
10.1.600 FinancialManagement MultiSiteManagement 193497 Application writingofXMLintothenewlevelaboveVerbosecalledExtended
10.1.600 ProductionManagement FieldService 94520 Application ServiceContractEntryNowsupportstheChangeLog
10.1.600 ProductionManagement MaterialRequirementsPlann 183608 Application NewPOSuggestionsApprovedPurchaseOrdersneedtogeneratetaxes
PriceListImportandExportpathnowreferstoaClientpath,insteadofa
10.1.600 SalesManagement CustomerRelationshipMana 183660 Application Serverpath
ReceiptEntryResolvedthestringorbinarydataerrorwithSupplierName+
10.1.600 SupplyChainManagement Shipping/Receiving 193970 Schema PackingSlip>=60characters
AdministrationConsoleAddeddescriptionstoDatabaseandAppserver
10.1.600 ToolsandTechnologies AdminConsole 173014 Tools ManagerWindows
AdministrationConsoleAllowsyoutosetdefaultfilterswhenyouopen
10.1.600 ToolsandTechnologies AdminConsole 180215 Tools sessions
SetupEnvironmentImportSSRScheckboxisnowclear(unselected)whenyou
10.1.600 ToolsandTechnologies AdminConsole 180551 Tools areredeployinganappserver

Page126
ChangeListApplicationEnhancements EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


SetupEnvironmentAddedabilitytohaveMultipleselectionofbindingsinthe
10.1.600 ToolsandTechnologies AdminConsole 184716 Tools setupenvironment

10.1.600 ToolsandTechnologies AdminConsole 185336 Tools SetupEnvironmentAddedCommandLinesupporttoremoteinstalls/updates

SetupEnvironmentPublishedextensionsNetTcp,httpandhttpsprotocol
10.1.600 ToolsandTechnologies AdminConsole 188906 Tools prefixfromAppserverURLfieldnowchangebasedontheselectedbinding
10.1.600 ToolsandTechnologies AdminConsole 188986 Tools SetupEnvironmentUpdatedPublishExtensions
SetupEnvironmentAllowsconnectiontoanappserverusing
10.1.600 ToolsandTechnologies AdminConsole 190445 Tools HttpsBinaryWindowsChannel
SetupEnvironmentUserisnolongerforcedtotaboutfieldafterentering
10.1.600 ToolsandTechnologies AdminConsole 190875 Tools information

10.1.600 ToolsandTechnologies AdminConsole 193137 Tools SetupEnvironmentAddedaHelp>AboutdialogtotheSetupEnvironmentUI

10.1.600 ToolsandTechnologies AdminConsole 193490 Tools AdministrationConsolePublishExtensionnolongeroverwiteRemoteData.xml


SetupEnvironmentRESTserviceisnowenabledbydefaultforupgradeand
10.1.600 ToolsandTechnologies AdminConsole 197912 Tools newinstallfor600andup
AttachmentsAllowstheabilitytohavemorethanoneSharePointlibraryatany
giventime.Or,allowscustomertochangetheSPlibrarywithoutbreaking
10.1.600 ToolsandTechnologies Attachments 129715 Tools existingattachmentlinks
AttachmentsAllowsusertoentercredentialstoauthenticatewithSharePoiint
10.1.600 ToolsandTechnologies Attachments 141120 Tools server

10.1.600 ToolsandTechnologies Attachments 192899 Tools AttachmentsAllowsabilitytouseOffice365forSharepointattachments


AttachmentsAttachmentBOhasabilitytofunctionindependentlywithoutthe
10.1.600 ToolsandTechnologies Attachments 193922 Tools needofthebaseBOfromwhereisiscalled
AttachmentsAddedattachmentstotheCompanytabletoenableattachments
10.1.600 ToolsandTechnologies Attachments 197260 Tools onCompanyConfigurationform
ExternalBAQExternalBAQthatusesaListparameternowworkwithODBCand
10.1.600 ToolsandTechnologies BAQDesigner 163971 Tools OLEDBdataproviders

10.1.600 ToolsandTechnologies BAQDesigner 173625 Tools "Checksyntax"routinenowworkscorrectlyforCalculatedfieldsdefinition


IntegratednewBAQC#codeeditorintellisenseandimrpovedtheexisting
10.1.600 ToolsandTechnologies BAQDesigner 176096 Tools behaviour
Implementedunittestsforretrievalofcustomattributesforregular/UDfieldsin
10.1.600 ToolsandTechnologies BAQDesigner 181313 Tools BAQengine
ValidatedQueryParameterTypevsitssourcetypeduringexecutiontoavoid
10.1.600 ToolsandTechnologies BAQDesigner 184469 Tools TypeMismatcherrors

Page127
ChangeListApplicationEnhancements EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


Resolvederror:'Indexwasoutsidetheboundsofthearray'onBAQsaveif
10.1.600 ToolsandTechnologies BAQDesigner 185784 Tools there'sinvalidvalueinLikefield'sattribute

BAQwithundefinedBOcannolongerbesaved/executedbynonadvanceduser
10.1.600 ToolsandTechnologies BAQDesigner 186287 Tools despitethenotallowedfunctionalityinfield'sInitialExpression
10.1.600 ToolsandTechnologies BAQDesigner 193510 Tools DebtRevisedLINQinDynamicQuery.GetQueryListFromLikemethod

10.1.600 ToolsandTechnologies BAQDesigner 196487 Tools HierarchicalQueryEngineImplementedrelationsasfilteringonchildBAQs


10.1.600 ToolsandTechnologies BAQDesigner 196869 Tools TypedBAQconstantsforSyntaxcheckandruntime(3.1.600)
HierarchicalQueryEngineExecutedcrosscompanyandcurrentcompanyBAQs
10.1.600 ToolsandTechnologies BAQDesigner 197041 Tools inonequery
10.1.600 ToolsandTechnologies BAQDesigner 197107 Tools Enhanced"WhereUsed"tabforBAQ/EIreports
Ifparameter'sdropdownitemDisplayTextisundefineditnowshowsValuein
10.1.600 ToolsandTechnologies BAQDesigner 197720 Tools runtime

10.1.600 ToolsandTechnologies BAQDesigner 198199 Tools ExternalBAQAddedabilitytospecifycustompropertiesforOleDbprovider


PhraseBuilderJointypeinquerytextnolongerdiffersfromoneinPhrase
10.1.600 ToolsandTechnologies BAQDesigner 198582 Tools Builder

10.1.600 ToolsandTechnologies BAQDesigner 199022 Tools CalculatedFieldEnhancedTabordertobeconsistentanduserfriendly


ResolvedUnhandlederrorwhencreatinganewqueryifquerywiththesame
10.1.600 ToolsandTechnologies BAQDesigner 200116 Tools nameexistsandit'snotshared
FailuretoinitializenoncriticalinformationatstartupnolongerpreventsBPM
10.1.600 ToolsandTechnologies BPM 159311 Tools designerfromopeningthedirective
10.1.600 ToolsandTechnologies BPM 176124 Tools SyntaxCheckerrorpanenolongerdisplayswhenitisnotneeded
10.1.600 ToolsandTechnologies BPM 185317 Tools AddedReferenceERP/ICETriggersreferencesshouldnotbeloaded
DirectiveExportImprovedmessageshownandprocessiscanceledifthere's
10.1.600 ToolsandTechnologies BPM 185707 Tools undefinedblock(AttachHold)
ImprovedmethodtodisplayformdesignwhenitisopenedinMSVSForm
10.1.600 ToolsandTechnologies BPM 186021 Tools Designer
DirectiveExportImprovedmessageshownandprocessiscanceledifthere's
10.1.600 ToolsandTechnologies BPM 186203 Tools undefinedblock(BPMDataForm)
IntegratedCheckSyntax/CheckSecurityintotheValidatebuttonoftheBPM
10.1.600 ToolsandTechnologies BPM 186212 Tools designer
WorkflowDesignerScalarvariables'tagscannowbecopied/pastedbetween
10.1.600 ToolsandTechnologies BPM 187115 Tools ShowMessageblocks(emptystring)
10.1.600 ToolsandTechnologies BPM 189896 Tools ResolvedconfiguremappinglinktextinFill/Updateactions
UpdatediconsusedinSyntaxCheckpanesinaccordancewiththeonesfrom
10.1.600 ToolsandTechnologies BPM 190818 Tools ValidationResultspane

Page128
ChangeListApplicationEnhancements EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


WorkflowDesignerResolvedissueswithVariablesgridifthecellisleftinEdit
10.1.600 ToolsandTechnologies BPM 193392 Tools mode
ExtendprogramminginterfaceUInolongerexposesoptionsofC#programming
10.1.600 ToolsandTechnologies BPM 193996 Tools interfacegeneration
10.1.600 ToolsandTechnologies BPM 196473 Tools Improvedsyntaxcheckertoscrolltoerrorposition
10.1.600 ToolsandTechnologies BusinessActivityManager 185797 Tools AddedabilitytoallowusertospecifyArchivereportparameter
10.1.600 ToolsandTechnologies BusinessActivityManager 185833 Tools ImproveddetaileddiagnosticloggingforAutoPrint
DatabaseMigrationAddedoptiontogeneratereportofallthe
10.1.600 ToolsandTechnologies Conversions 133590 Tools skipped/truncatedrecordsofOpenEdgeMigration
DatabaseMigrationDurringtheOpenEdgeMigration,theprocessnowchecks
10.1.600 ToolsandTechnologies Conversions 186222 Tools forE9versionbeforeprocess

10.1.600 ToolsandTechnologies Conversions 187298 Tools DatabaseMigrationRemovedsystemdatabasefromMigrationConfigurator


10.1.600 ToolsandTechnologies Conversions 188968 Tools DatabaseMigrationChanged"Liccnfg"error

10.1.600 ToolsandTechnologies Conversions 196339 Tools DatabaseMigrationAddednewparametersfromGUItoCMDforSaaSrequest


CustomizationEngineAddedmoduledescriptiontotheerror"Themodule
10.1.600 ToolsandTechnologies CustomizationEngine 167177 Tools 0000000..isnotlicensedorenabled"
CustomizationEngineAddedabilitytoshowCompilerObsoleteMethod
10.1.600 ToolsandTechnologies CustomizationEngine 183316 Tools WarningsandhideObsoletemethodsinCustomizationTools
CustomizationEngineDefaultfolderwhenexportingcustomizationnolongeris
10.1.600 ToolsandTechnologies CustomizationEngine 187952 Tools clearedwhenclientcacheiscleared
SchemachangeChangedtheClusteredindexofthetablePartAlloctobethe
10.1.600 ToolsandTechnologies DatabaseAdministration 195785 Tools Primarykey

10.1.600 ToolsandTechnologies EnterpriseSearch 141132 Tools SearchChangedthesizeofthetextboxintheEnterpriseSearchtoolbar


IndexAllcompaniesonindexnowlistsallcompanies,notjustallcurrent
10.1.600 ToolsandTechnologies EnterpriseSearch 172390 Tools companies
AdminConsoleAddedabilitytoreconfigure(edit)existingESEconfigsettings
10.1.600 ToolsandTechnologies EnterpriseSearch 187223 Tools withintheAdminConsoleonceithasbeenmarkedasDeployed
10.1.600 ToolsandTechnologies ESCDESRouter 175286 Tools EpicorNet/Webreferences:UpdatedsyntaxinCompanyIDnode
10.1.600 ToolsandTechnologies ESCInstall 193052 Tools UpdatedcompatibilitywithWindowsServer2016
RestoreOperationnowallowsabilitytomodifyConnectionStringfor
10.1.600 ToolsandTechnologies ESCOther 193239 Tools DBoperationiniScalamode
DESPoster:ValidationagainstxsdisnowimplementedforManager,Netand
10.1.600 ToolsandTechnologies ESCOther 195600 Tools Webplugins

10.1.600 ToolsandTechnologies GeneralFramework 127245 Tools EWANowresetshowitusestheModuleEESforEnterpriseSearchAccess


10.1.600 ToolsandTechnologies GeneralFramework 137629 Tools UpdatednewSystemInformationtablewhenanAppServerstarts

Page129
ChangeListApplicationEnhancements EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


SearchFrameworkCreatedaBAQwithacalculatedfieldthattheusercan
10.1.600 ToolsandTechnologies GeneralFramework 153573 Tools selectforcriteriacolumninQuickSearchmaintenance
10.1.600 ToolsandTechnologies GeneralFramework 155140 Tools HelpSystemAddedGlobalHelpURL
10.1.600 ToolsandTechnologies GeneralFramework 163771 Tools EnhancedtheframeworktoidentifyaUIthreadisreadyfordata
10.1.600 ToolsandTechnologies GeneralFramework 175170 Tools AddedabilityforChangeTrackertolinkSCRtoeachreportedissue

10.1.600 ToolsandTechnologies GeneralFramework 175172 Tools AddedabilityforChangeTrackertosuppressspecificissuesonceapproved


10.1.600 ToolsandTechnologies GeneralFramework 182225 Tools Improvedvalidations/messagesinEpiClientLib
10.1.600 ToolsandTechnologies GeneralFramework 185476 Application ImprovedConversionprogram1120toendproperly
10.1.600 ToolsandTechnologies GeneralFramework 190729 Tools ICEBuildUpdatedEWAinstallertosupportincrementalupdates
ServerFileDownloadNolongerdisplaystheIPaddressoftheserverinthe
10.1.600 ToolsandTechnologies GeneralFramework 192986 Application Cloud
SessionManagementSessionModnowaddsanewmethodforreturning
10.1.600 ToolsandTechnologies GeneralFramework 193160 Tools LicensedModulesandDesc

10.1.600 ToolsandTechnologies GeneralFramework 193643 Tools AddedFrameworkmethodsforclientretrievalofAppServerLocales/Cultures

10.1.600 ToolsandTechnologies GeneralFramework 196508 Tools DiagnosticsthreadIntroducedfirstchanceexceptiontraceflagintothethread


10.1.600 ToolsandTechnologies GeneralFramework 196511 Tools CachingAddedZFieldDecimaltotablesbeingcachedglobally
10.1.600 ToolsandTechnologies GeneralFramework 201156 Tools HelpAboutUpdatedpagetoreflecttheOSSfor10.1.600

10.1.600 ToolsandTechnologies InformationWorker 177324 Tools MultiTenancyConfigurationManagernowsupportsmultipleappservers


10.1.600 ToolsandTechnologies InformationWorker 177328 Tools Enhancedabilitytoselectsysconfigfileratherthanhardcodeforsite
10.1.600 ToolsandTechnologies Licensing 189570 Tools LicenseUtilityResolvederrorwhendeletingnodesfromXMLfile

10.1.600 ToolsandTechnologies Menus 171366 Tools ShellMenuAddedsecurityonBAQgadgetstolimitthevisibilityofcertainBAQs


10.1.600 ToolsandTechnologies Menus 180079 Tools ShellMenuAddedUserSettingsoptiontodisableFlyin/Flyout
Addedconfigcheckruletodetermineifanypostingengineloggingoptionsare
10.1.600 ToolsandTechnologies Performance/Diagnostics 155830 Tools enabled
Nowrecommendsautogrowthofafixedsizethatwilltakelessthanafew
10.1.600 ToolsandTechnologies Performance/Diagnostics 165437 Tools secondstoexpandif/whentheautogrowtheventoccurs

10.1.600 ToolsandTechnologies Performance/Diagnostics 165727 Tools Improvedreturnofdataforlast5backupsagainstdatabaseinconfigcheck


AddedGoToboxfortimefilterinServerDiagplugin,usertypesadateandthe
10.1.600 ToolsandTechnologies Performance/Diagnostics 167527 Tools cursormovestothedateselected
10.1.600 ToolsandTechnologies Performance/Diagnostics 168608 Tools PreservedTrulesinbetweenPDTversions
AddedadditionalcodetoupdatethePDTfromaSharepointdownload
10.1.600 ToolsandTechnologies Performance/Diagnostics 175922 Tools preferablythePTTsite
10.1.600 ToolsandTechnologies Performance/Diagnostics 176102 Tools AddedascreenfortheDataFeedsandTransformationRules

Page130
ChangeListApplicationEnhancements EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


EnhancedthePDTsothatitnowsupportsbeinglaunchedthroughacommand
10.1.600 ToolsandTechnologies Performance/Diagnostics 185251 Tools lineinterface
10.1.600 ToolsandTechnologies Performance/Diagnostics 186983 Tools LoadtestWorkbenchAddedseveralenhancementsandfixes
TaskAgentServiceAddedContextMenuRightClickactiontoRecycleaspecific
10.1.600 ToolsandTechnologies ProcessManagement 155890 Tools taskagentconfiguration

10.1.600 ToolsandTechnologies ProcessManagement 190854 Tools TaskAgentServiceStartupTasksnowstopwhenTaskAgentServiceisstopped


TaskAgentServiceWhentheservicestartseachoftheagentsnowstartsina
10.1.600 ToolsandTechnologies ProcessManagement 193488 Tools staggeredtime

10.1.600 ToolsandTechnologies ProcessManagement 193858 Tools SystemMonitorSystemmonitornowusesmessageboxestodisplayerrors


SysAgentBOGetByIdForTaskAgentInternalmethodnowusesthe
10.1.600 ToolsandTechnologies ProcessManagement 195718 Tools CommandTimeoutsettingfromweb.config
10.1.600 ToolsandTechnologies ReportsFramework 193369 Tools AddedCompanyNametoMenuSecurityReportrdl
LogonFailureReportNowincludesfailedlogonattemptswhenuserislocked
10.1.600 ToolsandTechnologies ReportsFramework 195263 Tools out
10.1.600 ToolsandTechnologies ReportsFramework 196760 Tools AddedBPMdatatoreports
10.1.600 ToolsandTechnologies ReportsFramework 198728 Tools AddedabilitytosupportprocessingofEDIontheserver
10.1.600 ToolsandTechnologies RESTFramework 196161 Tools RESTFrameworkImprovedEDIProcessing
SecurityReportImprovedSystemSetup/SecurityMaintenance/ChangeLog
10.1.600 ToolsandTechnologies SecurityFramework 194770 Tools Reportsothatkeysarenottruncated
AttachmentsNowallowscustomerstolimittheaccesstoSharePointlibraryto
10.1.600 ToolsandTechnologies SharePointPublisher 155542 Tools onlyAppPoolIdentity

10.1.600 ToolsandTechnologies SocialEnterprise 137342 Tools Resolvederrorwhenusing/or+intheUserIdfieldontheInviteUserform


NotificationprofileImprovedabilitytofindatableforEpicorERPonthe
10.1.600 ToolsandTechnologies SocialEnterprise 159998 Tools Notificationprofile
10.1.600 ToolsandTechnologies SocialEnterprise 179157 Tools SimplifiedSocialpanelinmodernshelltodisplaydataonly
RemovedE10Winformspostmessageforminfavorofhostedsocialpost
10.1.600 ToolsandTechnologies SocialEnterprise 179853 Tools messageform
10.1.600 ToolsandTechnologies SocialEnterprise 179862 Tools Addedadashboardelment/panelforESEmessages
Implementedamethodofdatabaseversioningtoreducerunningofunnecessary
10.1.600 ToolsandTechnologies SocialEnterprise 182265 Tools updatescripts
10.1.600 ToolsandTechnologies SocialEnterprise 183793 Tools EWAurlonnotificationsourceisnowrequired
DisabledfeaturesinESEwhenE10userdoesnothave"AllowEpicorWeb
10.1.600 ToolsandTechnologies SocialEnterprise 184213 Tools Access"enabled
DeploymentofESEnowallowscustomertoselectdeploymentdetailsfor
10.1.600 ToolsandTechnologies SocialEnterprise 184995 Tools website
10.1.600 ToolsandTechnologies SocialEnterprise 185020 Tools DatabaseinstallerelementsarenowremovedontheHD

Page131
ChangeListApplicationEnhancements EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


10.1.600 ToolsandTechnologies SocialEnterprise 189037 Tools ImprovedExternalGroupSupport
AddedabilityforESEtohavemultipleapplicationserverconnectionswithmulti
10.1.600 ToolsandTechnologies SocialEnterprise 189177 Tools tenant
Solutionmanagerfile(.CAB)nowincludesrelatedcustomchangesmadethrough
10.1.600 ToolsandTechnologies SolutionWorkbench 118293 Tools theuserinterface
SolutionElementEntryEnhancedAdvElementSearchtofilterMethod/Data
10.1.600 ToolsandTechnologies SolutionWorkbench 188452 Tools Directivesthatshouldnotbemovedbetweendatabases
WebFrameworkModalDialogsAddedautilitytoreplacemodaldialogsin
10.1.600 ToolsandTechnologies WebAccess 143093 Tools WinForms
10.1.600 ToolsandTechnologies WebAccess 194658 Tools WebFrameworkImproveduseabilityofEWAondevices

Page132
ChangeListPerformanceEnhancements EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


BankStatementProcessingImprovedperformancewithBankStatementAuto
10.1.600 FinancialManagement CashManagement 196026 Application Matching
BankStatementProcessingImprovedperformancewithBankStatement
10.1.600 FinancialManagement CashManagement 196028 Application posting
BankStatementProcessingImprovedperformancewhenprintingBank
10.1.600 FinancialManagement CashManagement 196029 Application statementEditList
CSFThailand,China,MalaysiaAnalyzedStockMovementReportandremoved
10.1.600 FinancialManagement CSFAll 192391 Application subreportsifpossible
ARInvoiceBalanceReportAnalyzedandremovedSubReports,ifpossible;ifa
subreportcouldn'tberemovedthenthedatasetfilterswerereplacedwith
10.1.600 FinancialManagement AccountsReceivable 169890 Application WhereClauses
CashReceiptEntryImprovedperformancetopaste/insertinvoicesinthe
10.1.600 FinancialManagement AccountsReceivable 183295 Application AllocateTab
InvoiceEntryARImprovedperformancewhenpastingmorethan10000lines
10.1.600 FinancialManagement AccountsReceivable 185249 Application ininvoice
InvoiceEntryARImprovedperformancewhengettingFieldServiceCallsin
10.1.600 FinancialManagement AccountsReceivable 186804 Application Invoice
10.1.600 FinancialManagement AccountsReceivable 187343 Application CashReceiptEntryImprovedperformanceretreivingaCustomer
InvoiceEntryARImprovedperformancewhencalculatingtaxesoneachline
10.1.600 FinancialManagement AccountsReceivable 189888 Application releaseadded

10.1.600 FinancialManagement AccountsReceivable 192582 Application SalesTaxReportImprovedperformanceandprocessingtodisplaythereport


VATTaxImprovedperformancewhenpostingwhentherearealargenumber
10.1.600 FinancialManagement AccountsReceivable 193900 Application oftransactions
ARInvoiceImprovedperformancewhenprintingARinvoicesbyreducing
10.1.600 FinancialManagement AccountsReceivable 195617 Tools processingtime
ARInvoiceImprovedperformanceinGetShipmentstoreduceprocessing
10.1.600 FinancialManagement AccountsReceivable 195818 Tools time(Epic1330)
BankAdjustmentEntryImprovedperformancetopaste/insertand
10.1.600 FinancialManagement CashManagement 185570 Application paste/updaterecords
10.1.600 FinancialManagement GeneralLedger 190041 Application VerifyBalancesImprovedprocessingandgeneratingofthereport
JournalEntryImprovedperformancetodisplaytheuserinterfacewhen
selectingtheAutoBalancebuttonorselectingtheGLAccountforalarge
10.1.600 FinancialManagement GeneralLedger 194587 Application journal(35k)
10.1.600 FinancialManagement GeneralLedger 194918 Application ARInvoiceImprovedperformanceforARInvoicewithover1000lines
10.1.600 FinancialManagement GeneralLedger 196291 Application PostingEngineImprovedprocessingtoremovealocktimeout
ARPaymentPostingImprovedperformancetoremoveacreditmemo()lock
10.1.600 FinancialManagement GeneralLedger 196393 Application timeout

Page133
ChangeListPerformanceEnhancements EpicorERP10.1.600

Release FunctionalArea Module Job Type Description

10.1.600 FinancialManagement GeneralLedger 198583 Application GLControlImprovedperformanceincreatingGLControlwith114Mintranglc


ConversionImprovedperformanceofcompilingafilefortheconversion
10.1.600 FinancialManagement GeneralLedger 198666 Application program
GenericIntegrationServerProcessImprovedprocessingwhenlessgroups
10.1.600 FinancialManagement MultiSiteManagement 180896 Application havemoreinvoicespergroup

MultiCompanyDirectServerProcessImprovedperformancewhenusing
10.1.600 FinancialManagement MultiSiteManagement 190331 Application GlobalSegmentexchangebetweentargetcompaniesifCOAisMaster
ConsolidatetoParentImprovedperformanceforquery
10.1.600 FinancialManagement MultiSiteManagement 193185 Application ConsolidToParentPostProcGLJrnDtlFindFirstGLJrnDtl
SupplierTrackerImprovedperformanceforretievingallinvoicesandall
10.1.600 SupplyChainManagement SupplierRelationshipMana 184689 Application purchaseorders
Internal.Lib.SharedlibraryImprovedperformancewithqueriesZFieldDecimal
10.1.600 ToolsandTechnologies General 198354 Application andZDataField
EndActivityImprovedperformancewhenthousandsofSerialNumbersare
10.1.600 ProductionManagement DataCollection 187543 Application assignedtoaPart
WhereUsedImprovedreportprocessingwhenprintingmorethan40,000
10.1.600 ProductionManagement Engineering 192447 Application Partsatthesametime

10.1.600 ProductionManagement JobManagement 193650 Application JobEntryImprovedperformancewhenretrievingUnfirmJobsinformation


10.1.600 ProductionManagement JobManagement 194685 Application JobEntryImprovedperformanceinprocessing
TimeSheetEntryImprovedperformancewhenapprovingaLaborTimerecord
10.1.600 ProductionManagement TimeManagement 181966 Application foraspecificproject
TaskImprovedprocessingwhenmodifyingaTaskwithmorethan40,000
10.1.600 SalesManagement CustomerRelationshipMan 191260 Application recordsaddedinTaskTable
ConfiguratorRulesImprovedperformancewhenapprovingaConfigurationID
10.1.600 SalesManagement ProductConfiguration 169425 Application thathasmultiplepartslinkedtoit

10.1.600 SalesManagement ProductConfiguration 187891 Application ConfiguratorLookUpImprovedperformancewhenimportingCSVformatfiles


ConfiguratorLookUpImprovedperformancewhenloadinglargeLookUp
10.1.600 SalesManagement ProductConfiguration 187937 Application tables
ConfiguratorEWARemovedthedelaywhenConfigurationruntimelaunches
10.1.600 SalesManagement ProductConfiguration 198016 Application fromEWAclient
10.1.600 SalesManagement QuoteManagement 192975 Application QuoteImprovedperformancewhenusingGetList
10.1.600 FinancialManagement MultiSiteManagement 189309 Application QueriesImprovedperformanceinseveralqueries
10.1.600 ProductionManagement MaterialRequirementsPlan 190986 Application NewPOSuggestionsImprovedperformancebasedonsuggestions
10.1.600 SalesManagement CustomerRelationshipMan 190200 Application RMAProcessingReplaceddefaultbinlogic
10.1.600 SalesManagement EDI 186915 Application ImportDocumentsRemovedThreadSleepandImplementFileLocking

Page134
ChangeListPerformanceEnhancements EpicorERP10.1.600

Release FunctionalArea Module Job Type Description


OrderEntryImprovedperformancebetweenversionsfororderswith500
10.1.600 SalesManagement OrderManagement 188355 Application releaselines

10.1.600 SalesManagement OrderManagement 188357 Application OrderEntryImprovedperformancebetweenversionsfororderwith100lines


OrderEntryImprovedperformanceandfocuswhenrefreshingscreenwith
10.1.600 SalesManagement OrderManagement 190743 Application manyReleases

10.1.600 SalesManagement OrderManagement 196115 Application OrderEntryImprovedperformanceinSalesOrderwithsuggestedchanges


ReceiptEntryImprovedperformancewhenaddingaLinewhenhavingtoo
10.1.600 SupplyChainManagement Shipping/Receiving 186891 Application manyBinrecords
10.1.600 SupplyChainManagement Shipping/Receiving 190201 Application TransferOrderShipmentEntryReplaceddefaultbinlogic
ECCCustomerImprovedperformaceonInvoicesearch(CUIS)sothatitdoes
10.1.600 ToolsandTechnologies CommerceConnect 190867 Tools nottimeout
10.1.600 ToolsandTechnologies GeneralFramework 196701 Tools ImprovedlogicofVendorBeforeCreatetouseframeworkmethod
10.1.600 ToolsandTechnologies GeneralFramework 183169 Tools ImprovedperformanceonmethodtoqueryIMtables
ReducedprocessingtimeofModifyPartTran.sqltocompletewithlargenumber
10.1.600 ToolsandTechnologies GeneralFramework 190673 Tools ofrecords
ImprovedprocessingtimeandreducedCPUusageforJobManager
10.1.600 ToolsandTechnologies GeneralFramework 192987 Tools Erp.Internal.JC.CreateJobPWB

10.1.600 ToolsandTechnologies GeneralFramework 198692 Tools EntityFrameworknowcorrectlyremovesCompiledQueriesfromthecache


10.1.600 ToolsandTechnologies SocialEnterprise 200737 Tools ESEImprovedperformanceoncallsmadebyESEintegration
10.1.600 ToolsandTechnologies WebAccess 199388 Tools ConfiguratorImprovedperformanceofConfiguratorwithinECC

10.1.600 ToolsandTechnologies WebAccess 200844 Tools ConfiguratorImprovedperformancebyminifyingseveralconfiguratorscripts

Page135
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


LayoutofmanyformschangedduetoAPTaxesfunctionality,
including:
QuoteEntryandTracker
POEntry
10.1.600 FinancialManagement APTaxes n/a APTaxesfunctionality POTracker(mustbecompletelyrewritten)
POSuggestions
ReceiptEntryandTracker
ContainerReceipts
AP Invoice Entry and Tracker
FinancialManagement 1037:FinancialEnhancements EN206 InvoiceEntryAPPrevententering NewparametersaddedtothefollowingBOServices/methods:
InvoicesintheFuture
Server/Services/BO/APInvGrp.OnChangeofApplyDate:
Server/Services/BO/APInvoice.ChangeInvoiceDateEx:
Server/Services/BO/APInvoice.OnChangeofApplyDateEx:
Server/Services/BO/APInvoiceLoad.ChangeApplyDate:
Server/Services/BO/APInvoiceLoad.ChangeInvoiceDate:
10.1.600 Server/Services/BO/LogAPInv.ChangeInvoiceDateEx:
Server/Services/BO/LogAPInv.OnChangeofApplyDateEx:
Server/Services/BO/LogInvGrp.OnChangeofApplyDate:

newDateTimeparameter:today'sdatefromtheclient
newoutputparameterDateMessage:themessagetoshowtheuser.
Blankifnomessageshouldbeshown.

FinancialManagement 1037:FinancialEnhancements EN206 InvoiceEntryARUnableto Added2newparameterstoGetFSCalls:


manuallyselectonlyoneservicecall publicvoidGetFSCalls(stringGroupID,stringCustList,string
toinvoice CodeList,stringCallList,stringPlant,outintNumInvs,out
10.1.600 decimalgrpTotalInvAmt)

RemovedbtnOKonGetFSCallsFormandreplacedwith
btnSelectAll
FinancialManagement 1037:FinancialEnhancements EN206 InvalidDateremainsdisplayed ToproperlyresetthedatesforAPInoviceLoadIhadtoadda
havingtheFutureInvoiceDates newpublicmethodOnChangingInvoiceOrApplyDatewhich
"Stop"actionselected handlesbothInvoiceorApplyDatesandiscalledviaan
10.1.600 onchangingevent.
Themethodsalreadyinplace(ChangeInvoiceDateand
ChangeApplyDate)weremodifiedandarebeingcalledbythe
onchangedevent.

Page136
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


FinancialManagement 1042:ExtendedPayment EN1685 ARInvoiceEntryPayment AddednewCurrencySwitchfieldforInvcSchedbaseamount
SchedulesAR Schedule"Amount"columncanbe calcula ons.
10.1.600
modifiedwithinvalidvalues thischangehasanewexternalcolumninthetttablethatis
calculated in ARInvoice Entry.
FinancialManagement 1042:ExtendedPayment EN1687 ARInvoice(BOE)Replaceold RemovedPaymentSchedulemenufromARBillofExchangeUI,
10.1.600 SchedulesAR PaymentSchedulefieldswithnew removedpublicmethodsfromARinvoiceadapterandBO.
tableInvcSched
FinancialManagement 1042:ExtendedPayment EN1857 SalesOrderPayAmountisrounded Updatedfieldlength
SchedulesAR aftersaveabigvalueinthelimitsof
10.1.600
theallowedformat.

FinancialManagement 1042:ExtendedPayment EN197 SalesOrderNewPayment Newtabadded,SalesOrderEntry>Header>PaymentSchedule


SchedulesAR ScheduleTabUI tableOrderSchedwasaddedtotheDatasetthusanew
10.1.600
parameterGetRowsmethodfirmwasmodified

FinancialManagement 1042:ExtendedPayment EN197 TermsMaintenanceAddPayment TermsSchedtablewasaddedtotheTermsdatasetwhichcauses


10.1.600 SchedulesAR Schedule thepublicmethodGetRowstochangeitssignature.

FinancialManagement 1042:ExtendedPayment EN197 ARPostedInvoiceUpdate Replacedtextbox"txtTerms",nowcombobox"cboTermsCode"


SchedulesAR PaymentSchedule isused
10.1.600
Path:
$\Current\Source\Client\UIApps\ARInvoiceUpdtEntry\Panels\De
tailPanel cs
FinancialManagement 1042:ExtendedPayment EN197 SalesOrderTrackerNewoptionto NewTabForPaymentScheduleadded
10.1.600 SchedulesAR ViewPaymentScheduleUI

FinancialManagement 1042:ExtendedPayment EN197 ARInvoiceEntryUIChanges MethodsignaturechangeARInvoiceGetRows


10.1.600
SchedulesAR
FinancialManagement 1042:ExtendedPayment EN197 UI2SalesOrderNewPayment Newtabadded,SalesOrderEntry>Header>PaymentSchedule
10.1.600
SchedulesAR ScheduleTab
FinancialManagement 1042:ExtendedPayment EN197 ARInvoicePaymentSchedulefor ModifiedARInvoiceGetRows
10.1.600 SchedulesAR Misc/AdvBilling/DepBillingInvoices
/CreditMemos
FinancialManagement 1042:ExtendedPayment EN197 CashReceiptEntryAddcolumnto ModifiedpublicmethodCashRecGetInvoices
SchedulesAR SelectionInvoicestodisplay
10.1.600
amountofthenextscheduledue

Page137
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


FinancialManagement 1042:ExtendedPayment EN197 ARPostedInvoiceUpdate Replacedtextbox"txtTerms",nowcombobox
SchedulesAR PaymentScheduleUI "cboTermsCode"isused
Path:
10.1.600 $\Current\Source\Client\UIApps\ARInvoiceUpdtEntry\Panels\he
aderpanels\HdrDetailPanel.cs

Addednewgrid"eugPaymentAc vity"
Path: $\Current\Source\Client\UIApps\ARInvoiceUpd
FinancialManagement 1042:ExtendedPayment EN197 ARInvoiceEntry/Tracker SprocsmodifiedonARInvoiceBO
SchedulesAR PaymentScheduleAmountcolumn _ZFW_ARInvoice_GetByID.sql
10.1.600 doesnotchangebasedonreporting _ZFW_ARInvoice_GetRows.sql
CurrencyDropdown _ZFW_ARInvoiceInvcSched_GetBySysRowID.sql

FinancialManagement 1043:ExtendedPayment EN1376 APInvoiceEntryReplaceold RemovedthepublicmethodsChangePaymentAmountand


SchedulesAP paymentschedulereferencefields ValidatePaymentDatefromtheAPInvoiceBOasthosemethods
withnewtablefields arenowobsoletewiththenewtableAPInvSched.Those
methodswereutilizingtheoldAPInvHedcolumnswhich
previouslyheldthepaymentscheduleinformationwhichisnow
10.1.600 inthenewtableAPInvSched.
Also,removedobsoleteformandpanelfrom
UIApps/APBillofExchangeEntry(obsoleteformandpanelwere
alreadyremovedinAPInvoiceEntryunderEN999)>
PaySchedForm.csandHeaderPaymentSchedPanel.cs
FinancialManagement 1043:ExtendedPayment EN1385 ARInvoiceReplaceoldPayment RemovedmenuoptionforInvoice..PaymentScheduleandthe
10.1.600 SchedulesAP Schedulefieldswithnewtable formandpanelsthatloadforthismenuoption.
InvcSched
FinancialManagement 1043:ExtendedPayment EN196 DatabaseSchemaChangesfornew Addednewtable'PurTermSched'toPurTermswhichadded
10.1.600
SchedulesAP Table/Fields anotherparametertoGetRows
FinancialManagement 1043:ExtendedPayment EN196 APPostedInvoiceUpdateAdd TermsCodeisnowaneditablefieldsandwasconvertedfroma
10.1.600
SchedulesAP PaymentSchedule textboxtoaComboBox.
FinancialManagement 1043:ExtendedPayment EN196 PurchasingTermsIncorrect DatabasechangemadetoincreasePurTermsSched.PayPercent
10.1.600 SchedulesAP paymentschedulepercentdecimal decimalprecisionto6.
rounding
FinancialManagement 1043:ExtendedPayment EN196 APInvoiceEntryIncorrect Databasechangemadetoincreasethenumberofdecimalsfor
10.1.600 SchedulesAP paymentschedulepercentdecimal APInvSched.PayPercentfrom2to6.
rounding

Page138
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


FinancialManagement 1043:ExtendedPayment EN999 APInvoiceEntryRemoveActions RemovedPaymentSchedulesActionmenuitemalongwith
SchedulesAP MenuoptionforPaymentSchedule associatedformsandpanels.
APInvoiceTrackerRemoveOld
10.1.600 PaymentScheduletabinAPInvoice
TrackerUpdateAPBillofExchange
(PeruCSF)

FinancialManagement 1298:Taxatthelinelevelon EN4 SchemachangestoReceiptstables Theadditionofthe4extratablesmeanstheGetRows()method


10.1.600 ReceiptLines toaddtaxeschildtables. nowcontainsanextra4parametersasawhereclauseforeach
ofthenewtables.
FinancialManagement 1298:Taxatthelinelevelon EN4 AddTotalstabtoContainer CarrierPanelandspecificduty/upliftamountmovedtoanew
10.1.600
ReceiptLines ShipmentHeader paneltohavespacefortotals.
FinancialManagement 1298:Taxatthelinelevelon EN4 SchemachangestoContainerLC ContainerTrackingclasshadContainerDetailTax,
ReceiptLines tablestoaddtaxeschildtables. ContainerDutyTax,ContainerMiscTax,andContainerHeaderTax
10.1.600 addedtosupporttheepic.Duetothoseextratablesthe
GetRowsfunctionneededthewhereclausesextendingto
support the extra tables
FinancialManagement 1298:Taxatthelinelevelon EN4 AddNew"Header"tabonReceipt *IndirectCoststabmovedfromLandedCosttoHeader
10.1.600
ReceiptLines Entry *CommentsmovedfromSummarytoHeader
FinancialManagement 1298:Taxatthelinelevelon EN4 RearrangeLinesDetailtabin *MovedSupplierPrice/UnitCost/NetWeight/GrossWeight/
ReceiptLines ReceiptEntry ImportNumber/ImportedFrom/PlanningContractontothe
bo ompanel.
*MoveTransac onQtytotheQuan esgroupbox.
*ChangedReceiptTypefromaradiobuttontoacombotosave
10.1.600 space.
*RemovedImportTabfromheaderasthisinformationisnow
onthegeneraltab.
*MovedDu estabfromLandedCosttabtotheLinestab.
*RemovedLandedCostssubdockingpanelasnotrequired
FinancialManagement 1298:Taxatthelinelevelon EN4 ReceiptEntrychangestohandle ChangedOnChangedTaxManualtopassintableNamewhichis
10.1.600 ReceiptLines systemcalculatedtaxes(posttax requiredsuchthattheBLcandifferentiatebetweenRcvMiscTax
engine) /RcvDtlTax.
FinancialManagement 1298:Taxatthelinelevelon EN4 RearrangeLinesDetailtabin ImportNumberandImportFromFieldsmovedtoadifferent
10.1.600
ReceiptLines ContainerReceiptEntry container.

Page139
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


FinancialManagement 1298:Taxatthelinelevelon EN4 ContainerLCEntrychangesto 3newparametershavebeenaddedtoGetRowswhichrelateto
ReceiptLines handlesystemcalculatedtaxes thewhereclauseforthe3newtablesaddedtothisDataSet:
10.1.600 (posttaxengine) *ContainerDetailTax
*ContainerHeaderTax
*ContainerMiscTax

FinancialManagement 1298:Taxatthelinelevelon EN4 Dropunusedcolumnsfromvarious ChangedReceiptAdapterOnGetRowsandreducedthe


ReceiptLines tablesaswellasdropRcvDutyTax/ whereclauseto14duetotheremovalofRcvDutyTaxfromthe
10.1.600
ContainerDutyTaxtables Receiptdataset.

FinancialManagement 1298:Taxatthelinelevelon EN4 ContainerLandedCostTracker AllpanelsinContainerShipmentTrackerhavebeenremoved.


ReceiptLines Modifytobringinlinewith TheapplicationnowaccessestheContainerReceiptsand
10.1.600
ContainerReceiptsEntry/ ContainerShipmentEntrypanelsdirectly.
Container Landed Costs Entry
FinancialManagement 1298:Taxatthelinelevelon EN4 ContainerReceiptsChangeReceipt RemovedReceiptTyperadiobuttonandreplacedwithcombo
10.1.600 ReceiptLines Typefromradiobuttonto boxtomatchtheReceiptEntryscreen.
dropdownlist
FinancialManagement 309:EnhancedLegal EN2247 LegalNumberMaintenanceNew InLegalNumberMaintenanceUI,theDefaultSequencepanel
NumberingAcrossFinancial ConfigurationoptionsforLegal wasmovedfromthemaindetailsheettoitsownpanel.The
10.1.600
Tx's Numbergeneration newpanelisinanewfoldertabcalledDefaultSequence.

FinancialManagement 309:EnhancedLegal EN2247 BankAdjustmentEntryAddLegal AddedparameterstopublicmethodGetLegalNumGenOpts.The


NumberingAcrossFinancial NumberActionMenuoptionsand parametersarethekeysofBankTran:BankAcctID,TranNum,
10.1.600 Tx's newfunctionalityforGeneration/ Voided.TheseareusedtofindBankTranwhenthemethodis
Void calledandthedatasetisnotneeded.

FinancialManagement 309:EnhancedLegal EN2247 APInvoiceEntryAddnew RemovedpublicmethodPreUpdate.Itisobsolete.


NumberingAcrossFinancial functionalityforLegalNumber RemovedrunPreUpdateparameterfrommethodUpdateMaster.
10.1.600 Tx's Generation/Void RemovedpublicmethodGetLegalNumDefaults.itisobsolete.

FinancialManagement 545:APTaxatLineLevel EN447 HeaderChargesseparatetax NewTableAPInvHedMscTaxwasaddedasthepartofthe


recordsSystemCalculatedTaxes project/story.
10.1.600
SeparateHeaderChargesTaxes BecauseofthisthemethodAPInvoice.GetRowswasmodified

FinancialManagement 545:APTaxatLineLevel EN9 APInvoiceLineTaxUIChanges MovedcontrolsfromLineTaxpaneltonewpanel.


10.1.600
MovedLineTaxPaneltonewdockpanel.

Page140
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


FinancialManagement 545:APTaxatLineLevel EN9 HeaderChargesseparatetax ChangestoremoveallmethodsrelatedtoAPLnTaxcreationwith
records line=0(APIHAPLnTax)
fromthecodewhicharenotusedanymore.

Publicmethodsremoved:
ChangeTaxableHdrAmt
10.1.600 ChangeTaxHdrAmt
ChangeTaxHdrCode
ChangeTaxHdrDeduc ble
ChangeTaxHdrPercent
ChangeRateHdrCode
ChangeReportableHdrAmt
FinancialManagement 545:APTaxatLineLevel EN9 APInvoiceLineChargeTaxUI PublicmethodsignaturechangedforGetRowsbytheService
Changes DesignerduetothenewtableAPINvLnMscTaxthatwasadded.
10.1.600 MovedpreexistingLineMiscChargespaneltothenew
LineChargeDockpanel.

FinancialManagement 545:APTaxatLineLevel EN9 MoveTaxFieldstonewTaxTabin MovedcontrolsfromLocalizatonDetailPaneltonewTaxes


10.1.600
CompanyConfiguration panel.
FinancialManagement 545:APTaxatLineLevel EN9 APInvoiceTrackerAddDetailTax ChangedtheLineTaxtabtoincludetwonewtabsforDetailand
TabatLineLevel List.OriginalTaxpanelwasundockedandnew
10.1.600
LineTaxMainPanelwasdockedinitsplace.Orignaltaxpanelwas
moved under sheetLineTax1 panel.
FinancialManagement 545:APTaxatLineLevel EN9 APInvoiceTrackerAddDetailTax RemovedgridgrdHdrIncldTaxesfromHeaderMiscPanel.
TabatHeaderMiscChargeTax UndockedHeaderChargesPanel.
10.1.600 AddednewdockedpanelHeaderMiscChargeDockto
SheetHeader.RemovedoriginalMiscellaneousTabpanel.
Controlsweremoved.

FinancialManagement 545:APTaxatLineLevel EN9 APInvoiceTrackerAddDetailTax TheLinesheethadchangestotheMiscChargestab.Movedthe


TabatMiscChargeTaxLine originalMiscChargespanelundertheMiscChargestaband
10.1.600
dockedanotherpanelforMiscChargeTax.

FinancialManagement 545:APTaxatLineLevel EN9 APInvoiceandTrackerAddTotal Creatednewpanelandmovedcontrolsfrom


summaryinHeaderandLineCharge LineChargesListPaneltonewpanelLineChargeGridPanel.The
10.1.600
TaxDetail controlsthatmovedweregrdLineChargesandcmbType.

Page141
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


FinancialManagement 545:APTaxatLineLevel EN9 DiscrepancieswithLine/Tax/Listtab 2Newcombos(hidden)areaddedtotheTaxPaneltoserveas
betweenAPInvoiceEntryandAP valuelistsforthecorrespondinggridfieldstodisplaythe
10.1.600
InvoiceTracker descriptionofTaxCodeandRatecodeinsteadofIDs

FinancialManagement 545:TaxatthelinelevelonPO EN167 AddLineTaxessummary POAdapter.OnGetRows


10.1.600
Lines
FinancialManagement 545:TaxatthelinelevelonPO EN167 NewTaxestabonCompany TaxInterfacepanelmovedfromFinanceDockPaneltoNewtax
Lines Configuration Panel
10.1.600 TaxOp onsmovedfromGeneralLedgerpaneltonewtaxpanel
TaxOptionsmovedfromARtonewtaxpanel

FinancialManagement 545:TaxatthelinelevelonPO EN167 AddDetail/ListviewsforHeader ExpectSICrequiredforrenamingofexistingGridstolistvariants


10.1.600
Lines andLineMiscellaneouscharges
FinancialManagement 545:TaxatthelinelevelonPO EN167 AddDetail/ListviewsforHeader *MovedHeaderMiscellaneouschargestaxesListinto
Lines andLineMiscChargeTaxes (HeaderChargeTaxPanel>HeaderMiscChargeTaxGridPanel)
10.1.600 *MovedLineMiscchargestaxeslistinto
LineMiscChargeTaxGridPanel(LineChargeTaxPanel>
LineMiscChargeTaxGridPanel)

Page142
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


FinancialManagement 545:TaxatthelinelevelonPO EN167 POEntrychangesformisccharge *ReplacedPOMiscTaxtablewithPODetailMiscTax.
Lines taxcalculations *ReplacedPOHeadMiscTaxtablewithPOHeaderMiscTax.
*ReplacedGetNewPOMiscTax()withGetNewPODetailMiscTax()
becausewenowusetablePODetailMiscTaxinsteadofPOMisc.
*ReplacedGetNewPOHeadMiscTax()with
GetNewPOHeaderMiscTax()becausewenowusetable
POHeaderMiscTaxinsteadofPOHeadMisc.
*AddtableNameparametertoChangedTaxManual()toindicate
whichtable(PODetailMiscTax,POHeaderMiscTax,PORelTax)the
flaghasbeenchangedfor.
10.1.600
*ThefollowingexternalfieldsweredeletedfromPODetailas
theycontainedthesamevaluesasexis ngDBfields:
**CalcDocInTaxAmt(useTotalTaxinstead)
**CalcInTaxAmt(useTotalTaxinstead)
**Rpt1CalcInTaxAmt(useRpt1TotalTaxinstead)
**Rpt2CalcInTaxAmt(useRpt2TotalTaxinstead)
**Rpt3CalcInTaxAmt(useRpt3TotalTaxinstead)

FinancialManagement 545:TaxatthelinelevelonPO EN167 AddInclusiveTaxesepishapeon RemovalofReleaseLineTaxDetailInclusiveepishape


10.1.600
Lines LineandReleaseTaxes
FinancialManagement 973:TaxandTaxInclusive EN6 AddanewtaxestabonQuote AddedQuoteHeaderTaxfunctionality
10.1.600
pricingonQuotes Header
FinancialManagement 973:TaxandTaxInclusive EN6 UIChangesonOpportunityQuote UnderheaderTab,renamed"MiscChrgs"tabtoMiscCharges.
pricingonQuotes Entryscreentomeetmaxsize Underline>Detailstab,renamed"MiscChrgs"labeltoMisc
standard Charges.
10.1.600 AddedLOSTEpiShapeinHeadertabaspartofEN329.
Changestoseveralscreenstoremovethehorizontal/vertical
bars(meetmaxsizestandard).

FinancialManagement 973:TaxandTaxInclusive EN6 ChangesonQuoteTrackertomatch QuoteTrackersharescodewithQuoteEntrytoensureQuote


10.1.600
pricingonQuotes newQuoteEntrylayout TrackerstaysinsyncwithchangestoQuoteEntry.

Page143
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


FinancialManagement 973:TaxandTaxInclusive EN6 RedesignQuoteSummarypanel RedesignQuoteSummary
pricingonQuotes Addednewfields:Tax(newcreated)andReadytoProcess
(alreadyexisted).
Movedfieldstootherplaceinthescreen.
Changedlogic:QuoteHed.ConfidencePct,QuoteHed.BestCsPct,
QuoteHed.WorstCsPctshouldstartinzerowhennewlineand
shouldnottakeanyvaluewhenanewlineadded.Ifnewlineis
addedandthosefieldshaveavalueenterbycustomer,then
newlineshoulddefaultthatvalue.
Addednewcalculatedfields:
WorseCsPctCalc
BestCsPctCalc
ExpectedCsPct
10.1.600 DiscountPercentCalc
TotalQuote
DocTotalQuote
Rpt1TotalQuote
Rpt2TotalQuote
Rpt3TotalQuote

Addednewphysicalfields:
Tax
DocTax
Rpt1Tax
Rpt2Tax
Rpt3Tax

Page144
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


FinancialManagement 973:TaxandTaxInclusive EN6 RedesignQuoteHeaderDetailpanel RedesignQuoteHeaderscreen.
pricingonQuotes
Meetthemaxscreensizestandardof1024x734.
Quotemovedtothetopofthescreen.
SoldToandShiptogroupsareatthesamelevel.
ReadytoProcessnewcheckboxfield,editable.
PO,NeedBy,ShipBy,Disc%,ShipVia,etc,belongstothesame
sec on.
10.1.600 Quoted,Due,Expires,FollowUp,ExpectedClosedatesbelongs
tothesamesec on.
PrimarySalesperson,CurrentStage,TaskSetbelongstothe
samesec on.
WebReady,CaseNumber,ParentQuote,Rating,Reference
belongstothesamesec on.
Campaign,Description,Event,Responsebelongstothesame
sec on.
ConclusionandReasonfieldsweremovedtoitsownnewtab.
FinancialManagement 973:TaxandTaxInclusive EN6 AddnewManufacturingRevision MovedMFGDetailsandCoparttabsunderthenewtab
pricingonQuotes tabunderLines "Manufacturing"andmovedDrawing,PLM,LeadTime,Co
10.1.600 PartsandConcurrency"fieldsfromLinetoitsowntab"revision"

FinancialManagement 973:TaxandTaxInclusive EN6 ChangesonSalesOrderEntry AddedTrueDiscountPercent


pricingonQuotes screentostandardizewithQuoteUI Expandedallsec onsuptotherightborderofthescreen.
changes Movedquantityfieldstotherightsothereismorespace
betweenthepartfields.
MovedDiscountPercent/Amounttoasingleline.
10.1.600 MovedPriceGroupbelowDiscPriceList.
Alignedthecheckboxestotherightsideofthescreen.
MovedSalesCat,Grouptotherightsotheyhavemorespaceso
thelabelscanberenamedto"SalesCategory"and"Product
Group".
MovedTaxCategorybelowProductGroup.

Page145
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


FinancialManagement 973:TaxandTaxInclusive EN6 RedesignQuoteLineDetailpanel
pricingonQuotes TaxInclusivePricingEpiShapewasadded,butwillnotbe
displayedun llogicisadded.
Addedtoscreen:TaxExemptandTaxLiabilitynewfields.
TaxExemptandTaxLiabilityareenableandeditedtotheuser.
RemovedHorizontal/verticalbarsfromMiscCharges,Worksheet
panels.
AddedNewphysicalfieldcalledQuoteDtl.TaxRegionCode,
(modifieddescrip on,labels,a ributes).
AddedNewphysicalfieldcalledQuoteDtl.Tax(DocTax,Rpt1Tax,
Rpt2Tax,Rpt3Tax),ReadOnly,

NewCalculatedExternalfield/ReadOnly
TotalQuote
10.1.600 DocTotalQuote
Rpt1TotalQuote
Rpt2TotalQuote
Rpt3TotalQuote

TotalQuotewhichincludesthetotalsumofpotential,misc
chargesandtaxas.
TotalQuote=Poten al+MiscCharges+Tax

MovedQtyfieldsandpercentagetogetherandalsosummaries
inthesameGroup.
ProductGroup,SalesCategory,AnalysisCodeandTaxasinthe
sameGroup.

FinancialManagement 973:TaxandTaxInclusive EN6 UpdatestoQuotethataffecttaxes AnewtablewasaddedtoQuotedataset:QuoteDtlTaxtable.


pricingonQuotes calculations(Exclusive) GetRows()wasmodifiedintheQuoteadaptertoaddthisnew
10.1.600
table.

Page146
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


FinancialManagement 973:TaxandTaxInclusive EN6 QuoteRecalculatetaxeswhen TokeepthesameTaxliabilityvalidationsatheaderandline
pricingonQuotes changetaxliabilityatheader level,
ThemethodChangeTaxRegionCodewasmodifiedaddingthe
parameter"FromTable"thatallowsustodoindividual
10.1.600 validationsifneededandtheparameter
"promptTaxRegionCodeMsg"thatonthecaseoftheheaderwill
tellthesystemtoprompttheuserforarequestonwhetherthe
taxliabilityshouldbepassedtoallthedetails.

FinancialManagement 973:TaxandTaxInclusive EN6 Disabletheabilitytodelete RemovedcontrolsEshManualTaxUpdate(EpiShape)and


pricingonQuotes inclusivetaxesonQuotesuntilSale ManualTaxUpdate(checkbox)from
Ordersupportstheabilitytodelete Client/UIApps/QuoteEntry/Panels/LineTaxesPanel.These
10.1.600 inclusivetaxes.HidetheSystem shouldnotbevisibleuntilTaxInclusivePriceisfully
TaxUpdateepishapeandthe implementedinQuoteEntryandSalesOrderEntry.
NoTaxRecalcflagontheQuoteLine
DetailTaxdetailpanel.

FinancialManagement APInvoiceEntry EN1547 APInvoiceEntryCorrectionInvoice ChangedsignatureofAPInvoiceBOPublicmethod


10.1.600 CannotbeCreated(ErrorTable "CreateCorrectionInvoice".Specifically,changedthetypeofthe
display) datasetparametertobenonref.
FinancialManagement EAARInvoiceForm 195797 ARInvoiceFormPackNumand ModifiedlookuplinkforeigntablefromMscShpDt/MscShpHdto
Packlineneverretrievethe ShipDtl/ShipHead,removedmappedfieldNameasitisinvalid.
10.1.600 infromationfromtheshipment ServiceDesignerdeletedpublicpropertyandmethodrelatedto
thisfield.

FinancialManagement EABook 196937 ConfiguringGLBookforposting GLBookdatasetwasmodified:


rulesconversion Addednewtables:
COASegmentNameListtoretrievesegmentsofrelatedCOA
GLBookPackageSegmentMaptostoresetupofmapped
10.1.600 segment.
GLBookAdapter.csOnGetRowschangedquantityof
whereClausestocallservermethodfromtwoaddedtables.

Page147
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


FinancialManagement EACashReceiptEntry 189519 CashReceiptEntryAttachments Addingtheabilitytoaddattachmentstoatableaddsanew
optionisnotavailblewhenaddinga tabletothedataset.Thisinturnaddsanewparametertothe
10.1.600 DebitNote GetRowsmethod.MethodCashRecBO.GetRowswillhavean
additionalwhereClauseparameterasaresultofthischange.

FinancialManagement EAGeneral 190488 TaxboxesbyEffectiveRate(Epic NewtableTaxBoxEffRatewasaddedtoBO.SalesTax.


1257) NewParameterwasaddedto
10.1.600
Erp.Contracts.BO.SalesTax.Erp.Tablesets.SalesTaxTableset
GetRows
FinancialManagement EAGeneralLedgerAccount 176929 GeneralLedgerAccountTab MassAddpanelsandformweremovedfromCOAEntryto
10.1.600 sequenceiswrongonGenerate GLAccountEntry.
Accountswindow.
FinancialManagement EAGeneralLedgerAccount 176940 GeneralLedgerAccountTab MassDelpanelsandformweremovedfromCOAEntryto
10.1.600 sequenceiswrongonDelete GLAccountEntry.
Accountswindow.
FinancialManagement EAInvoiceEntryAP 185857 InvoiceEntryAPOnlypartially Server/Services/BO/APinvoice/APinvoice.cs:Methodsignature
invoicedreceiptsareavailablefor formethodGetNotInvRecSourceSearch()waschanged
selectioninMassGRNIClearing from:
publicErp.Tablesets.APInvGetNotInvRecSourceTableset
GetNotInvRecSourceSearch(stringipSuppList,System.DateTime
invoiceDate)

to
publicErp.Tablesets.APInvGetNotInvRecSourceTableset
GetNotInvRecSourceSearch(stringipSuppList,System.DateTime
10.1.600 invoiceDate,outboolalternateMessage)

Server/Services/BO/APinvoice/APinvoice.cs:Method
ValidateNotPostedInvoices()wasadded.
publicboolValidateNotPostedInvoices(stringipVendorList)

Server/Services/BO/APinvoice/APinvoice.cs:Method
ValidateNotPostedInvoices()wasadded.
publicboolValidateNotPostedInvoices(stringipVendorList)

Page148
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


FinancialManagement EAInvoiceEntryAP 188753 InvoiceEntryAPBlankerror AddnewparametertotheAPInvoice.CreateCorrectionInvoice
messageappearswhenassigninga method
10.1.600 legalnumbertocorrectioninvoice. (refAPInvoiceTablesetds)passingthetablesetwillgiveaccessto
thevaluesenteredforlegannumberswhengenerationtypeis
manual and the defaults if automatic
FinancialManagement EAInvoiceEntryAP 197218 InvoiceEntryAPUnabletoseeand GetAPUninvoicedReceiptLinesanewparameterhasbeenadded.
selectlinesfromaReceiptthathave ThisparameterreceivesthePONum.IfPONumis0allreceipt
10.1.600
differentPOnumbers. lineswillappearelseonlythePONumsearchedreleatedlines
will appear.
FinancialManagement EAInvoiceEntryAR 187915 InvoiceEntryARLegalNumber requiresUserInputbooleanparameterhasbeenaddedto
warningmissingifitisnot PrePostInvoices()
10.1.600 generatedbeforeposting Itwillbetruejustwhenhaving1invoicemissingmanuallegal
numbergeneration.whenhavingmorethanoneamessagewill
be displayed.
FinancialManagement EAInvoiceEntryAR 194737 InvoiceEntryAREmptyInvoice Thefollowingmethodshavebeenremoved:
Groupsleftaftertheassociated StageShipConfirm.InvoiceShipmentProcess
invoicehasbeenpostedwithAuto StageShipConfirm.InvoiceShipmentProcessMasterPack
10.1.600 Invoice.
MethodShipConfirmwillnowexecutethelogicinthe2previous
methodsafterconfirmingtheshipmentinformation.Anew
parameterhasbeenaddedtothismethod.

Page149
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


FinancialManagement EALocalization 187138 CSFChinaCNBookingVoucher 1.UIChanges:
Revision.BookingVoucher[FS]CN Followingcontrolsareremoved:
UIReports/CNBookVoucherFCReport>DetailPanel
lblFiveLines(aa7ec0bfd72e4172a0a4d522409b7b83)
chkFiveLines(9132af370d39466caa0ea9fd03309df3)
UIReports/CNBookVoucherReport>DetailPanel
lblFiveLines(aa7ec0bfd72e4172a0a4d522409b7b83)
chkFiveLines(9132af370d39466caa0ea9fd03309df3)

10.1.600 2.Datasetschanges:
ExternalfieldsareremovedfromReportParametersDatasets:
CNBookVoucherFCReport>CNBookVoucherFCReportParam
>FiveLines
CNBookVoucherReport>CNBookVoucherReportParam
>FiveLines

FinancialManagement EALocalization 187251 CSFMexicoARElectronicInvoice OnformPayMethodForm,PaymentMethodEntryEpiTextBox


changesperSATcatalog(10.1.600) controltxtMXSATCode(key05efe349b1ef48d78529
10.1.600 c43c435d3985)willbereplacedwithEpiCombocontrol
cboSATCode(keyfc4cf9dad4c24d79bb37fa621d43229c)

Page150
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


FinancialManagement EALocalization 188580 CSFColombiaGLAuxiliaryReport RedesignedGLAuxiliaryReport.AddedgrouponlybyAccount.
Enhancements(EPIC364) Addedreportparametersprinting

AddedreportparametersforCOGLAuxBO
GroupAndSumBy
PrintSelCriteria

Addedcontrolson
$/ERP/Current/Source/Client/UIReports/COGLAuxRep/Panels/D
etailPanel.cs
cmbGroupBy
10.1.600 chkPrintSelCriteria

AddedcalculatedfieldsforCOGLAuxRepRDD
vJrnlCode
vOneTimeDesc

Redesignedreport
$/ERP/Current/Deployment/SSRS/reports/CO/COGLAuxRep/CO
GLAuxRep.rdl

EpiGUIDsaddedforpanels
on$/ERP/Current/Source/Client/UIReports/COGLAuxRep/Panels
FinancialManagement EALocalization 190492 CSFPoland:JPK_VATXMLReport Newtab'Link'wasaddedforcolumnoftype'Table'forfiltering;
VATforPurchaseandSales(Epic files,gerenatedinXMLtype,cancontainfilteredrecordsfrom
10.1.600
1221)ExportTooldev/changes tables,declaredas'Suppressoutput';
Phase 1
FinancialManagement EALocalization 190603 CSFPoland:JPK_VATXMLReport GetRowsfunctionwasexpandedwith3newparameters,used
VATforPurchaseandSales(Epic topassseletioncriteriafornewtables
10.1.600 1221)ExportTooldev/changes DataExportTableAttribute,DataExportColumnAttribute,
Phase2 DataExportColumnLink;
tableColumns1 tab was moved one level down;

Page151
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


FinancialManagement EALocalization 191740 CSFPeruSUNATARInvoiceReport AddednewcalculatedfieldsforInvcHeadtable
(EPIC1020,Development) PEBTNamecharacter
CurrDesccharacter
PEBTAddresscharacter
PECompanyAddressListcharacter
IsBaseCurrlogical
PETaxOperdecimal
PENonTaxOperdecimal
PEExSalesdecimal
10.1.600 PEIGVdecimal
PEISCdecimal
PEOtherTaxesdecimal
PEOtherChargesdecimal
PEDiscountsdecimal
PETotalAmtdecimal
PETotalAmtTxtcharacter
PEIden tyDocTypecharacter
PEIden tyDocTypeDesccharacter
PEDocumentIDcharacter
FinancialManagement EALocalization 193182 CSFIndia:StoringTaxPayer CSFUnitedStates
informationatcompanylevel Localizationtab"1099Reporting"wasmovedfromModules
>FinancetoModules>AllModules>Taxes.

Thesheet'sparentchanged
10.1.600 from
financeDockPanel1(guid"eae56b9f12714cc2a33c
1935fc4e04e4")
to
taxDockPanel1(guid"9719915fc2de438db8c1
FinancialManagement EALocalization 193770 CSFMalaysiaLMWextensions b73b58026150" )
LocalizationformCompanyConfiguration.
10.1.600 CompanyConfigurationchanges Controls"txtLMWlcn"and"lblLMWLcn"weremovedtonew
GroupBox"LMWPurchase":

Page152
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


FinancialManagement EALocalization 193771 CSFMalaysiaLMWextensions RemovedoldversionofLMWRawMaterialreport:
LMWPurchaseReportchanges RDD:removedreport'LMWRawMaterial'
SD:removedtemptable'TransSumRawMtl'
DeletedMenuItemSRRP0003'LMWRawMaterialMovement
Report'
DeleteSecurityIDSEC3413

FollowingsourcecodeswereremovedfromTFS:
10.1.600 $/ERP/Current/Deployment/Server/Erp/Rpt/LMWRawMaterial.s
vc
$/ERP/Current/Source/Client/UIReports/LMWRawMaterial/*
$/ERP/Current/Source/Server/Internal/IM/LMWRawMaterial/*
$/ERP/Current/Source/Server/Services/Rpt/LMWRawMaterial/*
$/ERP/Current/Source/Shared/Contracts/Rpt/LMWRawMaterial
/*

FinancialManagement EALocalization 194204 CSFMalaysiaLMWextensionsUI 'CommissionerofOath'sNumber:'txtLMWwithUID58b25d9f


changes(Part,Lot,Receipt, 640f45a7be41b0df5c212a3fwasremovedfromMalaysia's
10.1.600
QuantityAdjustment) localizationformofLotNumberEntryFrom

FinancialManagement EALocalization 194555 CSFThailandMonthlyVATreport FollowingUIcontrolsareremovedfrom


includePaymentTimetax UIReports/THLocMonthlyVATReport>DetailPanel:
10.1.600
lblTaxCode(cbed3ee711fa4d9498ab2d9083f3ddef)
cboTaxCode (fd8849eae6924ac68d69d8711f8084b3)

Page153
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


FinancialManagement EALocalization 194711 CSFJapanAPShimePayment In10.1.500.11vobjectsErp.Contracts.BO.JPAPPerBill.dll,
CyclePreliminarysteps Erp.Contracts.BO.JPAPPerBillStmt.dllarebasedonErp.Local001
Erp.Local010tables.Fieldsfromthesetablesneedforauxiliary
useandusers/customersmustavoidtousethem.

Belowthefieldslistmappedonlocalfields:

Table:Erp.JPAPPerBillHead>Erp.Local010
VendorNum>IntKey1
DueDateCriteria>ShortChar01
DynCalID1>ShortChar02
DynCalID2>ShortChar03
PerBillStatus>CheckBox01

Table:Erp.JPAPPerBillDtl>Erp.Local010
10.1.600 VendorNum>IntKey1
SummarizationDay>IntKey2
TermsCode>ShortChar01
EndOfMonth>CheckBox01

Table:Erp.JPAPPerBillStmtGrp>Erp.Local001
PerBillStmtGrpID>Key1
BillingDate>Date01
SummarizationDate>Date02

Table:Erp.JPAPPerBillStmtHead>Erp.Local010
PerBillStmtGrpID>Key1
VendorNum>IntKey1
BillingDate>Date01
SummarizationDate>Date02
FinancialManagement EALocalization ll b h h
195278 CSFJapanRemovefilterbyTaxfor SalesTaxPanel(listoftaxcodestofilterout)removed
BillingStatementreport DetailPanel:
10.1.600
EpiLabellblTaxesremoved
EpiTextBox txtTaxes removed

Page154
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


FinancialManagement EALocalization 195344 CSFIndia:ChangesinPOForm Addedcalculatedfieldls

addedcalculatedfieldINAddressListforCompanytable
10.1.600 addedcalculatedfieldsforPOHeadertable
INBillToAddrList
INShipToAddrList
INTotalWords
FinancialManagement EALocalization 195345 CSFIndia:ChangesonSalesOrder AddedcalculatedfieldTranDocTypeDescforOrderHedtablein
10.1.600
Acknowledgementform OrderAckRDD
FinancialManagement EALocalization 195844 CSFMalaysiaLMWextensions RemoveoldversionofLMWFinishedGoodsReport
LMWManufacturedReport.Add
amountstoOpenandClose RemovefromGoldenDB:
Value(RM). LMWFinishedGoodwasremovedfromReportStyleandReport
DataDefinition
MenuitemSRRP0002andSecurityIDSEC3412

FollowingitemswereremovedfromTFS:
$/ERP/Current/Deployment/Server/Erp/Rpt/LMWFinishedGoods
10.1.600 .svc
$/ERP/Current/Source/Client/UIReports/LMWFinishedGoods/*
$/ERP/Current/Source/Server/Internal/IM/LMWFinishedGoods/
*
$/ERP/Current/Source/Server/Services/Rpt/LMWFinishedGoods
/*
$/ERP/Current/Source/Shared/Contracts/Rpt/LMWFinishedGoo
ds/*
$/ERP/Current/Source/Test/Services/Rpt/Test.Rpt.LMWFinished
Goods/*
FinancialManagement EALocalization 195847 CSFIndia:RemoveChapterIDand IndiaCSFlocalizationformforPartMaintenanceUIwasdeleted.
linkedvalidationfromPart ChapterIDUIwithcorrespondingadapter,serviceandcontract
10.1.600 wasdeleted.
AllappropriatezDatawasremovedfromGoldenDB.

Page155
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


FinancialManagement EALocalization 196034 CSFEUChargebearerisincorrectly FlagindicatingifthedefinedcountrybelongsisusingSEPA.
SLEVinsteadofDEBTforEuro
10.1.600 paymentsoutsideEU. ThissettingindicatesifthedefinedcountryisincludedinSEPA,
whichisacommonpaymentareainEuropewithbank
transactionnormallydoneinEurocurrency.

FinancialManagement EALocalization 196041 CSFIndia:Removethesetupforapp CenvatDeterminationUIwithcorrespondingadapter,service


CenvatDeterminationMaintenance andcontractweredeleted.
10.1.600
fromInventoryMan./Setup AllappropriatezDatawasremovedfromGoldenDB.

FinancialManagement EALocalization 196970 CSFIndia:Printingnumbersin Addedcalculatedfield'INTotalWords'forDBRDD:


10.1.600 wordsinvariousdocuments OrderAckinOrderHedtable
APDebitMemoForminAPInvHedtable
FinancialManagement EALocalization 197655 CSFIndia:ARInvoiceLayout.Stage IncludedOrderNumcolumnforInvcHeadreporttable
2 Excludedalllabels(154rows)forCustomerBillToreporttable
(exceededthelabelscourtnumber)
USE[ERP10Golden]
updateIce.RptExclude
setexcludelabel=1
whererptdefid='arform'andexcludelabel=0andzdatatableid
='CustomerBillTo'

Addedcalculatedfield'INAddressList'(Characterx(500))for
Companyreporttable
AddedcalculatedfieldsforInvcHeadreporttable
10.1.600 INIsExportlogicalyes/no
INIsIGSTlogicalyes/no
INBillToAddrListCharacterx(500)
INShipToAddrListCharacterx(500)
INTotalWordsCharacterx(500)
INSATaxTotalDecimal>>>,>>9.99999
AddedcalculatedfieldsforInvcDtlreporttable
INCGSTRateDecimal>>>,>>9.99999
INCGSTAmtDecimal>>>,>>9.99999
INSGSTRateDecimal>>>,>>9.99999
INSGSTAmtDecimal>>>,>>9.99999
INIGSTRateDecimal>>>,>>9.99999
INIGSTAmtDecimal >>> >>9 99999

Page156
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


FinancialManagement EALocalization 198367 CSFIndia:ARInvoiceLayout.Stage AddedcalculatedfieldsforInvcHeadreporttable
3.QA&Stabilization INCGSTAmtTotalDecimal>>>,>>9.99999
INSGSTAmtTotalDecimal>>>,>>9.99999
10.1.600 INIGSTAmtTotalDecimal>>>,>>9.99999
INDocAllocAmtDecimal>>>,>>9.99999
INDocAllocTaxAmtDecimal>>>,>>9.99999
AddedcalculatedfieldsforInvcDtlreporttable
INTaxLineTotalDecimal >>> >>9 99999
FinancialManagement EALoggedInvoiceEntry 195534 LoggedinvoiceEntryIncorrect publicmethodsetBankNamehasbeenremovedasitisnolonger
Bank/RemitTochosenwhenhaving use.
10.1.600
thesameBank/RemittoIDin
several Suppliers
FinancialManagement EAOpenInvoiceLoadAR 187878 OpenInvoiceLoadARDocInvoice removedsecondparameterfrompublicmethod
Balanceisbeingrecalculatedwhen AnotherInvoice().
10.1.600
aforeigncurrencyisselected.

FinancialManagement EAPaymentInstrumentUpdate 185391 PaymentInstrumentUpdate Addedoneboolparametertomethods


PaymentInstrumentUpdatecan CheckPNotesExistTrackerandGetARPNListTrackertoidentify
10.1.600
retrieveandupdaterecordsof fromwheretheyarecalled.
incorrect types.
FinancialManagement EAPELogViewer 126410 PELogViewerCosmeticUIissues ThenextUIcontrolswereremoved:
Panels/DetailPanel.cscboValid7580cbe34c254ae09848
93805c732e18
Panels/DetailPanel.cslblInvalid7184848e96784a999af9
32940544bbda
Panels/SettingPanel.csgrpExpImp5bc9a59a59bb4572865c
b8aaa1709c24
10.1.600
Panels/SettingPanel.cstxtImportf2aa53805de54a98964d
262df5944e4e
Panels/SettingPanel.cstxtExport2e8430e2ed794eecbe1e
b5df055b26ef
Panels/SettingPanel.csbtnImport3280e40040ca494e9443
b969964d23ef
Panels/SettingPanel.csbtnExportb42b9247437d49ea87ff

Page157
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


FinancialManagement EAPostingEngine 191559 PostingEngineErroronReview PrimarykeyforTranGLCDtltablewaschanged.Itresultedin
JournalConfirmationfor signatureschangesfornextmethods:GetNewTranGLCDtl,
AutocorrectedRedStornoBank DeleteByID,GetByID.
Adjustment Oldsignatures:
GetNewTranGLCDtl(refErp.Tablesets.TranGLCDSTablesetds,
stringrelatedToFile,stringkey1,stringkey2,stringkey3,string
key4,stringkey5,stringkey6)
DeleteByID(stringrelatedToFile,stringkey1,stringkey2,string
10.1.600 key3,stringkey4,stringkey5,stringkey6,inttgLCTranNum)
GetByID(stringrelatedToFile,stringkey1,stringkey2,string
key3,stringkey4,stringkey5,stringkey6,inttgLCTranNum)

Newsignatures:
GetNewTranGLCDtl()
DeleteByID(GuidSysRowID)
GetByID(GuidSysRowID)

SupplyChainManagemen EAReceiptEntry 193970 ReceiptEntryStringorbinarydata ModifiedErp.MtlQueue.Referencefromnvarchar(60)to


10.1.600 errorwithSupplierName+Packing nvarchar(80)
Slip>=60characters
FinancialManagement EAReverseCashReceipt 187209 ReverseCashReceiptNonuser MethodCashRec.SetReadyToCalcdeletedsinceitisnotcalledby
10.1.600 friendlyerrormessageisshown anyprogram
afterReverseCashisdone.
FinancialManagement EATrialBalance 177222 Tech:TrialBalancereportRename RenamedmethodsignatureinGLTrialBalanceservice
publicmethod From:publicvoidOnChangeFiscalYear500(ref
OnChangeFiscalYear500 GLTrialBalanceTablesetds,intipFiscalYear)
To:publicvoidOnChangeFiscalYear(refGLTrialBalanceTableset
ds,intipFiscalYear)

10.1.600 RenamedmethodsignatureinGLTrialBalanceservice
From:publicvoidOnChangeFiscalYear(refGLTrialBalanceTableset
ds,intipFiscalYear,stringipFiscalYearSuffix)
To:publicvoidOnChangeFiscalYearSuffix(ref
GLTrialBalanceTablesetds,intipFiscalYear,string
ipFiscalYearSuffix)

Page158
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


FinancialManagement FinanceEnhancements EN233 PaymentEntrySelectionInvoices inBO/PaymentEntry/PaymentEntry,csmodifiedparameterto
publicmethodSelectInvoices.
10.1.600

Added DateTime? pdtDiscountHorizon


FinancialManagement 1265:MICRCheckMoveCSG's EN1924 PaymentEntryRemittanceAdvice Addedanewparameterformcalledoftypestringtothe
MicrCheckextentionintocore ReportdefaultsMICRCheckReport GetNewProcessPaymentmethod.
10.1.600
StylewhenusingMICRCheck
Payment Method
ProductionManagement EAEngineeringWorkbench 186559 EngineeringWorkbenchAlt Publicmethodsignaturechange.
Descriptiondoesnotdisplayafter
10.1.600
altmethodiscreated. AchangeinECORevconstructorisneededinordertoinclude
new field: AltMethodDescription.
ProductionManagement EAHHJobReceipttoJob 190679 HHJobReceipttoJobFocusisset Removedanunnecessarygroupboxcontrolfromhandheld
incorrectlyafterenteringjob paneltofreeupsomespaceandcleanthingsupabit.
10.1.600
numberalsogeneralUIlayout
issues
ProductionManagement EAHH 196332 HHPackageControlRepack Thisfixrequiresapublicmethodsignaturechange,2newpublic
PackageControlRepackReclassB ReclassByPCIDactionsareusing methodsandanewexternalcolumn.
yPCID thedefaultprinterwhenthereare TheGenerateNewPCIDQtyRemaining()methodneedsand
multipleprintersassigned. additionalparameter,needtoaddstringprinterIDparamaterin
ordertoprintPCIDlabeltouserselectedprinter.
10.1.600 Needtoaddpublicmethods:
publicstringLoadDefaultPrinter()
publicvoidValidatePrinter(stringprinterID)
NeedtoaddexternalcolumnPrinterIDto
PkgControlRepackReclassPCIDtablein
PkgControlRepackReclassPCIDservice.
ProductionManagement EAJobEntry 188440 JobEntryTheMaterialBurden AnewparameterneedtobeaddedtoGetDetailsmethodin
10.1.600 costschangesonGetDetailsandby QuoteAsmBOinordertohonorGetCostsFromTemplate
updatingtheQty/Parent. checkbox.
ProductionManagement EAJobEntry 197956 JobEntryGetDetailsprocess NextOprInspPlanSeqmethodwasdeletedfrom
throwsanerrorwhenanoperation CPMethodPhantomproject.Themethodisnolongerneeded.
10.1.600
hasmorethanoneinspectionplan PlanSeqnowissetdirectlyfromoldrow.

ProductionManagement EAJobPickList 186997 JobPickListreportnotprinted ChangedParameterinJobPickListReportServiceDesigner.


usingEWA. JobPickListParam,JoblistchangedtoJobList,with'L'uppercase.
10.1.600

Page159
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


ProductionManagement EAPackageControlAdhocPCID 187514 500PackageControlIDAdhoc ChangedthecombotypefromWarehouseControlto
PCIDDropdownshoulddisplayall PartPlantWhseSearchCombo
10.1.600 warehousesbuilttothePart,
regardlessofwarehousetypes.

ProductionManagement EA 196210 PackageControlMaintenancePCIDThesearchneedsadditionalparameters,addedintpageSizeand


10.1.600 PackageControlMaintenance Searchscreennotabidingbymax outboolmorePagesparamaterstoGetHeaderList()and
rowstoretrieve GetListCustom()methods.
ProductionManagement EAPart 106858 PartRemove TheActions/Revisions/ChangemenuitemonPartMainwas
Actions/Revisions/Changemenu removedasitisobsolete
item Removed:
10.1.600 'PartRevChange'form
'RenamePartRevision'method(fromadapter,bo,transaction
andcontract)
resourcesstringsPartRevChange,RenamePartRevisionand
PartRevChangeStatusBarMessage
ProductionManagement EAPart 146182 CoPartReplaceLocaltablesused Added"PrimaryCost"booleanfieldtoPartCoParttableto
forCoPartwithDBfields IndicateiftheparentPartshouldbeusedastheprimarycosting
methodforthecopartandaddedSubLevelCodeintfieldtoPart
table.
EXTERNALFIELDSREMOVED:
CoPartCountwasremovedduewasonlyusedtovalidateif
PartwasbeingusedasCoPart.Nowthelogicisdoneonthefly.
PrimCostPart,PrimCostRev,PrimCostAltMethodexternal
10.1.600
fieldswereremoved.Notneededanymore.UsePartCoParts's
PrimaryCostinstead

DBFIELDSADDED:
Added"PrimaryCost"booleanfiealdtoPartCoParttableto
IndicateiftheparentPartshouldbeusedastheprimarycosting
methodforthecopart
AddedSubLevelCodeintfieldtoParttable
ProductionManagement EATimeSheetEntry 185826 ECERP/HCMintegrationAddPay ThedifferencebetweentheEpiGuidinthecontrols
HourstoHoursSummarysection lblHCMTotalPayHoursandnbrHCMTotalPayHourswasbecausea
10.1.600
andaddthePayHourstoWeekly newcontrolwasaddedfor10.1.600differencethatthecontrol
Time. added for 10.1.500.

Page160
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


ProductionManagement EATimeSheetEntry 197632 HCM/ERPTimeSheetEntry ThemethodHCMGetLaborDtlwasrenamedas
UpdateLabormethodtopush HCMGetLaborRecords.ThismethodwillgettheLabor
LabordatatoHCM informationaccordingfromtheLaborHedorLaborDtlaccording
10.1.600 withthecurrentconfigurationoftheemployee
ThemethodHCMSetLaborDtlwasrenamedas
HCMSetLaborStatus.Thismethodwillupdatethestatus,onlyif
thestatusis'S'andtheLaborSource'HDR',thenthe
TransferredToPayroll will be set true
SalesManagement 1253:Manufacturing EN268 CRMCallEntryWanttobeableto Newcheckboxincompany
10.1.600 Enhancements deleteCRMCallLogs. configura on/Modules/Sales/CRM/Detail
"AllowDeleteCRMCalls"
SalesManagement EAConfiguratorDesigner 182025 ConfiguratorDesigner Theclientcodegeneratorhaschanged.Allconfiguratorsmust
GetSmartStringfunctionisnot beregenerated.ConversionprogramPCUpdateVersion2must
workingwiththeprefacewithpart runat10.1.600.
option.
Achangehasbeenmadetotheclientconfiguratorcode
10.1.600 generator.Thischangerequirestheconfiguratorstobe
regenerated.Aprogramwasruntoupdatetheconfiguratorsto
makethemRegenerateautomaticallythenexttimetheyare
used.Existingconfiguredrecordssavedconfigurationvalueswill
needtoberesavedoryouwillneedtoruntheVerifyExisting
Configurationsprocesstobeabletogetdetailsforthem.
SalesManagement EAConfiguratorDesigner 193314 ConfiguratorDesignerImplement Thisisanewdevelopmentprojectthatwillnotbemovedtoan
mappingsupportforthe2Dcontrol updaterelease.Newtablesarebeingaddedtosupportthe
10.1.600
QBuildcontrol,consequentlyGetRowswillbechanging.

SalesManagement EAConfiguratorDesigner 193317 EN591ConfiguratorDesigner Updatedmethodsignaturesfornewdevelopmenttosupport


modifythecodegeneratortomake the2DViewerintegration.
10.1.600
the2Dimagesavailabletoarun
time session
SalesManagement EAConfiguratorDesigner 193318 ConfiguratorDesignerImplement GetRowshaschangedduetonewtablesbeingaddedtosupport
theabilitytodynamicallychange theQBuildcontrol.
10.1.600
imagewhenmappedinputschange

SalesManagement EAConfiguratorDynamicLists 189546 ConfiguratorDynamicLists Theconfiguratorcodegeneratorhasbeenmodifiedforthisscr.


DynamicListconditionsnottested Thereforeallgeneratedconfiguratorassembliesmustbere
10.1.600
correctlyusing"Old"valueinstead compiled.
of "NEW"

Page161
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


SalesManagement EAConfiguratorFieldProperties 185753 ConfiguratorFieldProperties ThePcUpdateVersionRunLevelwillbesetto10.1.600.0
Unabletogetfieldpropertiesfrom
DateTimeInputandunabletosetThischangerequirestheconfigurationcodetoregenerate
10.1.600 nulltoMaximumDateand beforeusesoaconversionwasranthatwillforcethiscodeto
MinimumDate regenerateuponinitialuse.Existingconfiguredrecordssaved
configurationvalueswillneedtoberesavedoryouwillneedto
runtheVerifyExistingConfigurationsprocesstobeabletoget
details for them
SalesManagement EAConfiguratorLookUp 187891 ConfiguratorLookUpImporting ToimproveperformaceCreateLookupTblFromCSVmethodwas
CSVformatfilesisveryslow removedbecauseitisnotusedanymore,anew
performanceneedstobeimproved PcLookupImportExportTablesetiscreatedinthe
10.1.600 ImportPcLookupTblFromCSVmethodandthenthe
ImportPcLookupTblmethodvalidatesifthePcLookupTblHed
andPcLookupColSetHedshouldbeinsertedornot.

SalesManagement EAConfiguratorSalesKits 196364 ConfiguratorSalesKitsBusiness Thesinglelevelconfigurationcheckboxneedtobemovedfrom


RulestoSingleLevelConfigurator ConfiguratorRuleEntrytoConfiguratorEntryduetothisoption
worksattheconfiguratorlevelanditshouldbepartofthe
optionslistedinConfiguratorEntry.

Thechangesarethefollowing:
MovesthecheckboxcorrespondingtoSinglelevelConfiguration
10.1.600
fromConfiguratorRuleEntrytoConfiguratorEntry
RemovedOnChangeSingleLevelMethodfromAdapter,Contract
andBOfromConfiguratorRuleEntrytoConfiguratorEntry
becauseitisnotinuse
ModifythesizeoftheGroupbox(grpConfiguration)from
ConfiguratorEntrytoaddthenewcheckBox(SingleLevel
Configuration)
SalesManagement EAPurchaseOrderTracker 186588 PurchaseOrderTrackerTax NOTE:IfyouhavecustomizationsonPOTracker,youmust
informationmissingonPOTracker completelyrewritethecustomizationssincetheentire
underlyinglayerhaschanged.

10.1.600 POTrackerprojectwasdeletedfromTFS.
ThisprojectwillnolongerbeusedsincePOTrackerandPOEntry
formsweremergedinasingleproject(POEntry)
Thisway,allthechangesappliedtoPOEntrywillautomatically
be displayed on POTracker

Page162
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


SalesManagement EATransferOrderEntry 184131 TransferOrderEntryBinvaluenot Description:AcomboboxwasbeingusedinDetails/Listtabfor
10.1.600 displayedonLine/Listtab Binvalue,itwasremovedtocorrecrtthisSCR
andforconsistencywithTransferOrderShipment
SalesManagement EA 185217 TransferOrderShipmentEntry Tobeabletocorrecttheproblemneedtoaddanewparameter
TransferOrderShipmentEntry CheckAllocationsneedstosupport topublicmethodCheckDirectOrderLinetopassinIDfortransfer
10.1.600 thechangeallowinguserstoship shipheadpack
thesametransferlinemultiple
timesonsamepack.

SalesManagement EA 192292 TransferOrderShipmentEntry endStartWith1control'sGUIDchanged.NewlabellblStartAt2


10.1.600 TransferOrderShipmentEntry ValuesdisplayedonSearchscreen
arenotorderedproperly
SupplyChainManagemen 1252:SCMEnhancements EN184 MiscellaneousShipmentEntryAdd ThepanelontheSummaryTabhasbeenreplacedwithanew
Phonenumbertoscreenandto one.
10.1.600
freightXMLforInternational
shipments
SupplyChainManagemen 1252:SCMEnhancements EN184 RFQEntrydoesnotdisplaytheItem DetailPanel.cs
10.1.600 Typeinthelinedetailscreen *RadioBu onremoved(MTL/SUB)
*Groupboxremoved
SupplyChainManagemen 1318:SFDCintegration(Sales EN190 SFDCQuoteEntryChanges Thesyncforquotesisonedirectional,whichisinbound.Sinceit
Force) isinboundandthefieldisnotusedduringthesyncprocessthis
10.1.600 fieldcanberemovedfromtheUI.

Alsoatthistimetheimplementationofquotetoorderisnot
happening and the orderid can be removed
SupplyChainManagemen EABuyerWorkbench 166368 BuyerWorkbenchRFQDecision QtyFormwasremovedasitonlycontainedasingleQuantity
WizardhasduplicateQuantity fieldwhichwasdeemedunecessaryasyoupreviouslyhad
10.1.600
fields,oneonscreenandanother specifiedavaluebeforehand.
on a dialog box
SupplyChainManagemen EAContainerLandedCostEntry 191382 ContainerLandedCostEntry Thevolumefieldhasbeenchangedfromacurrencyeditortoa
Schemachangeforvolumefields numericeditorintheSupplierShipmentClassMaintenance
10.1.600
form,sothishascreatedanewGUIDwhichneedsaSICapproval
to continue.
SupplyChainManagemen EAContainerReceiptEntry 193500 ContainerReceiptEntryDutyvalue Receipt.cspublicmethodOnChangeDtlReceiptDatehasbeen
iscalculatedwithExchangeRateof deletedaspartoftherevertforSCR140788.Ifthisfixisever
10.1.600 PODate,insteadofArrivalDate retrofittedtopriorversions,themethodwillneedtobeleftand
possiblyaddanerrortobethrownthatthemethodshouldno
longer be used.

Page163
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


SupplyChainManagemen EASpreadCode 178295 SpreadCode:noerrorappears MethodErp.Services.BO.FASpreadCode.SetDefaultsForGenerate
whenuserimportsspreadcode usedtoreturnFiscalYearnumberwithoutFiscalYearSuffix,
10.1.600 withoutcodeid whichledtoambiguityandnecessityfortheusertofillinFiscal
YearSuffixmanually.
Additionaloutputparameterssolvestheissue.

SupplyChainManagemen EAStageShipConfirmEntry 195056 StageShipConfirmEntryInvoiced ChangedtheparametersofStagewarningpublicmethodfrom


DateofOldPackisusedtocompare voidStageWarning(intiPackNum,outstringiWarning)to
10.1.600
EarlyApplyDate,insteadoftoday's publicvoidStageWarning(intiPackNum,stringipShipmentType,
date out string iWarning)
SupplyChainManagemen EASupplierResponses 64331 SupplierResponsesCreatePO NewGUIDshavebeencreatedinordertomakethebuttonsto
screenistooshortsoOK&Cancel belocatedcorrectlywhenthewindowgetsresized.
10.1.600 buttonsfloatoverbottombar
Thecontrolsmovedtotheothercontainerwere
createPOPanel1.btnCancelandcreatePOPanel1.btnOK.

SupplyChainManagemen EASupplierResponses 185594 SupplierResponses"StartingAt" EpiTextBoxtxtStartWith1wasremoved,initsplacenowthere


filtertriggersanerrorwhenvalue are2controls:txtStartWithandnumStartWithinorderto
10.1.600
enteredisalphanumeric acceptbothalphanumericandnumericonlyentries

SupplyChainManagemen EASupplierShipmentClass 183766 SupplierShipmentClass RemovedregularcomboboxandreplaceditforPurMiscCombo.


10.1.600 Inconsistentdropdownlistfor EpiGuidchangedbecausecontrolwasreplaced.
ChargeID
SupplyChainManagemen LotAdd"DeferLotAttribute EN2381 Addcompanysettingsfortracking ThelotattributespanelontheCompanySettingsScreenandthe
Entry"option optionsforlotattributes PartMaintenancewindowhasbeenupdated,andthelot
10.1.600 attributecheckboxeshadbeenremovedandreplacedwith
comboboxesinordertosupportanewfunctionalitywichallows
moreoptionsforthatattributes.

SupplyChainManagemen LotAdd"DeferLotAttribute EN2381 Add"DeferLotAttributesEntry" TheDeferfunctionalityrelatedtotheLotswasimplemented


10.1.600
Entry"option optionalongthesystem usedanexistingpublicmethod.
Tools EACompany 187477 CompanyErrorwhenuserwith TableUserSubfhasbeenremovedfromdatabase.
10.1.600 Spanishlanguageselectedtriesto Erp.Triggers.UserSubf.dllandErp.Internal.Lib.FormName.dll
createnewcompany havebeendeleted.
Tools EAGeneral 185476 Conversionprogram1120never Addanewtabletoserviceice.cnvprogstolist
10.1.600 ends systaskLog(ConverLog)rowsasindividualrowsinsteadbeing
combinedintoasingleresultfield.

Page164
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


Tools EAGeneral 188352 buildissue,havetoresolveerror changedsignaturesofnextpublicmethods:
withGLJrnSrcSearchand Old:
TranGLCJournal voidDeleteByID(stringbookID,intfiscalYear,string
fiscalYearSuffix,stringjournalCode,intjournalNum,int
journalLine,inttgLCTranNum)
GLJrnSrcSearchTablesetGetByID(stringbookID,intfiscalYear,
stringfiscalYearSuffix,stringjournalCode,intjournalNum,int
journalLine,inttgLCTranNum)
voidGetNewTranGLC(refGLJrnSrcSearchTablesetds,string
bookID,intfiscalYear,stringfiscalYearSuffix,stringjournalCode,
intjournalNum,intjournalLine)

APPromissoryNotes
GetNewAPPNHeadTGLC(Erp.Contracts.BO.APPromissoryNotes.Er
p.Tablesets.APPromissoryNotesTableset&,String,String,String,
10.1.600
String,String,String,String)
GetNewBankTranGLC(Erp.Contracts.BO.APPromissoryNotes.Erp.
Tablesets.APPromissoryNotesTableset&,String,String,String,
String,String,String,String)

New:
voidDeleteByID(GuidsysRowID)
GLJrnSrcSearchTablesetGetByID(GuidsysRowID)
voidGetNewTranGLC(refGLJrnSrcSearchTablesetds)

APPromissoryNotes
GetNewAPPNHeadTGLC(Erp.Contracts.BO.APPromissoryNotes.Er
p.Tablesets.APPromissoryNotesTableset&,String,Int32)
GetNewBankTranGLC(Erp.Contracts.BO.APPromissoryNotes.Erp.
Tablesets.APPromissoryNotesTableset&,String,Int32,Boolean)

Page165
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


Tools EAGeneral 198096 Internal.Lib.Sharedlibrary ConfigurationDesignBO
ZFieldDecimalandZDataField DeletedGetValidTargetEn es
queriescausescansandreduce
10.1.600 performance ProjectBO
DeletedBuildReten onProcList

Both methods were not being called from UI


Tools EnhanceICEReporting E10T7 ModifytheRelationshipspanelto AnewtableaddedtoRptDataDefBOsotheGetRowsmethod
Frameworktosupport allowtheusertosetup changed
10.1.600 structuredfileoutputfor relationshipsbetweenBAQs.Inthis
GlobalComplianceReporting version,theparentandchild
elementsoftherelationshipwill
both be BAQs
Tools EnhanceICEReporting E10T7 Export/ImportReportDataDef ReturntypeofmethodImportReportchanged
Frameworktosupport shouldworkforRDDswithBAQs
10.1.600 structuredfileoutputfor and/orElectronicInterfaces.
GlobalComplianceReporting

Tools EnhanceICEReporting E10T7 CreateanewGridCriteria AnewtableaddedtoRptDataDefBOsotheGetRowsmethod


Frameworktosupport MappingunderReportCriteria changed
10.1.600 structuredfileoutputfor Sets.PopulatewiththeDefined
GlobalComplianceReporting ParametersforBAQsassociated
with the RDD
Tools EnhanceICEReporting E10T7 SubmissionformforBAQ/EIbased SomenewtablesaddedtoRptDataDefBOsotheGetRows
Frameworktosupport RDDReportswithdynamicCriteria methodchanged
10.1.600 structuredfileoutputfor PromptsandFilters
GlobalComplianceReporting

Tools EnhanceICEReporting E10T7 Review/fixanyexistingcode PrimarykeysontheIce.RptTableandIce.RptRelationtables


Frameworktosupport affectedby10T32(Schema changedaspartoftheprojecttoallowBAQsandEIsinReport
structuredfileoutputfor changestoRptDataDefand DataDefinitions.Changeinsignatureshouldnotaffectanyclient
10.1.600 GlobalComplianceReporting RptTable) customiza ons.

RptTableSearchBOwasremovedbecauseitisnotbeingused
any more

Page166
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


Tools ICEBAQ 194602 BAQDesignerCheckSyntaxerror BpMethodserviceisnotintendedtobeusedpublicaly.
forautogeneratedObjecttoQuery MoreoverBPMandBAQUIcannotbeconvertedtoEWAtoo.
expressionofproperly
migrated/createdUDfield UBAQUIwastheonlyconsumerofGetBOTablesetTypes
method,butthismethodusedtohaveinefficient
10.1.600 implementationfromtheperformancepointofviewandwas
usedinefficentlytoo.

Asaresultthemethodhasbeenreplacedwithnewerone
(GetMainBOTablesetWithUD).
Tools ICEBAQReportDesigner 181437 BAQReportDesignerWhenthe RemovedGenReportTestDataandGetReportResultSchema
abilitytocreatedSampleDatafora methods.Thefirstwasnotfunctionalandthesecondonewas
crystalBAQReportwasremovedin obsoleteandonlythrewaNotImplementedexceptionifitwas
10.1.600 Epicor10theBAQReport>Options called.
screenwasnotaddressed.Itstill RemovedoldUIstufffortheActionsmenuitemthatwasno
requestaSampleDataDirectorybe longerbeingshown.Removedsomeunusedresourcestrings.
entered.

Tools ICEBPM 190609 BPM\UBAQRemoveunneeded 4methods(DefineMethod,DeleteMethod,


methodsofBpMethodservice SystemImportMethod,UpgradeCustomization)ofBpMethod
servicewereremovedfromtheserviceAPI.

All4methodneverwereintendedtobeusedaspublic.

1.DefineMethodandDeleteMethodmethodswereintroduced
tosupportUBAQoverBPMcreation/edit.
10.1.600
2.SystemImportMethodmethodcontainedimplementationof
mostpartoftheBPM/UBAQE9toE10conversionlogic.

3.UpgradeCustomizationmethodcontainerimplementationof
E10toE10+BPMupgradelogic.

Allconsumersnowarereimpletedovernewsetofserverside
sharedlibrariesIce.Lib.Blaq*

Page167
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


Tools ICEBPM 194310 BPMAutoPrintBPMdoesntallow Droppedfollowingmethodfrom
useofaUDfieldtosettheDynamic Ice.Services.BO.AutoPrintSearch.dll:
PrintQuantity publicDataDefTablesTableset
GetTablesForReportDataDefinition(stringreportDataDefID)

10.1.600 ThismethodisinternaltoAutoPrintandusedexclusivelyfrom
theAutoPrintclientcode.
Themethodreturnedincorrectdatarelatedtoreportdata
definitions.Changedtheclientcodetousethecorrectmethod
fromRptDataDefBO.
Tools ICEBPM 200061 BPMBPMUpd_E10toE10_001 ChangeddatacontactDirectiveCompileErroraddedoptional
BPMUpgradelogshouldinclude propertyCompany
10.1.600 theinformationonthecompanyto
whichdirectivebelongs

Tools ICEBuild 192797 ICEBuildFWdrop3.1.600 Erp.Contracts.BO.JournalTrackerDetail.dll


Firmofmethodchanged
Old:Void
GetNewTranGLC(Erp.Contracts.BO.JournalTrackerDetail.Erp.Tabl
10.1.600 esets.JournalTrackerDetailTableset&,String,String,String,
String,String,String,String)
New:Void
GetNewTranGLC(Erp.Contracts.BO.JournalTrackerDetail.Erp.Tabl
esets JournalTrackerDetailTableset&)
Tools ICEBuild 193859 ICEBuild10.1.500.6conversions Thefollowingmethodwasdropped:
fail publicvoidAssignSerialNumber(stringcompanyID,decimal
10.1.600 serialNumber)

This method was previously marked as obsolete.


Tools ICEECFRuntime 192478 ECFReimplementECFbuildpipline EcfRuntimeserverisnotintendedtobeusedpublicaly.
aroundRoslyn. ThisisahelperclassforBPM/BAQUI.
10.1.600
GetAssemblySizemethodhasbeenremovedsincethismethodis
inapplicable any more.

Page168
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


Tools ICEGeneralFramework 183100 MigrateSysGLCntrlCodeSeqand ChangeddatatypeofthefollowingfieldsfromInt32toInt64:
CorrAccSeqsequencestoBigInt (Erp.Contracts.BO.AlcHistory.dll)AHGLJrnDtlRow.CorrAccUID
sequences (Erp.Contracts.BO.AlcHistory.dll)AHGLJrnDtlSimRow.CorrAccUID
(Erp.Contracts.BO.APAdjustment.dll)
APTranTGLCRow.CorrAccUID
(Erp.Contracts.BO.APAlcHed.dll)APAlcDtlTGLCRow.CorrAccUID
(Erp.Contracts.BO.APInvoice.dll)
APIHAPInvExpTGLCRow.CorrAccUID
(Erp.Contracts.BO.APInvoice.dll)APInvDtlTGLCRow.CorrAccUID
(Erp.Contracts.BO.APInvoice.dll)APInvExpTGLCRow.CorrAccUID
(Erp.Contracts.BO.APInvoice.dll)GlbAPIETGLCRow.CorrAccUID
(Erp.Contracts.BO.APPIWriteOff.dll)
APPNMoveTGLCRow.CorrAccUID
(Erp.Contracts.BO.APPromissoryNotes.dll)
APPNHeadTGLCRow.CorrAccUID
10.1.600 (Erp.Contracts.BO.APPromissoryNotes.dll)
BankTranGLCRow.CorrAccUID
(Erp.Contracts.BO.APPromissoryNotes.dll)
GLJrnlDtlRow.CorrAccUID
(Erp.Contracts.BO.ARAdjustment.dll)
CashDtlTGLCRow.CorrAccUID
(Erp.Contracts.BO.ARInvoice.dll)InvcDtlTGLCRow.CorrAccUID
(Erp.Contracts.BO.ARPIWriteOff.dll)
ARPNMoveTGLCRow.CorrAccUID
(Erp.Contracts.BO.ARPromissoryNotes.dll)
ARPNHeadTGLCRow.CorrAccUID
(Erp.Contracts.BO.ARPromissoryNotes.dll)
BankTranTGLCRow.CorrAccUID
(Erp.Contracts.BO.ARPromissoryNotes.dll)
GLJrnDtlRow.CorrAccUID
Tools ICEGeneralFramework 188023 GeneralFrameworkCreationof (TheLargeDataTablecolumnshasnomeaninginICE3.Thiswas
k dll) l
ViewsforBase/UDtablesfailswhen neededtohandleanOpenEdgeissueinICE2.Itwasremoved.
10.1.600
Basetablecontains
ForeignSysRowID col

Page169
ChangeListSoftwareInterfaceChanges EpicorERP10.1.600

Release FunctionalArea Module/Area Job JobDescription SoftwareInterfaceChangeDescription


Tools ICEGeneralFramework 188023 GeneralFrameworkCreationof FieldPurMisc.isAdValoremchangedtoPurMisc.IsAdValorem
ViewsforBase/UDtablesfailswhen
Basetablecontains Erp.Contracts.BO.GLJournalEntry.dll
ForeignSysRowIDcol FirmformethodGetNewGLJrnDtlMnlTranGLCchanged
Old:Void
10.1.600 GetNewGLJrnDtlMnlTranGLC(Erp.Contracts.BO.GLJournalEntry.E
rp.Tablesets.GLJournalEntryTableset&,String,String,String,
String,String,String,String)
New:Void
GetNewGLJrnDtlMnlTranGLC(Erp.Contracts.BO.GLJournalEntry.E
rp.Tablesets.GLJournalEntryTableset&)
Tools ICEReportsFramework 184186 ReportingFrameworkImplement Refactoredthecodetomovethedesignercodefrom
validationsfortheroutingrules ReportEntryintoaseparatelibrary
10.1.600 workflow. $/Dev/Current/Source/Client/Lib/Ice.UI.PrintRouting.Epiguids
removedfromReportEntryweremovedtoIce.Lib.PrintRouting.

Tools ICEReportsFramework 187446 ReportingFrameworkRemove Faxinghasn'tbeensupportedin3.0orabove.Ifyouwouldtryto


10.1.600 unsupportedFaxtabfromreporting fax,youwouldjustgetaNotImplementedexception.

Tools ICEUDTableEntry 187192 UDTableEntryFullSyncCheckbox TheFullSynccolumnswasappearinginsearchdialogswhereitis


forinExtendedUDMaintenance notalwaysapplicable.Sinceitisnotneededinthelistdataset
10.1.600 querygridhasnomeaningand (onlyinthemaindataset)itwasremovedfromthereastonot
needstoberemovedfromthegrid showinsearchdialogs.
display

Page170
Additional information is available at the Education and
Documentation areas of the EPICweb Customer Portal. To access
this site, you need a Site ID and an EPICweb account. To create an
account, go to http://support.epicor.com.