You are on page 1of 103

Patricia Diaz Seoane

-
Desde haca tiempo, el pato notaba algo extrao.
-Quin eres? Por qu me sigues tan de cerca y sin hacer ruido?
La muerte le contest:
1IEPIKVSHIUYITSVRQILE]EWZMWXS7S]PEQYIVXI
El pato se asust.
Quin no lo habra hecho.
=EZMIRIWEFYWGEVQI
-He estado cerca de ti desde el da en que naciste Por si acaso.
-Por si acaso? - pregunt el pato.
7uTSVWMXITEWEFEEPKS9RVIWJVMEHSWIVMSYREGGMHIRXINunca se sabe!
-Ahora te encargas de eso?
(IPSWEGGMHIRXIWWIIRGEVKEPEZMHEHIPSWVIWJVMEHSW]IPVIWXSHIGSWEWUYISWTYIHIRTEWEV
EPSWTEXSWHIZI^IRGYERHSXEQFMqR

Texto extrado de
El pato y la muerte de Wolf Erlbruch

3
ndice
1. Introduccin: La importancia de explicar la muerte a los nios........................................ 7

2. Problemas para abordar el duelo con nios y adolescentes............................................... 11

3. Conceptos generales clave para explicar la muerte a los nios: La necesidad de


la comunicacin............................................................................................................................................. 19
. La importancia de las explicaciones y las preguntas que aparecen a cada edad. 21
. Conceptos bsicos que debemos manejar................................................................................. 27
. Quin, cmo, cundo y dnde comunicar la muerte........................................................... 43

4. Los nios y el duelo..................................................................................................................................... 53


. Qu es el duelo?....................................................................................................................................... 55
. Diferencias entre duelo adulto y duelo infantil......................................................................... 57
. Creencias errneas acerca del duelo y los nios.................................................................... 63

5. %WTIGXSWUYIJEGMPMXER]HMGYPXERPEGSQTVIRWMzRHIPEQYIVXIWIKRPEW
distintas etapas del desarrollo................................................................................................................ 73
. De los 0 a los 2 aos.............................................................................................................................. 75
. De los 3 a los 6 aos.............................................................................................................................. 77
. De los 6 a los 10 aos........................................................................................................................... 79
. De los 10 a los 13 aos........................................................................................................................ 82
. Los adolescentes....................................................................................................................................... 84

6. El duelo en cada etapa del desarrollo: Aspectos normales, signos de alarma y


cmo ayudar.................................................................................................................................................... 87
. La muerte en la primera infancia: del beb al nio de 2 aos........................................ 89
. Los preescolares: de los 3 a los 6 aos........................................................................................ 94
. La muerte en la edad escolar: de los 6 a los 10 aos......................................................... 96
. Preadolescentes: de los 10 a los 12 aos.................................................................................... 103
. Los adolescentes....................................................................................................................................... 111
. Signos de alarma generales para todas las edades................................................................. 116

7. El duelo en personas con discapacidad intelectual.................................................................... 119


. Caractersticas generales........................................................................................................................ 121
. Dimensiones a las que atender.......................................................................................................... 124
. Cmo informar de una muerte a una persona con discapacidad................................ 130

5
1. La importancia de explicar la
8. Claves e ideas para la intervencin en duelo en el colegio................................................. 133
. Aprender a reconocer el duelo en el aula: Comportamientos esperables............. 136
. %GGMSRIWIWTIGuGEWUYITYIHIRVIEPM^EVPEWIWGYIPEW 144
. El duelo colectivo: Una situacin excepcional........................................................................... 155 muerte a los nios
9. 6IGYVWSWXMPIWTEVEEGSQTEyEVIPHYIPS 159
. Libros y cuentos.......................................................................................................................................... 161
. Pelculas........................................................................................................................................................... 166
. Otros materiales........................................................................................................................................ 176

10. Cuestiones prcticas habituales que se suelen plantear en el duelo infantil.............. 179

Bibliografa............................................................................................................................................................................. 195

6 7
1. La importancia de explicar la
muerte a los nios
Esta gua surge de la necesidad que hemos detectado en muchas personas que viven
o trabajan en contacto con nios y adolescentes, y no saben cmo abordar con ellos
adecuadamente el tema de la muerte de un ser querido.

La muerte es un hecho ineludible que forma parte de la vida. Todos los seres humanos
ZEQSWEXIRIVUYIIRJVIRXEVRSWEIPPEIREPKRQSQIRXS HIWHIIPMRWXERXIIRUYIYR
ser vivo nace, existe la posibilidad de la muerte. Aunque pensar en esa realidad nos
cuesta y nos duele, es algo inherente a la vida. Ponerle palabras a este suceso resulta
QY]GSQTPMGEHS QjWERWMWIXVEXEHIGSQYRMGjVWIPSEPSWQjWTIUYIySW HIELuUYI
consideremos importante disponer de recursos que nos ayuden a afrontar esta realidad
del mejor modo posible.

El temor que experimentamos los adultos ante esta situacin hace que en ocasiones
IPMNEQSW SGYPXEV ]S GEPPEV 2SW ETS]EQSW IR IP TSWMFPI MQTEGXS S IR PE HMGYPXEH UYI
creemos que tienen los nios para procesar la muerte de un ser querido. Por eso
acabamos dando explicaciones errneas que slo van a llevar al nio a una confusin
QE]SVPEGYEPYRMHEEPHSPSVHIPEI\TIVMIRGMETYIHIKIRIVEVGSQTPMGEGMSRIW]UYM^jYR
duelo patolgico que necesite de intervencin.

Es habitual tratar de proteger a los nios. Creemos que protegindolos de la muerte les
ahorramos sufrimiento, pero es todo lo contrario: los apartamos de un evento fundamental
en sus vidas y es imposible evitarles todo el dolor. De hecho, si los nios crecen sin
exponerse al sufrimiento, sern ms propensos a la frustracin y no desarrollarn las
habilidades necesarias para afrontar eventos a los que seguramente debern enfrentarse
cuando alcancen la edad adulta.

Los nios y los adolescentes sufren la muerte de sus seres queridos, sienten y se cuestionan
muchas cosas: sus preguntas, temores, comportamientos, inquietudes y dolor han de ser

9
2. Problemas para abordar
atendidos, escuchados y cuidados. A menudo el adulto no est preparado o no tiene
GSRSGMQMIRXSWWYGMIRXIWTEVESJVIGIVIWXEEXIRGMzRGSRGEPMHEH HIELuPEMQTSVXERGME
HIEFSVHEVIWXIXIQE 2STSHIQSWIWGSRHIVPEGEFI^E]LEGIVGSQSWMREHELYFMIVE
pasado, o dejar que el tiempo ponga las cosas en su sitio.
el duelo con nios y adolescentes
En los momentos en que tratamos de hablar y de atender a los nios y adolescentes tras
el fallecimiento de una persona de su entorno, es cuando nos surgen muchas dudas sobre
GzQSEFSVHEVQPXMTPIWGYIWXMSRIWUYIWITPERXIERSWIZERETPERXIEV

Cmo se lo cuento? Entienden lo que es la muerte? Es mejor que sepa o que no sepa? Los
nios estn en duelo? 0SZMZIMKYEPYREHSPIWGIRXIUYIYRRMySHIHMI^EySWSYRSHIGMRGS#
(IFIRZIVRSWPPSVEV#Qu se puede hacer en el aula? 7IPSGYIRXSEQMLMNSHMWGETEGMXEHS#
Cmo puedo prepararle? 0IXVEYQEXM^EVq#

)WXEKYuEXVEXEHIHEVVIWTYIWXEEEPKYREHIIWXEWGYIWXMSRIW GSRIPRHISJVIGIVEPSW
EHYPXSWVIGYVWSW]LIVVEQMIRXEWUYIPIWTIVQMXEREFSVHEVIWXEWMXYEGMzRGSRGSRER^E]
decisin.

De nuestras explicaciones sobre la muerte depender la forma en que los nios vivan
su primer duelo, que suele marcar las dems experiencias de prdida que sufrirn y,
IWTIGMEPQIRXIPEWI\TIVMIRGMEWHIQYIVXIUYIWIIRGYIRXVIR7SFVIIWXIPXMQSEWTIGXS
estaremos de acuerdo en que a lo largo de la vida se producen muchas prdidas: algunas
QjWGIRXVEPIW]ZMXEPIWUYISXVEWTIVSXSHEWWSRWMKRMGEXMZEWHIYRQSHSYSXVS

10 11
2. Problemas para abordar
el duelo con nios y adolescentes
0EMHIEHIPEQYIVXILEMHSGEQFMERHSGSRPSWEZERGIWGMIRXuGSW ERXIWPEQYIVXIIVE
algo natural que suceda a una edad ms temprana, los diagnsticos mdicos se hacan
ms difciles y menos accesibles. Pero hoy en da esa naturalidad con la que antes se
EWYQuEYRLIGLSMRIPYHMFPILEMHSLEGMqRHSWIQjWGSQTPINE]VIWMWXIRXI 0EIWTIVER^E
media de vida se eleva ao tras ao, hay una campaa antienvejecimiento mundial y esa
naturalidad con la que se asuma la muerte ha ido desapareciendo.

4SV IWXE VE^zR YRS HI PSW TVMRGMTEPIW TVSFPIQEW UYI RSW IRGSRXVEQSW IW PE
MRWXMXYGMSREPM^EGMzRHIPEQYIVXI=ERSIWEPKSZMWMFPI WILETEWEHSHIQSVMVIRGEWEE
fallecer en los hospitales o en instituciones de cuidados paliativos especialmente enfocadas
a tratar este tema, pero que dejan a los nios de lado.

)PPIRKYENIIWSXVSEWTIGXSUYIRSWHMGYPXELEFPEVHIPLIGLSREXYVEPHIQSVMV 4EPEFVEW
como muerte, muerto, moribundo o enfermedad terminal nos impresionan y las
sustituimos por otras expresiones que consideramos ms amables, pero que alejan la
realidad de la muerte, como: Se fue,El ocaso de la vida,Nos ha dejado,Ahora puede
HIWGERWEV)WXjIRSXVSPYKEV9RZMENIHIRMXMZS]YRPEVKSIXGqXIVEHIIYJIQMWQSW
que, lejos de abordar la muerte como algo lgico que forma parte de la vida, la coloca en
un lugar ms amable que confunde completamente a los nios.

Debido a que a los adultos nos cuesta mucho y nos parece duro nombrar las cosas,
GYERHS YXMPM^EQSW PSW XqVQMRSW VIPEGMSREHSW GSR PE QYIVXI LE] YRE TIVGITGMzR HI
brusquedad y de estar describiendo una situacin desagradable, de modo que adaptamos
nuestro lenguaje y evitamos referirnos a la muerte en trminos reales, complicando as la
comprensin de este hecho por parte de los nios.

Actualmente vivimos un momento cultural que intenta alejar el sufrimiento todo lo


posible de las personas. Vivimos bajo el lema de la felicidad obligatoria y tratamos de

13
alejar la muerte todo lo que podemos. Ligado a esto se aleja igualmente el duelo y todas que establecemos, los vnculos, cmo comprendemos la muerte, la cercana de la misma,
las manifestaciones asociadas a este proceso, de modo que vivimos en una cultura que cmo se altera nuestra vida cotidiana y todo aquello que se pierde tras la muerte de
impide o bloquea el sufrimiento. Esto no ocurre en otras culturas, donde el hecho de YR WIV UYIVMHS HIWHI YR GSRHIRXI GSQTEyIVS LMNS QEHVI EQMKS TVSZIIHSV 4SV
morir se convierte en un acontecimiento familiar y social en el que se implica toda la este motivo, la tendencia es alejar a los nios de esos sentimientos y emociones que se
comunidad, convirtiendo los ritos funerarios en parte de la vida cotidiana. generan tras un fallecimiento, creyendo que van a sufrir el mismo impacto que nosotros.

Pensar en la muerte y en todo aquello que vamos a perder nos angustia, y es precisamente
Tampoco en nuestra sociedad ha sido as siempre: hace no mucho se mora en casa,
esa angustia de lo que queremos proteger a los menores. Cuando se produce una muerte
rodeado de los seres queridos -tanto adultos como nios- y de aquellos allegados y
nos sentimos incapaces de responder a las dudas de los nios si estamos angustiados,
ZIGMRSWUYIUYIVuERTEVXMGMTEVIRPEHIWTIHMHE]IPPXMQSEHMzW )VELEFMXYEPEQSVXENEV
todas nuestras explicaciones se tien de esos pensamientos y preferimos no transmitirles
el cuerpo en casa, buscarle un lugar en el dormitorio principal y todos los asistentes
esas sensaciones. Pensamos que ocultarles la muerte, los difuntos y todo lo que les rodea
comprobaban de primera mano la realidad de la muerte como un hecho natural. Se
puede protegerles del miedo y de la inquietud ante ese hecho. Creemos errneamente
manifestaban sentimientos de dolor, desconsuelo, tranquilidad; se compartan ancdotas que si les enseamos la crueldad de la muerte corremos el riesgo de que tengan una
sobre el difunto; y esa situacin daba un sentido de normalidad a la muerte, mientras que experiencia traumtica.
los sentimientos, emociones y comentarios eran compartidos tanto por los nios como
por los adultos. Por ello, nos aferramos a excusas como Es muy pequeo, No lo va a entender, Se
TYIHIXVEYQEXM^EV2SIWRIGIWEVMSUYIWYJVE]EWuPIHIWTVSXIKIQSWHIYRLIGLSXER
(IFMHSEUYILIQSWEPINEHSXSHEWIWXEWGSWEW]PEWLIQSWMRWXMXYGMSREPM^EHSRSWVIWYPXE cierto como la vida, la muerte, a la que antes o despus van a tener que enfrentarse.
difcil abordar con naturalidad el tema de la muerte con los nios. Tratamos de que no
GSRS^GERPSWEWTIGXSWQjWMQTSVXERXIW]ERXIWYWTVIKYRXEWXIRHIQSWEYXMPM^EVIZEWMZEW Otro motivo por el que nos cuesta hablar de la muerte con los nios es el dolor que
No sabemos contestar muchas de las cuestiones que nos plantean y otras preferimos no sentimos tras la prdida de un ser querido. Nos asusta de nuevo que los nios sufran,
afrontarlas. Antes, con las vivencias personales no se haca tan necesario dar explicaciones, que les duela como nos duele a nosotros, as que tratamos de disimular el dolor para
enmascarar el de los nios y as no tener un sufrimiento aadido por la preocupacin que
porque los nios eran partcipes desde el primer momento.
nos causa ver a los nios dolindose, sufriendo, llorando o cuestionndose el sentido de
PEZMHE 1MRMQM^EQSWPEMQTSVXERGMEHIPSUYILESGYVVMHSEXVEZqWHIQIRWENIWGSQS
- Mam, la bisabuela ya es muy mayor, por qu no se ha muerto? Cario, esas cosas no
Cuanto menos sepas, mejor, Es muy pequeo, casi no se entera, Es mejor no dar
WIHMGIRUYIRSXIZYIPZEESuV
detalles, no los necesita, Es un nio, es preferible que est distrado, Es mejor no
- Pap, GYjRHSXIZEWEQSVMV#'EVMySUYqGSWEWXMIRIW]SRSQIZS]EQSVMV
decrselo, podemos hacerle mucho dao, etc.
- Mam, la abuelita de Juan se ha muerto, GYjRHSWIZEEQSVMVPEEFYIPE.YPME#2SLE]
UYITVISGYTEVWIHIIWEWGSWEWUYIPEEFYIPEIWXjQY]FMIRRSXMIRIWUYIHIGMVIWS A travs de estos mensajes, nuestro objetivo como adultos es proteger al nio del dolor
que va a sentir tras la prdida de un ser querido. Nos imaginamos que ese dolor va a ser
En ocasiones el miedo del adulto a la muerte es tan grande que intenta que el nio no lo casi insoportable, como le suele ocurrir a muchos adultos, con el agravante de que se
TIVGMFE4SVIWSSXVEHIPEWKVERHIWHMGYPXEHIWIWRYIWXVSTVSTMSXIQSVEPEQYIVXI]IP XVEXEHIYRRMyS]WMRSRSWKYWXEZIVIPWYJVMQMIRXSLYQERSERQIRSWIPMRJERXMP4SVIWS
impacto emocional que vivimos tras la prdida de un ser querido, que en los adultos es ponemos un gran empeo en proteger al nio del dolor.
ms intenso que en los nios por muchos factores, pero principalmente por las relaciones

14 15
Pero en realidad el dolor va a aparecer antes o despus, porque casi nadie es ajeno a 4SV IP GSRXVEVMS PE IRWIyER^E TFPMGE IR .ETzR ] IR )WXEHSW 9RMHSW Wu GSRXIQTPE YR
PEQYIVXIHIEPKYMIRGIVGERS ]EWIEHIYRJEQMPMEV YRGSQTEyIVS YREQMKS)WGEWM TVS]IGXSSYRFPSUYIHMVMKMHSRMGEQIRXIEI\TPMGEVPIWPEQYIVXIEPSWRMySW7MRIQFEVKS
seguro que ms tarde o ms temprano ese nio va a enfrentarse al dolor de la prdida en Espaa los colegios que incluyen este tema en el currculo acadmico son los menos,
de un ser querido. EYRUYIGEHEZI^LE]QE]SVMRXIVqWIRXVIPEGSQYRMHEHIHYGEXMZETSVXVEXEVIWXIXIQE
dentro del aula.
Acostumbramos a los nios a vivir lejos del sufrimiento y es ah donde vamos a
encontrarnos otro gran escollo, lo que les lleva a abandonar actividades, evitar retos y
Finalmente, igual que no se tiene en cuenta a los nios por muchos motivos, a los adolescentes
EWIRXMVVIGLE^STSVEUYIPPSUYITYIHIWYTSRIVIWJYIV^S]GMIVXSQEPIWXEV )ZMXjRHSPIW
tampoco, porque los adultos presuponemos que ya tienen toda la informacin pertinente
el sufrimiento y alejndolos de la muerte como un sufrimiento inherente a la vida los
sobre el tema o que, en su lucha por la autonoma, habrn buscado informacin acerca de
alejamos tambin de unas habilidades que son necesarias a la hora de reponerse de
las dudas. De ese modo, evitamos enfrentarnos a explicaciones y aclaraciones que suelen
determinados reveses que nos suele tener preparada la realidad.
ser dolorosas.

Relacionado con este tema, desde hace tiempo hay una tendencia a decirles a los nios
que no hay techo, que podrn conseguir todo aquello que sueen, que los lmites los
PARA RECORDAR
marcan ellos. No tenemos en cuenta que hay limitaciones que marca la vida y que este
mensaje los lleva a negar la realidad ms amarga porque les hemos vendido que lo
Los principales problemas que existen para abordar el tema
pueden todo. Por tanto, frente a enfermedades terminales o situaciones que no se han
de la muerte con los nios y los adolescentes:
podido paliar o evitar, nos encontraremos ante grandes problemas.

1. Se ha perdido la naturalidad de la muerte y, con ello, el saber implcito que


)RPSVIPEXMZSEPjQFMXSEGEHqQMGSSXVEHIPEWHMGYPXEHIWUYIMQTMHIREFSVHEVIWXIXIQE
generaba.
es que las escuelas no estn preparadas para trabajar la muerte desde el aula, aunque hay
2. 2YIWXVEGYPXYVEGSRWMHIVEPEQYIVXIGSQSYRXEFHIPUYIIWTVIJIVMFPI
que reconocer que la mayora ya lo intenta. Los colegios tienen grandes limitaciones, a las
no hablar.
UYIWIWYQERPEWHMGYPXEHIWTIVWSREPIWHIGEHEHSGIRXIUYIRSHINEHIZIVWIEJIGXEHS
3. La muerte nos genera angustia y tratamos de proteger a los nios de ese
por los duelos o por el tema en s. A esto se unen unos temarios que no contemplan el
sentimiento.
ciclo de la vida o la muerte como algo que necesita ser trabajado.
4. El instinto de proteccin nos lleva a alejar el sufrimiento de los menores
y, de ese modo, se impide que desarrollen habilidades de afrontamiento.
Los docentes encuentran muchas obstculos para trabajar este tema por parte de los
5. Vivimos una vida alejada del sufrimiento.
padres de los alumnos, que tienden a reprochar que se d esa informacin a los nios por
6. Transmitimos al nio que todo est a su alcance: Si quieres, puedes.
la necesidad de proteccin de la que hemos hablado anteriormente. Por eso, a menudo el
7. La escuela tiene pocos recursos para afrontar la muerte y trabajarla desde
primer acercamiento en la escuela se produce irremediablemente cuando fallece alguien
el aula.
cercano a los alumnos un docente o incluso un compaero de estudios- y entonces no
8. Consideramos al adolescente como un adulto que ya maneja toda la in-
suele haber disponible un material de trabajo preparado, ni un protocolo previamente
formacin.
IWXEFPIGMHSPSUYIWIWYQEEXSHEWPEWHMGYPXEHIWUYITIVXIRIGIREPQYRHSEHYPXS]UYI
ya hemos comentado.

16 17
3. Conceptos generales clave
para explicar la muerte a los nios:
La necesidad de la comunicacin

19
3. Conceptos generales clave
para explicar la muerte a los nios:
La necesidad de la comunicacin
3.1. LA IMPORTANCIA DE LAS ETPLICACIONES Y LAS PREGUNTAS
QUE APARECEN A CADA EDAD

La muerte nos produce mucha angustia y esa angustia nos lleva a intentar paliar el dolor
UYIGVIIQSWUYIZEETVSZSGEVIRPSWRMySW%PTIVGMFMVRYIWXVSHSPSV PSWRMySWEGXER
HIHSWQERIVEW XVEXERHITVSXIKIVRSWHIPHSPSVEWYZI^]IZMXERLEGIVRSWTVIKYRXEW
temiendo hacernos ms dao.

7MR IQFEVKS IWXS RS WMKRMGE UYI WY HIWIS HI WEFIV UYIHI GYFMIVXS WMRS UYI WI LE
amortiguado esperando otro momento. Al mismo tiempo, surge una necesidad imperiosa
HI WEFIV ] TSV IWS PER^ER XSHS XMTS HI TVIKYRXEW MRXIRXERHS EFWSVFIV MRJSVQEGMzR ]
XIRIVYRQE]SVGSRSGMQMIRXSHIPEWGSWEWTVSTMSHIPTVSGIWSHIETVIRHM^ENI

La angustia que genera en los adultos ver cmo un nio se enfrenta a la muerte hace que
se dispare la necesidad de amortiguar sus efectos. Cuando los nios perciben esa angustia,
puede que experimenten cierta reticencia a preguntar, no slo porque entienden que nos
duele, como explicbamos antes, sino tambin porque rpidamente comprenden que es
YRXIQEHIPUYIIWQINSVRSLEFPEV]TSVIPPSMRXIVMSVM^ERUYIHIFIHIWIVQEPS1EQj
pone mala cara si pregunto, ser que es algo muy, muy malo de lo que no se puede hablar.

Ese hecho de no poder hablar suele provocar que muchas de las ideas que tienen los
pequeos sobre la muerte se formen a partir de datos sueltos que oyen sobre el hecho
de morir o la muerte, y que ellos complementan con su fantasa o sus ideas infantiles.

Al comunicar una muerte a los nios, un aspecto clave es evitar que elaboren sus propias
conjeturas sobre el tema, ya que seguramente stas no slo sern errneas sino que

21
TYIHIREyEHMVYRTYRXSHIQSVFSWMHEHSXIVVSVUYIRSIWVIEPEHIQjWHIHMGYPXEVQjW Entre los 3 y los 6 aos
adelante la comprensin y el acercamiento de los menores al hecho natural de morir y a
todo lo que le rodea: Preguntas concretas acerca de cmo son las cosas en el lugar donde est la persona que
ha fallecido:
- Mam, PEEFYIPEWIZEEQSVMVEPKRHuE#2SWLERHMGLSUYI.YERIWXjXVMWXITSVUYIWY  5YqZEEGSQIV#
 ,EGIJVuSHSRHIIWXj#
abuelito, que era muy mayor, se ha muerto. La abuela es muy mayor tambin, UYqZEETEWEV#
 %UYqZEENYKEV#
5YqGSWEWXMIRIWIWEWGSWEWRSWSRHIRMySWXRSXMIRIWTSVUYqTVISGYTEVXIHIIWS:IE
 Cmo respira?
NYKEVUYIIWSWXIQEWPSWLEFPEQSWWzPSPSWQE]SVIW
 'zQSZEEPIIVWMRSWILEPPIZEHSPEWKEJEW#
 :EEZIRMVEXVEIVQIQMVIKEPSHIGYQTPIEySW#
Este tipo de conversaciones hacen que el nio se calle, lo confunden y le crean temores
 Cmo se duerme?
sobre un tema que escapa a su conocimiento. Las respuestas evasivas de los adultos y los
intentos por alejarles o distraerles del tema hacen que ellos mismos saquen sus propias
Preguntas sobre su cuidado y bienestar:
GSRGPYWMSRIW]RSWMIQTVIPSLEGIRHIPQSHSGSVVIGXS4SVIWXEVE^zRIWTVIJIVMFPIFEWEV  5YMqRQIZEELEGIVPEGSQMHE#
nuestra respuesta en un estndar que nos ayude a guiar al nio por el mejor camino  5YMqRQIZEEPPIZEVEPGSPIKMS#
posble.  :S]EWIKYMV]IRHSEJXFSPPSWQMqVGSPIW#5YMqRQIZEEVIGSKIVELSVE#

5YM^jYREXIRXEGMzRGSQRHIPSWEHYPXSWIWTIRWEVUYIIPRMySWIZEESPZMHEVHIPXIQE Preocupacin sobre si la muerte puede afectar a las personas que les rodean:
EP^ERNEVPEGSRZIVWEGMzRSUYIRYIWXVEVIWTYIWXELEGYFMIVXSWYRIGIWMHEHHIWEFIVTIVS  8IZEWEQSVMV#
puede ser que el nio no pregunte por temor a nuestra reaccin o porque la muerte es  4ETjWIZEEQSVMV#
un tema que todava no le preocupa ni le angustia.  1EQjWIZEEQSVMV#
 7MSWQSVuWUYMqRQIZEEGYMHEV#

7EFIQSWUYIPEGYVMSWMHEHHIPRMySIWMRRMXE HILIGLSXSHSWPSWIWXYHMSWIZSPYXMZSW  A qu edad se muere uno?

nos sealan edades clave en las que los nios se embarcan en una serie de porqus
Entre los 6 y los 9 aos
MRRMXSW IR YR MRXIRXS HIWIWTIVEHS TSV MV GSRWXVY]IRHS WY QYRHS ] IRXIRHMIRHS IP
funcionamiento de las cosas.
Preguntas para saciar su curiosidad sobre lo que le ocurre al cuerpo cuando uno muere:
 Cmo se come?
Las preguntas ms frecuentes sobre la muerte que nos vamos a encontrar en funcin de
 'zQSZEEFIFIVEKYE#
la edad son las siguientes:
 Crecen las uas? Y el pelo?
 Qu le pasa al cuerpo cuando lo entierran?
 He odo que se crece muerto, eWZIVHEH#
 7MYRSXMIRIKEREWHILEGIVTMWcmo lo hace?

22 23
Preguntas acerca de su responsabilidad: Preadolescentes y adolescentes
 7MLEKSIWXSWIZEEIRJEHEV#
 He trado las notas, QIZEEVIKEyEV# Las preguntas que plantean son muy parecidas a las que formulara un adulto:
 Crees que se acuerda de que me port mal?  Cmo ha podido pasarnos esto?
 He roto eso que tanto le gustaba, se habr puesto triste?  5YqZEQSWELEGIVELSVE#
 'zQSRSWZEQSWESVKERM^EV#
Preguntas sobre conceptos abstractos que no entienden:  Cmo hago esto yo solo, si estoy acostumbrado a hacerlo con ayuda?
 Va a bajar del cielo?  ,EWYJVMHS#
 Cmo es el cielo?  7ILEIRXIVEHS#
 En el cielo se est bien?  Dnde est?
 1IZIHIWHIIPQjWEPPj#  Est donde est, RSWZI#Nos oye?
 )WIPYKEVQINSVXMIRIXIPIZMWMzR#  5YqZEQSWELEGIVGSRWYWGSWEW#
 %HzRHIZERPEWTIVWSREWGYERHSQYIVIR#  Cmo es posible que nadie pudiera hacer nada?

Entre los 9 y 12 aos

Preguntas sobre reacciones de manera emptica:


 Mam, ests triste?
 Cmo puedo consolar a la abuela, que est tan triste?
 )WQY]KVEZIPSUYIRSWLETEWEHS#
 'YjRHSZEEHINEVTETjHIIWXEVXERTVISGYTEHS#
 Va a estar as mucho tiempo?
 Va a salir de casa el abuelo despus de que haya muerto la abuela? 5YIVVjZIRMVE
comer a casa como haca antes?

Preguntas sobre la realidad que se van a encontrar:


 Podemos seguir pagando la casa?
 Iremos al mismo colegio?
 5YqZEETEWEVGSRPEQSXSHITETj#
 5YMqRRSWPPIZEVjEGPEWIXSHSWPSWHuEW#
 Vamos a ser pobres?
 ,E]UYIZIRHIVPEGEWE#
 5YMqRZEEGYMHEVRSWWMXITEWEEPKS#

24 25
3.2 CONCEPTOS BSICOS QUE DEBEMOS MANEJAR
PARA RECORDAR
Todas estas cuestiones y muchas ms no tienen que ver exclusivamente con la vivencia de
La muerte genera en los nios mucha curiosidad y preguntas asociadas que debemos la muerte. No es necesario que el nio experimente un duelo o un fallecimiento para que
tratar de responder. Las ms habituales son: ETEVI^GERIWXSWMRXIVVSKERXIWPEQE]SVuEHIPEWZIGIWWIHIWIRGEHIRERTSVIPHIWEVVSPPS
IZSPYXMZS]PEGYVMSWMHEHHIPSWQIRSVIWHIFMHSEWYGSRWXERXIERWMEHIETVIRHM^ENI
Entre los 3 y 6 aos:
 3VKERM^EGMzRHIPEMRJSVQEGMzR WMIRIP'MIPSWINYIKE WIVIWTMVE WMLEGI
0SUYIWuIWGMIVXSIWUYIHIEPKRQSHSPSWRMySWTIVGMFIRUYIIPXIQEHIPEQYIVXI
JVuSWMIPJEPPIGMHSZEEZSPZIV
no nos deja impasibles, sino que suscita en los adultos una reaccin por la que el menor
 )PTVSTMSGYMHEHSUYMqRPSWZEEGYMHEVEZIWXMVEEPMQIRXEV
siente curiosidad. As, aparecen las preguntas constantes, ya sea porque es un tema que
 Preocupacin: si otros van a morir, la edad a la que morimos, quin morir
ERXIW incomoda, se evita o simplemente nos conecta con una emocin relacionada con la
prdida. Lo que s es cierto es que, a medida que crecen y van incorporando informacin,
Entre los 6 y 9 aos: la idea de muerte evoluciona hasta llegar a una idea adulta, si han recibido la informacin
 Curiosidad sobre el cuerpo y los procesos: cmo se come, cmo bebe, si correcta y real.
HIWTYqWHIQSVMVGVIGI
 Preocupacin sobre la responsabilidad: si se enfadar, si se sentir orgulloso Como nos explica el cuento El pato y la muerte, desde el momento en que nacemos,
o si se pondr triste ante determinados hechos. la muerte nos acompaa en nuestro viaje por la vida, de ah que uno de los instintos
 Conceptos abstractos: cmo es el Cielo, a dnde va uno cuando muere o animales que ms conservamos sea el instinto de supervivencia, que nos ayuda a buscar
qu es el ms all. proteccin y a evitar peligros, as como a buscar la proteccin de otros. Tener miedo a
PSWI\XVEySWPPSVEVWYGGMSREVVIINSWVIPEGMSREHSWGSRGEuHEWQMIHSEPZEGuSEIPIQIRXSW
Entre los 9 y 12 aos:
WIVTIRXIERXIW WSR EPKYREW QYIWXVEW HI GzQS MRXIRXEQSW TVSXIKIV RYIWXVE ZMHE
 )QTEXuE LEGME PSW HIQjW WM PE XVMWXI^E TEWEVj WM WEPHVjR HI GEWE WM WI
instintivamente.
VILEVjR
 La realidad que viene despus: si hay que cambiar de colegio, si la casa se
A menudo los nios saben cosas sobre la muerte. Aunque nosotros tratemos de evitar
puede pagar o quin cuidar a los supervivientes.
las explicaciones, de un modo u otro la muerte forma parte de sus juegos, explicaciones

Adolescentes: y universo inconsciente:


 Preocupaciones similares al adulto: sobre el sufrimiento, el afecto, problemas
futuros, el desarrollo de la vida sin el fallecido o la situacin econmica.  0ILIHEHSEQEQjYRWYWXSHIQYIVXI
 0SWHMRSWEYVMSWWII\XMRKYMIVSRTSVUYIWIQYVMIVSR
 'EWMWIQYIVIHIVMWE
 .YKEQSWEUYIXIQSVuEW]PYIKSZMZuEW

26 27
Lo importante no es que el nio pueda elaborar su propio concepto de muerte, sino que 1. Irreversibilidad: Aquello que ha muerto no va a volver a vivir
ese concepto est ligado a lo que realmente es. Las preguntas le sirven para apaciguar su
ansiedad ante el hecho de la muerte y para ir construyendo una idea propia. %YRUYITEVI^GEIZMHIRXIUYIPSUYIQYIVIRSZYIPZIEZMZMVGYERHSPSWRMySWZIRHMFYNSW
animados, programas de televisin o juegan con videojuegos, la realidad es que se muere y
1YGLEW TIVWSREW TVIIVIR RS LEFPEV E PSW RMySW WSFVI PE QYIVXI ] YWER EVKYQIRXSW
se puede volver a vivir al cabo de un rato, despus de unas condiciones o inmediatamente.
GSQS UYI WSR QY] TIUYIySW UYI ER RS WI IRXIVER UYI WIKYVEQIRXI ]E PS WITER
UYI ZEQSW E EWYWXEVPIW 7MR IQFEVKS PSW TVSFPIQEW TEVE I\TPMGEV PE QYIVXI ZMIRIR
Los nios no entienden la muerte como irreversible, sino que creen que es un estado
delimitados por el desarrollo cognitivo de los nios: no todos los aspectos o dimensiones
temporal que puede durar desde poco a mucho, pero que la persona fallecida puede
HI PE QYIVXI TYIHIR IRXIRHIVWI E WIKR UYq IHEHIW ] IWS IW PS UYI WYIPI PPIZEV E
ZSPZIVEZMZMVIREPKRQSQIRXSPSMRXIVTVIXERGSQSYREWITEVEGMzRXIQTSVEP
errores o a conceptos equivocados.

Los nios van incorporando paulatinamente aspectos relevantes a su concepto de Los ms pequeos suelen equiparar la muerte a un viaje en el que la persona va a estar

muerte, los ms pequeos tienen una comprensin limitada de la muerte mientras que fuera durante mucho tiempo y muy lejos. Esto est directamente relacionado con las
los adolescentes y los preadolescentes manejan un concepto muy parecido al del adulto. explicaciones que los adultos ofrecen a los nios cuando un familiar ingresa en el hospital
)RXIRHIVIWEWHMQIRWMSRIWRSWMKRMGEUYIPEQYIVXIRSWIEHSPSVSWEWMRSUYIIPTVSGIWS muy enfermo, diciendo que va a estar fuera durante mucho tiempo o incluso que esa
de asumir es igual de doloroso o costoso que el de cualquier adulto tras la muerte de persona se ha ido de viaje. As, si ese familiar no regresa del hospital, los nios siguen
una persona querida. pensando que el viaje dura ms de lo previsto o que est tan lejos que ahora no puede
volver.
Cuando los nios no entienden todas las dimensiones de la muerte, el proceso de
asimilacin es ms costoso o cclico, alternando periodos en los que parece que lo han El objetivo debe ser que el nio entienda que la muerte es permanente, que no hay vuelta
entendido con retrocesos lgicos al poder considerar dimensiones. No hay que perder de atrs, que no se puede estar muerto un ratito y luego vivir.
vista que en los nios la fantasa lo impregna todo y que puede dotar al duelo de matices
difciles de resolver, si no damos con un adulto que le ayude a aclarar sus dudas, temores,
Muchas pelculas y cuentos clsicos equiparan la muerte a un sueo o a un viaje:
angustias y pensamientos.
&PERGERMIZIW o 0EFIPPEHYVQMIRXIson claros ejemplos de cmo la muerte se vuelve
reversible y es posible en la mente infantil.
4SVIWXEVE^zR IWTVMSVMXEVMSXIRIVIRGYIRXEPEIHEHGSKRMXMZEHIPRMyS ,E]RMySWHI
GYEXVS EySW UYI IRXMIRHIR TVjGXMGEQIRXI XSHS ] RMySW HI HMI^ EySW UYI RIGIWMXER
Otra de las cosas que fomentan ese concepto errneo de reversibilidad de la muerte
explicaciones ms sencillas: hay que saber dar a cada nio lo que necesita. La realidad es
que existen cuatro conceptos clave que, si aprendemos a manejarlos, facilitarn tanto las son los mensajes que los adultos damos para explicar la muerte y lo que ha pasado con

explicaciones como la comprensin de los nios y reducirn las teoras propias basadas el familiar fallecido, en los que evitamos mencionar que esa persona no va a volver nunca
en la fantasa: ms porque se ha muerto. Sirvan de ejemplo las siguientes expresiones:

28 29
 )PEFYIPSWILEMHS  Usemos expresiones que contengan la palabra Muerte y que dejen claro que no
 8YQEQj]EIWXjIRSXVSPYKEVQINSV volveremos a ver ms a la persona fallecida. Por ejemplo: La abuelita se ha muerto y
 )PTIVVMXSWILEUYIHEHSHSVQMHSIRYRWYIySQY]PEVKS ]ERSPEZEQSWEZSPZIVEZIV
 4ETjLEWYFMHSEPGMIPS
A menudo resulta difcil explicarles a los nios este concepto y es muy tentador dejarles
'SRZMIRIQEXM^EVUYIXSHSPSUYIWYFIXMIRHIEFENEVIREPKRQSQIRXSUYIUYMIRWI que sigan con la fantasa de reencuentro porque en realidad muchos adultos comparten
va suele volver y, si se est en otro lugar, suele haber un modo en el que comunicarse es esa idea. Pero, si no aclaramos la situacin, esto puede generar mucho desconcierto y
posible. Por eso, si recurrimos a estas explicaciones confusas, podemos acabar vindonos desconsuelo en el menor, al creer que ha dejado de ser importante para el ser querido
envueltos en una conversacin de este estilo: que ya no est y que por eso no regresa. Eso provoca que cuando el nio crece y, con
ese crecimiento, desarrolla la comprensin cognitiva de la irreversibilidad de la muerte, se
 Dnde est el abuelo? TVSHY^GEYRIRJEHSGSRIPEHYPXSUYIPSLE]EQERXIRMHSWMWXIQjXMGEQIRXIIRPEQIRXMVE
 Ya te he dicho que el abuelo ha subido al cielo, cario. o que no le haya aclarado la verdad sobre la muerte.
 Cmo se sube?
 7IWYFIIREWGIRWSV Por otro lado, tambin podemos caer en la tentacin de dejar que sean los nios quienes
 Cundo baja? lo descubran, sin aclararles las cosas, porque no estamos preparados para hacerlo. En
 No puede bajar porque es un ascensor de subida. nuestra experiencia profesional, hemos encontrado casos en los que, pasado un ao
 :EPIPPqZEQIEZIVIPEWGIRWSV desde la prdida, los menores preguntan cansados cundo va a regresar o a bajar a jugar
 No puedo, cario. la persona fallecida, porque ya ha pasado demasiado tiempo.
 Por qu?
 )WIEWGIRWSVWzPSPSZIR PSWQYIVXSW A menudo esta sensacin de que la persona fallecida va a volver procede de un adulto
HIP IRXSVRS HIP QIRSV UYI E ZIGIW TMIRWE UYI IR EPKR QSQIRXS WI TVSHYGMVj YR
Nunca debemos olvidar que los menores suelen interpretar la informacin de manera reencuentro con el fallecido, una idea que se transmite al nio. Sin entrar a valorar esta
literal y que el concepto de irreversibilidad de la muerte se adquiere con el paso del situacin, conviene aclarar que esas ideas slo causan sufrimiento y desconcierto aadido
tiempo. A medida que los nios crecen y se desarrollan cognitivamente, entienden que en el menor, ya que los nios no entienden de eternidades ni de tiempos de espera.
quienes fallecen no van a volver. Independientemente de lo que piense el adulto acerca del posible reencuentro, hay que
transmitirle al nio que LA MUERTE ES IRREVERSIBLE.
Para dejar claro el concepto de irreversibilidad, o por lo menos para que los nios se
aproximen a la idea y no se compliquen en el desarrollo es conveniente que: Mientras el nio no entienda eso, lo que va a experimentar es ira y frustracin hacia ese
adulto que no regresa o que ha dejado de tenerle en cuenta. Tambin intentar cosas
 )ZMXIQSW YXMPM^EV QIXjJSVEW GSQS7I JYI )WXj IR SXVS PYKEV 7I LE MHS ,E TEVEUYIIPJEPPIGMHSZYIPZENYRXSEqPEVIKEyEVPIEGIPIFVEVEJIPMGMXEVPISXVETSWMFMPMHEH
subido, etc. IWUYIQYIWXVIQYGLEJIPMGMHEHEPTIRWEVUYIIREPKRQSQIRXSZSPZIVjEVIYRMVWIGSR
 Expliquemos abiertamente que la persona fallecida NO VA A VOLVER. esa persona.

30 31
Es importante asegurarse de que el menor ha entendido que NUNCA ms volver a ver mucho que comprendan su universalidad: se niegan a creer que la muerte sea universal,
a la persona que ha fallecido. Slo cuando los nios asimilan el hecho de que la muerte es o en otros casos piensan que es selectiva, que solo les sucede a las personas ancianas, o
TIVQERIRXITYIHIREZER^EVIRIPHSPSVSIRIPHYIPS0EGSQTVIRWMzRHIUYIPEQYIVXI malas, etc.
IWHIRMXMZEIWPSUYILEGIUYIIPRMySWIEHETXIEWYRYIZEWMXYEGMzR 7MIWXSRSWIHE
el nio se mantiene en una constante espera que le impide recuperar la normalidad y las A menudo son precisamente las explicaciones de los adultos las que llevan a los nios a
rutinas imprescindibles en su vida. pensar que la muerte es selectiva, dicindoles cosas como: No te preocupes, que eso no
QIZEETEWEVEQu)WSPISGYVVIEPEKIRXIQEPE7MIQTVIZS]EIWXEVEXYPEHS2YRGE
XIZEQSWEJEPPEVIXG 'YERHSIPRMySIQTMI^EETVIKYRXEVWSFVIPEQYIVXI IWGYERHS
Irreversibilidad
IQTMI^EEGSRGIFMVPEMHIEHIUYIPEWTIVWSREWHIWYIRXSVRSGIVGERSTYIHIRQSVMV]
valora que todos van a morir, incluido l.
 Lo que muere no vive ms.
 Evitar metforas como ha subido, est, se fue o es una vida mejor.
La universalidad puede causar mucho temor a los nios. Para evitarlo, ante la temida
 2SIWEPKSXIQTSVEPIWHIRMXMZS
 Fundamental: entender que NO VAMOS A VER MS A ESA PERSONA. TVIKYRXE=XXIZEWEQSVMV#PEWVIWTYIWXEWUYITSHIQSWHEVPIWTSHVuERMVIRIWXEPuRIE
7uGEVMyS]SQIZS]EQSVMVTIVSGYERHSLE]ETEWEHSQYGLSQYGLSQYGLSXMIQTS
=SQIZS]EQSVMVGYERHSXWIEWQY]QE]SV]TYIHEWGYMHEVXIWSPS
'PEVSGEVMySTIVSGYERHS]SQYIVEXWIVjWQjWQE]SVLEFVjWLIGLSQYGLEWGSWEWLEFVjW
XIVQMREHSIPGSPIKMSXIRHVjWYREJEQMPMEXVEFENEVjW
9RMZIVWEPMHEH8SHSWPSWWIVIWZMZSWQYIVIRIREPKRQSQIRXS
Aunque podemos considerar algunas de estas respuestas una pequea mentira, el
Los nios creen que aquello que les es cercano nunca va a dejar de existir, que las objetivo que buscamos es que el nio entienda que todos vamos a morir, pero que lo
personas a las que quieren y que cuidan de ellos siempre van a estar a su lado. Por eso, es VE^SREFPIIWTIRWEVUYIIWSSGYVVMVjGSRIPTEWSHIPXMIQTSTSVUYIIWXEHuWXMGEQIRXIIW
normal que no les preocupe que sus seres queridos puedan morir, porque no contemplan lo ms probable.
esa opcin.
Si entiende la universalidad, el nio puede darse cuenta de que las personas que le rodean
9RE ZI^ UYI WI TVSHYGI PE TVMQIVE QYIVXI GIVGERE IP RMyS IQTMI^E E TVIKYRXEVWI E pueden morir, independientemente de que sean ms mayores.
quin afecta la muerte y la respuesta es que todos vamos a morir. Sin embargo, hay
UYIXIRIVGYMHEHSEPXVERWQMXMVPIIWXIGSRGITXS TSVUYIIPRMySIRXMIRHIPEMRQIHMEXI^  Mam, XXIZEWEQSVMV#
PMKEHEEPEVSXYRHMHEHHIIWXILIGLS )WHIGMV WMGYERHSPITVIKYRXEEYREHYPXS8XI  'EVMyS]SQIZS]EQSVMVHIRXVSHIQYGLSWQYGLSWEySW
vas a morir?, ste le responde rotundamente S, el nio entender que esa muerte va  7uTIVSPEQEQjHI0YMWWIQYVMz]IVEGSQSXEWuUYIXITYIHIWQSVMV
a producirse en un lapso muy corto de tiempo y se asustar enormemente al pensarlo.  )WZIVHEHGMIPSTIVSPSRSVQEPIWUYIPEWTIVWSREWWIQYIVERHIWTYqWHIQYGLSQYGLS
tiempo, o cuando estn muy, muy, muy malitas.
Con frecuencia los nios piensan que la muerte ocurre a nuestra voluntad y que hay cosas
UYITSHIQSWLEGIVTEVEMQTIHMVPESUYIMRY]IRIRPSWEGSRXIGMQMIRXSW )WXSHMGYPXE

33
4EVERSTVSZSGEVPEWIRWEGMzRHIMRQIHMEXI^IRPSWRMySWUYIRSHSQMRERPEWWIGYIRGMEW Una de las cosas ms importantes es que a los nios no se les debe mentir ni ocultar
temporales, lo ideal es que utilicemos el recurso de la postergacin, que explicaremos informacin. Las respuestas rotundas, sean en el sentido que sean, no suelen traer nada
ms adelante. bueno. Tanto el s como el no suelen jugarnos malas pasadas: el s, porque genera
mucha angustia en el menor ante la idea de la propia muerte, la soledad, el abandono; y
0ETSWMFMPMHEHHIPETVSTMEQYIVXIWITPERXIEYRMHEEPEMRQIHMEXI^RSWzPSGYERHSIPRMyS el no porque, al ser un engao, en la mente de los pequeos -donde prima la fantasa- se
valora la posibilidad, sino en el momento en que el adulto debe explicarle que l tambin hace posible la sensacin de inmortalidad o de una mortalidad dependiente de factores
va a morir, lo que hace que hablar a los nios de este punto sea muy delicado. Cuando controlables por la conducta del nio.
aparece en el nio la preocupacin sobre su propia muerte, es difcil explicrsela, por lo
que es tentador recurrir a una salida rpida del estilo: Como decamos antes, un recurso al que podemos recurrir ante la angustia de los nios
es la postergacin: cuando se produce un fallecimiento en la familia, es normal que los
 'zQSXIZEWEQSVMVXGSRPSTIUYIySUYIIVIW# RMySWQYIWXVIRQMIHSERXIPETSWMFMPMHEHHIUYIWITVSHY^GERSXVEWQYIVXIW(IRXVSHI
 4IRWEVIWSIWYREXSRXIVuETSVUYIXSHSWIWXEQSWQY]FMIR esa preocupacin, nos estn expresando muchos temores ms: quin les va a cuidar, quin
les recoger del colegio, quin les har la comida, quin va a acostarles, si podrn celebrar
Esa angustia que nos invade cuando tenemos que explicarle al nio que l o nosotros WYGYQTPIEySW(IELuUYIVIGYVVEQSWEPETSWXIVKEGMzR%RXIPETVIKYRXE8XIZEW
vamos a morir -cuando a menudo los adultos ni siquiera estamos preparados para asumir a morir, mam?, podemos responder:
nuestra propia muerte- nos hace sentir muchsima culpa por la angustia y el temor que
podamos transmitirle.  'EVMySPSRSVQEPIWUYI]SQIQYIVEGYERHSXWIEWQjWQE]SV]XITYIHEWGYMHEVWSPS
 Qu pasa si pap se muere?
Sin embargo, podemos contarle la verdad de manera que el menor pueda entender el  7MTETjWIQYIVI ]SXIVIGSKIVqHIPGSPIKMS]GYMHEVqHIXMTEVEUYIWMIQTVIXIRKEWPS
GSRGITXS]GSRHIPMGEHI^EYWERHSYRPIRKYENIUYITYIHEGSQTVIRHIV)RIPGEWSHIUYI que necesitas.
la muerte de un ser querido sea previsible (enfermedad grave, etc.), es importante que el
RMySZE]EMRXIVMSVM^ERHSKVEHYEPQIRXIIWETSWMFMPMHEH )RSGEWMSRIWYXMPM^EVPETSWXIVKEGMzRMQTPMGELEFPEVHIGMIVXEMRGIVXMHYQFVI)WXMPYXMPM^EV
expresiones como: 'YERHS WIE QY] QY] QE]SV7M IWXj QY] QY] QY] IRJIVQE etc.
En ocasiones el fallecimiento de un ser querido nos impacta tanto que tratamos de Es cierto que esta respuesta puede no ser real, pero lo probable o lo esperable en caso
explicarle al nio las cosas de manera gradual. Ese retraso en las explicaciones sobre la HIQYIVXIWRSXVEYQjXMGEWIWUYISGYVVEHIIWIQSHS=EWuIPRMySTYIHIIRXIRHIVPE
QYIVXIEZIGIWHEPYKEVEGSQTPMGEGMSRIW]EUYILE]UYIRKMVUYIPEQYIVXIERRSLE muerte con mayor facilidad.
tenido lugar y esconder determinadas emociones; o tambin puede provocar que el nio
WIWMIRXEHIWTPE^EHS]IRKEyEHSGSQSWMRSJYIVEYRQMIQFVSMQTSVXERXIIRPEJEQMPME No hay que perder de vista las limitaciones del menor y cmo va construyendo sus
Normalmente, ante las muertes violentas, inesperadas o los suicidios, se suele engaar al VIGYVWSWTEVEUYIWIEGETE^HIMRXIKVEVIWXERYIZEWMXYEGMzRWMREXEWGEVWIIRMHIEWUYI
nio. Son situaciones en las que no se encuentra la forma ni el momento idneo para PINSWHIE]YHEV HMGYPXEVjRPEGSQTVIRWMzRHIYRLIGLSUYIIWXERGMIVXSGSQSPEZMHE
abordar el tema y se lo ocultamos al menor mientras decidimos qu le vamos a explicar. Por lo tanto, se hace necesario huir de las mentiras piadosas, las respuestas edulcoradas o
las historias mgicas que quitan realismo y protagonismo a la verdad de la muerte en s.

34 35
Tampoco usaremos respuestas rotundas y en nuestras explicaciones nos centraremos )WXSWQIRWENIWUYIPSWEHYPXSWVIPEXMZM^EQSWWYIPIRGSRJYRHMVEPRMySTSVHSWQSXMZSW
en que los pequeos entiendan que TODOS nos vamos a morir, pero que ser cuando principales:
hayamos hecho muchas cosas o haya pasado mucho tiempo, recurriendo a la postergacin
como herramienta principal.  El pensamiento concreto o el escaso desarrollo cognitivo de los nios

2SIWJjGMPI\TPMGEVIPRHIPEWJYRGMSRIWZMXEPIWEPSWQjWTIUYIySW]UYIPSIRXMIRHER
Universalidad: Todos morimos
En general, suelen equiparar la muerte a un sueo, piensan que la muerte es otro estado
y que los muertos sienten, ven, oyen y experimentan cosas. se es el motivo por el que
 Cuidado con las respuestas rotundas.
preguntan si los difuntos llevan ropa, si se han llevado las gafas para poder ver la televisin,
 Con los ms pequeos se usa la postergacin.
se preocupan porque el telfono mvil sigue encima de la mesa, etc.
 Si la muerte es previsible, les introduciremos en ella de manera gradual.
 Objetivo: que entienda que todos vamos a morir sin que eso le genere angustia.
Otras veces los nios piensan que las limitaciones vienen dadas por circunstancias externas,
TSVINIQTPSPSWQYIVXSW]ERSWIQYIZIRTSVUYIIPEXEHIWQY]IWXVIGLSSRSTYIHIR
ver porque donde estn est muy oscuro; o no nos hablan porque estn dormidos. Es
habitual que hagan preguntas sobre cmo estn los fallecidos, si estn contentos, si ven
3. El cuerpo deja de funcionar: Todas las funciones vitales se paran tras la PE XIPIZMWMzR WM LEGI JVuS WI TVISGYTER TSV PS UYI WMIRXIR WMR GSQTVIRHIV UYI IWEW
muerte funciones estn interrumpidas.

El objetivo es que los nios entiendan que, despus de la muerte, todas las funciones
 /DGLFXOWDGGHODVH[SOLFDFLRQHVTXHRIUHFHHODGXOWR
del cuerpo dejan de trabajar, es decir: cuando las personas fallecen no ven, no oyen, no
WMIRXIR RSLEFPER RSWYJVIR RSWMIRXIRHSPSV1MPHIXEPPIW]QEXMGIWUYIIWGETEREP
Los adultos somos en parte responsables de esta incomprensin debido al uso continuado
entendimiento de los menores.
que hacemos de las metforas. Al hacerlo, no solemos caer en la cuenta de que a veces
el menor no puede distinguirlas de la realidad y las va a entender de manera literal. Esto
0SWEHYPXSWXIRHIQSWEIQTPIEVJSVQEWHILEFPEVUYIHMGYPXERQYGLSPEGSQTVIRWMzR
de esa interrupcin de las funciones. Muchas de las expresiones que confunden a los VIWTSRHIERYIWXVSEJjRTSVWYEZM^EVPEWI\TPMGEGMSRIWERXIPSWRMySW]UYIHEVRSWQjW
pequeos van en esta lnea: tranquilos cuando les decimos cosas que son incapaces de procesar.

 7IQILEQYIVXSIPQzZMP Algunos ejemplos los encontramos en frases como: 1EQj XI WMKYI UYIVMIRHS ] XI ZE
 )PGSGLIWILEUYIHEHSQYIVXS EGYMHEVWMIQTVI)PEFYIPSWIUYIHzHSVQMHMXSQY]XVERUYMPS%YRUYIRSZIEWETETj
 0EQYyIGEXMIRIJVuSXjTEPE qP XI ZE E IWXEV SFWIVZERHS WMIQTVI HIWHI IP GMIPS 4YIHIW GSRXEVPI PS UYI UYMIVEW UYI
 4ETjZEEIWXEVWMIQTVIEXYPEHS XI IWGYGLE HSRHI IWXq 0S RMGS UYI GSRWIKYMQSW GSR RYIWXVE FYIRE MRXIRGMzR HI
 1EQjZEEZIVXSHSPSUYILEGIWHIWHIIPGMIPS WYEZM^EV PE QYIVXI IW TVSZSGEV GSRJYWMzR IR IP QIRSV ] E QIHMS TPE^S KIRIVEVPI YR
 4SVPEWRSGLIWTYIHIWGSRXEVPIXSHSPSUYIXITVISGYTI mayor sufrimiento.
 7IKYVSUYIXIZEEE]YHEVQYGLSHIWHIIPGMIPS

36 37
Cuando le damos explicaciones al nio dando a entender que la persona fallecida puede  Miedo a los espritus.
seguir haciendo cosas all dnde est, puede parecerle que sigue viva de verdad. Usamos  Miedo a quedarse solos en casa o en otros lugares.
I\TVIWMSRIWUYILEGIRUYIPSWQYIVXSWTEVI^GERZMZSW
Al hablar de la muerte con los nios hay que hacer un especial nfasis en el hecho de que,
 7IKYVSUYIETETjPIKYWXEQYGLSXYGEVXE GYERHSPEWTIVWSREWQYIVIR]ERSZIRRMS]IRWYGSVE^zRRSPEXIRSWYJVIRRSLYIPIR
 El abuelo est muy orgulloso de tu actuacin. IPGYIVTSLEHINEHSHIWIRXMV RSTYIHIRLEFPEV,E]UYIHINEVGPEVSEPQIRSVUYIPE
 8MIRIWUYITSVXEVXIFMIRUYIQEQjPSZIXSHSHIWHIIPGMIPS QYIVXIGSRPPIZEIPREPHIPEWJYRGMSRIWZMXEPIW%WuIZMXEVIQSWGSRJYWMSRIW]TVIKYRXEW
relativas a si los muertos sufren en el entierro, si hay sensacin de ahogo, si se queman,
 7MIQTVIZS]EIWXEVEXYPEHS
WMRSWZIRYS]IR WMTYIHIRSPIV WMXMIRIRJVuSSWMZEREPIIV=XSHEWIWEWGSWEWUYI
 2YRGEXIZS]EHINEVWSPS
se les ocurren a los nios y giran en torno a que las funciones fsicas se mantienen tras
 :EQSWEPPIZEVPIIWXEWSVIWEQEQjUYIWSRWYWTVIJIVMHEW
la muerte.

El objetivo es que el nio entienda no slo que las funciones vitales han desaparecido, sino
Slo cuando el nio entiende que esas funciones se han interrumpido podemos explicarle
que, cuando se usan expresiones como esas, a lo que apelamos los adultos es a cmo nos PSUYIWMKRMGEUYIYRETIVWSREIWXjZMZEIRRYIWXVSVIGYIVHS]UYIGYERHSTIRWEQSW
gustara que fuera: a que la persona fallecida est viva en nuestra memoria y en nuestro en la posibilidad de que nos escucha o podemos dirigirnos a ella, slo estamos apelando
GSVE^zR E XVEZqW HIP VIGYIVHS HI PEW GSWEW UYI ZMZMQSW NYRXSW 7M RS EGSQTEyEQSW a un recuerdo y a cmo nos gusta recordar a la persona que ha fallecido, que siempre va
este tipo de expresiones con una explicacin apelando al recuerdo o a la memoria del EIWXEVIRRYIWXVEQIQSVME]RYIWXVSGSVE^zR
JEPPIGMHS IPRMySIRXMIRHIUYIIWETIVWSREIWXjZMZEIREPKRPYKEV ]EUYITYIHILEGIV
cosas propias de los vivos. As que tendremos que explicarle que no est viva, sino que -Cuando una persona muere deja de existir? El abuelito ya no existe?
IWXjIRRYIWXVEQIQSVMEGSQSWMWMKYMIVEZMZEIRIPVIGYIVHSSIRRYIWXVSWGSVE^SRIW 2S GYERHSEPKYMIRQYIVITIVQERIGIIRRYIWXVSVIGYIVHS EZIV qu cosas recuerdas que
hacas con el abuelo?
Esas explicaciones adultas en las que dotamos al fallecido de cualidades fsicas y lo -bamos a comprar helados a escondidas.
describimos como si pudiera hacer cosas propias de los vivos pueden resultar aterradoras -Bien, as es como a ti te gusta recordar al abuelo, yendo contigo a escondidas a comprar
para los nios. Si lo pensamos framente, el hecho de que alguien a quien no vemos, ni helados.
WIRXMQSW RM TSHIQSW EFVE^EV TYIHE ZIVRSW S ZMKMPEVRSW HIWHI GYEPUYMIV PYKEV KIRIVE -Entonces, puede comprar helados ahora?
bastante incomodidad y una ms que probable sensacin de terror en los nios. No en 2SRSTYIHI]ERSTYIHIGSQTVEVTIVSXTYIHIWVIGSVHEVPIIRXYGSVE^zRGSQTVERHSIWSW
helados.
vano hay muchos adolescentes que, ante esta confusin, temen que el fallecido tenga la
-Tambin me lea cuentos cuando me quedaba a dormir en su casa.
capacidad de comunicarles cosas, e incluso dirigirse o aparecerse ante ellos.
-Claro, ya no puede leerte cuentos, el abuelo no est y no puede leer, pero puedes acordarte
HIIWSWGYIRXSWUYIXIPIuE]PIIVPSWX TYIHIWEGSVHEVXIHIXSHEWPEWZIGIWUYIWIWIRXz
)WLEFMXYEPUYIXVEWIWXEWI\TIVMIRGMEWPSWQIRSVIWQERMIWXIR
contigo en la cama a leer.

 Miedo a dormir solos.


 1MIHSEHINEVPEPY^ETEKEHE
 Temor a apariciones o fantasmas.

38 39
No hay que olvidar que todos dormimos, que los accidentes de cualquier tipo son muy
El cuerpo deja de funcionar: las funciones vitales se detienen comunes y que tambin nos ponemos enfermos. Por eso, estas explicaciones pueden
generar confusin y temor en los pequeos.
 El muerto no ve, ni oye, ni respira, ni siente, ni huele, ni piensa, etc.
Cualquier explicacin que se aleje de la realidad que caus el fallecimiento del ser querido
 Evitar expresiones que hagan referencia a las funciones vitales en un intento de
puede llevar a los menores a creerse sus propias teoras sobre qu fue lo que caus
XVERUYMPM^EVEPRMyS
en realidad la muerte. Por eso, es fundamental aclararle al nio que sus pensamientos,
 Evitaremos el uso de metforas, porque confunden.
sentimientos, la rabia, el enfado o los celos jams van a causar la muerte de nadie: tienen
 Apelamos al recuerdo y a la memoria cuando el nio comprenda que las fun-
que saber que ellos no tienen la culpa de lo que ha pasado.
ciones vitales se han detenido.

En consecuencia, a la hora de explicar a los nios la muerte es conveniente centrarse en el


plano fsico: no hace falta entrar en detalles innecesarios, ni en el morbo que puede suscitar
el suceso, especialmente cuando se trata de una muerte violenta como un suicidio, un
,E]YREGEYWE0EQYIVXIXMIRIYREI\TPMGEGMzR]IWJuWMGE EGGMHIRXIHIXVjGSSYREEKVIWMzR%WuUYIPIWI\TPMGEVIQSWPEGEYWEJuWMGEWMRQIRGMSREV
los detalles de carcter morboso.
El nio tiene que entender que la muerte se produce por una causa, hay algo que la ha
motivado, que las personas no mueren de nada o sin una causa fsica. Es fundamental Como hemos explicado anteriormente, hay que huir de las metforas que, lejos de facilitar
explicarles a los nios cul ha sido la causa exacta de la muerte del ser querido: si fall la comprensin del nio, aaden confusin al suceso y pueden incrementar sus miedos:
IPGSVE^zRWMJYIVSRPSWTYPQSRIWWMIPGIVIFVSHINzHIJYRGMSREVSGYEPUYMIVSXVEGEYWE
fsica que desembocase en la interrupcin de las funciones vitales de la que hablbamos  7IHYVQMz]WIUYIHzQY]XVERUYMPSTIVS]ERSTYHSHIWTIVXEVWI
 8YLIVQERMXEIVEXERFYIREUYIIPRMyS.IWWUYMWSUYIWIJYIVEGSRqP
en el apartado anterior.

3JVIGIVEPRMySYREI\TPMGEGMzRHSRHIPIGSRXIQSWUYIIPGSVE^zRHIPETIVWSREJEPPIGMHE
Si los nios no entienden que hay una causa fsica, lo que puede ocurrir es que asocien la
dej de latir, o que sus pulmones ya no funcionaban, o que su cuerpo dej de funcionar
muerte a un detalle, a un estado o incluso que se sientan culpables de la misma. Pueden
FMIRTSVUYIIPGIVIFVS]ERSIRZMEFEPEWzVHIRIWRIGIWEVMEW STSVUYIIPGSVE^zRWI
llegar a pensar que sus pensamientos, sus enfados o su comportamiento han podido
HIXYZS]]ERSFSQFIEFEPEWERKVIUYIRIGIWMXEIPGYIVTSTEVEWIKYMVZMZS IWWYGMIRXI
causar ese fallecimiento y aadir problemas a la elaboracin de su duelo.
para que los nios pequeos comprendan las causas fsicas que han provocado la muerte.
En cuanto a los preadolescentes y adolescentes, estos suelen entender sin mucho problema
'SRJVIGYIRGMEPSWEHYPXSWYXMPM^EQSWI\TVIWMSRIWGSRJYWEWTEVEI\TPMGEVPEQYIVXIEPSW
las causas fsicas porque ya han aprendido el funcionamiento del cuerpo humano.
nios, suelen ir en esta lnea:

9RTVSFPIQEGSQREPELSVEHIEFSVHEVYRETqVHMHEGSRPSWRMySWIWUYI ETIWEVHI
 )PEFYIPSWIUYIHzQY]XVERUYMPSQMIRXVEWHSVQuE PE I\TPMGEGMzR GMIRXuGE HI PE QYIVXI E QIRYHS PEW JEQMPMEW XMIRIR GVIIRGMEW VIPMKMSWEW
 4ETjXYZSYREGGMHIRXI IWTMVMXYEPIW S PSWzGEW UYI SXSVKER E qWXE HMJIVIRXIW WMKRMGEHSW )R IP WIV LYQERS
 8YZSYRTIVGERGI]WIQYVMz existe la necesidad de dar continuidad a la vida despus la muerte, as que tendremos que
 1IEPIKVSHIUYIWIQYVMIVETSVUYIIVEQY]QEPS adaptar algunas explicaciones para que los nios entiendan las diferentes interpretaciones
 0EIRJIVQIHEHPSQEXz religiosas o espirituales de la muerte y no se queden en el mundo abstracto.

40 41
4SVIWXEVE^zR TEVXMVIQSWHIPEI\TPMGEGMzRHIPEQYIVXIJuWMGEERXIWHIHEVTEWSEPE Bsicamente hay que conseguir que el nio entienda que la muerte ocurre en un momento
interpretacin religiosa. Slo cuando el plano fsico est aclarado podremos dar paso a las determinado y es independiente de la bondad o la maldad de la persona que fallece, as
creencias que comparta la familia, buscando la forma de que los nios entiendan que esas GSQSHIWYIHEHSWYWGMVGYRWXERGMEW=UYIGSQTVIRHEUYIERXIYRQMWQSWYGIWSLE]
creencias religiosas constituyen un modo de elaborar el recuerdo de la persona fallecida. personas que sobreviven y otras que no. En cierto modo, se trata de explicarles a los
RMySWIPKVEHSHIE^EVUYIEZIGIWXMIRIPEQYIVXI
En este punto hay que aclarar que el Cielo que imaginamos los adultos no tiene nada que
ZIVGSRIPGMIPSMRJERXMPIWIIWTEGMSE^YPEPUYIQMVERXSHSWPSWHuEW SHIPSGSRXVEVMS
Toda muerte tiene su causa
pueden acabar buscando incesantemente al fallecido entre las nubes y el paisaje. Basta con
explicarle al nio que cuando decimos que un ser querido est en el cielo, hablamos del  Las causas son fsicas y hay que explicarlas.
lugar en el que a nosotros nos gusta recordar a esa persona y que tiene que ver con la  ,E]UYIIRXIRHIVPEQYIVXIJuWMGETEVETSHIVMRXVSHYGMVPEWGVIIRGMEWVIPMKMSWEW
QERIVEIRUYIPEVIGSVHEQSW%WuWMIPJEPPIGMHSIVEQY]EGMSREHSEPEQWMGEWYGMIPS  No depende de la bondad o la maldad de cada uno, ni de la edad u otros
WIKYVEQIRXIWIVjYRTVIGMSWSGSRGMIVXS WMIVEQY]EGMSREHSEPEQSRXEyE TSHVIQSW detalles.
explicarle al nio que su cielo ser como una preciosa montaa por la que podr pasear, y  Debemos evitar las explicaciones que no mencionen las causas: no se muere
UYIIWEWuGSQSERSWSXVSWRSWKYWXEVIGSVHEVEPJEPPIGMHS]PPIZEVPSIRIPGSVE^zR YRSHIYREGGMHIRXIRMHIVITIRXIRMHIKSPTI

-Qu le ha pasado al abuelito, mam?


-)PEFYIPSWILEQYIVXSIWSWMKRMGEUYIWYGSVE^zR]ERSPEXIUYIRSPIZEQSWEZIVQjW
UYIRSTYIHIZIVRMLEFPEVRMPIHYIPIREHE 3.3. QUIN, CMO, CUNDO Y DNDE COMUNICAR LA MUERTE

-Y ahora dnde est? 'zQSTSHVuEZIVPI#


Como imaginaris, al transmitir a los nios la noticia de un fallecimiento, debemos hacerlo
-=ERSIWXjEUYuRSTSHIQSWZIVPITIVSEQuQIKYWXEVIGSVHEVPIIRPEWGSWEWUYILEGuEGSR
WIKRPEPzKMGE]PEZIVHEHUYIKYuERPSWTVSGIWSWMRJERXMPIW EPINjRHSRSWHIQIRXMVEW]
nosotros. Me gusta pensar que est en el cielo, que es como un recuerdo de las cosas que a l
detalles que edulcoren lo que ha ocurrido.
le gustaban. Recuerdas que le gustaba mucho la jardinera? Pues a m me gusta imaginrmelo
GSR IWI WSQFVIVS UYI WI TSRuE GYERHS HMWJVYXEFE EVVIKPERHS IP NEVHuR Cmo te gustara
La noticia debe ser transmitida por personas queridas y cercanas al nio, que estn en
imaginrtelo a ti?
contacto con l de manera habitual: a ser posible sus padres o uno de ellos en el caso del
-%QuGYERHSQIPPIZEFEEGSQIVLIPEHSW]QIGSKuEHIPEQERS fallecimiento del otro progenitor. Si han fallecido ambos, debe comunicrselo la persona
-4IVJIGXS TYIWIPGMIPSIWGSQSPSZEQSWEVIGSVHEV te parece? Para m ser el jardn del que se quedar al cuidado del menor y/o quien est ms cercano a l.
abuelo y para ti, el quiosco de helados.
Se debe comunicar al menor la noticia lo antes posible, preferiblemente de forma
Por supuesto, habr muchas preguntas que no sabremos responder, pero los nios inmediata, en lugar de esperar horas o das a que terminen los ritos y homenajes. Los
no buscan explicaciones perfectas, as que no pasa nada por admitir ante ellos que no nios deben estar entre las primeras personas en enterarse si quien ha fallecido es uno
sabemos determinadas cosas, o por preguntar a otras personas que seguramente podrn SEQFSWTVSKIRMXSVIW]HIFIRWEFIVPSPSERXIWTSWMFPIIRIPGEWSHIUYIUYMIRJEPPI^GE
ayudarnos a encontrar una respuesta ms adecuada. sea una persona muy cercana. De lo contrario, le estaremos dejando fuera de aspectos
importantes y eso puede complicarnos el manejo de otras situaciones a posteriori.

42 43
,E] UYI IPIKMV YR PYKEV uRXMQS UYI IWXq PMFVI HI TSWMFPIW MRXIVVYTGMSRIW HSRHI PSW
nios o adolescentes puedan expresar sin miedo las dudas, emociones o reacciones que
XIRKERXVEWWIVPIRSXMGEHEPEQYIVXIHIPWIVUYIVMHS)WIPYKEVHIFITIVQMXMVEUYMIRIW
se encarguen de transmitir la noticia la expresin emocional sin tapujos y el contacto,
as como ofrecerles un espacio para comprender las distintas reacciones que pueda
manifestar el menor.

Como ya hemos explicado, en caso de que sean los padres quienes hayan fallecido o
estos se encuentran muy impactados por la noticia y no puedan encargarse de dar la
noticia al nio, es muy importante que lo haga otra persona en la que el nio confe, con
UYMIRXIRKEXVEXS]EJIGXS YRXuS YREFYIPS  GYEPUYMIVTIVWSREUYIWIEWMKRMGEXMZE
para el nio. Primaremos la cercana independientemente del vnculo que les una. Por ello,
si la persona encargada tiene que ser la madre de un amigo o su cuidador o cuidadora,
MRGPYWSYREIQTPIEHEHILSKEVWIVjPETIVWSREIPIKMHEWMGYQTPIPSWGVMXIVMSWHIGSRER^E
y cario.

Si las personas que deben comunicar la muerte se ven invadidas por emociones muy
intensas, como suele ocurrir cuando se sufre una prdida inesperada o traumtica, es
conveniente proteger al nio de situaciones muy desbordantes que puedan asustarle.
En ese caso, la persona elegida ser la ms cercana que pueda transmitirle la noticia de
manera triste pero calmada, sin explosiones emocionales que puedan resultar demasiado
excesivas o desbordantes para que el nio las pueda procesar, o que puedan generarle la
sensacin de una gran desgracia.

2S IW RIGIWEVMS XVERWQMXMVPI EP RMyS XSHE PE MRJSVQEGMzR HI KSPTI IQTI^EVIQSW TSV
contarle lo que consideremos esencial y, despus, podremos ir aadiendo detalles de
QERIVEKVEHYEP WIKRWIERIGIWEVMSSEQIHMHEUYIIPQIRSVRSWTPERXIITVIKYRXEWS
dudas.

Es muy importante favorecer el dilogo: que el nio o el adolescente se sienta libre


de preguntar, independientemente de si sus preguntas puedan afectar al adulto o no.
Debemos dejar la puerta abierta al dilogo. Si las preguntas que hace son muy complicadas
S QSVFSWEW TSHIQSW IQTPE^EVPEW TEVE VIWTSRHIV QjW EHIPERXI S VIWTSRHIV GSR YR
simple: No lo s, podemos buscar a alguien que nos lo explique.

44 45
Cuando tiene lugar una muerte en el entorno del menor, hay que comunicrselo al es conveniente recordar que, si el nio no ha sido iniciado en las creencias religiosas, la
colegio. No podemos olvidar que es un lugar donde el nio pasa muchas horas al da y muerte puede ser un momento demasiado confuso para hacerlo o incluso podemos
donde puede manifestar muchas conductas y expresiones relacionadas con el duelo que generar en el nio miedos a las ideas abstractas relacionadas con la religin.
los responsables del centro escolar no entendern sin el contexto adecuado.
Al comunicar a los nios la noticia del fallecimiento de un familiar, vamos a encontrarnos
Es fundamental que, al transmitir la noticia, afrontemos la verdad que rodea a la muerte, con muchas preguntas que cuestionan el porqu de la muerte, en algunos casos similares
TSVQY]HYVEUYIWIE)WSIZMXEVjUYIIRYRJYXYVSIPRMySWIWMIRXEIRKEyEHS0SRMGS a las que hacen los adultos: Por qu se ha tenido que morir? Por qu nos ha pasado esto a
UYILEVIQSWIWEHETXEVPEZIVHEHEPHIWEVVSPPSGSKRMXMZSHIGEHERMySTEVEUYIWIEGETE^ nosotros? PSVUYqREHMILM^SREHE#Por qu cogera la moto esa maana? Por qu se puso
de entender los aspectos ms importantes que rodean al suceso. IRJIVQEQEQj#4SVUYqRSRSWHMQSWGYIRXEERXIWHIUYIQEQjIWXEFEXERQEPMXE#

Afrontar este tema con la verdad permite que el nio confe en nosotros y se sienta parte La mayora de las cuestiones sern preguntas que intentan variar la situacin, que
activa de todo el proceso. Por muy duras que sean las circunstancias de la muerte, ms mantienen en la imaginacin la posibilidad de que la muerte no haya sucedido. Si hay
HYVSWIVjIRJVIRXEVWIEYREQIRXMVE]EPEHIWGSRER^EUYIKIRIVEIRIPQIRSVHIWGYFVMV YREI\TPMGEGMzRVE^SREFPIEPLIGLSIRWuIWFYIRSGSRXjVWIPEEPQIRSVTIVSXEQFMqRIW
posible que nosotros nos estemos haciendo las mismas preguntas o que no sepamos qu
que ha sido engaado y, adems, en un tema tan importante como ese.
responder. En ese caso, debemos indicarle al nio que no sabemos si hay una respuesta
correcta o que nos vaya a dejar ms tranquilos. Es bueno que el nio entienda que a veces
9XMPM^EVINIQTPSWETEVXMVHIPEREXYVEPI^EHISXVSWWIVIWZMZSWSI\TIVMIRGMEWHITIVWSREW
los adultos no tenemos respuestas para todo.
cercanas en torno a la muerte puede ayudar mucho en un primer momento a que los
pequeos comprendan los aspectos fundamentales de la muerte.
Por mucho que aclaremos todo lo que pregunte el nio, hay que tener en cuenta que
plantear muchsimos interrogantes ntimos o relacionados con sus construcciones
2SLE]UYIXIRIVQMIHSHIYXMPM^EVPEWTEPEFVEWQYIVXI]QYIVXSRSZEQSWEEWYWXEVPIW imaginarias. En esa situacin, lo ms importante es que estemos abiertos al dilogo, que
y es lo adecuado en ese momento. pueda preguntar algo aunque a nosotros nos incomode o aunque no tengamos una
respuesta certera que darle. Las dudas que nos plantee el menor podrn orientarnos
Como ya hemos comentado, es importante que los nios entiendan que el cuerpo de acerca de sus necesidades con respecto a la muerte y el duelo.
la persona fallecida ha dejado de funcionar y con l todas las funciones vitales asociadas:
IPHMJYRXSRSZI RSS]I RSLEFPE RSWMIRXI RSPIHYIPIRPEWGSWEW RSGSQI0SUYI Un punto clave es aclarar la responsabilidad del menor frente a la muerte. Cuando
permanece son los recuerdos que tenemos del tiempo que hemos disfrutado con l. hablamos de responsabilidad no slo hacemos referencia a los casos en que los nios
)WXSWWIUYIHERIRRYIWXVEQIQSVME]RYIWXVSGSVE^zR]TSHIQSWEGYHMVEIPPSWGYERHS sienten que han provocado el fallecimiento del ser querido, sino tambin a cuando piensan
sea necesario. Las cosas que hemos vivido con ellos perdurarn siempre en el recuerdo. errneamente que el fallecido ha muerto disgustado, enfadado, molesto o preocupado
por algo que hicieron y que no ha quedado resuelto (sacar malas notas, un parte del cole,
una amonestacin, un castigo). El pensamiento mgico es muy poderoso en la primera
Es el momento de introducir las creencias religiosas, en caso de que la familia las tenga,
infancia y puede llevar al menor a pensar que un ser querido ha muerto por algo malo
GSQS LIQSW I\TPMGEHS ERXIW ,E] UYI IZMXEV HIXIVQMREHEW JVEWIW LIGLEW UYI WYIPIR
que ha hecho.
decirse en estas circunstancias: )VEXERFYIRSUYI(MSWLEUYIVMHSPPIZjVWIPS,EGuEQjW
JEPXEIRIPGMIPSUYIEUYu%LSVEIWXjQINSVTSVUYIIWXjGSR(MSW Llegados a este punto,

46 47
En el caso de los adolescentes, puede ocurrir que por enfado hayan sentido el deseo de Lo que les lleva a hacer estas preguntas concretas es el temor a que, tras la prdida del
que esa persona muera o deje de ser su pariente, por el hecho de buscar la independencia: ser querido, se desmorone el mundo y el estilo de vida que llevan. Necesitan saber cmo
3NEPjRSJYIVEMWQMWTEHVIW3NEPjIWXYZMIVEMWQYIVXSW WIVuEXSHSQjWJjGMP etc. Algunos se van a ver afectadas las rutinas que les dan seguridad y les permiten predecir el entorno
TYIHIRLEFIVPSI\TVIWEHSIRZS^EPXE]SXVSWXEPZI^PSLE]ERHIWIEHSQIRXEPQIRXI tal y como lo conocen. Por eso, tras darles la noticia de la muerte, es importante que
pero la realidad es que esos comentarios acaban generando culpa en los adolescentes y IRXMIRHER UYI WYJVMVjR IP QIRSV RQIVS TSWMFPI HI GEQFMSW ] WMIQTVI XVEXERHS UYI
dudas sobre si el fallecido sabra que en el fondo le queran. estos no afecten a sus rutinas. Es necesario generar la mnima incertidumbre posible al
nio: necesita saber que su mundo va a estar intacto.
Es bueno que les ayudemos a expresar esos sentimientos de culpabilidad tan destructivos,
ya que de lo contrario pueden hacer que el duelo se complique o se alargue mucho,
Otro de los temas importantes a abordar con el nio es que la persona que ha muerto no
porque creen que hay asuntos sin resolver.
ZEEWIVSPZMHEHERMVIIQTPE^EHETSVREHMI0IVIGSVHEVIQSWUYIIPJEPPIGMHSTIVQERIGIVj
en nuestra memoria y nuestro recuerdo, y que siempre podremos recordarlo. Del mismo
La intencin es que el nio entienda que los pensamientos, las palabras, las conductas, los
modo, si nos pregunta si puede tener otro pap u otra mam, le explicaremos que l ya
gestos no slo no matan, sino que tampSGSWSRWMKRMGEXMZSWWMPSWGSQTEVEQSWGSRIP
resto de tiempo compartido con la persona fallecida. tuvo un pap o una mam y que no puede tener otro, pero que puede tener a otras
personas que le cuiden igual de bien que lo haca el fallecido.

'SQS]ELIQSWGSQIRXEHSERXIVMSVQIRXI IWQY]MQTSVXERXIKEVERXM^EVPEWIKYVMHEH
HI PSW RMySW IW RSVQEP UYI XVEW YRE RSXMGME EWu XIRKER QMIHS HI UYI WI TVSHY^GER )WJYRHEQIRXEPXVERUYMPM^EVEPRMySGYERHSQERMIWXEIPXIQSVHISPZMHEVWIHIPETIVWSRE
que ha fallecido, o de los detalles que ha vivido o sentido con ella. Debemos explicarle que
otras muertes. Por eso, les explicaremos en qu consiste la seguridad y la proteccin
TSHIQSWEPQEGIREVIWSWVIGYIVHSWIRRYIWXVEQIQSVMEIRIPGSVE^zR]UYITSHIQSW
que podemos ofrecerles en esos momentos. Deben entender que la muerte no es una
epidemia que vaya a afectar a todas las personas de su entorno y dejarles desprotegidos. buscar actividades que le ayuden a recordar a esa persona cuando sea muy, muy mayor.
En los adolescentes este miedo se exacerba, temen que el paso del tiempo les haga
Explicarles los aspectos ms prcticos de su cuidado (cmo va a ser, quin va a recogerles
TIVHIVPSWVIGYIVHSWUYIGSRWIVZERYSPZMHEVWIHIPXSRSHIZS^HIPSPSVHIPWIVUYIVMHS
del colegio, quin les preparar la comida, dnde van a vivir) suele darles tranquilidad y
WIKYVMHEH%QIRYHSIWWYGMIRXIGSRSJVIGIVEPQIRSVYREI\TPMGEGMzRWIRGMPPEHIUYI
Estos temores son reales, pero debemos dirigirles a los recuerdos esenciales y animarles
nos vamos a ocupar de l y que no le va a faltar nada.
a hacer cosas que les ayuden a mantenerlos intactos para poder apelar a ellos con el

En los nios ms mayores y en los adolescentes podemos encontrar un pensamiento paso del tiempo. Para generar esos recuerdos es importante hablar de los fallecidos,
de las emociones y sensaciones que tenemos, sin escondernos y sin miedo. No hablar
parecido al adulto sobre cmo va a afectar la prdida a su futuro, es decir, en qu
HIPETIVWSREUYILEQYIVXSHMGYPXEEPSWRMySWXIRIVVIGYIVHSWVIEPIW EWuUYIHIWHI
aspectos va a afectar su vida la muerte de ese familiar. En estos casos pueden aparecer
preocupaciones de corte adulto, como: 5YMqRZEETEKEVPEGEWE#5YqZEQSWELEGIVGSR el primer momento nombraremos al fallecido y hablaremos de l o ella con la mxima
naturalidad posible.
IPGSGLI#. Se harn preguntas sobre el estatus socioeconmico de la familia, los privilegios
HIPSWUYIKS^ER WMWITYIHIQERXIRIVIPGSPIKMSEPUYIZER IRHIRMXMZE GzQSZEE
afectar la prdida a su desarrollo y circunstancias, y cmo repercutir en esas reas. Otro aspecto a abordar directamente tras la muerte de un ser querido es la expresin
emocional. Desde el primer momento hay que explicar a los nios que es adecuado
expresar lo que se siente. Los adultos podemos y debemos expresar lo que sentimos o

48 49
ayudar a los menores a expresarse por s mismos, poniendo palabras a los sentimientos Con respecto a los adolescentes, es muy importante tenerlos en cuenta en los ritos.
S E PEW IQSGMSRIW 2S RKMVIQSW UYI RS LE TEWEHS REHE RM ETEVIRXEVIQSW YRE JEPWE ,E]UYIGSRWMHIVEVPIWTEVXIEGXMZEHIPTVSGIWSEYRUYIPEWMXYEGMzRTYIHIWIVXVMWXIQjW
tranquilidad. triste es que ellos se sientan apartados de la familia en esos momentos. Despus de una
prdida, el sentimiento de pertenencia familiar es muy intenso y no hay que dejarles de
Los nios tienen que saber que es normal emocionarse y cules son las emociones que lado.
nos generan las prdidas. Conviene explicarles que nos podemos sentir tristes, enfadados,
EPMZMEHSW IRGMIVXSQSHS WSPSWEWYWXEHSW7zPSIWRIGIWEVMSTVSXIKIVEPSWRMySWIR Si les hemos propuesto participar en el ritual y no quieren, o tienen dudas, les recordaremos
el caso de emociones muy intensas o desbordantes, como ya hemos comentado antes. con cario que no es obligatorio, que no pasa nada si no acuden. En esas circunstancias
XMIRIRUYIWIRXMVWIPMFVIWHIEGXYEVGSQSGVIIRRSLE]UYIJSV^EVIWEWMXYEGMzR8EQTSGS
La emocin expresada debe ir acorde con la situacin y no debe ser exagerada ni HIFIR EGYHMV WM RS TSHIQSW KEVERXM^EVPIW WIKYVMHEH S UYI ZER E IWXEV TVSXIKMHSW ]E
transmitir pnico al nio. No hay que olvidar que muchos nios regulan sus emociones sea de comentarios tremendistas o alarmantes, o bien de las emociones exageradas o
en funcin de la regulacin adulta, as que, si la persona que est hablando con el nio desbordantes que puedan manifestar los dems asistentes.
experimenta una emocin muy intensa, es conveniente alejar al nio o a esa persona y
buscar a alguien ms adecuado para llevar a cabo el primer abordaje tras la muerte. Los
nios e incluso algunos adultos necesitarn la contencin de otros adultos que muestren PARA RECORDAR
unas emociones ms adecuadas.
El mejor modo de comunicar la muerte: quin, cmo, dnde y cundo
4SV PXMQS LE] UYI MRMGMEV EP QIRSV IR PSW VMXSW JYRIVEVMSW8VEW PE TqVHMHE HI YR WIV
querido, tenemos que explicarle al nio en qu consisten estos ritos de despedida y  Las personas cercanas y queridas tienen prioridad: los padres en primer lugar,
UYqWMKRMGER TEVEUYIIRXMIRHEUYIIWYREJSVQEHILSQIRENIEVEPJEPPIGMHS HIHEVPI luego quien ms cercano sea o se vaya a quedar al cargo del menor. Prima el
YR PXMQS EHMzW IR PE QIQSVME 4SHIQSW LEFPEVPI HIP XEREXSVMS HI PSW VMXYEPIW HI PEW cario frente al parentesco.
GIVIQSRMEWVIPMKMSWEWIXGUYIZE]EREPPIZEVWIEGEFS  Lo antes posible.
 En un lugar ntimo para que pueda expresar lo que sienta con libertad.
2SI\MWXIYREIHEHIWTIGuGETEVEUYIPSWRMySWTEVXMGMTIRIRPSWVMXSWHIHIWTIHMHE0E  La informacin puede darse de manera gradual, partimos de lo esencial para
PMXIVEXYVEGMIRXuGEMRHMGEGSQSIHEHQuRMQEETEVXMVHIPSWWIMWEySW TIVSIR)WXEHSW despus dar detalles.
Unidos se hace mucho antes. No debemos tener miedo a ofrecerles una explicacin  ,E]UYIEGPEVEVPSWEWTIGXSWJYRHEQIRXEPIWTEVEUYIIPRMySIRXMIRHEPEQYIVXI
sobre el tema: los nios necesitan saber qu pasa con el cuerpo de las personas fallecidas  Es el momento de introducir los ritos y los homenajes.
] EYRUYIERSWSXVSWRSWTEVI^GEUYIWIZEREMQTVIWMSREVQYGLS TYIHIRIRXIRHIVPS  Se pueden abordar las creencias religiosas.
perfectamente si les damos una explicacin adecuada. En el caso de que el nio vaya a  Las responsabilidades se aclaran.
participar en los ritos, debemos asegurarnos previamente de que entiende cmo son y lo  Contestaremos a sus preguntas en la medida de lo posible.
que va a ver, or, cmo es el lugar de la ceremonia, etc. El objetivo es que pueda anticipar  0IWIWTIGMGEQSWUYIWMIQTVIVIGSVHEVIQSWEPJEPPIGMHS]UYIRSTYIHIWIV
con la mxima seguridad la situacin que se va a encontrar. Tambin es importante que VIIQTPE^EHSTSVREHMI
estn acompaados y protegidos de las manifestaciones emocionales desproporcionadas  Facilitaremos la expresin emocional y slo protegeremos a los nios de
que mencionbamos antes. emociones muy intensas o desbordantes.

50 51
4. Los nios y el duelo

53
4. Los nios y el duelo
4.1. QU ES EL DUELO?

0STVMQIVSUYIHIFIQSWWEFIVIWUYIRSI\MWXIYRERMGEHIRMGMzRHIHYIPSWMRSUYI
la literatura recoge muchas acepciones para este trmino. Una de las ms extendidas
seala que: Duelo es el proceso de adaptacin normal que sigue a la prdida de un ser
UYIVMHSIWSMQTPMGEZEVMEWGSWEWUYIWIHIHYGIRHIIWXEHIRMGMzR]HISXVSWJEGXSVIW
inherentes al duelo:

1. El duelo es un proceso, lo que nos indica que no es inmediato, sino que requiere
de tiempo: no es algo que vaya a resolverse de forma inmediata.
2. Que sea un proceso implica que es algo dinmico -est sujeto a variaciones-
y es algo activo -nos permite ejercer cierto control sobre el mismo-, es decir: hay
cosas que las personas pueden hacer en este proceso, que no es esttico. Si fuera
esttico, nos limitaramos a esperar y se pasara sin ms, pero hay altibajos, idas y
ZIRMHEW IPRMZIPHIMRXIRWMHEHHIPEWIQSGMSRIWTYIHISWGMPEVVIWYQMIRHS RSIW
lineal.
3. Es normal )WXSWMKRMGEUYIIWGSQREPEWTIVWSREW UYIXVEWPEQYIVXIHIYR
WIV UYIVMHS PS LEFMXYEP IW UYI ETEVI^GE IP HYIPS UYI HYIPE UYI LE]E VIEGGMSRIW
Atravesar un duelo es algo habitual y no un proceso extrao. No es una enfermedad
y al doliente no le est pasando nada malo por manifestar esas reacciones tras una
prdida. Es preferible que haya reacciones a que el doliente se muestre impasible,
como si no hubiera ocurrido nada.
4. Es un proceso nico. La forma en que responden al duelo los nios y los adultos
es personal, propia, cada persona tiene un duelo diferente: no hay dos duelos
iguales, igual que no hay dos personas iguales. El duelo es un proceso que tiene un
KVERGSQTSRIRXITVMZEHS TIVSUYIEPEZI^RIGIWMXEWIVVIGSRSGMHSWSGMEPQIRXI
Esto quiere decir que, con los nios, hay que hablar de ello en casa y expresar
los sentimientos de la prdida; pero, al mismo tiempo, la sociedad debe respetar
sus emociones y legitimarlas, no usar frases como: Ya ha pasado mucho tiempo,

55
(IFIVuEW GIRXVEVXI IR SXVEW GSWEW, etc. Tras una prdida, los nios y adolescentes
oscilan entre la necesidad de comprensin y cierta repulsa a verse invadidos por los PARA RECORDAR: Qu es el duelo?
adultos que reconocen su duelo, pero siempre necesitan recibir el cario y el apoyo
de sus seres queridos. Cuando la sociedad no reconoce un determinado tipo de  Un proceso, as que necesita tiempo.
duelo, o no deja espacio para vivirlo o dolerse, o bien el entorno se muestra muy  Es dinmico y activo, cambia, hay altibajos, el nio puede hacer cosas.
 Es normal, por tanto, no es una enfermedad ni un trastorno.
I\MKIRXI]RSHETMIEUYIIPQIRSVI\TVIWIWYHSPSVIWXSLEFMXYEPQIRXIHMGYPXEIP
 )WRMGSRSLE]YRHYIPSMKYEPESXVS
proceso de duelo infanto-juvenil.
 -QTPMGEXVEFENSTIVWSREP]QSZMPM^EVSETVIRHIVVIGYVWSW]LEFMPMHEHIW
5. El duelo implica un trabajo personal, no es un proceso que venga dado
Normalmente hay que:
tras la muerte, sino que requiere de un trabajo y una elaboracin personal,
1. Aceptar la realidad de la muerte.
MQTPMGE VIEPM^EV YRE WIVMI HI XEVIEW (I SFPMKEHE QIRGMzR WSR ;MPPMEQ
2. Trabajar las emociones asociadas.
;SVHIR ] WYW XEVIEW UYI WIVjR PEW UYI YXMPMGIQSW GSQS VIJIVIRGME IR IP 3. Aprender a vivir en un mundo en el que el fallecido no est.
duelo y el modelo que usaremos para abordar el duelo adolescente - por 4. Recolocar al muerto en nuestra vida y seguir viviendo.
tener caractersticas similares al adulto-, adaptndolas a los ms pequeos.
Las tareas para superar el duelo que encontramos en este modelo son:

1. Aceptar la realidad de la muerte: es decir, asumir que la persona fallecida no


va a vivir ms, que no la vamos a ver, que no va a volver. 4.2. DIFERENCIAS ENTRE DUELO ADULTO Y DUELO INFANTIL
2. Trabajar las emociones asociadas a la prdidaPEMVEPEXVMWXI^EIPEPMZMS
todas aquellas emociones que se experimentan tras la prdida de un ser Antes de enumerar las diferencias entre el duelo infantil y el adulto, debemos tener en
querido. GYIRXE UYI IP HYIPS HI PSW RMySW ] EHSPIWGIRXIW WI ZI MRYMHS HMVIGXEQIRXI TSV PSW
3. $SUHQGHUDYLYLUHQXQPXQGRHQHOTXHHOIDOOHFLGRHVWiDXVHQWH. Esto siguientes factores:

implica asumir ciertas responsabilidades de las que se encargaba el fallecido. En


 La edad del nio y, por tanto, sus capacidades cognitivas y emocionales, que pueden
los adultos pueden ser gestiones o roles, mientras que para los adolescentes
estar en construccin, sin haberse desarrollado totalmente como las de los adultos.
pueden ser cosas tan simples como ir y venir de manera autnoma al colegio,
 (OWLSRGHUHODFLyQ\GHYtQFXORTXHPDQWHQtDFRQODSHUVRQDIDOOHFLGDNo es
estudiar sin supervisin, pequeas tareas domsticas, etc., siempre sin asumir
PSQMWQSUYIIPQIRSVTMIVHEEYREKYVEHIVIJIVIRGMESGIRXVEPIRWYHuEEHuEUYI
PSWVSPIWRMPEKYVEHIPJEPPIGMHS a un familiar directo por el que no senta apego, o con quien apenas tena contacto.
4. 5HFRORFDUHPRFLRQDOPHQWHDOIDOOHFLGR\VHJXLUYLYLHQGR. Esta tarea se  Los recursos externos de los UYI WI HMWTSRKER TEVE KEVERXM^EV PE EXIRGMzR ]
equiparara a generar un recuerdo que no sea doloroso y al que poder apelar cuidados del nio.
en caso de necesitarlo.  Los recursos internos de los que disponga el nio y cmo haya afrontado
ERXIVMSVQIRXISXVEWHMGYPXEHIWJVYWXVEGMSRIWSTqVHMHEWHMWXMRXEWEPEQYIVXI

Al margen de estos factores, existen una serie de caractersticas y elementos que hacen
que el duelo infanto-juvenil requiera un abordaje distinto al de los adultos:

56 57
1. El ritmo vital 4. La expresin emocional

La primera diferencia que nos encontramos es que la vida del nio difcilmente se ve Tras la prdida de una relacin importante, en el adulto suelen producirse una serie de
interrumpida por la muerte de un ser querido. El nio vive una vida muy dinmica, con reacciones emocionales, mientras que en el nio puede ocurrir que estas reacciones no
mucho movimiento, llena de actividades a las que no se puede renunciar. Est respondiendo WIHIRHIQERIVEMRQIHMEXESRSWIHIRRYRGE)WXSRSWMKRMGEUYIRSI\TIVMQIRXIYR
constantemente a requerimientos y para el menor el duelo no suele implicar una HYIPSTIVSWuUYITEVEIPRMySPETqVHMHERSXMIRITSVUYqWIVWMKRMGEXMZERMMVEWSGMEHEE
ruptura con la realidad, como ocurre a menudo en los adultos. Cuando hablamos de sufrimiento mientras su mundo tenga estabilidad.
requerimientos nos referimos a:
La expresin emocional de los nios depende de que los adultos les proporcionen
 %WTIGXSWEGEHqQMGSWHIFIVIWI\jQIRIWGPEWIWLSVEVMSIWGSPEV espacio y legitimen esas emociones. Los adultos disponen de espacios para expresar las
 6IPEGMSRIWWSGMEPIWGYQTPIEySWIWXEWTPERIWGSREQMKSWMRZMXEGMSRIWIXG emociones del duelo y de otros adultos que pueden soportar esa expresin emocional.
 Aspectos temporales: Navidades, primeras comuniones, cumpleaos, vacaciones, En cambio, los menores raramente cuentan con otros nios o adolescentes que soporten
GEQTEQIRXSWEGXMZMHEHIWUYIPSWQIRSVIWWYIPIRLEGIVHIQERIVELEFMXYEPIR esas emociones de manera constante. A los nios les cuesta ms entender la pena y el
funcin de la poca del ao. duelo de otros, porque muchos no han vivido una experiencia similar.
 3GMS]XMIQTSPMFVI )RXVIREQMIRXSWHIEPKRHITSVXI TEVXMHSWHIRHIWIQERE
competiciones, salidas al parque, patines, bici, piscina, salidas nocturnas con amigos, las Las emociones de los nios y adolescentes tienden a oscilar, es raro que mantengan la
TVMQIVEWIWXEW misma emocin durante mucho tiempo, as que es muy habitual que su duelo vaya y venga,
EPMKYEPUYIPEWIQSGMSRIW)WGSQSWMHIZI^IRGYERHSSPZMHEWIRPETqVHMHETEVETSHIV
2. La duracin concentrarse en otras cosas que les pasan a diario. Los adultos pueden malinterpretar
IWSWSPZMHSW GVI]IRHSUYIIPQIRSV]ERSIGLEHIQIRSWEPJEPPIGMHS TIVSPSRMGS
El nio suele elaborar el duelo ms rpidamente que el adulto. Es precisamente esa UYITEWEIWUYITEVEPSWRMySWIWMRWSWXIRMFPIMRQSZMPM^EVWIIRPETIRE]IPHSPSVHYVERXI
secuencia de actividades obligatorias de la que hablbamos (acadmicas, sociales, mucho tiempo. Es habitual que los adultos que son testigos de este vaivn emocional
deportivas, etc.) la que favorece que el menor conecte con el aqu y el ahora, y tenga que crean errneamente que los menores estn traicionando al fallecido y no honran su
dar cabida a sus necesidades. La vida de los nios est perfectamente encajada en una memoria al poder disfrutar de algunas cosas.
secuencia de la que no suelen desengancharse. Si lo hacen, las consecuencias son mucho
ms complejas que para los adultos. La expresin emocional infantil tambin es distinta: los nios expresan ms con su
GSRHYGXE]GSRIPGYIVTS QMIRXVEWUYIPSWEHYPXSWXMIRHIREYXMPM^EVPEWTEPEFVEWTEVE
3. El mantenimiento de las rutinas expresar lo que sienten. A los nios hay que proporcionarles expresiones emocionales
EPXIVREXMZEWGSQSHMFYNSWTSIQEWGERGMSRIWNYIKSWQMIRXVEWUYIPEI\TVIWMzREHYPXE
Mantener las rutinas favorece la elaboracin del duelo infantil, mientras que en los adultos est ms ligada a la palabra y la conducta.
el mantenimiento de las rutinas a menudo se traduce en no querer cambiar nada y hacer
como si el fallecimiento del ser querido no hubiera tenido lugar. 5. Afectacin en las distintas reas

)RPSWEHYPXSWIPHYIPSWIQERMIWXETSVUYIqWXIKIRIVEPQIRXIEJIGXEEXSHEWPEWjVIEW
principales de la vida, mientras que en los nios suele haber reas preservadas: puede ser

58 59
que el duelo afecte a sus relaciones sociales, pero que el rea acadmica se mantenga ,EFMXYEPQIRXIPSWQIRSVIWFYWGERPEGSQTEyuE]PEGIVGERuEHISXVSW IRXEFPERRYIZEW
perfectamente; o que el rea familiar se vea afectada, mientras que el ocio, los amigos o el amistades y establecen nuevas relaciones sociales con cierta celeridad. En el adulto esta
GSPIKMSWIQERXMIRIRGSQSWMRSLYFMIVERMRKRTVSFPIQE fase suele retrasarse, es frecuente que se muestre reticente a trabar nuevas amistades o
VIPEGMSRIWGSRWYWTEVIWLEWXELEFIVEZER^EHSYRTSGSIRWYTVSGIWSHIHYIPS
)PWMKRMGEHSHIPETqVHMHE
10. La informacin que reciben
)PEHYPXSGSRIVIEPETqVHMHEYRWMKRMGEHSQjWKPSFEPI\MWXIYRETqVHMHEHIPEVIPEGMzRHI
PSWZuRGYPSWIWQjWWMQFzPMGS4SVWYTEVXIIPWMKRMGEHSUYIIPRMySHEEPETqVHMHEIWQjW 0SWRMySWVIGMFIRPEMRJSVQEGMzRQIHMEXM^EHETSVPSWEHYPXSW WSRIPPSWUYMIRIWHIGMHIR
concreto: la atribuye a aquellas cosas que le repercuten directamente, en resumen, a lo suyo. qu cosas van a explicarle al menor y cules no. Igualmente es el adulto quien decide si el
nio participa o no en los ritos de despedida. En cambio, en el mundo adulto recibimos
7. El concepto de muerte la informacin de primera mano y no se nos excluye de IWSWQSQIRXSWREPIWUYIHER
lugar a despedidas.
El nio, por su desarrollo cognitivo, va a manejar una idea limitada de la muerte y se ver
MRYMHSTSVWYTIRWEQMIRXSQjKMGSGSRGVIXS]PMXIVEP-KYEPQIRXIWYHYIPSIWXjQIHMEHS 7MPEMRJSVQEGMzRUYIVIGMFIIPRMySRSIWGSVVIGXESZIVE^ WYHYIPSWIPMQMXEVjEMHIEW
TSVEUYIPPSUYIIWGETE^HIXSPIVEVIRGEHEQSQIRXSHIPHIWEVVSPPS EWuUYI EYRUYI errneas que posteriormente sern difciles de corregir o manejar.
expliquemos a los pequeos las distintas dimensiones de la muerte, ellos mantienen sus
propias teoras, por lo que asumirn ms lentamente la realidad, limitados por el desarrollo
cognitivo de cada etapa. PARA RECORDAR: Principales diferencias
entre duelo adulto e infantil
8. La necesidad de comunicarse
 La vida del nio no suele interrumpirse, sigue su ritmo.
El nio necesita un espacio para preguntar dudas y as poder generar el concepto de  ,EFMXYEPQIRXIPSWQIRSVIWVIWYIPZIRIPHYIPSHIQERIVEQjWVjTMHE
muerte que manejar en su etapa adulta. El adulto necesita hablar de la prdida, mientras  Mantener las rutinas es esencial y suele ser un factor protector.
que el nio necesita un espacio de conocimiento y aclaracin previo a ese estado. De  La expresin emocional es indispensable y puede hacerse por vas
hecho, es posible que en el menor no se d nunca esa necesidad de hablar de la prdida. alternativas.
 Los nios suelen preservar sus reas vitales y el duelo slo afecta a una o
9. Los apoyos familiares y sociales dos reas principales.
 En los nios la prdida suele traducirse en prdidas concretas frente a la de
4EVE PSW RMySW IW JYRHEQIRXEP UYI PEW KYVEW HI ETIKS IWXqR TVIWIRXIW ] ETS]IR WY PSWEHYPXSWUYIXMIRIYRWMKRMGEHSKPSFEP
TVSGIWSHIHYIPS)RGEQFMSPSWEHYPXSWRSRIGIWMXERXIRIVXERTVIWIRXIWESXVEWKYVEW  )PGSRGITXSHIQYIVXIHIPSWRMySWIWPMQMXEHS]ZEEZER^ERHSGSRPEIHEH
pueden trabajar con el simbolismo de la compaa frente a la necesidad concreta del nio.  Los nios necesitan comunicar sus dudas e inquietudes a los adultos.
El nio necesita de otro adulto que le gue y se encargue de proporcionarle lo que  Los apoyos familiares y sociales son imprescindibles para la resolucin del
necesita frente a un adulto, que es autnomo y puede gestionar casi todo por s mismo, duelo.
sin necesitad de otro que le gue y tome las riendas de su vida.  0EMRJSVQEGMzRUYIVIGMFIRPSWTIUYIySWIWXjMRYMHETSVPESTMRMzREHYPXE

60 61
4.3. CREENCIAS ERRNEAS ACERCA DEL DUELO Y LOS NIOS

Cuando hablamos del duelo infantil, habitualmente partimos ya de una creencia errnea:
TIRWEQSW UYI IP HYIPS IR PSW RMySW IW TSGS GSQR ] RS XIRIQSW IR GYIRXE UYI
mientras crecen, las personas se exponen a distintas prdidas vitales que hay que elaborar.
)PHYIPSMRJERXMPIWQYGLSQjWGSQRHIPSUYIWSPIQSWTIRWEV IRPEZMHEIWGSQR
experimentar la prdida de seres queridos desde una edad temprana (abuelos, bisabuelos,
mascotas, padres).

Tampoco debemos olvidar que, a medida que se suceden los distintos cambios de
etapa en el crecimiento, el nio ya se enfrenta a una prdida: pierde la dependencia
de sus cuidadores; el estatus de pequeo o de beb; privilegios como que le tapen,
PIPIER PIEGYRIR PIEGYIWXIR%QIHMHEUYIGVIGI XMIRIUYIPMHMEVGSRPSWGEQFMSW
corporales y sufre la prdida de la imagen que tena para dar paso a otra nueva; por el
camino va cambiando de amigos o de compaas, a veces tambin de colegio o de etapa
escolar; cambian las relaciones con sus padres o hermanos y se producen muchas otras
transformaciones o prdidas que el nio debe afrontar.

1YGLSWEYXSVIWIRKPSFERIWXEWTqVHMHEWHIRXVSHIPSUYIWMKRMGEYRHYIPSWMXSQEQSW
PE HIRMGMzR HIP HYIPS GSQS PE VIEGGMzR UYI WMKYI E YRE TqVHMHE )WSW GEQFMSW ZER
dotando a los nios y adolescentes de habilidades de afrontamiento que pondrn en
QEVGLEGYERHSWITVSHY^GERSXVEWTqVHMHEWRYIZEW

Nos encontramos ante una serie de creencias que marcan los duelos de los nios.Tanto si
GYIWXMSRERIPLIGLSHIUYIPSWRMySWTYIHERXIRIVYRHYIPSGSQSWMWIVIIVIREPQSHS
en que este se desarrolla, es muy importante conocerlas para saber qu se va a encontrar
el menor en muchos mbitos y cmo podemos ayudarle.

1. El nio no entiende lo que est viviendo

En nuestra necesidad de protegernos de las emociones y los sentimientos de los nios,


los adultos tendemos a creer que los menores no son conscientes de lo que viven, que
no perciben los detalles o que no entienden lo que est sucediendo.

62 63
El adulto tiende a pensar que, cuanto ms pequeo el nio, menos comprende los 'YERHSEPINEQSWEPSWRMySWHIPHSPSV SRKMQSWUYIRSIWXjTEWERHSREHESUYIRS
aspectos que rodean la muerte y, en caso de entenderlos, muchas personas consideran IWXEQSWEJIGXEHSWTSVYRETqVHMHETEVEUYIIPRMySRSZIEUYIWYJVMQSW PSRMGSUYI
que es una comprensin relativa y que no se vive plenamente. GSRWIKYMQSWIWUYIIPQIRSVSGYPXISRNEWYWIQSGMSRIWIRYRMRXIRXSHIEWIQINEVWIE
los adultos que lo rodean.Tambin provocamos que simulen encontrarse en un estado de
Desde hace mucho tiempo sabemos que esto no es as: los nios, independientemente de bienestar casi idntico al del adulto, para ejercer de protectores ellos tambin: Bastante
WYIHEHSHIWYQEHYVI^GSKRMXMZEWSRGETEGIWHIHEVWIGYIRXEGSQSQuRMQSHIUYI TVISGYTEHSWIWXjR]EQMWTEHVIWGSQSTEVEUYIWITVISGYTIRHIQMWYJVMQMIRXS
EPKSLEGEQFMEHSIRWYIRXSVRS%WuUYI XVEWPEQYIVXIHIYRWIVUYIVMHSWMKRMGEXMZS
o presente en sus vidas, todos los nios elaboran el duelo. No podemos decir que no Si alejamos a los menores de la experiencia de la muerte, con frecuencia les negamos
perciban o no sean conscientes de lo que ocurre. la oportunidad de despedirse del fallecido, lo que adems facilita la comprensin de la
muerte y permite al nio tomar conciencia de que esa persona ha muerto y no la va a
El menor, por pequeo que sea, jams es ajeno a lo que sucede a su alrededor. Si esa muerte ver ms.
implica un cambio, aunque ste sea mnimo, el nio atravesar un duelo. Pensar que no es
consciente de ello no le ayuda, sino que perjudica su desarrollo, ya que debemos tener en Es preferible acompaarles en esa experiencia, facilitarles las despedidas, la expresin
GYIRXEUYIEPIWXEVIRHIWEVVSPPSIPRMySGEVIGIHILEFMPMHEHIWSVIGYVWSWWYGMIRXIWTEVE emocional, un escape, a tratar de alejarlos para que no vivan y sientan el dolor o tengan
afrontar esa nueva situacin y va a guiarse por el adulto que le acompae en su proceso. la posibilidad de sufrir.
En resumen: los nios s se enteran de lo que ocurre, lo que cambia es la forma en que
PSQERMIWXER]IPEFSVER 0SWJYRIVEPIW]XEREXSVMSWTYIHIRXVEYQEXM^EVEPRMyS

7MSGYPXEQSWIPHSPSVWIVjRQjWJIPMGIW,E]UYIHMWMQYPEV Esta idea est muy extendida, muchos adultos creen que si llevan al nio a un tanatorio,
EYRIRXMIVVSSEYRJYRIVEP PIZEREXVEYQEXM^EVSZEREKIRIVEVPIYRVIGYIVHSQY]
Los adultos solemos angustiarnos ante un nio que sufre. Nos sentimos muy impotentes, doloroso, negativo o imborrable que marcar toda su vida. Normalmente estos adultos
sin saber cmo manejar ese dolor y esa angustia que, adems, suele coincidir con la han vivido situaciones similares en su infancia, bien porque el mensaje que se les inculc
nuestra, ya que va unida a esa prdida por la que sufre el nio o el adolescente. Es habitual fue el de un posible trauma si vean a un muerto, o porque participaron de los ritos sin
pensar que protegindoles de las situaciones dolorosas los alejamos del sufrimiento que ser advertidos antes de cmo eran y lo que iban a escuchar y ver.
stas generan y, por tanto, crecern ms felices. Pero es necesario que los nios formen
parte del proceso doloroso de la muerte y que no se les excluya de algo tan ntimo y )RVIEPMHEHTEVEPSWRMySWTYIHIPPIKEVEWIVFIRIGMSWSTEVXMGMTEVIRPSWVMXSWJYRIVEVMSW
familiar. porque se sienten parte de la familia a todos los niveles, participan del apoyo social y,
EHIQjWIQTMI^EREVIGSPSGEVEPQYIVXSIRWYWZMHEWEXVEZqWHIPVIGYIVHSLEGMIRHSVIEP
4VSXIKIVEYRRMySHIPHSPSVIWYREVQEHIHSFPIPSTVMQIVSTSVUYIIWMRIZMXEFPIUYI PETqVHMHE4EVXMGMTERHSIRIPVMXSIPRMyS]IPEHSPIWGIRXIGSQMIR^ERELEGIVWIGEVKSHI
IREPKRQSQIRXSZE]EEZMZMVSTEHIGIVHSPSV IWMQTSWMFPIUYIRYRGEWIIRJVIRXIE PEVIEPMHEHPETIVWSRELEJEPPIGMHSTEWEHIWIVEPKSGXMGMSIRPEMQEKMREGMzREWIVVIEPLE
situaciones complejas. Por otro lado, al hacerlo desprotegemos al menor, porque evitamos pasado y est ah.
que desarrolle las habilidades necesarias para enfrentarse a esas situaciones complicadas,
dolorosas o traumticas que la vida pondr en su camino.

64 65
2SIWJjGMPXVEYQEXM^EVEPSWRMySWTIVSWuGSRZMIRIERXMGMTEVPIWPSUYIZEREZIVGzQSZE le haya mentido. Normalmente afrontar esto supone para el menor un trabajo extra
a ser la ceremonia y qu es esperable que ocurra. De ese modo reduciremos el impacto EyEHMHS EP HYIPS UYI RS WYIPI WIV GETE^ HI VIEPM^EV ]E UYI IQTPIE PE QE]SVuE HI WYW
que puede generarles el hecho de encontrarse cosas nuevas que no pueden prever. recursos en resolver el duelo.

Los ms pequeos necesitan explicaciones adaptadas a su edad y un adulto que los 5. El duelo dura aproximadamente un ao
acompae y d respuesta a sus dudas. Los adolescentes pueden requerir tanto compaa
como intimidad, lo que es importante es que el entorno responda a las necesidades Esta idea sobre la duracin estndar del duelo est muy extendida: muchas personas
IQSGMSREPIWUYIXIRKERTEVEUYITYIHERIQTI^EVEIPEFSVEVIPHYIPS piensan que, despus de un tiempo prudencial, todo aquello relacionado con el duelo
ha tenido que pasar. As pues, al cabo del mismo el doliente ha tenido que superar la
,E]UYILYMVHIIWEMHIEHIUYIPSWQIRSVIWWITYIHIRXVEYQEXM^EV)PLIGLSHIXVEXEVPE WIRWEGMzRHIXVMWXI^EPSWWIRXMQMIRXSWHIZEGuSHIWSPIHEHLEFVjVIGYTIVEHSPEWVYXMREW
QYIVXIGSQSTEVXIHIPEZMHERSWzPSRSXVEYQEXM^EVjEPSWRMySWWMRSUYIPIWE]YHEVjE o habr recolocado ya al fallecido en su vida.
GVIEVVIGYVWSWI\XIVRSWIMRXIVRSWTEVEEJVSRXEVPEWQPXMTPIWTqVHMHEWUYIPIWWYGIHIVjR
a lo largo de la vida. La verdad es que el duelo dura lo que tarda cada persona en elaborarlo, no hay un
tiempo exacto para ello. Sin embargo, en los nios lo recomendable es que cuanto antes
,E] YREW QYIVXIW TISVIW UYI SXVEW IW QINSV QEUYMPPEV PE VIEPMHEH ERXI IP se resuelva, mejor, porque si el menor no va resolviendo las tareas asociadas al duelo, las
nio distintas reas de su vida pueden verse interrumpidas o afectadas, lo que puede tener
mayores repercusiones para l.
Partimos de la idea equivocada o extendida de que si la muerte es violenta -por ejemplo,
un suicidio, un atropello, un atentado-, en la mente de los adultos se considera una Aun as, en los menores es normal que determinadas reacciones del duelo puedan
muerte peor. Por el contrario, aquellos fallecimientos que pueden considerarse dulces, extenderse en el tiempo -aunque amortiguadas- o incluso manifestarse en otros
naturales o que tienen lugar tras una larga enfermedad se consideran como muertes QSQIRXSWQjWWMKRMGEXMZSWHIWYZMHE TSVINIQTPSYREKVEHYEGMzRYREGIPIFVEGMzRYR
mejores o ms afortunadas. cambio de etapa vital, etc.).

En realidad, para los nios no hay una muerte mejor que otra si fallecen personas 6. El tiempo lo cura todo
WMKRMGEXMZEWTEVEIPPSW)PVIWYPXEHSIWIPQMWQSRSZEREZIVEPETIVWSRERYRGEQjW,E]
que tener en cuenta que los nios a menudo no manejan el concepto de temporalidad y Una idea extendida en los adultos es que las cosas van a mejorar con el tiempo, que con
el hecho de que la persona que va a fallecer pueda durar muchos meses no les aporta el transcurso de los meses el duelo se ir amortiguando y las emociones y sentimientos
REHE)PPSWWYIPIRIRXIRHIVPEMRQIHMEXI^SFMIRTYIHISGYVVMVUYIIPGSRGITXSQYGLSW volvern a la normalidad. Creen que a medida que transcurren los das lo normal es que
meses se les haga tan largo o tan cotidiano que la muerte del ser querido les resulte el nio o el adolescente vayan recuperando la normalidad y disminuya proporcionalmente
igualmente inesperada. el grado de afectacin que supone el duelo.

Si maquillamos cmo se ha producido la muerte, estamos sobreprotegiendo al nio y le )RVIEPMHEH PSRMGSUYILEGIIPTEWSHIPXMIQTSIWTSRIVHMWXERGMEGSRIPLIGLSHIPE


impedimos que desarrolle de verdad las habilidades para afrontar la realidad. Adems, es muerte en s. Lo que ayuda, o cura, es aquello que hagamos con el tiempo, las alternativas
probable que acabe enterndose por otra va y eso le genere mucho ms dolor, porque que proporcionemos a los nios, la forma en que recuperen sus rutinas, cmo recoloquen
al afrontamiento de la prdida se aade el hecho de que su familia lo haya apartado o al muerto en sus vidas, etc.
66 67
7. No hay que estar tristes, porque entonces el fallecido se pone triste 4.4. DERECHOS DEL NIO EN DUELO

Cuando les decimos a los menores en duelo que un ser querido que ha muerto puede Es importante que consideremos algunos derechos que tienen los nios en duelo. De
preocuparse o ponerse triste, o incluso que no le gustara lo que ve, estamos haciendo este modo, no invadiremos su espacio personal, ni les atosigaremos o trataremos de
guiarles por un camino ms rpidamente de lo que ellos necesitan.
varias cosas que no son reales y que pueden confundir al nio:

Estos derechos tambin pueden servirnos de orientacin para comprender mejor sus
 Puede parecer que realmente nos ve, algo confuso porque no responde, ni habla, ni
necesidades sin equipararlas a las de los adultos y sin caer en la sobreproteccin o la
consuela.
HINEHI^
 El fallecido no siente ni padece.
 Esta idea genera miedo y es un pensamiento que puede perseguir al menor a lo largo 1. Tengo derecho a tener mis propias emociones y sentimientos sobre la
de su vida. muerte.
 Condiciona el comportamiento del nio.
4YIHSWIRXMVQIXVMWXIEWYWXEHSIRJEHEHSIMRGPYWSEPMZMEHS,EFVjZIGIWIRPEWUYIIWXq
La idea de que nuestros actos afectan de alguna manera al fallecido es una creencia acorchado y no sepa cmo debo reaccionar, o bien me quedar inmvil sin saber qu
irracional que transmitimos al nio, suele generarle mucho estrs e impide que se den con hacer o decir.
naturalidad sus expresiones y comportamientos disruptivos, pudiendo enmascarar otros
problemas asociados al duelo. Nadie puede sentirse exactamente como yo me siento en esos momentos. Mis
WIRXMQMIRXSWWSRRMGSW 4SVJEZSV RSPSWGSQTEVIWGSRPSWUYIXWMIRXIW RMQIHMKEW
que a ti tambin te pasa o que sabes exactamente cmo me siento.
PARA RECORDAR
2. Tengo derecho a hablar de mi duelo cuando quiera y con quien quiera.
Las creencias errneas sobre los nios y el duelo ms habituales:
Si necesito hablar con alguien de lo que me est pasando, lo buscar.Tratar de encontrar
 Los nios no son conscientes de lo que estn viviendo: a menor edad a esa persona o hablar de lo que me pasa cuando me pregunten. Slo necesito a alguien
menos percepcin de lo que pasa. que me quiera y me escuche.
 3GYPXEVPIW IP HSPSV PIW LEGI QjW JIPMGIW LE] UYI RKMV PEW IQSGMSRIW Y
SGYPXEVPEXVMWXI^E Si no quiero hablar, resptame, seguramente as las cosas tambin estn bien.
 0SWJYRIVEPIW]PSWXEREXSVMSWTYIHIRXVEYQEXM^EV
 ,E]QYIVXIWTISVIWUYISXVEW 3. Tengo derecho a mostrar mis sentimientos por el duelo a mi manera.
 El duelo dura ms o menos un ao.
 El paso del tiempo lo cura todo. 4YIHIUYIEYRUYIPEWMXYEGMzRQIHYIPEQIETIXI^GENYKEVGSRQMWEQMKSW]QIWMIRXE
 Si estamos tristes, el fallecido estar triste. mejor. Puede ser por un tiempo corto o ms largo, tambin puede que me enfade y
 0EMRJSVQEGMzRUYIVIGMFIRPSWTIUYIySWIWXjMRYMHETSVPESTMRMzREHYPXE VIEGGMSRIQEP TIVSIWEWVIEGGMSRIWRSQILEGIRWIVQEPS WzPSWMKRMGEUYIRSIWXS]
FMIRUYIXIRKSQMIHS]UYM^jWRIGIWMXIXYE]YHE

68 69
4. Tengo derecho a contar con la ayuda de otros en mi duelo, especialmente 8IRKSHIVIGLSEEZER^EVIRQMHYIPSLEWXEWIRXMVQIQINSV
de las personas que me cuidan.
:S]EWIVGETE^HIZMZMVYREZMHEJIPM^ TIVSXERXSPEZMHEGSQSPEQYIVXIHIUYMIRLE
Es un momento en el que necesito una atencin especial, tanto a lo que siento como a fallecido van a formar parte de mi vida siempre. Seguramente echar de menos a esa
lo que hago y digo. Necesito que me digas que las cosas van a ir bien y que vamos a salir TIVWSREHIYRQSHSYSXVSEPSPEVKSHIQMZMHEIWSRSZEEMQTIHMVQIWIVJIPM^
adelante.

5. Tengo derecho a estar molesto. PARA RECORDAR: Los derechos del nio en duelo

 Tener emociones y sentimientos propios sobre la muerte.


Es normal que est enfadado y proteste con mayor frecuencia. A veces buscar alejarme
 ,EFPEVGYERHSUYMIVE]GSRUYMIRUYMIVE
para no estar en compaa de otros
 Mostrar sus sentimientos a su manera.
 Recibir ayuda de otros.
6. Tengo derecho a tener explosiones emocionales.
 Estar molesto.
 Tener explosiones emocionales.
)WRSVQEPUYIXIRKEI\TPSWMSRIW TYIHIUYIWIEPETVMQIVEZI^UYII\TIVMQIRXIYREW  Entender los motivos que han causado la muerte.
emociones tan intensas. Esos sentimientos pueden asustarme y tambin mis explosiones  ,EFPEVHIWYWVIGYIVHSW
pueden asustar a otros, pero no me dejes solo, en esos momentos te necesito ms que  %ZER^EVLEWXEIRGSRXVEVWIQINSV
nunca.

7. Tengo derecho a entender los motivos que han provocado la muerte


de mi ser querido.

No necesito una respuesta, porque normalmente no la hay, pero tengo derecho a


preguntar los motivos y los porqus. Son preguntas que se hacen muchas personas, es
normal que yo tambin me las haga.

8. Tengo derecho a hablar de mis recuerdos con la persona fallecida.

En ocasiones, el hecho de recordar me har sentir triste y, en otras, me har sentir bien.
Pase lo que pase, esos recuerdos me ayudan a mantener vivo a ese ser querido en la
QIQSVME]IPGSVE^zR2SPSWMRLMFEWEYRUYIXIHYIPERHqNEQIUYIPSWI\TVIWIRSQI
prohbas hablar del fallecido.

70 71
5. Aspectos que facilitan y
HMGYPXERPEcomprensin de
PEQYIVXIWIKRPEWHMWXMRXEWIXETEW
del desarrollo

73
5. Aspectos que facilitan y
HMGYPXERPEcomprensin de
PEQYIVXIWIKRPEWHMWXMRXEWIXETEW
del desarrollo
Es importante saber qu cosas pueden facilitar a los nios la comprensin de la muerte
WIKRWYIHEH]UYqGSWEWIWGSRZIRMIRXIIZMXEVTSVUYITYIHIRGSQTPMGEVWYTVSGIWS%
continuacin os sealamos algunas cosas que conviene tener en cuenta en funcin de la
edad del nio y que pueden resultar de gran ayuda.

5.1. DE LOS 0 A LOS 2 AOS

Si podemos prever la muerte del ser querido, es bueno anticiparla y hacer los pequeos
cambios necesarios para que la transicin del nio a la nueva situacin sea lo ms tranquila
posible, frente a una transicin inesperada. De este modo cambiaremos a los cuidadores,
los horarios de comida, de higiene, de cuidado, etc.

En los casos en que la muerte se pueda prever, haremos una transicin progresiva en
colaboracin con la persona que vaya a fallecer: primero estarn con el nio los dos
cuidadores juntos, luego el cuidador principal ir dando paso al que vaya a quedarse y se
ir retirando lo mximo posible de las rutinas centrales del beb.

Sustituir a la persona fallecida en las actividades del nio o del beb por alguien externo
UYIRSGSRS^GETYIHIHMGYPXEVQYGLSPEGSQTVIRWMzR]PERSVQEPM^EGMzRHIPEWVYXMREW
tras el fallecimiento.

Es fundamental que durante los dos primeros aos de desarrollo del nio las rutinas sean
QERXIRMHEW]TVIWIVZEHEWEWuUYIIRGEQMREVIQSWKVERTEVXIHIRYIWXVSWIWJYIV^SWEUYI
el nio no tenga que cambiar los hbitos o rutinas que ya tuviera establecidas.
75
Es probable que los menores se contagien del estado de nimo de los adultos de su 5.2. DE LOS 3 A LOS 6 AOS
entorno, pudiendo as expresar las emociones asociadas a la prdida a travs de irritabilidad,
XVMWXI^ERIKEGMSRIWGEFI^SRIVuEKVMXSWMRWSQRMS Una de las principales cosas que van a necesitar los nios a esta edad es que el lenguaje
sea lo ms claro y concreto posible. Dado que su pensamiento es mgico y en su mente
)W MQTSVXERXI RS GVIEVPIW QjW MRUYMIXYHIW S MRGIVXMHYQFVI LE] UYI KEVERXM^EVPIW PE MRJERXMPXSHSIWTSWMFPIIPLIGLSHIYXMPM^EVQIXjJSVEWINIQTPSWSHIXIVQMREHEWTEPEFVEW
seguridad a travs de una alimentacin adecuada, proteccin, horarios, lmites. EQFMKYEWZEEGSQTPMGEVQYGLSUYIGSQTVIRHERPEWHMQIRWMSRIWHIPEQYIVXI,E]UYI
YXMPM^EVYRPIRKYENIVIEP]IZMXEVJVEWIWGSQS
'YERHSIQTMI^EREIRXIRHIVPEWTEPEFVEW IWMQTSVXERXIYWEVPSWXqVQMRSWEHIGYEHSW
para referirse a la muerte. As, poco a poco, podrn ir entendiendo los aspectos principales  )PEFYIPSIWXjIRYRPYKEVQINSV
relacionados con la prdida.  7ILEMHS
 'SQSRSWUYIVuEXERXSWMIQTVIZEEIWXEVERYIWXVSPEHS
Tras la muerte de un ser querido, estamos ante un periodo en el que las emociones estn  ,EWYFMHSEPGMIPS
ESVHITMIP]RSTEWEREHETSVIQSGMSREVWIWMIQTVI]GYERHSPEWIQSGMSRIWRSWIER  4YIHIWGSRXEVPIGYEPUYMIVGSWE
demasiado extremas al atender al beb. Es importante intentar calmarlo: si el adulto que
lo cuida siente una emocin muy desbordante, sera preferible que fuera otro adulto Es importante ofrecer una respuesta sincera y concreta ante la curiosidad del nio, hay
quien se ocupase del nio en esos momentos. Por eso, conviene contar con una red de que aclararles las cosas para que luego no se confundan ni aumenten sus miedos. No
ETS]SUYIGSRS^GEPEWVYXMREWHIPFIFq]TYIHEE]YHEVGYERHSWIERIGIWEVMS LEGIJEPXEUYIPEI\TPMGEGMzRWIEGMIRXuGEQIXEJuWMGESGSQTPINEPSMQTSVXERXIIWUYIPIW
queden claras las ideas principales. Tambin es importante que, si no sabemos responder
EYRETVIKYRXE PSVIGSRS^GEQSW 2STEWEREHETSVHIGMVPIEPRMyS2SWqUYqHIGMVXI
De los 0 a los 2 aos no puedo contestarte a eso porque no lo s.

FACILITA
Es ms adecuado ofrecer a los pequeos un conocimiento prctico y apoyado en hechos
 Poder anticipar la muerte.
 Mantener las rutinas. ERXIW UYI YRE I\TPMGEGMzR TIVJIGXE ] GMIRXuGE 4SV IWS GSRZMIRI UYI ETVIRHER GzQS
 +EVERXM^EVWYWIKYVMHEH]GYMHEHS reaccionar ante la muerte y qu es adecuado. Por ejemplo: si nos ven llorar, no nos
 Usar palabras adaptadas. esconderemos. Es preferible explicarles que lloramos porque estamos tristes, porque
 Sustituir al fallecido en las rutinas.
echamos de menos al fallecido o porque tenemos miedo.
 Emociones adecuadas a la situacin.

DIFICULTA Para que los nios entiendan la irreversibilidad de la muerte, les explicaremos que todos
 Cambios bruscos y rpidos. moriremos, que lo normal es que esto ocurra cuando seamos muy, muy mayores,
 Alteracin en las rutinas.
GYERHSLE]EQSWLIGLSQYGLEW QYGLEWGSWEW ,E]UYIHINEVPIWGPEVSUYIIPPSWZERE
 Cuidadores nuevos o con los que haya poca familiaridad.
WIVQE]SVIW]ZERETSHIVGYMHEVWITSVWuQMWQSWGYERHSJEPPI^GERPEWTIVWSREWUYIPIW
 Emociones extremas.
rodean. Es importante dar seguridad al nio: aunque esto no sea del todo cierto, s es lo
esperable o lo que tiene ms probabilidades de suceder.

76 77
En lo relativo a las enfermedades terminales, hay que explicar al nio que la muerte se
produce cuando la persona est muy, muy enferma, tan enferma que ya ni los mdicos ni De los 3 a los 6 aos
REHMIPETYIHIRE]YHEV (IIWXEQERIVEPIXVERUYMPM^EQSWJVIRXIESXVEWIRJIVQIHEHIW
FACILITA
ms banales que pudieran preocuparle.
 Uso claro y adaptado del lenguaje, usaremos un lenguaje real.
 Comprender la insensibilidad post-mortem.
Otro aspecto que resulta de ayuda para los nios es comprender la insensibilidad post  8VERUYMPM^EVERXIPETSWMFMPMHEHHISXVEWQYIVXIW
mortem, es decir, que las personas que mueren ya no sienten ni ven ni oyen nada. Eso los  9WEVINIQTPSWHIPEREXYVEPI^ESUYIGSRS^GER
protege de ideas relacionadas con un posible sufrimiento del fallecido en el entierro, en la
DIFICULTA
muerte y evita que se preocupen por si el difunto tendr fro, si tendr hambre, etc. Para
 El uso de metforas.
EGPEVEVIWXIXIQEIWMQTSVXERXIRSYXMPM^EVJVEWIWGSQS  Usar frases como )WXjIRYRPYKEVQINSV(YIVQIIXIVREQIRXI2SWZI
WMIQTVI]RSWGYMHE
 )WXjIRYRPYKEVQINSV  )\TPMGEGMSRIWGSQTPINEW]GMIRXuGEW
 2SWGYMHEHIWHIIPGMIPS
 8IZIWMIQTVI
 (YIVQIYRWYIySIXIVRS
5.3. DE LOS 6 A LOS 10 AOS
El nio tiene que comprender que el cuerpo del fallecido y sus funciones se han terminado,
que se han detenido; que no respira, ni ve, ni oye; no puede caminar ni comer; no pasa fro A esta edad cobra gran importancia que el nio llegue a comprender la totalidad de las
ni tiene calor; no ve la televisin, no le duelen las cosas, no tiene hambre y otras muchas dimensiones de la muerte, es decir: las circunstancias y los hechos que han rodeado el
EVQEGMSRIWVIPEGMSREHEWGSRIWXIXIQE fallecimiento. Por este motivo, es imprescindible escuchar a los pequeos, atender sus
dudas, establecer un dilogo y permitir las reacciones que tengan tras comunicarles la
A esta edad la comprensin de los nios es bastante literal, as que si ilustramos las muerte.
I\TPMGEGMSRIWGSRINIQTPSWGSXMHMERSWSGSKMHSWHIPEREXYVEPI^EPIWVIWYPXEVjHIKVER
E]YHETEVEIRXIRHIVPS 9XMPM^EVIQSWYRPIRKYENIGSRGVIXS]PMXIVEP IZMXERHSQIXjJSVEWS Es una poca en la que los nios son de carcter ms temeroso. Por eso puede que
I\TPMGEGMSRIWGSQTPINEWUYIIWPSUYIPIWHMGYPXEPEGSQTVIRWMzREIWXEWIHEHIW desarrollen ciertos miedos relacionados con la prdida de otros seres queridos, con el
QYRHSHIPSIWTMVMXYEPPESWGYVMHEH,E]UYIEGPEVEVPIWXSHSWPSWEWTIGXSWVIEPIWHIPE
TqVHMHETEVEUYIWYMQEKMREGMzRRSMRGVIQIRXIIWSWQMIHSWSHMGYPXEHIW

Responderemos a sus preguntas de manera sincera y lo ms completa posible: hay que


atender sus dudas, sus preocupaciones, inquietudes y darles una respuesta lo ms segura
posible, que sientan que tras el acontecimiento no han perdido seguridad ni proteccin,
que no estn desvalidos ni es una situacin que genere cambios irreversibles en su da a
da.

78 79
A esta edad aparece una curiosidad enorme hacia las costumbres y los rituales: los nios
quieren saber en qu consisten y cmo se desarrollan, incluyendo los pormenores que los
rodean. Tambin en este periodo suelen manifestar un inters por participar en los ritos
de despedida que debemos atender. A partir de los seis aos, la mayora de los autores
coinciden en que los nios pueden participar sin problema de los ritos funerarios y de
despedida.

Si el nio va a participar de los ritos es importante que pueda anticipar lo que va a ver en
el tanatorio, cmo va a ser, qu personas van a estar all y todos los pormenores que se
RSWSGYVVER)WVIGSQIRHEFPIKEVERXM^EVUYIIPRMySRSWIZEEZIVI\TYIWXSEVIEGGMSRIW
emocionales desmesuradas, ya sea por su intensidad o por su contenido, ya que esto
TYIHIHIWIWXEFMPM^EVEPQIRSVUYIRSWEFVjUYqVIEGGMzRIWPEEHIGYEHE

Si exponemos a los nios a reacciones inadecuadas en intensidad, contenido o duracin,


pueden salir daados de esa experiencia, asustados y con temores que pueden volverse
recurrentes.

Tenemos que facilitar al nio un espacio donde estn permitidas las emociones. Como
adultos expresaremos nuestras propias emociones y se las ensearemos al nio sin temor,
ya que nuestros sentimientos no van ni a daarle ni a asustarle.

En el caso de que haya un ser querido con una enfermedad terminal, es importante que
IPRMySTYIHEWIVXIWXMKSHIWYHIXIVMSVSRSLE]UYISGYPXjVWIPS=GYERHSIPWIVUYIVMHS
IWXqIRWYWPXMQSWQSQIRXSW LE]UYIHINEVEPQIRSVUYIIWXqTVIWIRXI]I\TPMGEVPI
todo lo que sepamos del proceso para que pueda anticipar la muerte.

No debemos ocultar informacin a los nios: cmo muri, qu pas, cundo ocurri
I\EGXEQIRXI )RXVI PSW EHYPXSW WI HE PE XIRHIRGME LEFMXYEP HI MRXIRXEV IHYPGSVEV PE
muerte ante los nios, o contarles mentiras piadosas y medias verdades. Eso genera
QYGLEHIWGSRER^EEQIHMHEUYIGVIGIRTSVUYITMIRWERUYIWIPIWLEIRKEyEHS]UYI
no se les ha tenido en cuenta.

80 81
Sera conveniente que, en torno a los 9 10 aos, se tuviera en cuenta la opinin del nio Dejaremos que el preadolescente colabore en los ritos funerarios, para que pueda tener
para determinados detalles de los homenajes de la persona fallecida, es adecuado que un conocimiento completo de lo que ha pasado y d sentido a la realidad de la prdida.
JSVQIRTEVXIEGXMZEHIPSWVMXSW]UYIEHUYMIVERYRTETIPTVSXEKSRMWXETIVSWMRJSV^EVPE Es importante favorecer las despedidas, que el menor tenga las mismas oportunidades
WMXYEGMzRWzPSIRGEWSHIUYIPIWETIXI^GE]WIWMIRXERGSRKEREW que los adultos que le rodean para despedirse de su ser querido.

Los preadolescentes estn en una etapa vital en la que a veces les resulta difcil mostrar
De los 6 a los 10 aos sus sentimientos, pero hay que legitimar todas las emociones y facilitar su expresin. Ante
una prdida, es preferible huir de las tpicas frases que frenan la expresin emocional tras
FACILITA
 Entender todas las dimensiones de la muerte. la muerte:
 Explicar los rituales y dejarles participar si as lo desean.
 Permitir las emociones.  %LSVEIVIWIPLSQFVIHIPEGEWE
 Responder a su curiosidad.
 ,E]UYIWIVJYIVXI
 Prepararles para el desenlace, si es posible.
 Valorar su opinin, en torno a los 9 10 aos.  8YQEHVIRIGIWMXEUYIIWXqWFMIR
 8YWLIVQERSWWINERIRXM
DIFICULTA  %XYQEHVIRSPILEFVuEKYWXEHSZIVXIXERXVMWXI
 No aclarar las fantasas o teoras imaginadas.
 No explicarle cmo son los rituales y lo que va a ver o encontrar.
*VIRXIEIWXSPSEHIGYEHSIWRSVQEPM^EVPEWMXYEGMzR )WRSVQEPIWXEVXVMWXI=SXEQFMqR
 Ocultar los detalles del fallecimiento.
PEIGLSQYGLSHIQIRSW0PSVSTSVUYIXIRKSQMIHS etc.

Es importante animar al menor a compartir sin miedo la informacin con sus iguales. No
WIIWHMJIVIRXITSVLEFIVWYJVMHSPEQYIVXIHIYRWIVUYIVMHS]IWTVSFEFPIUYIEPKR
5.4. DE LOS 10 A LOS 13 AOS compaero ms se anime a compartir alguna experiencia similar.

)R PE TVIEHSPIWGIRGME IW PzKMGS UYI ETEVI^GE IR PSW RMySW PE TVISGYTEGMzR WSFVI PE ,E] UYI TVSGYVEV RS EXSWMKEVPIW RSW QERXIRHVIQSW GIVGE HMWTYIWXSW E IWGYGLEVPIW
muerte. Una de las cosas que ms les concierne es cmo se va a ver afectada su vida, el pero sin estar encima, porque a esta edad suelen ser reservados. Es cierto que algunos
impacto que genera la prdida y que van a sufrir o sufren ellos mismos y sus amigos. En preadolescentes lo comparten todo, pero es importante que tengan su parcela de
este caso, debemos explicarles que la muerte es una parte de la vida y que lo habitual es intimidad.
UYIEYRUYITYIHEWIVHSPSVSWEXEQFMqRLEFVjVIGYIVHSWUYIQIVI^GERPETIRE

A los menores les ayuda que compartamos situaciones similares que hayamos atravesado:
podemos describirles los detalles y los sentimientos que vivimos para que ellos puedan
explorar los suyos, de forma que perciban que, aunque es una situacin dolorosa, se
puede seguir adelante y nuestro ejemplo puede servirles de gua.

82 83
Si su opinin no es aceptable, que sientan al menos que se los tiene en cuenta y que
De los 10 a los 13 aos se abre un abanico de posibilidades. Podemos plantearles otros puntos de vista sobre
IPQMWQSXIQE PIE]YHEVIQSWEI\MFMPM^EVPEWMHIEWYSTMRMSRIWVEHMGEPIWXuTMGEWHIPE
FACILITA adolescencia.
 Ensearles a valorar los recuerdos.
 Compartir nuestras experiencias.
Los adolescentes deben sentirse respetados. A esta edad, las opiniones sobre la muerte
 Compartir las emociones y los sentimientos.
 Solicitar su ayuda en los ritos de despedida. son muy variables: pueden manifestar opiniones que atacan directamente a nuestros
 2SVQEPM^EVPEWIQSGMSRIW principios y deben sentir que las respetamos. Nos basaremos en un principio de la terapia:
2SLE]GSWEWFYIREWRMQEPEWWMQTPIQIRXILE]GSWEWXSHEWZEPIR
DIFICULTA
 9WEVJVEWIWUYIHMGYPXERWYI\TVIWMzRIQSGMSREP Debemos dejarles espacio para la expresin emocional, respetando sus tiempos. Les suele
 Atosigarles sobre lo que les pasa.
molestar que nos mantengamos demasiado cerca o demasiado lejos. Permitiremos sus
 Invadir su intimidad.
expresiones, incluso aquellas que estn alejadas de la realidad o estn ligadas a ideas
fantasiosas e irreales. Dejaremos que expresen esas posibilidades e iremos corrigiendo
aquellas que estn muy alejadas de la realidad y puedan generar cierta desconexin con
el aqu y el ahora, como las relativas a comunicaciones, deseos o seales que enva el
5.5. LOS ADOLESCENTES fallecido.

=ELIQSWHMGLSUYIPSWEHSPIWGIRXIWTYIHIRLEGIVWITVIKYRXEWWSFVIPEQYIVXIQY] Es conveniente corregir o prestar una especial atencin a las conductas peligrosas que se
parecidas o idnticas a las que se hacen los adultos. Viven la prdida de un modo muy HIWIRGEHIRERXVEWYRJEPPIGMQMIRXSWMKRMGEXMZS]UYIWIFEWERIRPEMHIE Total, a m ya
WMQMPEVIRPSVIPEXMZSEHYHEWTVIKYRXEWHIWISW9REHIWYWHYHEWQjWGSQTPMGEHEWHI XSHSQIHEMKYEP. No debemos caer en el error de considerarlas cosas de cros o que
responder es si realmente hay algo despus de la muerte, si existe un ms all o si hay ya se le pasar, hay que transmitirle al menor que esa idea de que es inmune a otra
posibilidades de un reencuentro futuro. desgracia no es real, y de que todo puede pasar y cambiar en un momento.

Una de las cosas que ms va a ayudarles -adems de sentirse incluidos en las despedidas El sentimiento de EQuRSQIZEETEWEV o de que ]ERSLE]REHEUYITIVHIV puede
y todo lo que rodea a la prdida- es que no les apartemos ni les contemos mentiras aparecer en la adolescencia tras la muerte de un ser querido. Por eso, hay que explicar a los
relativas a la muerte. Si hay una enfermedad terminal, tienen que saber el nivel de menores que, si bien es cierto que parece improbable sufrir otra desgracia, efectivamente
gravedad, el tiempo de vida estimado. Si el fallecimiento ha sido por una muerte violenta puede pasar y su comportamiento puede tener consecuencias irreparables. Es preferible
deben saberlo, o si fue un suicidio debemos poder abordarlo con ellos. La verdad facilita el dilogo abierto en lugar de reprender o castigar las conductas de riesgo y las opiniones
mucho el proceso, mientras que ocultar, mentir o engaar es una de las cosas que ms EPINEHEWHIPSWSGMEPQIRXIEGITXEFPI ,EFPEVPIWHIRYIWXVEI\TIVMIRGMEEWYIHEHWYIPI
HMGYPXEHIWXVEIVjREPEVKSTPE^S E]YHEVPIWEYRUYIRSPSVIGSRS^GER

,E]UYIXIRIVIRGYIRXEPESTMRMzRHIPQIRSVMRHITIRHMIRXIQIRXIHIPSUYIWIE(IFIR Sobra explicar que hay que darles un papel activo en los rituales de despedida y en los
sentirse valiosos y tenidos en cuenta como parte importante de la familia durante esos actos en torno al fallecido, no hay que alejarles ni proponerles un papel secundario. Es
momentos tan difciles, frente a la actitud sobreprotectora de apartarles a un lado. importante que su mundo emocional se vea validado, es decir: las emociones hay que

84 85
expresarlas. Sabemos que es una poca en la que cuesta mucho hacerlo, pero todas son
PIKuXMQEW]LE]UYIHIGuVWIPS )WMQTSVXERXIUYIQYIWXVIIRJEHS EPMZMS XVMWXI^E MVEPS 6. El duelo en cada etapa del
que surja, facilitndole su expresin y evitando mensajes inadecuados como: Ahora eres
YRLSQFVI7qJYIVXITSVXYQEHVI]XYWLIVQERSW)VIWIPGEFI^EHIJEQMPMEy otras cosas desarrollo: Aspectos normales, signos
que suelen decirse en esta lnea.
de alarma y cmo ayudar
Si la persona fallecida era central para el adolescente, es importante que sea uno de
los primeros en recibir la noticia. No es bueno retrasar el momento, ya que lo coloca al
QEVKIR]TYIHIWIRXMVWIRMRKYRIEHSSHIWTPE^EHS

Es muy importante que el menor se reintegre en sus actividades lo antes posible. Resulta
MRHMWTIRWEFPI QMRMQM^EV PSW GEQFMSW EWu UYI IZMXEVIQSW UYI EWYQE VIWTSRWEFMPMHEHIW
que no le corresponden o que tenga que abandonar sus actividades por necesidades
IGSRzQMGEW ,E] UYI MRXIRXEV UYI WY QYRHS WI ZIE PS QIRSW MRXIVVYQTMHS S
I\TIVMQIRXIIPQIRSVRQIVSTSWMFPIHIGEQFMSW

En la adolescencia

FACILITA
 Sentirse parte activa de todo.
 Valorar su opinin.
 Corregir con cario sus expresiones u opiniones radicales.
 ,EFPEVPIWHIRYIWXVEI\TIVMIRGME
 )ZMXEVQIRWENIWHIJSVXEPI^ESVIWTSRWEFMPMHEH
 1MRMQM^EVPSWGEQFMSW

DIFICULTA
 Apartarles de los sucesos.
 Permitirle actitudes basadas en la idea: 8SXEPUYqQjWQIZEETEWEV.
 Atosigarle con constantes ejemplos nuestros.
 Retrasar la noticia y anteponer a otras personas.
 Pedirles ayuda en nuestras responsabilidades.

86 87
6. El duelo en cada etapa del
desarrollo: Aspectos normales, signos
de alarma y cmo ayudar
0E QYIVXI RS IW EPKS PMRIEP EWu UYI RS TSHIQSW LEFPEV HI GIVXI^EW TIVS TSHIQSW
VIJIVMVRSWEEUYIPPEWGSWEWGSRYREMRGMHIRGMEQjWEPXEIRGEHEKVYTSHIIHEH ,E]UYI
XIRIVIRGYIRXEUYIIRIPRMySMRY]IRQYGLEWGSWEWUYIPILEGIRMVIRYREHMVIGGMzR
u otra: su desarrollo emocional, el entorno, la red de recursos de los que disponga, el
desarrollo cognitivo, el tipo de muerte, las experiencias previas o la informacin que haya
ido recibiendo, la edad, el estilo de comunicacin y otras muchas cosas directamente
relacionadas con su entorno o desarrollo.

6.1. LA MUERTE EN LA PRIMERA INFANCIA: DEL BEB AL NIO


DE 2 AOS

Entre los cero y los dos aos no hay una comprensin de la muerte, sino que hay una
percepcin de ausencia que se produce desde el momento en que el beb puede
TIVGMFMVPEEYWIRGMEHIYREKYVEGSRPEUYILE]EIWXEHSLEFMXYEPQIRXIIRGSRXEGXS]
haya formado parte de su da a da de manera regular, es decir: que se d la permanencia
de objeto. Es necesario que el beb haya establecido un vnculo para que se d ese duelo
asociado a la ausencia.

0SRSVQEPIWUYIWIERPEWKYVEWQjWGIVGEREWPEWUYIGSFVIRYREQE]SVMQTSVXERGME
tras la muerte: lo ms frecuente es la madre, luego el padre.

Esta permanencia de objeto se produce tambin con determinadas personas que forman
parte del desarrollo del nio, pero para que se d deben estar presentes de manera
GSRXMRYEHEIRWYGVMER^E%WuTSVINIQTPSVIGSRSGIREPSWEFYIPSWXuSWLIVQERSWSPSVIW
y son capaces de anticipar rutinas que forman parte de su vida de forma cotidiana.

La permanencia de objeto es el primer pre-requisito para que se pueda construir el


concepto de muerte en la mente infantil, es necesario que el nio pueda generar un

89
recuerdo del objeto amado y esperar el reencuentro. De este modo se hace posible la
separacin y el posterior encuentro.

Lo que quiere decir esto es que, aunque no haya una comprensin exacta de la muerte, lo
que s hay es una percepcin de ausencia y lo ms importante: los nios son conscientes
del impacto que tiene la prdida en sus rutinas. Es habitual que un beb se niegue a comer,
EUYIPSFEyIR EWIVQIGMHSWMUYMIRVIEPM^EFEIWXEWEGXMZMHEHIWIVEPETIVWSREJEPPIGMHE
Es su manera de intentar que la persona que lo atenda regrese junto a l y se haga cargo
de su cuidado como antes.

A medida que el nio se va acercando a los dos aos, hay una evolucin de la memoria,
PEEYXSRSQuE PEWSGMEPM^EGMzR]IPPIRKYENI ]PEWVIEGGMSRIWWSRQjWMRXIRWEW ]ERSWzPS
percibe la ausencia, sino que aparece el temor a que el objeto querido no vuelva. El beb
TYIHI XIRIV GSRHYGXEW HI FWUYIHE QYGLS QjW PPEQEXMZEW TEVE EWIKYVEVWI HI UYI PE
persona fallecida regresa o, por el contrario, de que no hay nada que pueda hacer para
que vuelva. La expresin no es slo desde la emocin, sino que puede ser verbal.

Otra de las cosas que capta el nio a esta edad son los estados de nimo. Por tanto, una
parte de lo que comprenda del duelo estar determinada por el estado emocional de las
personas que lo rodean y lo cuidan.

Qu cosas son normales y cules debemos considerar signos de alarma:

0SLEFMXYEPXVEWYREQYIVXIWMKRMGEXMZEIWUYIPSWFIFqW]RMySWGIVGERSWEPSWHSWEySW
QERMIWXIR

1. Irritabilidad, normalmente en forma de llantos o protestas. A medida que van


creciendo se vuelven oos.
2. Problemas con la alimentacin: lo ms frecuente es una negativa a comer, que a
menudo es un intento desesperado de que vuelva la persona que le daba de comer
de manera habitual.
3. Alteraciones en el sueo y en la vigilia: duermen menos, o bien cambian su patrn de
sueo, o estn ms apagados y duermen ms.
4. 6IKVIWMSRIWZYIPZIREGLYTEVWIIPHIHSTMHIRYRFMFIVzRWMIQTI^EFEREGSRXVSPEV
WYWIWJuRXIVIWQYIWXVERTVSFPIQEW HYIVQIRGSRPEWKYVEWHIETIKSSRSUYMIVIR
HSVQMVWSPSW

90 91
Todas estas reacciones son las conductas esperables en un nio tras el fallecimiento de
YRSHIWYWGYMHEHSVIWTVMRGMTEPIW SHIEPKYRETIVWSREQY]TVIWIRXISWMKRMGEXMZEIR
su vida.

Los signos de alarma que deben preocuparnos en esta edad son:

1. 2IKEXMZEEGSQIVUYIWITVSPSRKEIRIPXMIQTS]KIRIVEYRETqVHMHEWMKRMGEXMZE
de peso.
2. Llantos constantes que no cesan, exagerados, el nio parece inconsolable.
3. Incapacidad para participar en las rutinas compartidas con otros adultos: nos
encontramos un beb muy aptico, inapetente, desmotivado, que no muestra
curiosidad por nada.
4. -RWSQRMSTVSPSRKEHSSYREEPXIVEGMzRWMKRMGEXMZEHIPTEXVzRWYIySZMKMPMEUYIRSIW
GETE^HIVIGYTIVEVRMHIRSVQEPM^EV
5. -RGETEGMHEHTEVE VIEPM^EVEUYIPPEW GSWEWUYI]EVIEPM^EFERHIJSVQE EYXzRSQE RS
ZYIPZIREWYGEQEHINERPEPY^IRGIRHMHERSUYMIVIRHINEVIPGLYTIXIIXG

Cmo podemos ayudarles?

 Manteniendo las rutinas del beb.


 +EVERXM^ERHSYRGYMHEHSI\XVE
 ,EFPjRHSPIHIPSUYIWIRXMQSWEYRUYIRSPSIRXMIRHE
 Mostrando paciencia ante las regresiones.
 7YWXMXY]IRHS EP GYMHEHSV TVMRGMTEP ERXIW HI UYI JEPPI^GE WM WY QYIVXI WI TYIHI
anticipar.

Del beb al nio de 2 aos

 A esa edad no existe el concepto de muerte como tal.


 7ITIVGMFIPEEYWIRGMEHIPETIVWSREWMKRMGEXMZE
 Los estados emocionales se contagian.
 0EEPXIVEGMzRHIPEWVYXMREWMRY]IRIKEXMZEQIRXI
 Aparece: alteracin de las rutinas principales como la comida y los estados
de sueo y vigilia, los menores se vuelven irritables.
 ,E] UYI IWXEV EXIRXS E WM PEW EPXIVEGMSRIW IR PEW VYXMREW WI ZYIPZIR QY]
PPEQEXMZEWWMLE]YRETqVHMHEHITIWSWMKRMGEXMZSWMWIZYIPZIMRGSRWSPEFPI
si muestra apata o no recupera el patrn de sueo.

92 93
6.2. LOS PREESCOLARES: DE LOS 3 A LOS 6 AOS 1YGLEW HI IWXEW TVIKYRXEW RSW MRGSQSHEVjR S XEP ZI^ RS WITEQSW UYq GSRXIWXEV 0S
positivo es que nos permitirn abrir un dilogo con el nio y saber qu aspectos maneja
A esta edad los nios conciben la muerte como algo temporal y reversible. En ocasiones sobre la muerte y cules no.
creen que la persona est durmiendo, sumida en un sueo, y piensan que puede despertar
HIIWIIWXEHSIREPKRQSQIRXS8EQFMqRGVIIRUYIIWVIZIVWMFPI UYIPETIVWSREIWXj Qu cosas son normales y cules debemos considerar signos de alarma:
IREPKRPYKEVUYIIWGETEEWYGSQTVIRWMzRTIVSUYITYIHIZSPZIV0SRSVQEPIWUYIE
esta edad equiparen la muerte a un sueo o a un viaje. 0SLEFMXYEPIWUYIXVEWYRJEPPIGMQMIRXSPSWRMySWHIIWXEWIHEHIWQERMIWXIR

Es una edad en la que prima la fantasa y los menores no entienden que las funciones  Confusin con los trminos y los acontecimientos, con el concepto de muerte,
vitales bsicas se han interrumpido. Por tanto, piensan que la persona fallecida vive de  Conductas para comprobar la realidad de la muerte, como una negativa a comer a
ver si viene el fallecido a alimentarle, rabietas que buscan que el difunto le consuele,
EPKRQSHS]TYIHIGSQIVWIRXMVJVuSSGEPSVSuVLEFPEVTIRWEV]QMVEVRSWHIWHIHSRHI
QEPGSQTSVXEQMIRXSXVEXERHSHITVSZSGEVPEVIEGGMzRHIPJEPPIGMHS
se encuentre.
 Ansiedad de separacin: les va a costar mucho separarse de las personas que quieren
SHIPEWKYVEWHIETIKSTSVUYIXIQIRUYIWITVSHY^GERSXVEWQYIVXIW
Es una etapa en la que el egocentrismo domina la comprensin de las cosas, por ese
 Cierta regresin en sus conductas o en los hbitos adquiridos: pueden dejar de
motivo creen que stas suceden a su antojo y estn ligadas a ellos. Es posible que en este
HSVQMV WSPSW QERMIWXER HI RYIZS TVSFPIQEW TEVE IP GSRXVSP HI WYW IWJuRXIVIW ]
periodo haya momentos en los que los menores piensen que la muerte es contagiosa,
piden ayuda para hacer cosas que antes hacan solos.
pero es debido al pensamiento mgico y a la subjetividad.  Pesadillas, sueo interrumpido y problemas ligados al sueo.
 Miedos, en especial aquellos relacionados con otras prdidas y con enfermedades.
En esta etapa preescolar aparece la sensacin de eternidad, es decir: no entienden la
universalidad de la muerte, piensan que las personas a las que quieren y ellos mismos Aquellas cosas que nos deben mantener alerta o que debemos considerar importantes
siempre estarn vivos, si bien la muerte es vlida para determinadas personas, as que para son:
ellos no existe completamente la universalidad de la muerte.
1. Ansiedad de separacin que no cesa, que produce al menor incapacidad para
)RIPQSQIRXSIRIPUYIETEVIGIPEGSQTVIRWMzRHIPEYRMZIVWEPMHEHIQTMI^EREZIVFEPM^EV reintegrarse a las actividades cotidianas propias de su edad
su temor a la propia muerte y la de las personas de su entorno, o su preocupacin acerca 2. Miedos incapacitantes, terror ante cosas cotidianas que antes no le generaban esas
de si van a estar cuidados o no. reacciones.
3. 4IWEHMPPEW VIGYVVIRXIW UYI ERXIW RS WI TVIWIRXEFER IP RMyS IQTMI^E E WSyEV GSR
Es una etapa en la que hay mucha curiosidad: el nio se hace muchas preguntas para as frecuencia cosas que le aterran.
poder construir el mundo y los conceptos que tienen que manejar. Si hacemos memoria, 4. 7uRXSQEW HITVIWMZSW GSQS ETEXuE XVMWXI^E TVSJYRHE RIKEXMZE E MRMGMEV EGXMZMHEHIW
es la poca de los 4SVUYq#, por lo que difcilmente su curiosidad va a quedar saciada y agradables.
nos sometern a un interrogatorio acerca de aspectos relacionados con la muerte como: 5. 2IKEXMZEEGSQIVTqVHMHEHITIWSWMKRMGEXMZEHIFMHSEUYIRSHIWIEWIVEPMQIRXEHS
come menos o se muestra desganado.
 Dnde est?
 8MIRIJVuSTYIHIGSQIV]FIFIV# Cmo les ayudamos?
 Puedo hablar con l o ella?
 Cmo se sube al cielo? Cundo baja?  Respondiendo a sus preguntas de manera honesta.
 'YjRHSZEQSWEPGMIPS#  +EVERXM^jRHSPIWIPGYMHEHSUYIRYRGEZEREUYIHEVWIWSPSW]HIWEXIRHMHSW
 4VSTSVGMSRjRHSPIWWIKYVMHEHIRPSWHMWXMRXSWEQFMIRXIWSHMGYPXEHIWUYIZMZER
 4SVUYqRSZMIRI#
 Evitando metforas que compliquen la explicacin de la muerte.
 :IRHVjEQMGYQTPIEySW2EZMHEHIWIWXEW#

94 95
 Usando un lenguaje adecuado y sencillo para explicar los conceptos relacionados
con la muerte.
 9WERHS VIGYVWSW TEVE EER^EV IP IRXIRHMQMIRXS HI PE QYIVXI GSQS TIPuGYPEW
GYIRXSWHMFYNSW
 9XMPM^ERHSINIQTPSWHIPEREXYVEPI^EUYIIWXqREWYEPGERGI
 ,EFPjRHSPIWHIPEQYIVXIEYRUYIRSLE]EWYGIHMHS
 8VERUYMPM^ERHS TSGS E TSGS ] GSR GEVMyS PEW GSRHYGXEW HITIRHMIRXIW ] HI ETIKS
inseguro que vayan apareciendo.
 ,EFPERHSHIRYIWXVSWWIRXMQMIRXSW
 Mostrando nuestras emociones y sentimientos.
 Ayudando a recolocar al fallecido con ejemplos de actividades, cosas, recuerdos que
hayan podido vivir.

Los nios de 3 a 6 aos

 %IWEIHEHGVIIRUYIPEQYIVXIRSIWHIRMXMZE
 No entienden la irreversibilidad de la muerte.
 Creen que los fallecidos siguen manteniendo sus funciones vitales, pero en
SXVSPYKEVGVIIRUYIZIRUYIS]IRUYIWMIRXIRJVuSSGEPSV
 La muerte es selectiva, principalmente algo caracterstico de personas
mayores o que estn muy, muy enfermas.
 0EW I\TPMGEGMSRIW EHYPXEW WSR VIGMFMHEW HI QERIVE PMXIVEP RS EPGER^ER E
entender las expresiones sobre la muerte.
 Necesitan mensajes claros y concisos.

6.3. LA MUERTE EN LA EDAD ESCOLAR: DE LOS 6 A LOS 10 AOS

En este periodo, el concepto de muerte se acerca al real. Lo esperable es que en torno


EPSWRYIZISHMI^EySWPERSGMzRHIPEQYIVXIWIEGSQTPIXE TIVSERXIWPSWQIRSVIW
TYIHIR QERINEV PSW GSRGITXSW GSR GEPMHEH ] GSQMIR^ER E EHUYMVMV IP WMKRMGEHS HI PE
muerte.

,EWXEPSWWIMWEySWTVMQEIPTIRWEQMIRXSQjKMGS TIVSIRXSVRSEIWEIHEHPSWRMySW
IQTMI^ER E HMWXMRKYMV PE JERXEWuE HI PE VIEPMHEH ] E GSQTVIRHIV UYI PSW JEPPIGMHSW RS
pueden sentir, ni ver, ni or y que ya no hay funciones vitales. A esta edad la muerte deja de
96 97
WIVXIQTSVEPTEVEWIVHIRMXMZEPSWQIRSVIWETVIRHIRUYIPEWTIVWSREWUYIQYIVIRRS En esta etapa el grupo de amigos, de iguales, se convierte en algo esencial: sirve de gua y
van a volver y pueden entender que no se trata de un sueo ni de un estado temporal. de medida, y pertenecer al grupo mayoritario es fundamental para los menores, pasando
en muchos casos a ser populares o marginados. Por eso, a esta edad se convierte en
,EGMEPSWWMIXIEySWPSWRMySWGSQTVIRHIRPEMVVIZIVWMFMPMHEHHIPEQYIVXI]PEMRWIRWMFMPMHEH un sufrimiento el hecho de sentirse diferente, ser el primero en experimentar algo o
o interrupcin de las funciones vitales, pero les falta un concepto clave: la universalidad. bien tener que cambiar de amigos. Perder a un progenitor en esta etapa puede resultar
)PPSWWEFIRUYIXSHSWPSWWIVIWZMZSWQYIVIR TIVSRSWIMHIRXMGERGSRIWXIGSRGITXS YRQE^E^SERMZIPWSGMEP PSUYIYRMHSEPKSPTIIQSGMSREPLEGIUYITSHEQSWIRGSRXVEV
creen que la muerte es selectiva y que suele afectar a personas muy mayores, es decir: QE]SVIWHMGYPXEHIWIRPSWRMySW QYGLSWRSUYIVVjRLEFPEVHIPXIQETEVERSWIRXMVWI
para este grupo de edad, la muerte es de viejos.
comparados o evaluados por sus iguales.

'YERHSTSVRGSQTVIRHIRUYIPEQYIVXIIWYRMZIVWEP ETEVIGIPEERKYWXMESIPQMIHS
0EGYVMSWMHEH]PERIGIWMHEHHIGSRSGMQMIRXSWIWYRHIRSQMREHSVGSQREIWXEWIHEHIW
ya sea a la propia muerte o bien a la de los familiares cercanos que se encargan de su
VE^SREVPSXSHSWEFIVHIQYGLEWGSWEWGYIWXMSREVPSWGSRSGMQMIRXSWFYWGEVI\TPMGEGMSRIW
cuidado. En el momento en que aparece esta gran preocupacin por su propia muerte
PIW HE QYGLS TSHIV ] EHIQjW LEGI UYI WY HIWEVVSPPS EZERGI 4SV IWXE VE^zR PS QjW
y la de los adultos de su entorno, es normal que los menores estn atentos a cualquier
indicio de una posible enfermedad, e incluso es posible que experimenten pequeas TVSFEFPIIWUYIERXIYRETqVHMHEETEVI^GEIRPSWRMySWYREGYVMSWMHEHMRWEGMEFPIWSFVI
WSQEXM^EGMSRIWWMQMPEVIWEPEWUYIXYZSPETIVWSREJEPPIGMHE la muerte, sus causas, el cuerpo, los procedimientos, el funeral, la incineracin, el entierro,
PEWXYQFEW=HIELuWYIPIRTEWEVEGSWEWQjWEFWXVEGXEWUYMIVIRWEFIVGzQSIWIP'MIPS
Durante este periodo y alrededor de los 9 10 aos es cuando los nios toman a dnde vamos cuando morimos, qu pasa despus de la vida, etc.
verdaderamente conciencia de la universalidad de la muerte. Entonces se hace ms
patente el temor a perder su vida o a sus familiares cercanos y desarrollan un instinto de Estas preguntas pueden generar reacciones emocionales intensas en el adulto, ya que
proteccin que les hace revisar y concienciar a los adultos de su entorno de los peligros EPKYREWGYIWXMSRIWRSXMIRIRYREVIWTYIWXEGPEVE KIRIVERYRKVERHIWGSRGMIVXSSUYM^j
que les rodean. pueden resultar comprometidas. Lo cierto es que estas dudas son propias del crecimiento
y responden a la necesidad del nio de intentar dar sentido al mundo que le rodea.
En consecuencia, es probable que en este contexto los nios se muestren ms precavidos,
QSHIVEHSW GEYXIPSWSW]EPIVXIREWYWQE]SVIWWSFVIPEGSRZIRMIRGMEHIGVY^EVTSVIP
Algunas de esas preguntas pueden relacionarse con temas como:
TEWSHIGIFVE MRWMWXERIRLjFMXSWWEPYHEFPIWSMQTSRKERGSRVMKMHI^IPWIKYMQMIRXSHI
PEW RSVQEW TSV INIQTPS TSRIVWI IP GMRXYVzR HI WIKYVMHEH IR IP GSGLI GVY^EV GSR IP
 Cmo es el proceso de descomposicin de un cuerpo, de qu color, si crece el pelo
semforo en verde, no saltarse los semforos en rojo, no hablar con desconocidos, el
SPEWYyEWWMLE]KYWERSWWMWIHIWLEGI
JYIKSPEGSGMRE%WuUYIIWRSVQEPUYIXSQIRTVIGEYGMSRIWIMRXIRXIRUYIPEWTIVWSREW
 Qu pasa con las vsceras y los rganos internos.
de su entorno tambin las tomen.
 Dudas realistas acerca del futuro: si habr dinero para hacer lo que antes se haca,
A esta edad es habitual que empiece a aparecer la culpa. El principal motivo es el cmo se va a mantener la casa, si se podr seguir pagando el colegio, si las actividades
egocentrismo que impera en esta etapa. Esa cualidad hace que el nio piense que, si alguien extraescolares pueden continuar.
LEQYIVXSLETSHMHSWIVTSVEPKSUYIqPLE]ELIGLSHMGLSSTIRWEHS=EQIRYHSSGYPXE  Cuestiones concretas sobre los rituales: qu pasa con el cuerpo al ser enterrado, qu
esas dudas a los adultos, hasta que entiende que el pensamiento, la opinin, los hechos o pasa durante la incineracin, si se va a incinerar a otras personas, etc.
las palabras no suelen causar la muerte.  Cmo es el cielo o el ms all.

98 99
Qu cosas son normales y cules debemos considerar signos de alarma: 1. 7SQEXM^EGMSRIWUYIRSGIWERHSPSVIWVITIXMHSWWMRGEYWEQqHMGEETEVIRXI
2. 4VSFPIQEWGSRWXERXIWHIERWMIHEHUYIWIQERMIWXERIR MRGETEGMHEHTEVEGSRGMPMEV
Lo habitual es que nos encontremos con: o mantener el sueo, problemas con la alimentacin -ya sea por comer en exceso o
demasiado poco-, o nerviosismo en sus actividades cotidianas.
 Oscilaciones en la comprensin: En los primeros aos, los nios pueden no entender 3. Malhumor y agresividad constante que antes no estaba, incluso agresiones a sus
EWTIGXSW GSRGVIXSW ] GSRGITXSW VIPEGMSREHSW GSR PE QYIVXI QMIRXVEW UYI EP REP iguales.
pueden tener una comprensin completa o casi completa, as que habr cosas que 4. Sntomas depresivos que se mantienen ms de lo esperable: problemas de sueo,
entiendan y otras cosas que no acaben de entender, llegando incluso a obcecarse con regresin a etapas anteriores, apata, prdida de inters por las cosas que antes le
los conceptos que no manejan. interesaban, prdida de inters social.
 Temores y miedo a que la muerte les sobrevenga a ellos o a otros familiares: harn 5. Bajada drstica de actividad: no le apetece participar en nada, nada parece emocionarle.
comprobaciones del bienestar de otros y mostrarn preocupacin por su salud. 6. Incapacidad para reintegrarse al mbito acadmico: hay una negativa a ir al colegio o
 Preguntas sobre los pormenores y detalles de la muerte, que habitualmente se temor incapacitante para afrontar el da a da en clase o a sus compaeros.
vuelven recurrentes. 7. Problemas de concentracin que antes no tena y que se prolongan, repercutiendo
 Preguntas sobre aspectos morbosos de la muerte. en sus actividades cotidianas.
 1ERMIWXER HI JSVQE LEFMXYEP IQSGMSRIW GSQS IP IRJEHS ] PE GSRJYWMzR IWXjR 8. Bajada drstica del rendimiento escolar o del inters por las actividades acadmicas,
enfadados tanto con la muerte, como con la persona fallecida que ya no les va a que se mantiene en el tiempo y con consecuencias indeseables para el nio.
cuidar. 9. Miedos prolongados e impropios de su edad.
 )W LEFMXYEP UYI ETEVI^GE PE RIKEGMzR ] EGXIR GSQS WM REHE LYFMIVE TEWEHS 10. %RWMIHEHHIWITEVEGMzRSMRGETEGMHEHTEVEWITEVEVWIHIPEWKYVEWHIETIKSTSVUYI
mantenindose en un mundo irreal con sus actividades, su humor, su conducta y su el menor teme que haya nuevas muertes en su entorno.
mundo social intacto.
 Si aparece la negacin, pueden mostrarse reacios a abordar el tema o a hablar de la Cmo les ayudamos?
muerte, tendrn una actitud evitadora.
 Pueden mostrar enfado y agresividad tras el fallecimiento, debido a la prdida del  Debemos explicarle las cosas al nio y responder a sus preguntas.
cuidado y las actividades que les proporcionaba la persona fallecida.  Evitaremos ocultarle informacin.
 Problemas de concentracin asociados al duelo.  Evitaremos mentirle o edulcorar la muerte del ser querido.
 Bajada del rendimiento escolar.  Le integraremos en los ritos funerarios.
 Conductas para comprobar la realidad de la prdida: hacer enfadar a un progenitor  ,E]UYIKEVERXM^EVUYIWYWEGXMZMHEHIWTVMRGMTEPIW]VYXMREWZERETIVQERIGIVMRXEGXEW
a ver si vuelve el otro, reclamar la presencia del fallecido para contrastar algo, traer en la medida de lo posible.
un regalo, etc.  Respetaremos sus reacciones de duelo.
 ,E]UYIGSVVIKMVPEWGSRHYGXEWMRHIWIEFPIW]I\TPMGEVPIWPSUYITIRWEQSWUYIIWXj
,E]EPKYRSWEWTIGXSWUYIRSTSHIQSWTIVHIVHIZMWXE]UYIWMETEVIGIRWSRsignos de sucediendo.
alarma que pueden requerir la consulta con un profesional:  Le proporcionaremos actividades para facilitar el recuerdo del ser querido.

100 101
 0IETS]EVIQSWIREUYIPPEWGSWEWUYIRIGIWMXI]IRPEWHMGYPXEHIWUYIWITVIWIRXIR 6.4. PREADOLESCENTES: DE LOS 10 A LOS 12 AOS
 Le ofreceremos informacin y explicaciones previas a la muerte para que pueda
anticiparla (si es posible) y no suponga un impacto muy grande. La muerte para los preadolescentes no es un misterio, comprenden todas sus dimensiones
 Mostraremos nuestras emociones y legitimaremos las suyas. y componentes, entienden que los muertos no van a volver y que no los vern ms. Por
lo tanto, comprenden la irreversibilidad, saben que cualquiera puede morir y que antes o
despus la muerte le llega a cada persona, incluido ellos, as que entienden la universalidad
Los nios de 6 a 10 aos
de la misma.
 'SQTVIRHIRPEYRMZIVWEPMHEH]PEMVVIZIVWMFMPMHEHHIPEQYIVXIEPREPHI
esta etapa, aunque hay oscilaciones en el concepto. Los preadolescentes saben que las funciones vitales se interrumpen completamente, que
 Tardan en comprender que los muertos no sienten, que los sentidos el muerto no escucha, no ve, no siente. Son conscientes de que esa interrupcin es
han dejado de funcionar y preguntan mucho sobre el tema, lo acaban
absoluta y que los sentidos no se mantienen tras el fallecimiento. Tambin conocen los
entendiendo en esta franja de edad.
 Comprenden bien la interrupcin de las funciones vitales: saben que el aspectos causantes de la muerte: las causas que provocan la muerte y a qu rganos
GSVE^zRRSPEXI]UYIRSWIVIWTMVE afectan principalmente.
 Creen que la muerte es selectiva, propia de personas mayores: cuando
entienden que ellos tambin pueden morir se angustian ante la idea de su 0SWVMXSWJYRIVEVMSWXEQTSGSWYTSRIRYRWIGVIXSTEVEIPPSWIRXMIRHIRXERXSWYWMKRMGEHS
propia muerte y la de quienes los rodean.
como el sentido de participar en los mismos, as que lo habitual es que soliciten participar
 Aparecen los primeros pensamientos de culpa asociados a su egocentrismo.
 Existe preocupacin por su salud y la de los adultos de su entorno. Temen en ellos. De hecho, es muy importante que puedan formar parte de las despedidas y
SXVEWQYIVXIW]UYIIRJIVQIRWYWKYVEWHIETIKSSIPPSWQMWQSW de los rituales. No hay que considerarlos meros espectadores, sino agentes activos. Es
 ,EGIRQYGLEWTVIKYRXEWWSFVIXSHSVIPEXMZEWEPSWVMXYEPIW]PEWGVIIRGMEW bueno que pidamos su opinin y tengamos en cuenta sus sugerencias en esos momentos.
Pueden mostrar inters en participar en los ritos y despedidas, hacia los 6
Tambin podemos darles un papel algo ms activo en los ritos si se sienten cmodos.
aos pueden hacerlo, siempre con condiciones favorables y habindoles
explicado bien en qu consisten previamente.
 Es importante no mentirles ni edulcorarles la informacin: antes o despus Como ya hemos comentado previamente, los preadolescentes entienden todas las
conocern la verdad y preferirn haber sido incluidos. dimensiones de la muerte y sus causas, as que son conscientes del impacto que genera
 Resulta fundamental que su opinin sea tenida en cuenta o, al menos, que
la prdida en terceras personas y en ellos mismos. Al ser conscientes de este impacto
les consultemos determinadas cosas para integrarles en el proceso.
 0SLEFMXYEPIWUYIQERMIWXIRGSRJYWMzRIRPSWGSRGITXSW TVISGYTEGMzR en su entorno y del dolor que causa el fallecimiento de un ser querido, es habitual que
por otros fallecimientos, curiosidad sobre la muerte, problemas de IRSGEWMSRIWYXMPMGIRIWXIXIQEGSQSEVQEEVVSNEHM^ETEVEMRXIRXEVQERMTYPEVHMWXMRXEW
concentracin, preguntas recurrentes, etc. situaciones:
 Buscaremos ayuda profesional ante los sntomas de alarma mencionados,
especialmente si hay miedos y cambios de conducta bruscos y prolongados.
 7MQILYFMIVEQYIVXSXIEVVITIRXMVuEWHIIWXIGEWXMKS
 3NEPjQIQYVMIWIRSQIVIGIPETIREZMZMVGSRZSWSXVSW
 3NEPjXILYFMIVEWQYIVXSXIRZI^HI

102 103
Uno de los aspectos que les genera ms dudas o incertidumbre en esta etapa son las
creencias religiosas o culturales que le han inculcado o comparte con la familia. Es habitual
UYIIPQIRSVIQTMIGIEQSWXVEVVE^SREQMIRXSWGVuXMGSW]EWIRXMVWIIWGqTXMGSGSRPEW
creencias que antes aceptaba sin cuestionrselas.

A esta edad son comunes las dudas religiosas y el inters por el ms all, los espritus, la
VIPMKMzRIPEPQEPEVIWYVVIGGMzRIPGMIPS]GYEPUYMIVGSWEVIPEGMSREHEGSRPEWGVIIRGMEW
aspectos espirituales o trascendentales va a ser interpelada y cuestionada. Esto responde
EPMRXIRXSHIPQIRSVHIFYWGEVYRWMKRMGEHSIWXEFPIHIGSWEWUYIRSPSWSRXERXS8VEXE
HIXIRIVGIVXI^EWEGIVGEHIXIQEWQY]GSQTPINSW

Es habitual que el preadolescente pregunte por el cielo, la resurreccin, creencias de otras


GYPXYVEWIPEYVEEWTIGXSWEWXVEPIWPEVIWYVVIGGMzRSPEVIIRGEVREGMzR=XEQFMqRIWRSVQEP
UYIWITVSHY^GERWMXYEGMSRIWMRGzQSHEWXVEWYREXERHEHITVIKYRXEWPSWzGEWEPEWUYI
resulta difcil dar respuesta.

La capacidad del menor le permite fantasear e imaginar situaciones futuras relacionadas


con la muerte, con la posibilidad de anticipar los cambios o la forma en que podra
afectarle una muerte. Puede especular sobre las distintas situaciones que sucedern tras
el fallecimiento y, por tanto, valorar aspectos econmicos, sociales, familiares, educativos,
PEFSVEPIW )W GETE^ HI IRXIRHIV PE QYIVXI IR XSHEW WYW HMQIRWMSRIW ] TVS]IGXEV PEW
GSRWIGYIRGMEWHIqWXEEGSVXSQIHMS]PEVKSTPE^S

Esa capacidad de fantasear permite a los preadolescentes imaginarse su propia muerte y


ZEPSVEVPEWGSRWIGYIRGMEW]IPMQTEGXSUYIqWXEXIRHVuE4SVTVMQIVEZI^TYIHIRJERXEWIEV
con su muerte: imaginan quin les llorara, quin les echara de menos, cmo se sentiran
WYWTEHVIWWYJEQMPMEIPGIRXVSIWGSPEV

Lo normal es que la idea de su propia muerte les angustie, pero tambin es habitual que
muestren cierta reticencia a compartir esas fantasas y preocupaciones con los adultos, lo
que complica el dilogo a estas edades. Adems, podran encontrarse ante una opinin
adulta que menosprecie esas ideas y eso es algo de lo que habitualmente huyen.

104 105
Aunque el menor entiende todas las dimensiones y puede proyectar en el futuro las A menudo pueden manifestar cierto inters morboso sobre la muerte y es posible que
HMWXMRXEWGSRWIGYIRGMEWUYIXIRHVjPETqVHMHEIWXSRSWMKRMGEUYIGYIRXIGSRPSWVIGYVWSW hagan muchas preguntas sobre los detalles de la muerte para tener una idea exacta
experiencias y habilidades para afrontar el fallecimiento de un ser querido. de todo. Por otro lado, debido a la tendencia a la evitacin que mencionbamos antes
tambin pueden mostrar mucho hermetismo y negacin al abordar el tema.
A esta edad los sentimientos se convierten en algo difcil de vivir, manifestar y afrontar. Es
una etapa en la que los nios son muy vulnerables y creen que las emociones pueden ser )WPETVMQIVEZI^UYIPSWQIRSVIWTYIHIRJERXEWIEVWSFVIWYQYIVXI]EZIGIWTYIHI
una muestra de debilidad. Temen ser diferentes al resto y pasar a ser objeto de burla o a TEVIGIVUYII\MWXIYRETPERMGEGMzRHIPLIGLSIRWuUYIIREPKYRSWHIWYWGSQIRXEVMSW
ser cuestionados por sus sentimientos, as que es frecuente que tiendan a ocultar ante sus haya una intencin suicida. De hecho, es el primer momento en el que puede aparecer de
MKYEPIWPEWIQSGMSRIWEWSGMEHEWEPHYIPSTSVXIQSVEWIVNY^KEHSW manera consciente la ideacin suicida.

Qu cosas son normales y cules debemos considerar signos de alarma: Las bajadas en el rendimiento acadmico y la falta de concentracin no deben alarmarnos,
porque el preadolescente emplea parte de su concentracin en resolver su duelo.
Los preadolescentes entienden la muerte en todas sus dimensiones y, adems, en esta Normalmente suele ser una etapa en el estudio y pasa en un periodo corto de tiempo,
etapa afrontan muchos cambios tanto corporales como cognitivos: se estn preparando pero al principio es normal. Adaptarse a la nueva situacin es complicado y requiere de
para ser adultos y estn integrando muchos conocimientos. Por eso, a esta edad la muerte YRIWJYIV^SEHMGMSREPUYIVITIVGYXIIRSXVEWEGXMZMHEHIWGSXMHMEREW
es de vital importancia y los procesos de duelo no deben pasar desapercibidos, sino al
contrario: debemos estar atentos a las cosas que el menor vaya a experimentar y sentir 3FZMEQIRXIYRIWXEHSHIXVMWXI^E]HIGMIVXEHIWIWTIVEGMzRIWRSVQEPXVEWPETqVHMHE
en esta etapa. de un ser querido, que suele unirse a cierta apata o desgana por las cosas y los eventos
sociales, al principio cuesta adaptarse a ser distinto y a la nueva situacin.
8VEWYRJEPPIGMQMIRXSPSRSVQEPIWUYIIPRMySQERMIWXIHMGYPXEHTEVEEWYQMVPEVIEPMHEH
de la muerte. Frente a las anteriores etapas del crecimiento en las que el menor no entiende )WGSQRUYIIPQIRSVHIWEVVSPPIEGXMXYHIWUYIVIWTSRHIREJVEWIWLIGLEWGSQS TSV
que no va a volver a ver ms al fallecido, a esta edad lo comprenden perfectamente y la ejemplo: %LSVE XYW LIVQERSW HITIRHIR HI XM 8MIRIW UYI HEV INIQTPS 8Y QEHVI XI
HMGYPXEHWIXVEHYGIQjWFMIRIRYRERIKEXMZEEEGITXEVIWEVIEPMHEH RIGIWMXE QjW UYI RYRGE )VIW IP LSQFVI HI PE GEWE 8MIRIW UYI QSWXVEVXI XVERUYMPS ]
WIVIRSELSVEIVIWIPEHYPXS]SXVEWMHIEWMREHIGYEHEW4SVIWSEQIRYHSVIWTSRHIRE
%P MKYEP UYI PSW EHYPXSW PSW QIRSVIW HIWEVVSPPER GSRHYGXEW HI FWUYIHE EWu UYI lo que se les reclama con actitudes ms propias de un rol que no les corresponde.
encontraremos hbitos de comprobacin de la realidad: conversaciones imaginarias con el
HMJYRXS IRWSyEGMSRIWIRPEWUYIWIQERXMIRIZMZEEPETIVWSREJEPPIGMHE IWGYGLEVQWMGE Muchos sentimientos que encontraremos en el menor son comunes a las reacciones de
GSQRVIPIIVQIRWENIWGSQTVSFEVWMIWXjGSRIGXEHSEPXIPqJSRSSEPEWVIHIWWSGMEPIWIXG HYIPSIREHYPXSW EySVER^EWIRWEGMzRHIHIWIWTIVER^EXVMWXI^EETEXuETqVHMHEHIMRXIVqW
TSVPEQE]SVuEHIPEWGSWEWIXG 8EQFMqRETEVIGITSVTVMQIVEZI^IPTIRWEQMIRXSHIUYI
Tambin es habitual que el preadolescente muestre cierta reticencia a hablar de la prdida UYM^jPEZMHERSXMIRIWIRXMHSSHIUYIIWQYGLSIPWYJVMQMIRXSTSVIPUYIYRSXMIRIUYI
o a mantener una conversacin larga sobre el tema con un adulto. Tienden a evitarlo pasar. A veces piensan que la vida ha dejado de merecer la pena.
por temor a mostrar su vulnerabilidad y, tambin, por miedo a daar a los adultos de su
IRXSVRSEPLEGIVPIWTEVXuGMTIWHIWYXVMWXI^E

106 107
Pueden sentirse abrumados y/o atosigados, lo que provocar que se cierren a la
comunicacin, o a la expresin con sus iguales o con aquellos adultos que traten de Los preadolescentes
acercarse habitualmente.
 No necesitan explicaciones adaptadas, comprenden todas las dimensiones
de la muerte.
En general, casi todas las cosas que deben preocuparnos y ponernos en alerta no  Son conscientes de la mortalidad y en esta etapa aparecen las preocupaciones
son ms que aquellas reacciones de duelo que, pudiendo ser normales, impiden que o las ideas en torno a su propia muerte.
el preadolescente se reincorpore a las actividades cotidianas que mantena antes del  Aparece curiosidad por los temas espirituales y religiosos, sus opiniones
fallecimiento: sobre este tema oscilan mucho.
 Participan en los ritos funerarios y muestran inters por este tema.
 7SRGSRWGMIRXIWHIPMQTEGXSUYIKIRIVEPEQYIVXI]IRSGEWMSRIWPSYXMPM^ER
1. Incapacidad para reintegrarse al aula con sus compaeros.  Son conscientes de los cambios asociados a la muerte y de cmo van a
2. Aislamiento social extremo elegido: se siente distinto y no quiere juntarse con los GSRHMGMSREVWYJYXYVSSGzQSMRYMVjRIRPEWHIQjWjVIEWHIWYZMHE
dems porque cree que no le van a entender.  La expresin emocional les cuesta, pero debemos facilitrsela.
 Pueden sentirse agobiados o abrumados ante la preocupacin adulta.
3. &ENEHE WMKRMGEXMZE HIP VIRHMQMIRXS EGEHqQMGS UYI WI TYIHI XVEHYGMV IR VITIXMV
 Se debe respetar su silencio si son reacios a hablar y buscar otro momento
curso o suspensos recurrentes cuando previamente el alumno iba bien. ms propicio.
4. 7SQEXM^EGMSRIW]SWMRXSQEXSPSKuEQqHMGE HSPSVIWHIGEFI^EVIGYVVIRXIW HSPSVIW  (IFIQSWHSXEVPIWHIXSHEPEWIKYVMHEHUYITSHEQSWKEVERXM^EVPIWIRIWSW
abdominales, vmitos, dolores musculares que no tienen una explicacin mdica. momentos.
 Suele ayudarles el hecho de conocer otras situaciones y experiencias
5. Incapacidad para dormir, ya sea para conciliar el sueo o para mantenerlo.
similares.
6. Aislamiento familiar y hermetismo.  ,E]UYIIZMXEVHIGMVPIGSWEWUYIGSPSUYIREPQIRSVIRYREWMXYEGMzRHI
7. -RWIRWMFMPMHEHIQSGMSREP ETIREWIWGETE^HII\TVIWEVPEWIQSGMSRIWEWSGMEHEWEPE responsabilidad o le lleven a asumir roles que no le corresponden.
muerte.  Las emociones extremas, las reacciones persistentes, la incapacidad
8. 8VMWXI^EI\XVIQETIVWMWXIRXIUYIMRGETEGMXESMRY]IRIKEXMZEQIRXIIRSXVEWjVIEW TEVEVIXSQEVWYZMHE IPEMWPEQMIRXS PEWWSQEXM^EGMSRIW]PSWGEQFMSWHI
conducta extremos deben ser vigilados y, llegado el caso, consultados con
vitales.
un especialista.
9. Excesiva responsabilidad o colaboracin tras el fallecimiento.  Muchas reacciones de duelo son similares a las de un adulto.

108 109
5.5. LOS ADOLESCENTES

No hay que olvidar que sta es una etapa de muchos cambios a nivel fsico y biolgico, a
PSWUYIWIYRIRPSWTWMGSPzKMGSW IPEHSPIWGIRXIWIIRGYIRXVEIRXVIPERMyI^]PEEHYPXI^
]PYGLETSVWYEYXSRSQuE7YIPIIQTI^EVEPVIHIHSVHIPSWEySWEYRUYIIWJVIGYIRXI
verla adelantada, hay adolescencias precoces y tambin las hay tardas, aunque es ms
habitual que sean precoces.

En esta etapa cobra protagonismo el baile de hormonas y la lucha por pasar de nio
a adulto, es una poca de grandes transformaciones. Los caracteres sexuales se hacen
evidentes: el inters por el otro sexo, la posibilidad de la reproduccin, la lucha por la
MRHITIRHIRGMEPSWGVMXIVMSW]STMRMSRIWTVSTMEW

El nio trata de integrarse en el grupo de iguales, que pasa a ser el pilar fundamental en el
que se apoya, tratando de construir una identidad que la mayora de las veces se muestra
frgil. Es una etapa de gran vulnerabilidad por todos los cambios y ajustes que implica, as
UYIEIWXEIHEHPEQYIVXIHIYRWIVUYIVMHSWMIQTVIZEEVIWYPXEVWMKRMGEXMZE

En esta etapa, el nio suele crecer en oposicin al adulto, lo que da lugar a muchos
GSRMGXSW

 Por la paga.
 Los horarios.
 Las creencias.
 Los estilos y la moda.

0E FWUYIHEHIEYXSRSQuEHEPYKEVEQYGLEWHMWGYWMSRIWJEQMPMEVIW 4SVPSXERXS WMIP


QIRSVWYJVIPETqVHMHEHIYRJEQMPMEVIRIWXEqTSGE IWRSVQEPUYIETEVI^GEPEGYPTE]
tenga remordimiento porque la relacin con el fallecido no fuera la mejor que hubieran
podido tener.

Muchas de las reacciones son similares a las que tendra un adulto en su misma situacin y, por
XERXSPEWGSWEWUYILE]UYIXVEFENEVWSRPEWVIPEGMSREHEWGSRPEWXEVIEWHI;MPPMEQ;SVHIR

110 111
 Aceptar la realidad de la muerte. ,E]UYIHIWXEGEVUYI KVEGMEWEPTVIHSQMRMSHIPTIRWEQMIRXSEFWXVEGXS EIWXEIHEHIP
 Trabajar las emociones asociadas a la prdida. QIRSVTYIHIGSRXIQTPEVPEQYIVXIWMRIRJVIRXEVWIEIPPEIWGETE^HIGSRWXVYMVIWGIREVMSW
 ,EGIVWI GEVKS HI EUYIPPEW GSWEW UYI ERXIVMSVQIRXI LEGuE IP JEPPIGMHS )WXE IW PE en los que distintas enfermedades, distintas muertes, son protagonistas y as puede poner
RMGEHIPEWXEVIEWUYIIRPSWEHSPIWGIRXIWWIXVEFENEHIQERIVEPIZI]EUYIRSWI en marcha sus habilidades a nivel cognitivo.
busca que el menor se haga cargo de esas cosas, sino que colabore dentro de sus
posibilidades. Qu cosas son normales y cules debemos considerar signos de alarma:
 Recolocar emocionalmente al fallecido y seguir viviendo.
A esta edad, igual que en la preadolescencia, los menores entienden todas las dimensiones
2SVQEPQIRXI IP EHSPIWGIRXI VIGLE^E LEFPEV GSR PSW EHYPXSW WI WMIRXI ZYPRIVEFPI ] de la muerte. Suelen sobrar las explicaciones, aunque ellos agradecen un espacio abierto
TVIIVIGSQTEVXMVWYQYRHSIQSGMSREPGSRWYGuVGYPSHIEQMKSWQjWGIVGERSW0SRMGS para poder comentar las cosas, as como recibir informacin de primera mano sobre el
que conseguimos al insistirle en que hable con los adultos de su entorno es alejarlo ms, fallecimiento.
RSVQEPQIRXIIRYRMRXIRXSHITVSXIKIVEIWSWEHYPXSWHIWYXVMWXI^E 0SWEHSPIWGIRXIW
Es un momento de mxima vulnerabilidad, as que es bueno que sepa que siempre van
WSRGSRWGMIRXIWHIPEXVMWXI^EUYIKIRIVEYRJEPPIGMQMIRXS]RSUYMIVIREyEHMVHSPSVGSR
a tener un espacio para hablar de las personas fallecidas, aunque no quiera en esos
WYIWXEHSIQSGMSREPTSVIWSXVEXERHIRKMVYRFMIRIWXEVUYIRSXMIRIRIRTVIWIRGMEHI
QSQIRXSW]UYITYIHIYXMPM^EVPSGYERHSPSRIGIWMXI
otros adultos afectados por la prdida.

Las reacciones van a ser muy parecidas a las de los adultos, con expresin cargada de
)RIPEHSPIWGIRXITVMQEIPTIRWEQMIRXSEFWXVEGXSUYIPITIVQMXIXISVM^EVWSFVIXSHEWPEW
emociones y pensamientos que van desde el realismo hasta ideas tremendistas asociadas
cosas sin necesidad de haberlas experimentado o visto. As, tras una prdida, lo normal a la muerte.
es que haya un intento de enfrentarse a esta nueva situacin desde el plano terico, sin
poner en juego ms habilidades que las intelectuales. Es posible que los adolescentes se El adolescente puede contemplar su propia muerte y valorarla como solucin a los
IRJVEWUYIRIRPEVKEWGSRZIVWEGMSRIWWSFVIIPFMIR]IPQEPPEZMHEIXIVREPERMXYHHIPWIV problemas que provoca la prdida. Es posible que sienta que su vida carece de sentido y
]SXVSWGSRGITXSWQjWEFWXVEGXSWUYIWSRHMJuGMPIWHIQEXIVMEPM^EVTIVSIRPSWUYIWIZERE que debe soportar un dolor muy grande. La ideacin suicida puede aparecer de manera
centrar porque a ellos les apasionan. Es una etapa de cuestionamiento de valores, normas, VIGYVVIRXIEWuGSQSPEWZIVFEPM^EGMSRIWHIUYIPEZMHEEWuRSXMIRIWIRXMHSTEVEqP
ideas, ideales, creencias y as lo demuestran en el modo de afrontar la muerte.
3XVE TSWMFMPMHEH IW UYI PSW EHSPIWGIRXIW QERMIWXIR YRE EGXMXYH TVSXIGXSVE LEGME PSW
Dentro de ese pensamiento abstracto, del mundo de la fantasa, el adolescente imagina miembros de la familia. Tienden a hacerse cargo de sus hermanos pequeos o a ocultar
muchas veces cmo ser su futuro y, tras un fallecimiento, es posible que se d una bajada su dolor a los progenitores. En cierto modo, buscan aliviar la situacin pero quedndose
ellos desprotegidos, mientras tratan de no aadir dolor al dolor.
en sus expectativas que puede llevarle a conductas de riesgo, al darse cuenta de que la
ZMHEIWEPKSIJuQIVS]RSQIVIGIPETIREIPIWJYIV^S
)WJVIGYIRXIUYIETEVI^GEPEHIWKERESPEETEXuEUYIHINIRHIETEWMSREVWITSVGSWEWUYI
antes les emocionaban. Piensan que su vida carece de sentido tras la prdida e intentan
2SWIVjLEWXEIPREPHIIWXEIXETEGYERHSIPEHSPIWGIRXIGSRWMKEGSRWSPMHEVQYGLSW
buscar otras cosas que les puedan entusiasmar, ya que las que conocan hasta entonces
valores, normas, habilidades, ideas, emociones y se acerque un poco ms al proyecto de
IQTMI^ERETIVHIVMRXIVqW
adulto que desea ser.

112 113
0SWEHSPIWGIRXIWTYIHIRYGXYEVIRXVIPEFWUYIHEHIEMWPEQMIRXSS TSVIPGSRXVEVMS Como signos de alarma o actitudes que no podemos perder de vista, destacan:
estar rodeados de amigos en los que apoyarse y con quienes compartir sus emociones
y pensamientos. Recordemos que el grupo de iguales cobra gran importancia tanto en la 1. Irritabilidad extrema o cambios de humor constantes que no cesan con el paso del
preadolescencia como en la adolescencia. XMIQTSSGSRPERSVQEPM^EGMzRHIPEWVYXMREW
2. &ENEHEWMKRMGEXMZEHIPVIRHMQMIRXSEGEHqQMGS]EWIETSVHMGYPXEHIWHIGSRGIRXVEGMzR
Es normal que se muestren ansiosos y que trasladen las conductas de ansiedad a otras reas o por incapacidad para reintegrarse al ritmo normal de la clase.
vitales: que coman mucho, que estn muy activos, que se muestren demasiado habladores, 3. Aislamiento extremo: el adolescente no quiere salir ni participar de eventos sociales
UYI XIRKER HMGYPXEHIW TEVE GSRGMPMEV IP WYIyS 'SR JVIGYIRGME I\TIVMQIRXEVjR YRE con amigos en los que antes s participaba.
bajada en el rendimiento acadmico. Tienen muchas cosas a las que atender, muchos 4. Pensamientos negativos recurrentes sobre la muerte que no cesan tras el paso de
cambios a los que adaptarse y a menudo lo acadmico ocupa un segundo plano. La bajada un tiempo prudencial y que suelen convertirse en ideas algo irracionales o irreales.
acadmica suele ser leve y puede que aqu el menor necesite cierto apoyo. 5. Sintomatologa depresiva.
6. Ideacin suicida que llega incluso a la elaboracin de un plan suicida.
Es muy habitual que los adolescentes quieran asumir roles del fallecido o asuman ms 7. %WYRGMzRHIVIWTSRWEFMPMHEHIWUYIERXIWRSWIEWYQuER]UYIMRY]IRIRWYZMHE
responsabilidades de las que tenan antes de la prdida. O, por el contrario, puede ocurrir social, es decir: el adolescente abandona las actividades que antes hubiera hecho para
que se despreocupen de todo y se muestren ms irresponsables de lo que haban sido recoger o cuidar a sus hermanos, para evitar que su padre se quede solo, para ayudar
hasta entonces. Es frecuente que se vuelvan sobreprotectores con la familia, en especial a su ta, para acompaar a su abuela, etc.
con el progenitor superviviente, al que ven dbil, con sus hermanos y, si es la familia 8. Aparicin de otros trastornos somticos, obsesivos, de ansiedad, de separacin, que
cercana la que ha perdido a unos de sus miembros, con sus tos y primos. anteriormente no se haban manifestado o no lo haban hecho con la intensidad
WYGMIRXIGSQSTEVEGSRWMHIVEVWIWMKRMGEXMZSW
La adolescencia suele coincidir con el inicio de la conducta probatoria. Durante su 9. %KVIWMZMHEHI\XVIQESMQTYPWMZMHEHUYIRSIWGETE^HIGSRXVSPEV
TVSGIWSHIMRHMZMHYEPMHEHPSWEHSPIWGIRXIWIQTMI^EREXIRIVWYWTVMQIVSWGSRXEGXSWGSR 10. Consumo de sustancias inadecuado para su grupo de edad, ya sea por la frecuencia o
IPEPGSLSP]IPXEFEGSXEQFMqRGSRPSWTSVVSW]PEQEVMLYERE)PHYIPSTYIHIMRYMVPIIR por la intensidad. En cierto modo se refugia de la realidad en el consumo.
ambas direcciones, ya sea desarrollando un temor excesivo hacia las sustancias nocivas o 11. Incapacidad para retornar a sus rutinas habituales que tuviera antes de la prdida.
manteniendo una conducta de consumo de las mismas que puede llegar al abuso. 12. Culpa que no cesa, recurrente: el adolescente cree que el fallecido estara enfadado,
poco orgulloso o dolido con su actitud.
8VEWIPJEPPIGMQMIRXSHIYRWIVUYIVMHSIWLEFMXYEPUYIETEVI^GEIPQMIHSESPZMHEVEPSW 13. 2SUYMIVIXSGEVPEWGSWEWHIPJEPPIGMHSTVIIVIHINEVPSXSHSGSQSWMPETIVWSREJYIVE
QIRSVIWPIWEWYWXERSTSHIVVIGSVHEVYRXSRSHIZS^ YRSPSV YRKIWXS8MIRIRQYGLS a volver, alegando que son sus cosas, que no se tocan, o disgustndose al asociar los
miedo a olvidar quin era el fallecido y qu relacin tena con ellos, de ah que a veces pequeos cambios con olvidos.
se muestren muy reticentes a que los familiares inicien nuevas relaciones por el temor a 14. Pone en prctica conductas de riesgo sin temer por su vida, o precisamente porque
PEWYWXMXYGMzR0IWGYIWXEIRXIRHIVUYIRSWIIWXjVIIQTPE^ERHSEREHMI]PSZMZIRGSQS la vida ha dejado de preocuparle o de tener valor para l.
EPKSMRXVYWMZS TYHMIRHSPPIKEVEGSQTSVXEVWIHIQERIVEQI^UYMRE]EKVIWMZE8EQFMqR 15. 8VMWXI^E I\GIWMZE UYI PI MQTMHI PIZERXEVWI IWXYHMEV QERXIRIV VIPEGMSRIW
pueden aumentar los momentos de agresividad verbal y fsica: es un modo de dirigir la ira sintomatologa parecida a la depresiva.
UYIWMIRXIR]GEREPM^EVPEEYRUYIRSIWIPQSHSEHIGYEHSHILEGIVPS 16. Ira hacia quienes le dieron la noticia o hacia el personal sanitario que no pudo hacer
ms, llegndoles a hacer responsables directos de la muerte.

114 115
1. En el plano fsico o conductual
Los adolescentes
 Propensin a accidentes: el nio sufre muchos accidentes fsicos o lesiones.
 Conocen la muerte en todas sus dimensiones y no necesitan explicaciones
 Abuso de sustancias, principalmente alcohol y tabaco.
complejas, son capaces de valorar la muerte y enfrentarse a ella en su
imaginacin.  Cambios en la ingesta o el apetito: se engulle la comida, se come mucho ms o se
 Es una etapa en la que prima el pensamiento abstracto y habr mucha deja de comer.
XISVM^EGMzR]HMWGYWMzRWSFVIGSRGITXSWPSWzGSW]VIPMKMSWSW  Catarros recurrentes.
 7SRGETEGIWHIVII\MSREVWSFVIPEWGSRWIGYIRGMEWHIPEQYIVXIERMZIP
 Mareos.
familiar en todas sus dimensiones.
 Es una poca en la que pueden reaccionar con conductas de riesgo que  Dolor de estmago.
ponen en peligro su propia integridad.  Diarrea y otros trastornos de la eliminacin, como el estreimiento.
 Las relaciones con los adultos y sus iguales pueden sobrepasarles y a veces  Presencia de eccemas o enfermedades atpicas en la piel.
necesitan espacio para poder reaccionar y expresarse.  Insomnio.
 Pueden participar en todos los ritos de despedida y, si quieren, pueden
 Bajo estado anmico o falta de energa.
tener un papel protagonista.
 Nos vamos a encontrar con reacciones parecidas a las de los adultos:  Nuseas recurrentes.
XVMWXI^E WSQEXM^EGMzR ERWMIHEH TVSFPIQEW TEVE VIXSQEV PEW EGXMZMHEHIW  .EUYIGEW
GSXMHMEREWFENEHEHIPVIRHMQMIRXSHMGYPXEHIWHIGSRGIRXVEGMzRWIRWEGMzR  (IFMPMHEHQYWGYPEVUYIWIQERMIWXEWSFVIXSHSIRPEWTMIVREW
HIMRGSQTVIRWMzR
 'EQFMSWPPEQEXMZSWHITIWSFMIRTSVKERERGMESTSVTqVHMHEWMKRMGEXMZEHIPEQEWE
 Estaremos especialmente atentos a situaciones que se mantengan en el
tiempo: incapacidad para recuperar el ritmo acadmico o para reintegrarse corporal.
IR PEW EGXMZMHEHIW WSGMEPIW GEQFMSW HI LYQSV I\XVIQSW XVMWXI^E UYI PIW
impide funcionar, exceso de responsabilidades, miedos o pensamientos 2. En el rea emocional
recurrentes sobre la muerte, culpa y todo aquello que se mantenga en el
tiempo o afecte a muchas reas de su vida, incapacitndoles o frenando su
desarrollo o progreso.  Agitacin constante.
 Enfado y agresividad constante.
 Obediencia excesiva.
 Sntomas depresivos.
 Culpabilidad.
6.6. SIGNOS DE ALARMA GENERALES PARA TODAS LAS EDADES  Irritabilidad.
 Envidia constante.
,E]YREWIVMIHIMRHMGEXMZSWKIRqVMGSWUYITSHIQSWGSRWMHIVEVWMKRSWHIEPEVQEIRPSW  Prdida de autoestima.
menores y que no podemos desatender tras el fallecimiento de un ser querido:  Mal humor presente la mayor parte del da.
 Pesadillas.
 Preocupacin por el pasado.
 Inquietud.
116 117
 8VMWXI^E
 Exceso de autocrtica. 7. El duelo en personas con


Pensamientos o ideas de muerte y de suicidio.
Alterna entre la evitacin y la necesidad de relaciones cercanas o ntimas.
discapacidad intelectual
3. En el mbito intelectual

 Confusin constante.
 Incredulidad.
 3PZMHSWGSRWXERXIWSEGXMXYHSPZMHEHM^E
 Incapacidad para concentrarse.
 Prdidas de memoria.
 Necesidad constante de conseguir logros y de ser reconocido.

118 119
7. El duelo en personas con
discapacidad intelectual
En este captulo vamos a abordar la atencin del duelo en las personas con discapacidad
MRXIPIGXYEPIRVIWTYIWXEEPEWRYQIVSWEWGSRWYPXEWUYIRSWLERPPIKEHSHYVERXIPSWPXMQSW
aos sobre este tema, ya que es un colectivo que en ocasiones pasa desapercibido.

7.1. CARACTERSTICAS GENERALES

Si hasta ahora sabemos que el duelo en los nios a menudo est encubierto, nos da
miedo afrontar el tema de la muerte con ellos o nos asusta que este tema los traumatice
SPSWEXIVVIEPEJVSRXEVIPHYIPSIRQIRSVIWHMWGETEGMXEHSWPEWMXYEGMzRIWERTISV]EUYI
en general se tiende a tratar a los miembros de este colectivo como nios durante toda la
etapa adulta. Adems, los adultos que rodean a las personas con discapacidad intelectual
suelen tomar actitudes de infravaloracin, basndose en el bajo nivel de conocimiento y
GSQTVIRWMzRUYIEPKYRSWEPGER^ER

Tampoco podemos olvidar que, actualmente, las personas con discapacidad Intelectual
XMIRIRYREIWTIVER^EHIZMHEQY]WYTIVMSVEPEHILEGIYREWHqGEHEW%RXIWIVEHMJuGMPUYI
vivieran ms que sus cuidadores, pero hoy en da la realidad es que en muchos casos viven
ms que sus padres o tutores, de ah que resulte necesario dar cabida a un duelo que muy
probablemente van a experimentar.

Aunque intentamos alejar el sufrimiento de las personas con discapacidad intelectual,


el dolor est presente no slo perciben la prdida, sino que padecen sufrimiento y
TVSFPIQEWEWSGMEHSWEPEQMWQE ,E]IWXYHMSWUYIHIQYIWXVERUYILEWXEIP HIPEW
TIVWSREWGSRHMWGETEGMHEHMRXIPIGXYEPUYILEQERMJIWXEHSXVMWXI^E QEPIWXEV HITVIWMzRS
problemas conductuales y emocionales de aparicin repentina haba sufrido la prdida de
un ser querido en los seis meses previos.

121
En el pasado se pensaba que las personas discapacitadas intelectualmente carecan de Lo ideal para abordar el duelo en personas con discapacidad intelectual es:
LEFMPMHEHIW TEVE IRJVIRXEVWI EP HYIPS ] PEW IQSGMSRIW EWSGMEHEW 7YW HMGYPXEHIW TEVE
comprender la muerte movan a su entorno a evitarles todo aquello relacionado con  (SXEVPIWHIIWXVEXIKMEWIWTIGuGEWVIPEGMSREHEWGSRIPEJVSRXEQMIRXSHIPHYIPS
el duelo. Sin embargo, hoy sabemos que no es imprescindible comprender el concepto  Contar con recursos cercanos de atencin al duelo.
HI QYIVXI TEVE I\TIVMQIRXEV PEW IQSGMSRIW EWSGMEHEW EP HYIPS ] TSV XERXS IQTMI^E  Ofrecer estrategias que contribuyan a una mejora de la calidad de vida de las personas
a hacerse necesario un cambio de concepcin en las vivencias de los discapacitados con discapacidad intelectual.
intelectuales sobre este tema.  Implicar a otros familiares en el conocimiento del duelo y cmo abordarlo.

El empeo que a menudo se tiene en ocultar la muerte no slo afecta a las personas con ,E]EPKYREWVIGSQIRHEGMSRIWTEVEPEWTIVWSREW]IRXMHEHIWUYIVSHIEREPEWTIVWSREW
discapacidad, aislndolas de la realidad, sino que afecta a las personas que habitualmente con discapacidad intelectual:
las cuidan debido a la actitud de ocultacin que se ven obligadas a mantener.
 Conocer los datos bsicos de la familia (cultura, costumbres y religin) para tenerlos
El papel fundamental de la familia es contribuir a que la persona con discapacidad intelectual en cuenta ante situaciones de prdida.
EGXIGSQSIPEKIRXITVMRGMTEPHIWYZMHEXSQERHSHIGMWMSRIW]LEGMIRHSIPIGGMSRIWWSFVI  Trabajar con los padres para que garanticen el bienestar de la persona con
WYGEPMHEHHIZMHEHIQERIVEPMFVI]WMRMRYIRGMEWSMRXIVJIVIRGMEWI\XIVREWMRHIFMHEW discapacidad tras la muerte. Esto puede incluir vivienda, nombramiento de tutores,
(Verdugo, 2006). La familia puede ser un agente facilitador o entorpecedor en esta rea, provisiones de fondos, etc.
WIKRTVITEVISMQTMHEWMXYEGMSRIWHIHYIPSIRJIVQIHEHQYIVXIHIJEQMPMEVIWIXG  8VEFENEVPEQYIVXIWIKRIPHIWEVVSPPSMRXIPIGXYEPHIGEHEYRS
 Apoyar en el duelo y respetar las costumbres y creencias.
La familia y los tutores deben considerar:  Respetar la intimidad de las personas con discapacidad.
 Facilitar un espacio para las emociones, aceptarlas como vienen.
 Facilitar el crecimiento, incluido el sufrimiento asociado, favoreciendo su desarrollo  )QTEXM^EVGSRPEWIQSGMSRIW]WIRXMQMIRXSW
emocional. No hay que engaarles ni ocultarles situaciones de enfermedad y muerte,  'EHETIVWSREIWHMWXMRXE]TSVXERXSGEHEHYIPSIWRMGS)\MWXIREWTIGXSWGSQYRIW
sino prepararles y apoyarles en funcin de sus posibilidades. pero hay que atender a la individualidad de las personas.
 Informarles acerca del futuro y de las posibilidades que tendran (como con quin
quieren vivir, qu desean, etc.). Cuando se trata con personas que padecen discapacidad intelectual hay que moverse
 Preparar su futuro, tanto legalmente como en trminos de dependencia, favorecer entre las explicaciones infantiles y las que proporcionamos a los adultos. Por un lado, hay
relaciones amplias para que tengan un crculo que vaya ms all de la familia. que conseguir que entiendan la irreversibilidad de la muerte, la universalidad, las causas
 Tratar de establecer con ellos metas y objetivos, ayudarles en la toma de decisiones y la y la interrupcin de las funciones vitales; y, por otro, hay que ayudarles a trabajar en la
resolucin de problemas fomentando su autonoma. Con respecto al duelo, conviene aceptacin de la realidad de la prdida, el trabajo con las emociones asociadas, la asuncin
dejarles que decidan si quieren ver al difunto, o acudir y participar en los ritos, que de nuevos roles o responsabilidades y la tarea de aprender a vivir en un mundo donde el
expresen sus propios sentimientos, que decidan si acudir o no al cementerio, etc. fallecido no est presente.

122 123
7.2. DIMENSIONES A LAS QUE ATENDER 2. Bienestar material

Siendo concretos, en personas con discapacidad intelectual deberemos prestar atencin 'SRWMWXIIRKEVERXM^EVEPETIVWSREIRHYIPSUYIZEEZMZMVIRYRPYKEVEGSKIHSV]UYI
a las 8 dimensiones de calidad de vida de Robert L. Schalock: otras personas la protegern en caso de que sea necesario. De igual manera hay que
KEVERXM^EVPIUYIWYWVYXMREWEGXMZMHEHIW]TYIWXSPEFSVEPWIKYMVjRWMREPXIVEVWI
1. Bienestar emocional
Las rutinas son muy importantes, sus horarios deben mantenerse, as como los hbitos
'SRFMIRIWXEVRSWVIJIVMQSWEWIRXMQMIRXSWIQSGMSRIWZEPSVEGMSRIW]VII\MSRIWEGIVGE de higiene, alimentacin y actividad, que son prioritarios tras el fallecimiento de uno de
de la calidad de vida. Lo primero que debemos tener en cuenta es que no debemos los cuidadores principales. En resumen, sus necesidades bsicas deben estar cubiertas y
mentir sobre la muerte. Esto no slo se aplica a personas con discapacidad intelectual, sino es conveniente que est al corriente de su situacin socioeconmica, dentro de su nivel
a todo el mundo. Si no contamos la verdad, no slo no protegemos a nuestro interlocutor, de comprensin.
WMRSUYIPSHIWTVSXIKIQSWKIRIVERHSHIWGSRER^E]VIXVEWERHSPSWTVSGIWSWRSVQEPIW
del duelo. Es bueno que ayudemos a las personas con discapacidad intelectual a escoger aquellos
recuerdos materiales de la persona fallecida que quieran conservar, o bien facilitarles que
Los sentimientos asociados a la prdida son una de las primeras cosas que tendremos que puedan deshacerse gradualmente de otros objetos que pertenecan al fallecido.
EXIRHIV4SVPSXERXSLEFVjUYIIWXEVEXIRXSWEPEXVMWXI^EIPQMIHSPEJVYWXVEGMzRPEVEFME
PEWSPIHEHPEJEXMKEPEETEXuEIXG,E]UYIJEGMPMXEVPEWI\TVIWMSRIWHIHSPSV]TIVQMXMVUYI En este punto podemos sugerirles que vuelvan a los lugares a los que solan acudir con el
la expresin emocional sea libre. Tambin es conveniente transmitirles que ese tipo de fallecido, o que se expongan a recuerdos, familiares y actividades que hubieran pasado a
emociones y sentimientos son habituales tras la muerte de un ser querido. ser especialmente dolorosas tras el fallecimiento por la carga emocional asociada.

Esta expresin emocional no debe interrumpirse. No vamos a ayudar a los dolientes si 3. Bienestar fsico
tratamos de distraerles de su dolor, de modo que hay que evitar expresiones como: No
PPSVIW 2S IWXqW XVMWXI 8MIRIW UYI WIV JYIVXI o 8MIRIW UYI WIV ZEPMIRXI. Es necesario Es normal que despus de la muerte de un ser querido, la persona con discapacidad
KEVERXM^EVPIWUYITYIHIRI\TVIWEVWI]UYIZEQSWEWIKYMVEGITXjRHSPIW]UYIVMqRHSPIW QERMIWXIWuRXSQEWHIERWMIHEHEWuUYILEFVjUYIEXIRHIVEPEWWIRWEGMSRIWGSVTSVEPIW
EWSGMEHEWHIEW\MEHSPSVIRIPTIGLSQEPIWXEVKIRIVEPMRWSQRMSJEXMKEIXG
Un aspecto importante es transmitirles que estamos ah para que formulen sus preguntas
y dudas, que no hay que temer nombrar al fallecido y que, aunque es probable que no En esta rea, es importante que el doliente recupere la rutina diaria y normalice los
quieran recibir ayuda mientras se encuentran en duelo, aun as estaremos atentos para hbitos cotidianos de sueo, comidas y cuidado personal, de modo que las normas y
proporcionrsela si es necesario. costumbres deben mantenerse siempre que resulte posible. Esas normas son las que
suelen aportar estabilidad en un mundo que aparentemente se desmorona. Tampoco hay
Una buena opcin es crear una caja de recuerdos o un lbum para que el doliente pueda que olvidar que la persona ha de ir recuperando poco a poco las actividades placenteras
recordar determinadas situaciones cuando quiera. en las que participaba antes del fallecimiento.

124 125
Si la persona sigue un tratamiento farmacolgico, es muy importante que no deje de Conviene que se involucren en las actividades relacionadas con ritos de despedida
tomar la medicacin. TVSTMSWHIPEGYPXYVEEPEUYITIVXIRI^GER 2SIWSFPMKEXSVMSUYIEGYHEREJYRIVEPIWRM
ESXVEWEGXMZMHEHIWHIQSHSUYIWMIPHSPMIRXIIWGETE^HIHMWGIVRMVWMUYMIVIMVSRSIW
4. Desarrollo personal MQTSVXERXITVIKYRXEVPI]UYIHIGMHEHIQERIVEPMFVI 4SVIPGSRXVEVMS WMIWMRGETE^HI
escoger, la recomendacin principal es que se le involucre al mximo. Su mera presencia
Un factor muy importante sera que se fuese incorporando el concepto de muerte al en los ritos de despedida hace que empiece a comprender el proceso.
ETVIRHM^ENIHIPEWTIVWSREWGSRHMWGETEGMHEHMRXIPIGXYEP 0SMHIEPIWUYIRSXIRKEQSW
UYIIRJVIRXEVRSWTSVTVMQIVEZI^EIWXIXIQEGYERHSSGYVVEIPJEPPIGMQMIRXSWMRSUYIPE Si asiste, hay que explicarle previamente los detalles de lo que va a ver y escuchar, as
MHIEWIZE]EMRGPY]IRHSIREWTIGXSWGSXMHMERSWHIPETVIRHM^ENIHIWHIPETVMQIVEMRJERGME como el motivo por el que los ritos son as y las personas reaccionan de esa forma. Si no
Para ello, podemos aprovechar la muerte de las mascotas, de vecinos, familiares lejanos, hacemos esto, el impacto al que les someteremos puede ser grande, ya que hay muchas
personajes histricos, pelculas, etc. MHIEWJEPWEWIRXSVRSEGzQSIWYRQYIVXSYREXEHIXG4SVIWSRSWEWIKYVEVIQSWHI
que siempre estn acompaados por una persona muy cercana a ellos con la que se
Si una prdida se puede prever, ya que es consecuencia de una enfermedad larga, es sientan seguros, o que puedan ver el cadver y tener un rato a solas con l. Si no quieren
conveniente incluir a la persona en el proceso (visitas al hospital, comunicacin de la TEVXMGMTEVIRRMRKRVMXSRMZIVIPGEHjZIVIWQY]MQTSVXERXIUYIRSWIWMIRXERGYPTEFPIW
enfermedad) para que compruebe que envejecer o enfermar forma parte de la vida y IRRMRKRGEWS
pueda ir integrndolo en su conocimiento.
8EQFMqRGSRZMIRIERXMGMTEVPIWPEWJIGLEWGPEZIGSQSIWXEWGYQTPIEySWGIPIFVEGMSRIW
)WQY]XMPE]YHEVPIIRPEGSRWXVYGGMzRHIYRERYIZEMHIRXMHEHEPQEVKIRHIPJEPPIGMHS%P y dejarles claro cmo se van a ver afectadas o qu costumbres se van a mantener y cules
principio les cuesta mucho adaptarse a un mundo en el que el fallecido no est presente, RS%WMQMWQS IWMQTSVXERXITVIKYRXEVEPHSPMIRXIGzQSUYMIVITEWEVIWEWIWXEW]UYq
por eso les ayudaremos no perdiendo de vista que aunque hay un antes y un despus cosas quiere mantener.
tras el fallecimiento, hay muchas cosas que cambian y es difcil volver a ser igual que antes
de la prdida. )WFYIRSJSQIRXEVPEWEGXMZMHEHIWEPEMVIPMFVI]UYIGSRS^GERPESJIVXEHIEGXMZMHEHIWHI
ocio en las que puedan participar y disfrutar. En este punto, es importante que el mdico
No hay que perder de vista que en ocasiones esta nueva construccin, que al principio de Atencin Primaria de la persona discapacitada est al corriente de todo y le ayude a
WITIVGMFIGSQSEQIRE^ERXI TYIHIGSRZIVXMVWIIRYRESTSVXYRMHEHHIEYXSRSQuE HI LEGIVWIGEVKSHIWYWGYMHEHSWFjWMGSWIRPSUYIEWEPYHWIVIIVI
crecimiento personal, de ampliar contactos sociales, de asumir otras responsabilidades y
muchas cosas ms. 6. Derechos

5. Inclusin Debemos considerar algunos derechos que tienen las personas en duelo, como:

)WXITYRXSWIVIIVIEPERIGIWMHEHHIMRGPYMVEPEWTIVWSREWGSRHMWGETEGMHEHIREGXMZMHEHIW  Derecho a saber la verdad.


propias de su edad y evitar tratarlos como nios cuando dejan de serlo.  Ser tratados con normalidad.
 Que sus preguntas sean respondidas de manera honesta.

126 127
 Ser escuchados con dignidad y respeto. fsico tiene mucho poder, pero tocarse puede tambin convertirse en algo fro y rutinario,
 No querer contar sus emociones ni sentimientos, a que se respete su silencio. as que el contacto debe darse cuando sea sincero.
 Ver a la persona que muri y el lugar en el que se produjo la defuncin.
 )\TVIWEVWYXVMWXI^EIRPEJSVQEUYIWIEWMIQTVI]GYERHSRSEKVIHEESXVEWTIVWSREW 8. Autodeterminacin
 Participar en la toma de decisiones de los ritos relacionados con la muerte.
 )PIKMVPETIVWSREHIWYGSRER^EUYIUYMIVIRXIRIVEWYPEHS]UYIPIEGSQTEyI La autodeterminacin abarca todo lo relativo a dirigir a la persona para que alcance su
 Ser cuidados por personas compasivas, sensibles y que comprendan las propias autonoma y ayudarle a hacer cambios o elecciones en esa lnea, como marcarse metas,
necesidades. tomar decisiones, tener el control personal, etc.
 Tener cuidados mdicos que busquen el confort, si la cura no es posible.
 Participar en su propio proceso de muerte. Uno de los objetivos debe ser que las personas con discapacidad intelectual aprendan
 Comprender su proceso de muerte. E ZMZMV IR WSGMIHEH]WIQERINIR TIVJIGXEQIRXIIR IPPE ,E]UYI VII\MSREVGSR IPPSW
sobre lo que hay que hacer tras la muerte de un familiar de referencia: cmo inscribirles
en el testamento, nombrar un tutor si es necesario, registrarles como demandantes de
7. Relaciones Interpersonales
IQTPIS%IWXSZEQY]YRMHEPEEHUYMWMGMzRHILEFMPMHEHIWTEVEVIEPM^EVXEVIEWGSXMHMEREW
como hacer la compra, cocinar, limpiar la vivienda, hacer su cama. Por eso es bueno
Dentro de las relaciones interpersonales englobamos la intimidad, el afecto, la familia,
ensearles estas cosas, primero con compaa y supervisin, y poco a poco dejndolos
las interacciones, los amigos y el apoyo. El grado de apoyo percibido es clave en estos
solos.
procesos, ya que hace que el estrs disminuya y esto hay que tenerlo en cuenta porque,
en ocasiones, un duelo que se alarga en el tiempo puede aislar al doliente de muchas
Es importante fomentar la autoestima y el autoconcepto, que ste sea slido para que
relaciones sociales.
no cambie tras la muerte. Como ya hemos dicho, hay que decirles la verdad sobre la
muerte del ser querido. Puede suceder que para determinadas preguntas no tengamos
Tras una prdida, hay que escuchar a las personas con discapacidad intelectual, sin prisas,
respuestas, pero en ese caso les diremos que no lo sabemos.
reservndoles el tiempo que necesiten, en un clima acogedor y familiar, y permitiendo la
expresin emocional de manera libre.
Tambin les ayudaremos a tomar decisiones, ya que en el contexto estresante de la
prdida les va a costar decidir si quieren ir o no al funeral, al entierro, al tanatorio, al
Prestaremos especial atencin a los aniversarios, favoreciendo su conmemoracin, LSWTMXEP
IWTIGMEPQIRXIIPTVMQIVERMZIVWEVMSHIPEQYIVXI ,E]UYIVIGSVHEVUYIPEJEQMPMEIWIP
mejor apoyo en estos momentos, es un momento en los que las familias se unen y se Asimismo, valoraremos si necesitan apoyos o no para ejecutar dichas decisiones y que
agrupan. sean capaces de comunicrselas al resto de la familia o de personas implicadas.

Es importante que le ayudemos a buscar el contacto con sus familiares y amigos tratando Dentro de esta rea, es muy importante que la persona con discapacidad entienda sus
de balancearlo bien, en ocasiones necesitan sentirse acompaados y en otras ocasiones TVSTMEWIQSGMSRIW]WIRXMQMIRXSW EHIQjWHIWIVGETE^HIEGPEVEVWYWTIRWEQMIRXSW]
necesitan estar solos, es importante que los familiares y amigos que puedan le dediquen actuar de manera coherente con ellos, que comprenda sus derechos y los haga valer.Tiene
XMIQTSRSIWRIGIWEVMSLEFPEVTIVSIWFYIRSEPKRKIWXSWMRGIVSHIGEVMyS)PGSRXEGXS que saber que su opinin es importante y que la vamos a valorar.

128 129
,E]UYIWIVGSRWGMIRXIWHIUYIPEEYXSHIXIVQMREGMzRWIZEPSVEVjWIKRPEWLEFMPMHEHIW
cognitivas de cada uno, no en todos es posible llegar al mximo nivel. PARA RECORDAR: Las personas con discapacidad

Se les equipara a la poblacin infantil y se les protege del mismo modo. Van a
7.3. CMO INFORMAR DE UNA MUERTE A UNA PERSONA CON WYJVMVHYIPSW]EUYIWYIWTIVER^EHIZMHELEEYQIRXEHSQYGLS7IKR7GLEPSGO
hay 8 dimensiones que nos sirven de gua:
DISCAPACIDAD INTELECTUAL
1. Bienestar emocional
Lo ideal es comunicrselo lo antes posible. Escogeremos el lugar y hablaremos con  Les contaremos la verdad.
TEPEFVEWWIRGMPPEW]WMRGIVEW YXMPM^ERHSTEPEFVEWHMVIGXEWGSQSQYIVXI]QYIVXS 4SV  Dejaremos que se expresen emocionalmente.
tanto, nos alejaremos de los eufemismos.  )ZMXEVIQSWI\TVIWMSRIWUYIPSWHMVMNEREPEJSVXEPI^ESPEZEPIRXuE

2. Bienestar material
Es muy importante que quien se haga cargo de la explicacin sea una persona allegada al
 Van a tener un lugar acogedor donde vivir.
HSPMIRXIUYITYIHELEFPEVPIHIWIRXMQMIRXSW]IQSGMSRIW]EPEZI^WIEGETE^HIJEGMPMXEVPI
 ,E]TIVWSREWUYIPSWTVSXIKIVjRWMPSRIGIWMXER
la expresin de los mismos o simplemente de ejercer el acompaamiento silencioso que  Las rutinas y necesidades bsicas estn preservadas.
XEPZI^VIGPEQIPETIVWSREGSRHMWGETEGMHEH  Que elijan aquellos recuerdos materiales que quieren mantener.

,E]UYII\TPMGEVPIGzQSLESGYVVMHSPEQYIVXIIWHIGMVPEWGEYWEWHIPEQMWQE4SHIQSW %LHQHVWDUItVLFR
usar expresiones como IWXEFE QY] QY] QEPMXS o, en caso de accidente, qued muy  Pueden aparecer sntomas fsicos relacionados con la ansiedad.
 'YMHEVPSWLjFMXSWGSXMHMERSWHIWYIyS GSQMHE SGMS LMKMIRIPEWVYXMREW
QEPLIVMHS. No hay que ocultarles el motivo del fallecimiento, porque antes o despus se
habituales que les dan estabilidad.
acabarn enterando y es preferible que lo hagan por nosotros.Tampoco conviene recurrir  Si sigue un tratamiento farmacolgico, es importante que no lo deje y lo
a los tpicos en nuestras explicaciones. supervise alguien.

7MPETIVWSREYXMPM^EWMWXIQEWHIGSQYRMGEGMzREPXIVREXMZSW IWQY]XMPYXMPM^EVWYQMWQS 4. Desarrollo personal


sistema, o incluso contar con apoyo visual o noticias para ese momento.  Conviene incluir el concepto de muerte poco a poco en el desarrollo de
las personas con discapacidad.
 Incluirles en el proceso de deterioro de las personas.
Como norma general, tendremos en cuenta la edad cognitiva del doliente para adecuar
 Ayudarles a adaptarse a la nueva situacin.
a la misma el lenguaje que utilicemos y conseguir que entienda la mayor cantidad de
informacin posible, as como las repercusiones que tendr la prdida en su vida. 5. Inclusin
 Se les incluir en todo, igual que a otros adultos.
Informaremos del suceso a aquellas instituciones que estn implicadas de manera habitual  Se les invita a los ritos, que decidan si quieren ir.
en las actividades cotidianas de la persona, ya sea su trabajo, un centro ocupacional, un  Les acompaaremos en los homenajes y ritos funerarios.
 Anticiparemos las fechas de aniversario y les preguntaremos su opinin.
centro de ocio, educadores, personal sanitario, etc. Es importante que tengan conocimiento
 Incluiremos a su mdico de Atencin Primaria en la informacin.
del fallecimiento y de las implicaciones que ste tendr en la vida del doliente, para que le
ayuden tanto en la expresin emocional como en las adaptaciones cotidianas que pueda
necesitar.

130 131
6. Derechos 8. Claves e ideas para la
intervencin en duelo en el colegio
 A saber la verdad y ser tratados con normalidad.
 A hacer preguntas y expresar o no sus emociones del modo que sea.
 A entender la muerte.
 A ser cuidados y atendidos.

7. Relaciones interpersonales
 Necesitan estar con su familia y amigos, y ser escuchados.
 Es necesario que reciban cario.

8. Autodeterminacin
 Fomentar la autonoma y el autoconcepto.
 Ayudarles en la toma de decisiones.

132 133
8. Claves e ideas para la
intervencin en duelo en el colegio

El colegio o el instituto suele ser el lugar donde el nio pasa ms tiempo despus del
hogar familiar. Por eso, se hace imprescindible que en el centro educativo haya un inters
por trabajar el concepto de muerte o, al menos, apoyar y trabajar con los nios tras un
fallecimiento.

)R)WXEHSW9RMHSW].ETzRI\MWXIPERIGIWMHEHHIMRGSVTSVEVPEQYIVXIEPSWTPERIWHI
estudio. El concepto de muerte se construye de manera social, los menores reciben mucha
informacin de los medios de comunicacin, lo que hace que a menudo el concepto de
muerte se construya de manera irreal, fantstica, por lo que resulta necesario dar una
respuesta educativa a dicho concepto.

Educar en la muerte plantea una serie de prejuicios:

 0EIRWIyER^EHIPEQYIVXITYIHIMRHYGMV]SEYQIRXEVQYGLSWQMIHSWIRPSWRMySW
;EWW 
 Los padres y profesores evitan este tema porque lo consideran inapropiado para
jvenes y nios (Kim, 2001; Lee, 2005).
 %PKYRSWEHYPXSWTMIRWERUYIIPHIWEVVSPPSGSKRMXMZSHIPSWRMySWIWMRWYGMIRXITEVE
comprender el concepto de muerte (Lee, Lee y Moon. 2009).

Como contraposicin, encontramos muchos estudios que avalan la tesis contraria, incluso
con alumnos que padecen alguna discapacidad psquica.

En la educacin para la muerte se ha comprobado que:

 Una intervencin bien diseada y apropiada puede generar en los nios una
comprensin madura de la muerte (Lee, Lee y Moon, 2009).
 El reconocimiento maduro de la muerte como acontecimiento biolgico que forma
parte de los ciclos vitales genera una disminucin del miedo a la muerte (Slaughter y
135
+VMJXLWGSRPSWUYI;EWWGSMRGMHIIREPEVQEVUYIPEIHYGEGMzRTEVE lleva a hacerse cuestionamientos similares a los de los adultos sobre el momento, las
la muerte reduce los miedos que produce este fenmeno). circunstancias e incluso lo justo o no de esa muerte. Esto les lleva a estar ms enfadados
 Los nios y adolescentes no viven ajenos a la muerte como ya hemos explicado GSRPEWTIVWSREWQqHMGSWJEQMPMEVIW]IPQYRHSIRKIRIVEP
ERXIVMSVQIRXI]WIWMIRXIRMRYMHSWTSVIPPE TYHMIRHSI\TIVMQIRXEVIQSGMSRIW]
WIRXMQMIRXSWHMZIVWSW +SR^jPI^]6EQSW WMFMIRHMGLEWI\TIVMIRGMEWTSHVuER Los ms pequeos, por el contrario, sufren ese enfado y esa agresividad derivada de los
mitigarse si se dispusiera de un contexto que les permita elaborar el duelo adecuado GEQFMSWUYILE]IRIPEQFMIRXI)PPSWLERTIVHMHSFMIRIWXEVVYXMREWGSQTEyuEWETS]SW
a su edad, a su personalidad, a su particularidad y que constituyera un recurso en s ]IWSTYIHIVIINEVWIIRUYIWIQYIWXVERQjWMVEWGMFPIWI\GMXEHSWERWMSWSW]EKVIWMZSW
mismo para su desarrollo. PPIKERHSMRGPYWSETIKEVEWYWGSQTEyIVSW=ELIQSWI\TPMGEHSUYIQYGLSWRMySWUYIWI
sienten diferentes a los dems tratan de defenderse agrediendo, as que es una situacin
0EIWGYIPEIWYRSHIPSWTVMRGMTEPIWPYKEVIWHSRHIIPHYIPSZEETSRIVWIHIQERMIWXS que nos encontraremos con frecuencia.
EWuUYIIWEPPuHSRHIWITSHVjE]YHEVMKYEPQIRXIEPRMyS4SVIWXEVE^zRXVEWYREQYIVXI
el colegio debe estar informado de muchos aspectos: En el colegio nos encontraremos ante un nio que se muestra irascible, refunfua, protesta
por cosas que antes no le hubieran molestado, con una actitud de enfado: pega a los
 Quin ha fallecido. GSQTEyIVSWXMIRHIEHIWXVS^EVWYWXVEFENSWSIPQEXIVMEPERXIPEQuRMQEMRGSQSHMHEHIXG
 Qu vnculo tena con el menor. Aunque comprendamos la reaccin del nio, es conveniente que le expliquemos que, si
 Cmo ha ocurrido. bien entendemos que lo est pasando mal, ni los compaeros ni el material tienen que
 Qu aspectos de la muerte conoce el nio. ZIVWIHEyEHSW0IE]YHEVIQSWEHMWGYPTEVWIEXVERUYMPM^EVWIEVITEVEVEUYIPPEWGSWEWUYI
 Qu recursos de ayuda maneja la familia en caso de que sea necesario acudir a ellos. haya roto e intentaremos que entienda que hay reacciones que no se pueden permitir y
que debe buscar otras alternativas.
No slo es muy importante informar al colegio, sino tambin mantener un estrecho
contacto con los docentes para conocer la evolucin de los nios tras un fallecimiento. 2. Problemas de aislamiento y con las habilidades sociales

Cuando los nios pierden un familiar o estn atravesando un duelo, puede que se vean
8.1. APRENDER A RECONOCER EL DUELO EN EL AULA: diferentes a los dems o sientan que han perdido la conexin que les una al resto del
COMPORTAMIENTOS ESPERABLES KVYTS )WXS TYIHI TVSZSGEV UYI TVIIVER FYWGEV PE WSPIHEH JVIRXI E PE GSQTEyuE S
UYI IZMXIR NYIKSW I\GMXERXIW TSV PE XVMWXI^E UYI QYIWXVER 'SR JVIGYIRGME IZMXER E PSW
Muchos de los comportamientos que puede manifestar un nio o adolescente en duelo compaeros para ahorrarse conversaciones sobre la muerte o explicaciones que no
estn recogidos a cada edad en captulos anteriores, pero vamos a resumir aquellos que quieren dar.
inciden directamente en el mbito acadmico y frente a los cuales los profesores deben ser
ms sensibles, o bien estar atentos para informar a los padres o ayudar en la intervencin. 0EWIRWEGMzRHIWIVHMJIVIRXIWTYIHIEKYHM^EVWIIRPETVIEHSPIWGIRGME]PEEHSPIWGIRGME
es el momento de mxima vulnerabilidad y aislamiento.
1. Problemas de agresividad e ira
Al evitar el contacto con el grupo de iguales, las habilidades sociales del menor van
Despus de perder a un ser querido, es habitual estar enfadados. En los nios sucede HMWQMRY]IRHSTSVRSTVEGXMGEVPEW)WQY]MQTSVXERXIUYIIWXIQSWEXIRXSWTEVERSVQEPM^EV
lo mismo: muchos no son ajenos a las circunstancias que rodean la muerte y eso les esta situacin lo antes posible.

136 137
3. Ansiedad de separacin Los profesores pueden ayudar al alumno dividiendo su tarea en objetivos ms cortos,
vigilando sus ejecuciones para que la distraccin no baje su rendimiento, llamndole
Tras la muerte, el nio puede sentirse desprotegido ante la posibilidad de que la muerte HMWGVIXEQIRXIPEEXIRGMzRSHIJSVQEI\GITGMSREPHjRHSPIYRTPE^SQE]SVTEVEXIVQMREV
TYIHEZSPZIVEVITIXMVWI]WIRXMVUYIWYWKYVEWHIVIJIVIRGMESGYMHEHSRSIWXjREWEPZS las tareas propuestas en el aula.Tambin es positivo revisar con ellos los errores y darles la
HIELuUYIWIQYIWXVIVIXMGIRXIEWITEVEVWIHIWYWKYVEWHIETIKSSUYIFYWUYIPE oportunidad de ser ellos quienes encuentren lo correcto, en lugar de corregir los errores
seguridad de su bienestar en la medida de lo posible. WMRRMRKRXMTSHIJIIHFEGO

Las conductas que nos indican que esto est pasando y que ms frecuentemente nos 7SQEXM^EGMSRIW
podemos encontrar en el aula son:
El nio puede llegar al aula con quejas repetidas. Podemos encontrarnos ante nios que
 8IQSVEUYIHEVWIWSPSW]FWUYIHEGSRWXERXIHIPEKYVEHIYREHYPXSHIGSRER^E presentan:
para que les tranquilice.
 Preguntas constantes dirigidas a comprobar que sus progenitores estn a salvo:Ha  (SPSVIWHIGEFI^EVIGYVVIRXIW
PPIKEHSTETjEPXVEFENS4SHIQSWPPEQEVEQEQjTEVEWEFIVWMQIZMIRIEFYWGEV  Problemas estomacales.
4YIHIWTVIKYRXEVWMQMQEQjLEPPIKEHSFMIREGEWE  (MGYPXEHIWTEVEVIWTMVEV
 4VIKYRXEWEPIUYMTSHSGIRXIWSFVIWYGYMHEHS FYWGERKEVERXM^EVPEGSQTEyuE]IP  Dolor en las articulaciones.
cuidado.  Dolor abdominal.
 1EPIWXEVMRHIRMHS
4. Cambios en la atencin y en la concentracin
=SXVSWWuRXSQEWUYIRSWPPIZERETIRWEVUYIWIIRGYIRXVEQEPSUYIIWXjIRJIVQS
Tras un duelo, todos somos sensibles a que nuestra concentracin se vea alterada, as como )WXEWUYINEWRSWSREPKSUYIIPRMySRNE RSTSHIQSWGSRWMHIVEVPSEWu )RVIEPMHEHIP
nuestro nivel de atencin. Resolver un duelo requiere mucha energa y normalmente la RMySWMIRXIIWIQEPIWXEVPSUYISGYVVIIWUYIRSLE]YREGEYWEQqHMGEUYIPSNYWXMUYI
atencin est puesta en procesos internos. Algunos de estos sntomas se relacionan con la sintomatologa que desarroll el fallecido
antes de su muerte. El nio, desde su temor a que le ocurra algo similar, puede tener
Estos cambios atencionales suelen aparecer en torno a los siete aos: el nio se muestra esos sntomas al tratar de revisarse mdicamente. En cuanto a los adolescentes, lo ms
ensimismado, distrado, le cuesta centrarse en tareas acadmicas que antes no le requeran probable es que su carcter se vuelva algo hipocondraco.
XERXSIWJYIV^S]TSVGSRWMKYMIRXILE]YREFENEHEHIPVIRHMQMIRXSIWGSPEV
En un principio, podemos dar un espacio en el aula al nio para que se tranquilice, se tome
El menor puede mostrarse absorto en sus pensamientos o sentimientos y es posible que alguna pastilla que le hayan mandado y veamos si mejora. Poco a poco iremos espaciando
mentalmente se cuestione muchas cosas del futuro o de cmo va a resolverse la rutina. PEEXIRGMzR]XVEXERHSHIUYIWYQEPIWXEVHMWQMRY]E VE^SREVIQSWGSRqPWSFVIWMLE]
8SHEWIWXEWHYHEWLEGIRUYIIPRMySTEVI^GEIRWMQMWQEHSHIWTMWXEHSIRWYQYRHSTIVS EPKRQSXMZSSFNIXMZSTEVEWIRXMVWIQEPIMRXIRXEVIQSWUYIGSRXMRIGSRWYWXEVIEW 0S
lo que ocurre es que est elaborando su duelo internamente: est trabajando con la idea importante es que, si hay pequeos sntomas fsicos, estos no incapaciten al nio.
de que no va a volver a ver al fallecido y todas las cuestiones asociadas a esto.
138 139
6. Problemas de memoria Tambin estaremos ms pendientes de su rendimiento en el aula: el profesor puede
pedirle que se acerque a la mesa, o bien puede acercarse a su pupitre y vigilar ms de
Si el nio emplea una gran cantidad de recursos en resolver su duelo o en gestionar el GIVGEWYINIGYGMzRXVEXERHSHIETS]EVPIIRPEVIEPM^EGMzRHIPEWXEVIEW]IRPEWHYHEWUYI
malestar que le produce la prdida, es lgico que tenga despistes u olvidos tras la muerte pueda tener.
de un ser querido.
Igualmente buscaremos dirigir al nio hacia la autonoma: si est muy despistado podemos
4YIHIWYGIHIVUYIWISPZMHIHIPEWJIGLEWHIPSWI\jQIRIWHIPSWTPE^SWHIIRXVIKEHI escribirle en una cartulina los pasos que debe dar para hacer un examen, apuntar los
XVEFENSWHIPSWHIFIVIWSHIPPIZEVIPQEXIVMEP)WXSXEQFMqRTYIHIIWXEVPMKEHSEPLIGLS deberes, terminar las tareas de aula, etc.

HIUYILE]EJEPPIGMHSPETIVWSREUYIIWXEFETIRHMIRXIHIUYIIPRMySWIVIWTSRWEFMPM^EVE
Es importante que el profesor transmita al nio que su estado es normal y transitorio
de esas cosas. Encontramos con ms frecuencia estos problemas cuando quien fallece es
TSVUYIWMEPLIGLSHIPEQYIVXIWIWYQEUYIRSPSKVEEPGER^EVPSWSFNIXMZSWEGEHqQMGSW
la persona que revisaba las tareas, que ayudaba al menor a preparar los exmenes o le
GYERHS ERXIW PS GSRWIKYuE GSR JEGMPMHEH IW TSWMFPI UYI ETEVI^GE QYGLE ERKYWXME ]
recordaba que revisara su mochila o las fechas de entrega.
frustracin, lo que puede llevarle a abandonar actividades acadmicas en las que antes no
tena problemas.
Los profesores pueden ayudar al alumno revisando que se lleva todo, que ha apuntado
bien las cosas, o creando un calendario de fechas importantes en el aula y en su casa. As,
8. Problemas de ansiedad y miedos
poco a poco, vamos espaciando la revisin y el nio puede suplir sin problemas esos fallos
en la memoria.
Tras la prdida de un ser querido, es normal que el nio o adolescente se sienta ms
nervioso, o que la muerte le despierte miedos. Uno de los temores ms comunes en
Tambin podemos consultar a ver qu otro adulto puede ayudarle a revisar sus cosas para PSW QjW TIUYIySW IW IP QMIHS E UYI SXVS TEVMIRXI JEPPI^GE ] WI UYIHI HIWTVSXIKMHS
UYIIWXSWSPZMHSWWITVSHY^GERGSRQIRSWJVIGYIRGMETEVEIWSWIVjRIGIWEVMSEPTVMRGMTMS Esto le hace estar alerta en el colegio y muy pendiente del bienestar de sus familiares,
darle ms oportunidades o hacer un poco la vista gorda mientras se adapta. generndoles mucha angustia y conductas de comprobacin continuas.

7. Bajada en el rendimiento acadmico Puede suceder que el nio desarrolle problemas para quedarse en el colegio e intente
UYIWIUYIHIGSRqPIPEHYPXSUYIPSEGSQTEyESXEPZI^TYIHIXVEXEVHIMVWIGSRqPTEVE
Los problemas de atencin, concentracin y memoria comunes tras un fallecimiento no separarse y as poder comprobar que est a salvo. Ante esta situacin, los profesores
TYIHIRZIVWIVIINEHSWIRYREHMWQMRYGMzRHIPVIRHMQMIRXSEGEHqQMGS )WRSVQEPUYI pueden bajar al patio a recibir al nio, quedarse ah un ratito y esperar a que disminuya la
en esta poca el nio obtenga peores notas en sus trabajos o en sus exmenes. El objetivo ansiedad del menor para subir a clase, mientras el adulto se va marchando.
es que vuelva al rendimiento que tuviera anteriormente y, para ello, habr que hacer
ajustes en la manera en que afronta sus tareas. Otra cosa que pueden hacer los profesores es dejar que el nio haga una llamada al da
para asegurarse del bienestar de sus parientes y, poco a poco, ir espacindosela: puede
Si quien fallece es la persona que estudiaba con el nio y ste no es autnomo para llamar dos veces por semana, luego una y, cuando compruebe que no pasa nada y se
estudiar solo, hay que buscar a alguien que pueda apoyarlo en sus tareas: un profesor tranquilice, entonces se le retirarn las llamadas y le iremos explicando lo improbable que
TEVXMGYPEVSYRTEVMIRXIUYITYIHELEGIVWIGEVKS]KEVERXM^EVIPGYQTPMQMIRXSHIPIWXYHMS es que pase algo malo o que, en caso de que algo sucediera, seguro que habra personas
dirigiendo al menor hacia la autonoma. que podran cuidarle.

140 141
Los adolescentes tambin pueden mostrarse reticentes a asistir a clase, llegando incluso Si vemos que el llanto es incontenible y que el nio puede sentirse abrumado por los
EHIWEVVSPPEVYREJSFMEIWGSPEVTEVEIZMXEVWIVNY^KEHSWTSVPSWHIQjWTEVERSXIRIVUYI compaeros, podemos darle margen para que salga un rato del aula, vaya al bao, beba
dar explicaciones sobre el fallecimiento, o bien porque se sienten muy diferentes al grupo agua y espere a que se le pase un poco.
]TVIIVIRRSI\TSRIVWIRMVIPEGMSREVWI
Otra posibilidad es que esos llantos sean producto de la frustracin o del sentimiento de
Es posible que al menor le preocupe mucho qu van a pensar de l tras lo sucedido, si impotencia que tiene el menor tras haber fallado en algo que antes no fallaba o porque
llora, si ha faltado a clase o si los profesores se muestran ms condescendientes con l. Le IPQIRSVWIWMIRXIWSPSXVEWPEVIEPM^EGMzRHIXVEFENSW)RIWXIGEWSTSHIQSWVIJSV^EVPEW
inquieta que sus compaeros puedan pensar que tiene mucha cara, que es blando, o que ejecuciones que le acerquen a los objetivos u ofrecerle la ayuda de otros adultos si la
TEVI^GEUYIPETqVHMHERSPIMQTSVXE )WSRSUYMIVIHIGMVUYIPSWGSQTEyIVSWTMIRWIR necesita.
eso realmente, sino que es el menor quien anticipa o imagina que eso puede ocurrir y
tiende a evitar una situacin incmoda antes de que suceda. No castigaremos el llanto; ni reaccionaremos con frases como: 4EVE ]E 2S IW TEVE
XERXS; ni distraeremos la emocin. Le diremos que es normal estar triste, que no se
0SMHIEPIRIWXSWGEWSWIWUYIIPRMySGSRWMKEVE^SREVUYIERXISXVSGSQTEyIVSIRIWE preocupe por llorar si echa de menos a la persona fallecida y le dejaremos un espacio algo
misma situacin, l no pensara que tiene morro o que es diferente, y trabajar con las ms privado que proteja su intimidad.
opiniones reales que tendra.
Si el llanto parece ser una llamada de atencin que busca el inters del adulto, lo iremos
Si el menor llegase a desarrollar fobia escolar, lo ms conveniente sera recurrir a un MKRSVERHS TSGS E TSGS PI HINEVIQSW UYI PPSVI TIVS EXIRHMqRHSPI GEHE ZI^ QIRSW S
profesional que nos ayude a gestionarlo. Para prevenir la fobia, es importante que el intentando que busque el espacio ntimo por s solo, sin ayuda del adulto.
colegio reciba bien al alumno y que ste no tarde mucho en reincorporarse al aula.
Tambin, si es posible, es bueno que en los primeros momentos los compaeros de su
crculo ms cercano estn pendientes de l y de sus necesidades. PARA RECORDAR: Algunas conductas que podemos
encontrarnos en el aula
8VMWXI^E]PPSVSW
 Problemas de agresividad e ira.
 Problemas relacionados con el aislamiento y las habilidades sociales.
Durante el duelo por el fallecimiento de un ser querido, las imgenes y los recuerdos  Ansiedad de separacin.
TYIHIRTVSZSGEVIRIPRMySWIRXMQMIRXSWHIEySVER^E XVMWXI^E WIRWEGMzRHIWSPIHEHS  Problemas en la atencin y la concentracin.
mucho desconcierto al enfrentarse a una situacin, en general, nueva que cambia su vida  7SQEXM^EGMSRIW
 Problemas de memoria.
y sobre la que a menudo no tiene informacin previa o habilidades para afrontarla.
 Bajadas en el rendimiento acadmico.
 Problemas de ansiedad y miedos.
,EFVjHuEWIRPSWUYIIPRMySWIVjQjWTVSTIRWSEIWXSWEVVERUYIWHIPPERXSSEWYQMVWI
IRYREKVERXVMWXI^ETSVINIQTPSGYERHSWIEGIVUYIPE2EZMHEHIRJIGLEWWIyEPEHEWGSQS
cumpleaos, el Da del Padre o de la Madre, actuaciones escolares a las que suelen acudir
familiares, etc. Esta expresin emocional no tiene mayor importancia, es algo normal.

142 143
8.2. ACCIONES ESPECFICAS QUE PUEDEN REALIZAR LAS  9XMPM^EV PE XIGRSPSKuE ZMVXYEP S LEGIV ZMWMXEW E GIQIRXIVMSW LMWXzVMGSW QSRYQIRXSW
ESCUELAS JYRIVEVMSW]I\TPMGEVWYWMKRMGEHS
 Formar al profesorado para trabajar la muerte en el aula y detectar los problemas
Muchas de estas acciones ya han sido comentadas con anterioridad, pero vamos a recoger asociados al duelo.
EPKYREWMRMGMEXMZEWIWTIGuGEWUYIIPGSPIKMSTYIHIPPIZEVEGEFSTEVEJEGMPMXEVIPHYIPSHI  Tener un espacio peridico para resolver dudas que vayan surgiendo cuando sea
un alumno, o para manejar aquellas conductas que suelen aparecer tras un fallecimiento. RIGIWEVMSYSVKERM^EVYRKVYTSHIXVEFENS
 Trabajar con las distintas emociones y su expresin para que los nios entiendan
1. Acciones de formacin preventiva cmo se expresan y que todas son vlidas.

Con esto nos referimos a aquellas acciones que puede llevar a cabo el colegio antes de 2. Materiales de trabajo adecuados
UYIWITVSHY^GEYRJEPPIGMQMIRXS)WHIGMV]EWEFIQSWUYIERXIWSHIWTYqWRSWZEQSWE
encontrar con una situacin de duelo en el aula, ya sea por el fallecimiento de un abuelo,
Sabemos que un aspecto clave para trabajar con nios es lo atractivos que les resulten
YRTVSJIWSV YRTVSKIRMXSV LIVQERS EPYQRS IXG=XEQFMqRWEFIQSWUYI GYERXSERXIW
los materiales: cuanto ms adecuados y atrayentes resulten para el menor, mejor acogida
tratemos el tema de la muerte en el aula, el pronstico es mejor ya que la muerte forma
tendrn.
parte de la vida y es un proceso normal.

Podemos trabajar con cuentos grandes, vistosos, o sacar las escenas que ms nos interesen
0EWEGGMSRIWHIJSVQEGMzRTVIZIRXMZEGSRWMWXIRIRUYI ERXIWHIUYIWITVSHY^GEYRE
de los cuentos e ir trabajando los distintos conceptos que el nio tiene que manejar para
situacin as, sean los propios docentes quienes aborden el tema en clase a travs de
entender la muerte.
alguna actividad.

Con las pelculas, escogeremos las que sean ms actuales. Esto en ocasiones es difcil, pero
Es conveniente que los profesores hayan recibido previamente algo de formacin sobre
trataremos de buscar las ms recientes o las que se adapten mejor a la edad de los nios.
el tema, o que cuenten con alguna persona de referencia a la que acudir en caso de duda
y que pueda ayudarles con este tema o en casos concretos. =E WEFIQSW UYI PEW TIPuGYPEW ERXMKYEWRS WYIPIR KYWXEVPIW TSVUYI LE] QYGLE HMWXERGME
IRXVIPEWSGMIHEHEGXYEP]PEHILEGIHMI^EySW
Algunas de las acciones que se pueden llevar a cabo son:
4SHIQSW XVEFENEV GSR IQSXMGSRSW TIKEXMREW GLEW HI GSPSVIEV TMGXSKVEQEW RSXMGMEW
 Leer cuentos y trabajar con ellos en el aula, como: )PTEXS]PEQYIVXI2SIWJjGMP IXGFYWGERHSWMIQTVIUYIIPXVEFENSWIGSRZMIVXEIRYRETVIRHM^ENIEXVEGXMZS
TIUYIyEEVHMPPE)PNEVHuRHIQMEFYIPS4EVEWMIQTVI. (* Consultar bibliografa)
 Proyectar pelculas y plantear preguntas a los nios sobre su contenido. Podemos 3. Comunicacin constante entre padres y profesores
usar: )PVI]PIzR=SVSFSX&YWGERHSE2IQS1MGLMGE, etc.
 %TVSZIGLEVJIWXMZMHEHIWGSQSIPIRXMIVVSHIPEWEVHMREIR'EVREZEP,EPPS[IIRSIP Cuando tiene lugar un fallecimiento en la familia, es muy importante que los padres avisen
Da de Difuntos, obras artsticas como el cuadro de la Leccin de anatoma, o hechos a los profesores lo antes posible para que estn al corriente del suceso.
LMWXzVMGSWGSQSPSWJYWMPEQMIRXSWHIPHIQE]S]SVKERM^EVEGGMSRIWGSLIVIRXIWGSR
el contenido de esa fecha sealada.

144 145
Lo ms conveniente sera que los padres mantuvieran una reunin con los docentes 5. Respeto o sensibilidad hacia fechas especiales
para informarles de aquellos aspectos del fallecimiento que consideren importantes.
Independientemente del tipo de muerte y del impacto que pueda tener, los docentes En todos los centros educativos hay fechas que se celebran de forma especial y que
necesitan saber qu han vivido los nios, qu saben, qu se les ha dicho, para as poder HIFIRXVEXEVWIGSRGMIVXEHIPMGEHI^EIP(uEHIP4EHVISHIPE1EHVIHuEWHIPSWEFYIPSW
EGXYEVFMIREWYZI^STEVESJVIGIVEPSWTEHVIWHIPRMySMRJSVQEGMzRTEVEUYIEFSVHIR 2EZMHEH ZEGEGMSRIW]XSHEWEUYIPPEWJIGLEWUYIZE]EREZMZMVWITSVTVMQIVEZI^XVEWPE
el duelo del menor de la manera ms adecuada. prdida y que tengan un carcter familiar especial. En esta categora entran tambin los
JIWXMZEPIW S IWXEW IWGSPEVIW IR PSW UYI EGSWXYQFVEWI E TEVXMGMTEV PE TIVWSRE JEPPIGMHE
%RXI IP QuRMQS GSRMGXS WuRXSQE S MRHMGEHSV HI TVSFPIQEW PSW TVSJIWSVIW HIFIR GSQSEGXSWHIKVEHYEGMzRVIYRMSRIWIWGSPEVIWGYQTPIEySW
QERXIRIV YRE GSQYRMGEGMzR YMHE TEVE IZMXEV UYI PSW TVSFPIQEW WI LEKER VIWMWXIRXIW
ayudar al nio y mantener la misma lnea de trabajo que los padres. Cuando vaya a tener lugar una actividad con motivo de alguna de estas fechas sealadas,
podemos transmitir al nio que esas fechas van a repetirse sistemticamente cada ao y
4. Preparar el regreso de un nio en duelo que al principio pueden resultar un poco ms complicadas, porque uno no sabe cmo
reaccionar ni qu hacer exactamente, ya que nunca ha experimentado una situacin
=EUYIERXIWSHIWTYqWYRGIRXVSIHYGEXMZSWIZEEIRGSRXVEVGSRYREWMXYEGMzRHIIWXEW similar.
GEVEGXIVuWXMGEWPSMHIEPIWUYIWIPITYIHEHEVYREVIWTYIWXEIGE^]EHIGYEHE
Podemos permitir que sea el nio quien decida si quiere participar en la actividad y si se
)WRSVQEPUYIWYVNERQYGLEWHYHEWPETVMQIVEZI^UYILE]UYIEJVSRXEVIWXEWMXYEGMzR va a sentir cmodo con la misma. No es conveniente dirigir la actividad: si los nios van a
UYIRSWITEQSWGYjPIWIPQINSVQSHSHIEGXYEV]WIXIRKEPEXIRXEGMzRHIRKMVUYI hacer un trabajo manual, por ejemplo, para el padre o para un abuelo, podemos sugerirle
no ha pasado nada. Otras veces el caso toca muy de cerca a los profesores y el abordaje al nio que ha perdido a este ser querido que haga el trabajo como si fuera un homenaje,
resulta difcil. un recuerdo, y que as puede recordar a esa persona especial.

Puede ser de ayuda buscar un momento para hablar con los compaeros del alumno En los festivales o celebraciones escolares daremos prioridad a que el menor se sienta
IRHYIPS SVKERM^EVYRETIUYIyEXYXSVuE]I\TPMGEVPIWPSUYILETEWEHS]PEWIQSGMSRIW parte del grupo, que est integrado. Tambin le explicaremos que hay otras muchas
que pueda experimentar el compaero con un lenguaje adecuado y ejemplos: que sepan personas pendientes de l en esos momentos y que estn ah porque se preocupan por
UYI IW EPKS RSVQEP UYI IW FYIRS TVISGYTEVWI TSV WY FMIRIWXEV UYI XEP ZI^ WI WMIRXE l y quieren cuidarlo.
EFVYQEHS XVMWXI IRJEHEHS UYI UYM^jW UYMIVE LEFPEV S TSV IP GSRXVEVMS UYI HIFIQSW
respetar su espacio en caso de que no quiera. Las festividades familiares del mbito privado, como las Navidades y los aniversarios,
pueden entristecer al nio. Tiene que saber que entendemos que son malos momentos
Si hubiera malestar, les explicaremos que vamos a tomar alguna medida excepcional para y que tiene derecho a sentirse triste o enfadado. En esas fechas podemos ser algo
evitar que se comparen o que puedan expresar sentimientos de injusticia por el trato QjWI\MFPIWGSRIPPSW]YRTSGSQjWTIVQMWMZSWGSRPEWI\MKIRGMEWIRIPEYPE]GSRIP
hacia el nio. comportamiento que esperamos de los nios.

146 147
6. Acciones concretas WI UYIHI HIWGSPKEHS HIP KVYTS ,E] UYI XIRIV IR GYIRXE UYI GSR JVIGYIRGME IVE PE
TIVWSREJEPPIGMHEUYMIRWISGYTEFEHIVITEWEVGSRIPPSW HIVIEPM^EVPEWXEVIEW HIVIZMWEV
0EWEGGMSRIWGSRGVIXEWRSWSRQIHMHEWNEW]HITIRHIRHIPSUYIGEHETVSJIWSVRIGIWMXI WY VIRHMQMIRXS ] XSHS IWS TYIHI KIRIVEV HMGYPXEHIW IR WY ETVIRHM^ENI8EQFMqR LE]
IRJYRGMzRHIPSUYIIPRMySHSPMIRXIQERMIWXIEWYVIKVIWSEPEYPE'EHEHSGIRXITYIHI que prestar atencin a su tolerancia a la frustracin y a sus bloqueos, intentando que los
EHSTXEVPEWQIHMHEWUYIGVIEUYIZEREFIRIGMEVQjWEPQIRSV%PKYRSWINIQTPSWWIVuER afronte lo mejor y ms rpidamente posible.
las siguientes:
d. Facilitar la adaptacin al aula: A veces la reintegracin en el aula no es fcil, ya sea

a. Permitir salidas del aula: Los primeros das tras la prdida es posible que el nio est por el impacto de la prdida o porque el menor se ha ausentado muchos das.

QY]RIVZMSWSSEJIGXEHSTSVPSUYIWIVjTVIGMWSUYIWEPKEGYERHSRIGIWMXIXVERUYMPM^EVWI
Tambin, como ya hemos mencionado, a menudo el menor teme la opinin de sus
)PEPYQRSHIFIWEFIVUYIqWXEIWYREQIHMHEXIQTSVEPUYITYIHIYXMPM^EVGYERHSIWXq
compaeros o tiene miedo de ser diferente y que los dems le traten de modo distinto.
muy triste, nervioso o preocupado. Le permitiremos salir un ratito hasta serenarse,
La mentalidad con la que se reincorporan tras un periodo de ausencia o despus de un
buscando si es necesario la ayuda de otro compaero u otro adulto disponible para que
cambio drstico en la familia hace que piensen que los dems van a tener forjada una
PIEGSQTEyI]PIE]YHIEXVERUYMPM^EVWI
opinin desfavorable al respecto.

b. Aplicar medidas excepcionales con los deberes: Como ya sabemos, el duelo puede
Es bueno que les expliquemos que ya hemos hablado con el grupo, que si quieren
afectar directamente al rendimiento escolar. El nio est ms despistado, ms descentrado,
pueden contar ellos mismos lo que ha pasado o, si no quieren, respetaremos su silencio
tiene olvidos lgicos y podemos tomar algunas medidas excepcionales:
LEWXEUYIIWXqRTVITEVEHSW 0IWXVERUYMPM^EVIQSWWSFVIWYWMHIEWHIGzQSZEEWIVPE
reincorporacin y, si el nio se deja, aclararemos con l y el aula lo que sabemos y lo que
 Comprobaremos que lleva la agenda al da.
pensamos de la muerte. Intentaremos acompaarle y ayudarle a que vuelva a adquirir las
 Le ayudaremos a meter el material necesario en su mochila. rutinas de aula lo antes posible, si es que las ha perdido.
 Nos acercaremos para comprobar que ha entendido las instrucciones o las
explicaciones. e. Fomentar el respeto ante el grupo de iguales: Uno de los temores de los nios
 Le daremos un tiempo extra si est muy distrado. es la percepcin que tienen de ellos sus compaeros, sobre todo si es distinta: temen lo
 Le ayudaremos a revisar sus exmenes. que van a pensar o a opinar de ellos, ser diferentes y quedar sealados, as que habr que
 %PEVKEVIQSWIPTPE^SHIPSWXVEFENSWWMPSRIGIWMXE tener especial cuidado cuando le expliquemos a la clase lo sucedido y cmo repercute
esto en el alumno.
Estas medidas son excepcionales y no pueden convertirse en una costumbre. Le
reconduciremos hacia la normalidad, apoyndole en su autonoma si es que se ha visto Igualmente hay que estar ms pendiente de determinados insultos o comentarios que se
afectada por la muerte directa del familiar que se encargaba de supervisar estas actividades. producen a veces y que, adems, suelen coger a los nios dolientes en un momento en el
que estn ms irascibles y, por consiguiente, sus reacciones suelen ser ms violentas. Los
c. 3URSRUFLRQDU DO DOXPQR DSR\R H[WUD DQWH GLFXOWDGHV Al igual que en el docentes deben estar un poco ms atentos de lo habitual y cortar las interacciones que
apartado anterior, cuando veamos que el menor se bloquea o se atasca en las actividades puedan ofender o ir en contra del doliente, e igualmente cortar las reacciones agresivas
EGEHqQMGEW TSHIQSW HIHMGEVPI YR XMIQTS I\XVE TEVE UYI EERGI PSW GSRGITXSW ] RS de los dolientes hacia sus compaeros.

148 149
I )DFLOLWDU OD UHLQFRUSRUDFLyQ D ODV UXWLQDV Al principio las rutinas van a verse Lo ideal es que uno de los adultos del entorno del nio, que tenga buena relacin con l,
MRXIVVYQTMHEWIWVE^SREFPIUYIIPEPYQRSWEPKEUYIPIGYIWXIGSKIVIPVMXQSUYIRSUYMIVE WIIRGEVKYIHIGSSVHMREVPEEGGMzR]HIGIRXVEPM^EVPEMRJSVQEGMzR
NYKEVGSRWYWGSQTEyIVSWIRIPVIGVIS4SGSETSGSIWXEWWMXYEGMSRIWI\GITGMSREPIWWI
irn reduciendo hasta que recupere la normalidad. Si hubiera alguna intervencin externa como, por ejemplo, un servicio de salud mental-
es recomendable que sta tambin se coordine con los servicios implicados para ir todos
Si el nio desea participar normalmente en las rutinas desde el principio o no muestra IRPEQMWQEHMVIGGMzR]E]YHEVEPQIRSVHIJSVQEQjWIGE^
MRHMGMSWUYILEKERTIRWEVUYIRSIWGETE^HIVIMRXIKVEVWIIRIPPEWHIFIQSWMRXVSHYGMVPI
GSR I\MFMPMHEH ,E] UYI TVSGYVEV UYI PEW WMKE HIWHI IP MRMGMS WM IW UYI TYIHI RYRGE
L (YLWDU PHQVDMHV WtSLFRV R IUDVHV KHFKDV Ojo con los mensajes que le demos
obligndole ni llamndole la atencin por no poder seguirlas a la perfeccin o como lo
al nio. Se dicen muchas frases tpicas en torno a la prdida: 2SPPSVIW8MIRIWUYIWIV
haca antes del duelo.
JYIVXI=EZIVjWGzQSRSTEWEREHE%LSVEIPEFYIPSIWXjIRIPGMIPS]IWXjQINSV8IZI
HIWHIHSRHIIWXqIXG]YRRQIVSMRRMXSHIXzTMGSWUYIXMIRHIREHMWTEVEVWIXVEWYRE
Lo ideal es recuperar las rutinas cuanto antes -ya sabemos que stas ayudan a dar
RSVQEPMHEHEPEZMHEHIPRMySTIVSWMRHINEVHIWIVI\MFPIWERXITSWMFPIWHMGYPXEHIW muerte. Sabemos que a menudo este tipo de mensajes cortan la expresin emocional
SVIWTSRWEFMPM^EREPRMySHIWMXYEGMSRIWJEQMPMEVIWHIPEWUYIRSHIFIVuELEGIVWIGEVKS
g. Trabajar los sentimientos y proporcionar seguridad emocional: El docente debe 8EQFMqRXVERWQMXIRMHIEWIVVzRIEWGSQS TSVINIQTPS UYIPEJSVXEPI^ERSZEYRMHEEPE
hacerle saber al nio que no est solo y que entiende que est en duelo; que aparecern XVMWXI^ESEPPPERXS
IQSGMSRIW]WIRXMQMIRXSWUYIRSXMIRIUYIEZIVKSR^EVWI]UYIIWRSVQEPUYIWIWMIRXE
as. A veces no sabemos qu decir, pero en el aula es mucho mejor explicar al nio: No s
UYqHIGMVXITIVSIWXS]EUYuTEVEPSUYIRIGIWMXIW, que decirle una frase enlatada y carente
Es bueno que el menor sienta que hay adultos con los que puede contar si necesita de empata.
soporte o contencin emocional.Tambin es positivo que entienda que esos sentimientos
HIXVMWXI^E WSPIHEH ERKYWXMESHIWEQTEVSJSVQERTEVXIHIPEI\MWXIRGME]UYIZEEWIV Aunque los profesores hayan pasado por una situacin parecida, es importante que no
GETE^ HI MRXIKVEVPSW IR WY ZMHE ] WIKYMV EZER^ERHS UYI WY ZMHE RS ZE E HIXIRIVWI S
VIGYVVEREPEWGSQTEVEGMSRIWTSVUYIGSQS]ELIQSWHMGLSGEHEHYIPSIWRMGS]XMIRI
interrumpirse por el hecho de que se sienta as.
caractersticas propias.

4SHIQSWLEGIVWEFIVEPEPYQRSUYIRSWSXVSWXEQFMqRIWXEQSWEMKMHSWTSVWYWMXYEGMzR
7. Buscar un apoyo o referencia concreta para el menor
]RSSGYPXEVIQSWRYIWXVEXVMWXI^ESTVISGYTEGMzR2SGSRZMIRIRKMVUYIRSTEWEREHE
ni disimular las emociones en caso de que no podamos reprimirlas.
0S QjW GSQR IW UYI IP HYIPS IR PSW RMySW WI VIWYIPZE HI JSVQE RSVQEP 4SV IWS WM
h. &RPXQLFDFLyQ HQWUH ORV GLVWLQWRV SURIHVLRQDOHV GHO FHQWUR Debido a que el dejsemos que todo siguiera su curso, probablemente el menor acabara resolviendo su
tema de la muerte puede ser delicado o controvertido, conviene que todos los docentes duelo de manera exitosa y aprendera las habilidades de afrontamiento necesarias para
o miembros del colegio estn al corriente tanto de la situacin del alumno como de las encarar otras muertes a lo largo de su vida.
acciones que van a llevarse a cabo, para no solaparse, repetirse y provocar cierto agobio
al nio. Aunque la resolucin vaya a ser adecuada en la mayora de los casos, es importante
que los menores se sientan acompaados en ese proceso por varios adultos del centro

150 151
escolar, pero que tengan una persona concreta de referencia a la que acudir en caso de
HMGYPXEHFPSUYISQSQIRXSGVuXMGSSGYEPUYMIVIZIRXYEPMHEHUYITYIHEWYVKMV0SMHIEPIW 5. Respetar las fechas especiales:
UYIIWETIVWSREWIEEPKYMIRGSRUYMIRXIRKERGSRER^E]EUYMIRIWXqRYRMHSW  Preguntar al nio acerca de su participacin.
 Las manualidades no se dirigen a otras personas.
 Puede vivirse como un homenaje.
)RIPGEWSHIPSWEHSPIWGIRXIW IWXEKYVEIWERQjWMQTSVXERXI RSTSHIQSWSPZMHEV  ,EGIVPIZIVUYIIWXjEGSQTEyEHSIRJIWXMZEPIWEGXYEGMSRIWIWXEW
que, con frecuencia, el hecho de sentirse diferentes del grupo hace que los menores se
ZE]ER UYIHERHS EMWPEHSW TSV PS UYI RIGIWMXEVjR E IWE KYVE TEVE HIWELSKEVWI WM RS 6. Otras acciones ms concretas:
quieren compartir con sus compaeros lo que les est pasando por miedo a que no les  Permitirle salir del aula.
 Adaptar los deberes, revisarle la agenda, la mochila, repasar con l sus
entiendan.
I\jQIRIW]EPEVKEVPSWTPE^SWHIIRXVIKE
 %TS]EVPIIRHMGYPXEHIWEGEHqQMGEWERXIFPSUYISSFENEHEWHIVIRHMQMIRXS
 Fomentar el respeto en el grupo.
PARA RECORDAR: Algunas acciones que pueden  Facilitar la reincorporacin a las rutinas acadmicas.
realizar las escuelas  Comunicacin entre los profesionales del centro.
 Trabajar y facilitar la expresin emocional.
1. Acciones de formacin preventiva:  Cuidado con enviar mensajes tpicos.
 Introducir el tema de la muerte con antelacin.
 'YIRXSWIWTIGuGSW 7. Buscar a una persona de referencia para el nio:
 Pelculas y cine-frum.  Saber a quin pueden acudir en caso de necesitarlo.
 Trabajar las emociones.  9REKYVEHIHIWELSKS]GSRER^E
 Aprovechar las festividades y fechas clave.

2. Proporcionar materiales de trabajo:


 Adecuar los materiales para que capten la atencin de los alumnos.
 9WSHIGLEWTIPuGYPEWEGXYEPIWTIKEXMREWIQSXMGSRSWIXG

3. Mantener una buena comunicacin familia-escuela:


 Transmitir a los padres la importancia de estar al corriente de los cambios.
 Avisar en caso de indicadores o sntomas de duelo.
 Escuchar y apoyar.

4. Preparar el regreso del nio en duelo:


 ,EFPEVGSRPSWGSQTEyIVSW
 Preguntarle al nio si quiere abordarlo en el aula.
 Avisar a los compaeros de que se tomarn medidas excepcionales si surge
el malestar.
 Prevenir de posibles reacciones poco deseables.

152 153
8.3. EL DUELO COLECTIVO: UNA SITUACIN ETCEPCIONAL

En un centro escolar puede darse una situacin de duelo colectivo, es decir; que toda
una clase o que todo un colegio quede afectado por la prdida de un miembro de esa
comunidad educativa. Es una realidad que antes o despus vamos a enfrentarnos a una
situacin de duelo en el aula, pero tambin puede producirse la muerte de una persona
y que sta afecte a todo el equipo docente.

Las situaciones que podemos encontrarnos son muy variadas, pero suelen ir en esta lnea:

 Fallecimiento de un docente.
 Fallecimiento de una persona perteneciente a la comunidad educativa no docente.
 Fallecimiento de varios hermanos pertenecientes a un mismo centro educativo.
 Fallecimiento de un alumno por diversas causas.
 Varias muertes durante un mismo curso escolar.

Estas situaciones no suelen darse con frecuencia pero, si se producen, generan un gran
impacto, ya que no suelen dejar a nadie indiferente. Pueden afectar a una clase entera,
incluyendo a los docentes, todo el centro educativo y tambin a todo el claustro de
profesores.

)R IWXSW GEWSW IW GSQR UYI RSW IRGSRXVIQSW ERXI YRE GPEWI TVjGXMGEQIRXI IRXIVE
afectada. Si los alumnos se encuentran en la etapa adolescente, el impacto es mayor que
en la etapa infantil y los primeros cursos de Primaria.

,E]EPKYREWEGXMZMHEHIWUYIWITYIHIRVIEPM^EVGSRIPEYPEIRXIVE

1. 3VKERM^EVXYXSVuEWSIWTEGMSWTEVELEFPEVHIPEQYIVXI]HIPSUYIPERSXMGMERSWLE
generado. Sera un espacio libre donde se puede hablar de sentimientos, emociones,
recuerdos, vivencias y de aquellos pensamientos que nos haya suscitado esa muerte.
2. Celebrar una despedida conjunta o un homenaje: Los compaeros pueden buscar
una forma de expresar sus condolencias y cmo quieren que sea ese homenaje, al
margen de aquellos ritos que se realicen en el seno de las familias o que tengan un
carcter ms ntimo.

154 155
3. Decidir qu hacer con sus pertenencias: Si el fallecido ha sido un alumno tendra
YRTYTMXVI YRWMXMSIRIPEYPE QEXIVMEP XVEFENSW0SRSVQEPIWUYIIPTYTMXVIWI PARA RECORDAR: El duelo colectivo
mantenga un tiempo y, poco a poco, vaya siendo retirado a un lugar secundario.
Ah se puede crear un pequeo rincn de homenaje, o bien decidir entre todos si Ocurre cuando una clase o todo el centro escolar se ve afectado por la muerte
de un miembro de la comunidad educativa, ya sea alumno, docente, varios
desaparece del aula o acaba el curso con nosotros.
LIVQERSW YR IQTPIEHS HI PSW WIVZMGMSW HIP GIRXVS IWGSPEV S WI TVSHY^GER
4. Elaborar una caja de recuerdos o un libro de recuerdos donde los compaeros varias muertes durante el mismo ao acadmico. Las acciones que nos pueden
TPEWQIRPEMHIEHIGzQSIVEPSWVIGYIVHSWUYIXIRKERHIPJEPPIGMHSERqGHSXEW= ayudar son:
se puede entregar a la familia como un homenaje colectivo.
1. 8YXSVuEWIWTIGuGEWSIWTEGMSWTEVELEFPEVHIPXIQE HIPEWZMZIRGMEW]PSW
5. Invitar a los familiares para transmitirles el sentimiento colectivo del aula: El centro
recuerdos.
TYIHISVKERM^EVYRIRGYIRXVSTEVELSQIRENIEVEPEPYQRSSTEVEUYIPSWGSQTEyIVSW 2. Despedida u homenaje conjunto como forma de expresar las condolencias.
puedan transmitir a la familia sus recuerdos y condolencias, siempre y cuando sta 3. Tomar una decisin sobre qu hacer con sus cosas.
desee recibirlos. 4. Elaborar una caja de recuerdos o un libro de recuerdos que se puede
entregar despus a sus familiares.
6. %WMWXMVEPJYRIVEPSEPIRXMIVVSHIQERIVEKVYTEP 0SWEPYQRSWTYIHIRSVKERM^EVWI
5. Invitar a los familiares a un encuentro con los compaeros para conocer
TEVEMV]TEVXMGMTEVHIEPKRQSHS IWGVMFMV]PIIVYREGEVXEHIHIWTIHMHE GSQTVEV otros aspectos de su hijo y sus amigos.
SVIW HINEVEPKRQIRWENI QERHEVYREGSVSRESVEPHITEVXIHIXSHEPEGPEWI S 6. Asistir de manera colectiva al funeral o a los homenajes.
simplemente asistir. 7. Crear un mural-homenaje de despedida.
7. Crear un mural con los mensajes de despedida que los distintos compaeros y 8. ,SQIRENIW GSRGVIXSW SVKERM^EHSW TSV IP GSPIKMS GSQS YRE WYIPXE HI
globos, plantar un rbol o un partido deportivo.
alumnos quieran escribir.
9. )PEFSVEV YRE TjKMRE [IF HI QIRWENIW ] GSRHSPIRGMEW UYI IWXq EFMIVXE
8. 3VKERM^EGMzRHILSQIRENIWTSVTEVXIHIPGSPIKMS GSQSYREWYIPXEHIKPSFSW YRE durante un tiempo limitado.
celebracin de despedida, una excursin para plantar un rbol conmemorativo, dejar
un espacio conmemorativo en el centro para aquellos alumnos o docentes que vayan
JEPPIGMIRHSIXG,E]QYGLEWMHIEWIRIWEPuRIEUYIRSWTYIHIRE]YHEVEXVEFENEVYRE
situacin de duelo colectivo con los alumnos. Cualquier idea se puede llevar a cabo
con un objetivo concreto.
9. 'VIEVYRE[IFIRPEUYIHINEVPSWQIRWENIW]PEWGSRHSPIRGMEW%PYQRSW]TVSJIWSVIW
TYIHIR GVIEV YRE TjKMRE [IF GSRQIQSVEXMZE HSRHI PSW ZMWMXERXIW TYIHER HINEV
QIRWENIWERqGHSXEWJSXSKVEJuEWTSIQEWIRHIRMXMZEGYEPUYMIVGSWEUYIGVIEQSW
UYITYIHIWIVZMVHILSQIRENIEPETIVWSREJEPPIGMHE ,E]UYINEVYRTIVMSHSHI
XMIQTSPMQMXEHSHYVERXIIPGYEPPE[IFIWXEVjEFMIVXE]EGXYEPM^EHE TEVEIZMXEVUYI
los alumnos se enganchen a ella y no sean capaces de cerrar su duelo o sientan que
IPGSQTEyIVSWMKYIZMZSEXVEZqWHIIWE[IF

156 157
9. 6IGYVWSWXMPIWTEVE
acompaar el duelo

159
9. 6IGYVWSWXMPIWTEVE
acompaar el duelo
9.1. LIBROS Y CUENTOS

1. Para siempre
Autor: Durant, A. y Gliori, D. | Editorial Timun Mas | 2004
&XHQWRFRQSUHFLRVDVLOXVWUDFLRQHVUHFRPHQGDGRSDUD(GXFDFLyQ,QIDQWLO
Un grupo de amigos formado por una nutria, un topo y una liebre han perdido a su amigo
] GSQTEyIVS IP ^SVVS )P PMFVS VIGSVVI PEW IQSGMSRIW HI PSW ERMQEPIW ] WYW VIGYIVHSW
ZMZMHSWGSRIP^SVVSUYIPIWLEGIREXVEZIWEVHMWXMRXSWIWXEHSWLEWXEIPEFSVEVYRVIGYIVHS
LSQIRENIJIPM^HIWYKVEREQMKS

2. Nana Vieja
Autor: Wild, M. | Ediciones Ekar | 2003
&XHQWRUHFRPHQGDGRSDUD(GXFDFLyQ,QIDQWLO
)WXELMWXSVMEIWXjTVSXEKSRM^EHETSVHSWGIVHMXEW RMIXE]EFYIPE UYIGSQTEVXIRWYZMHE
9RHuEPEEFYIPEWIHEGYIRXEHIUYIIWQE]SV]UYIIWTVSFEFPIUYIWYREPIWXqGIVGE
y hace un repaso junto con su nieta para asegurarse de que todo est en orden antes
de morir.

3. No es fcil, pequea ardilla


Autor: Ramn, E. y Osuna, R. | Editorial Kalandraka | 2003
3ULPHURVFXUVRVGH(GXFDFLyQ3ULPDULDR~OWLPRVGH,QIDQWLO
Es la historia de una pequea ardilla que ha perdido a su madre, va recorriendo las
HMWXMRXEWIQSGMSRIWHIPETIUYIyEEVHMPPE]PEWHYHEWUYIPIWYVKIRNYRXSGSRYRFLS]IP
pap de la ardilla, que habla desde su experiencia de cuando l mismo perdi a sus padres.

161
4. El jardn de mi abuelo El rey de la selva tiene miedo a la muerte y, al igual que en el libro .EGO]PEQYIVXI, su
Autor: Pierola, M. y Gil Vila, M.A. | Editorial Bellatierra | 2007 VIMRSWIGSRZMIVXIIRYREXMIVVEUYITEHIGIPEIRJIVQIHEHHIPEMRQSVXEPMHEH6IINEPE
Precioso cuento recomendado para ltimos cursos de Educacin Primaria. RIGIWMHEHHIPEQYIVXI]PEWGSRWIGYIRGMEWHIUYIqWXEHIWETEVI^GE
Es la historia de la relacin de un abuelo y su nieto a travs del jardn que tiene el primero.
A lo largo del texto vamos recorriendo el ciclo de la vida y cmo otros seres vivos nacen, 9. La abuela de arriba y la abuela de abajo
crecen, se desarrollan y desaparecen. Autor: De Paola, T. | Ediciones SM | 2002
Educacin Primaria.
5. Jack y la muerte El cuento narra la historia de un nio y la relacin con su abuela y su bisabuela. El llama la
Autor: Bowley, T. y Pudalov, N. | Editorial Oqo | 2012 abuela de arriba a la bisabuela, porque siempre est en la cama, y la abuela de abajo a
Cuento dirigido a Educacin Primaria. la abuela que est en la cocina. Ambas mueren en distintos momentos y el nio se pone
4VIZMIRHSPEQYIVXIHIWYQEHVI UYIIWXjQY]IRJIVQE .EGOWEPIHIGEWE]GSRWMKYI triste, aunque no entiende muy bien qu es morirse.
atrapar a la muerte con engaos. El libro narra qu ocurre cuando no existe la muerte y
PEWGSRWIGYIRGMEWHIUYIRMRKRWIVZMZSTYIHEQSVMV 10. Ins azul
Autor: Albo, P. | Editorial Thule | 2009
6. El pato y la muerte Para Educacin Primaria.
Autor: Erlbruch, W. | Barbara Fiore Editora | 2010 Ins va siempre a la playa con Miguel, pero un da Miguel muere y la explicacin que le dan
til para Primaria, cuando surgen las primeras preguntas sobre la muerte. no consigue convencerla y se plantea distintas cosas.
Un gran libro donde se narra el encuentro de la vida y la muerte a travs de un pato que
se encuentra con la Muerte, quien ha estado a su lado desde siempre. El libro narra el viaje 11. El rbol de los recuerdos
HIEQFSWLEWXEIPHIWIRPEGIREPIRIPUYIIPTEXSQYIVIXVEWLEFIVLIGLSQYGLEWGSWEW Autor: Teckentrup, B. | Editorial Nube ocho | 2013
(GXFDFLyQ,QIDQWLO\3ULPDULD
7. El corazn y la botella Zorro est cansado y se acuesta para morir. Sus amigos animales van acercndose a l,
Autor: Oliver, J. | Editorial Fondo de Cultura Econmica | 2010 como en un homenaje, y comparten sus recuerdos sobre Zorro, que se haba portado
Para nios de entre 6 y 12 aos. muy bien con todos ellos.
No es un libro que aborde directamente el tema de la muerte, pero s que nos puede
ayudar a lograr que los nios que se encuentran bloqueados o no estn expresando sus 12. Gajos de Naranja
sentimientos se abran emocionalmente, ya que narra cmo la protagonista guarda un Autor: Portier, N. y Legendre, F. | Editorial Tandem | 2008
GSVE^zRIRYREFSXIPPETEVEIZMXEVWYJVMVTIVSEPLEGIVPSWITMIVHIQYGLEWGSWEWHIPEZMHE A partir de 2 de Educacin Primaria.
Petra es una nia que vive en un pueblo de Andaluca y tiene una relacin muy especial
8. La balada del rey y la muerte con su abuelo, que todas las maanas le da unos gajos de naranja. Un da, al volver a casa,
Autor: Jekkes, H. y Meinderts, K. | Adriana Hidalgo Editora | 2011 el abuelo ha muerto y no est donde acostumbraba. Se trata de un libro que permite
8QOLEURLQWHUHVDQWHSDUDORVSULPHURVFXUVRVGH(GXFDFLyQ,QIDQWLO\3ULPDULD explorar y trabajar las emociones tras la prdida.

162 163
13. Mam se ha marchado
Autor: Hein, C. | Ediciones SM | 2005 PARA RECORDAR: Algunos libros tiles para acompaar
6HSXHGHXVDUDOQDOGH3ULPDULD\DOSULQFLSLRGH6HFXQGDULD el duelo o explicar la muerte
Narra la historia de una nia y los cambios que sufre tras la muerte de su madre, es un
1. 4EVEWMIQTVI
relato de cmo aprende a vivir sin ella. 2. 2EREZMINE
3. 2SIWJjGMPTIUYIyEEVHMPPE
14. Mejillas rojas 4. )PNEVHuRHIQMEFYIPS
Autor: Janisch, H. | Lguez Ediciones | 2006 5. .EGO]PEQYIVXI
6. )PTEXS]PEQYIVXI
A partir de Secundaria.
7. )PGSVE^zR]PEFSXIPPE
En este libro vemos cmo un abuelo narra cuentos a su nieto, aunque en realidad es un 8. 0EFEPEHEHIPVI]]PEQYIVXI
homenaje al abuelo, que ha fallecido y cuyo nieto sigue escuchando sus historias. 9. 0EEFYIPEHIEVVMFE]PEEFYIPEHIEFENS
10. -RqWE^YP
11. )PjVFSPHIPSWVIGYIVHSW
15. Un monstruo viene a verme
12. +ENSWHIREVERNE
Autor: Ness, P. | Editorial Nube de Tinta | 2016 13. 1EQjWILEQEVGLEHS
A partir de Secundaria. 14. 1INMPPEWVSNEW
Siete minutos despus de la medianoche, Conor despierta y se encuentra un monstruo 15. 9RQSRWXVYSZMIRIEZIVQI
16. 'zQSIWTSWMFPI#0ELMWXSVMEHI)PZMW
en la ventana. Pero no es el monstruo de la pesadilla que tiene casi todas las noches desde
UYI WY QEHVI IQTI^z IP EVHYS I MRGERWEFPI XVEXEQMIRXS 2S IWXI QSRWXVYS IW EPKS
diferente, antiguo y quiere lo ms peligroso de todo: la verdad. Un libro que nos habla de
RYIWXVEHMGYPXEHTEVEEGITXEVPETqVHMHE]HIPSWPE^SWJVjKMPIWTIVSI\XVESVHMREVMEQIRXI
poderosos que nos unen a la vida.

16. Cmo es posible? La historia de Elvis


Autor: Schssow, P. | Lguez Ediciones | 2006
3DUDQLxRVGH~OWLPRVFXUVRVGH(GXFDFLyQ,QIDQWLOHLQLFLRGH3ULPDULD
La protagonista de este libro tiene que enfrentarse a la muerte de su mascota, un pajarito.
)WYRPMFVSHSRHIWIVIINERPEWIQSGMSRIWEWSGMEHEWEPHYIPS]EPETqVHMHE

164 165
9.2. PELCULAS  Qu le pasa a la mam de Piecitos?
 Cmo son los amigos de Piecitos?
1. Bambi  Por qu son importantes los amigos?
Hand, D. (1942)  Cmo crees que se siente Piecitos?
Dibujos animados  5YqXMIRIRIRGSQRPSWEQMKSWHI4MIGMXSW#
&EQFMIPGIVZEXMPPSTMIVHIEWYQEHVIEQERSWHIYRSWGE^EHSVIW )RIWXETIPuGYPELE]  'SRSGIWEEPKRRMySMKYEPUYI4MIGMXSWUYIRSXIRKEQEQjTSVUYIWILEQYIVXS#
muchas preguntas que se pueden trabajar con los ms pequeos:
4. Mi chica
 Qu le pasa a la madre de Bambi? =LHII+ 
 Quin cuida de Bambi? Preadolescencia
 Quin te cuida a ti?
)WXETIPuGYPEXMIRIQYGLEWGSWEWUYITSHIQSWYXMPM^EVTEVEXVEFENEVPETqVHMHE:IHEIW
 Qu pasara si tu mam o tu pap no pudieran cuidarte?
una nia obsesionada con la muerte, a la que est ligada por dos motivos: su madre ha
 Quin ms te podra cuidar?
fallecido y su padre dirige una funeraria. La pelcula narra su vida en compaa de su mejor
EQMKS%PKYREWVII\MSRIWUYIWITYIHIRLEGIVXVEWPETVS]IGGMzRWSR
2. El rey len
$OOHV5\0LQFRII5 
 Quin conforma la familia de Veda?
Dibujos animados
 Qu trabajo tiene el padre de Veda?
Simba tiene que enfrentarse a la muerte de su padre, el rey Mufasa, y a las emociones y
 Qu es una funeraria?
la sensacin de culpa que tiene, que su to Scar se ha encargado de transmitirle. Algunas
 Por qu es importante que haya funerarias? Cul crees que es el objetivo de estos
TVIKYRXEWUYITSHIQSWVIEPM^EVXVEWIPZMWMSREHSWSR
lugares?
 Qu le pasa al amigo de Veda?
 Qu le pasa al padre de Simba?
 Cmo se siente Simba tras la estampida?  Crees que esas cosas pasan o slo ocurren en las pelculas?

 Qu crees que siente Simba y qu le hace alejarse de su familia?  Qu emociones tiene Veda?

 Qu le pasa a la madre de Simba?  Crees que Veda tiene miedo a la muerte?


 Qu le dice su padre sobre lo que le pasa a su mejor amigo?
3. En busca del valle encantado
Freudberg, J. y Geiss, T. (2007) 5. Buscando a Nemo
Dibujos animados Stanton, A. y Unkrich, L (2003)
Piecitos es un dinosaurio que pierde a su madre a manos de un T-Rex y tiene que ,QIDQWLO\3ULPDULD
emprender un gran viaje para llegar a una tierra segura, ya que sus tierras han sido 2IQSIWYRTI^TE]EWSQY]TVSXIKMHSTSVWYTEHVI UYIXMIRIQYGLSQMIHSXVEWPE
MRZEHMHEW TSV SXVSW HMRSWEYVMSW GEVRuZSVSW %P REP WI JSVQE YR KVYTS HI HMRSWEYVMSW muerte de la madre de Nemo. Todo cambia cuando Nemo es capturado y tiene que salir
LYqVJERSWUYIHIFIRE]YHEVWITEVEWYTIVEVPEWHMGYPXEHIWUYIWIIRGYIRXVER%PKYREW IRWYFYWGE%PKYREWVII\MSRIWUYITSHIQSWLEGIVGSRPSWRMySWZERIRPEWMKYMIRXI
cosas que les podemos plantear a los nios: lnea:

166 167
 Qu teme el padre de Nemo?  Qu le pasa a Pepino?
 Por qu crees que es tan protector y se asusta tanto?  Cmo se sienten los amigos?
 Qu le pas a la mam de Nemo?  Conoces a personas que hayan superado un cncer?
 Conoces a gente que haya fallecido por un cncer?
6. Ponette  5YqIQSGMSRIWIVIWGETE^HIHIXIGXEVIRPSWHMWXMRXSWTIVWSRENIW#
Doilon, J. (1996)
Adolescencia 8. El hombre bicentenario
Narra la historia de una nia de cuatro aos que pierde a su madre en un accidente Columbus, C. (1999)
de coche. Narra las emociones, el desamparo y la desolacin que experimenta la nia Adolescencia
mientras est con sus primos y sus compaeros. Es la lucha de la inocencia de una nia %RHVI[IWYRVSFSXHSQqWXMGSGSQTVEHSTSVYREJEQMPME)WYRVSFSXJYIVEHIPSRSVQEP
de 4 aos que no comprende qu es la muerte, frente al mundo adulto que intenta que TSVUYI TYIHI I\TIVMQIRXEV IQSGMSRIW ] WIRXMQMIRXSW %RHVI[ ZE ZMIRHS GzQS PEW
se resigne a no volver a verla nunca ms. Algunas preguntas que se pueden hacer son: personas que lo adquieren van falleciendo, pero l sigue ah. Entabla una relacin especial
GSR4SVXMEYREHIPEWRMIXEWHIPELMNEHIPEJEQMPMESVMKMREP4SVXMEIRZINIGI]%RHVI[WMKYI
 Qu pasa? mantenindose joven, ante eso l pide envejecer y morir sin saber cundo ocurrir esto.
 4SVUYqGVIIWUYI4SRIXXIIWMRGETE^HIIRXIRHIVPEQYIVXI# Algunos aspectos que podemos trabajar con esta pelcula son:
 Qu emociones reconoces en Ponette?
 Cmo intentan ayudar los primos y los compaeros?  Cmo se sentira alguien que no envejece al ver que los seres queridos van
 Qu hace el padre? envejeciendo y muriendo?
 Cmo negocia Ponette con Dios y qu le pide?  Crees que es importante morir?
 Crees que eso es posible?  Qu pasara si nadie muriera?
 Qu emociones experimentan los personajes?
7. Planta 4  Qu pasara si no sintiramos?
Mercero, A. (2003)  Te da miedo envejecer?
Adolescencia
)PPQIREVVEPEZMHEGSXMHMEREHIYRKVYTSHINzZIRIWPSWTIPSRIW UYITIVQERIGIR 9. Frankenweenie
MRKVIWEHSWIRPETPERXEHI3RGSPSKuEHIYRLSWTMXEPWYWQMIHSWWYWJSVXEPI^EWWYWWYIySW Burton, T. (2012)
y cmo se comportan durante el transcurso de la enfermedad. Algunas cosas que se Dibujos animados | Recomendado para ltimos cursos de Primaria
pueden trabajar son: El mejor amigo de Vctor, un perro llamado Sparky, muere en un accidente al correr detrs
de una pelota.Vctor consigue revivirlo y otros compaeros le obligan a resucitar a otras
 5YqIRJIVQIHEHXMIRIRIRGSQR# mascotas, causando un gran problema en el pueblo en el que viven. Algunas preguntas que
 Cmo es cada uno? podemos hacer tras ver la pelcula:
 Por qu hay personas que sobreviven al cncer y otras que no?
 Es cncer sinnimo de muerte?

168 169
 Qu le pasa a Sparky?  Cmo piensas que se siente Carl?
 Cmo lo resucita Vctor?  Era igual Carl de joven?
 Es posible resucitar y volver a vivir?  Cules son los motivos por los que crees que Carl no quiere tocar nada de la casa?
 Qu pasa con el resto de las mascotas?  Cmo es Russell?
 %PREPUYqTEWEGSRPEWQEWGSXEW#  Quin suele cuidar de Russell?
 Sabes lo que hay que hacer cuando se muere una mascota?  Qu emociones crees que comparten?

10. La novia cadver 12. El club de los poetas muertos


Burton, T. y Johnson, M. (2005) Weir, P. (1989)
Dibujos animados | Recomendado para nios en ltimos cursos de Primaria Menores que ya cursan Educacin Secundaria
Nervioso por el ensayo de su boda,Vctor huye al bosque y coloca el anillo de compromiso Un grupo de alumnos de un colegio masculino muy elitista descubren la poesa y las
en lo que l cree que es una rama, pero que en realidad es el dedo de una mujer muerta emociones gracias a las clases de un profesor poco convencional. Durante la pelcula uno
que quiere reclamar la unin y se lleva a Vctor al mundo de los muertos. Podemos usar HIPSWEPYQRSWHIPEGPEWIWIWYMGMHEEPWIVMRGETE^HIUYIWYJEQMPMEVIWTIXI]EYXSVMGIWYW
algunas de estas preguntas para centrar el trabajo: TPERIWHIJYXYVSUYITEWERTSVPEMRXIVTVIXEGMzR)WYRETIPuGYPEQY]XMPTEVEXVEFENEVIP
WYMGMHMS]PEWIQSGMSRIWUYIVSHIEREPETqVHMHEHIYRGSQTEyIVS%PKYREWVII\MSRIW
 Dnde le pone el anillo Vctor a Emily? que se pueden plantear:
 Qu es un cementerio?
 Crees que los muertos se pueden casar o venir a exigir cosas?  Qu es un suicidio?
 Te asustan los muertos?  Qu opinas de los suicidios?
 5YqIPIQIRXSWVIPEGMSREHSWGSRPEQYIVXIIVIWGETE^HIMHIRXMGEV#  Crees que siempre hay alternativas?
 Qu emociones puedes encontrar en la pelcula?  Cmo se quedan los compaeros?
 Cmo se siente Todd?
11. Up  Qu crees que sentiras si perdieras a tu mejor amigo?
Docter, P. (2009)  Qu podras decirle a un compaero que ha perdido a un ser querido?
Dibujos animados | Recomendado para alumnos de Secundaria  Qu te gustara que te dijeran a ti si hubieras perdido a alguien?
Carl es un anciano que ha perdido a su mujer, Ellie, quien ha fallecido tras una enfermedad.
Toda la vida han ahorrado para ir a visitar las cataratas Paraso, un lugar donde un dolo 13. Mi vida
de su infancia corri mil aventuras. La pelcula nos muestra a un anciano grun que se Bruce, J.R. (1993)
embarca en un rocambolesco viaje con un nio, Russell, como compaero accidental. Adolescencia
%PKYREWGSWEWWSFVIPEWUYITSHIQSWVII\MSREV En esta pelcula, Michael Keaton, un gran ejecutivo que acaba de enterarse de que va a ser
padre, es diagnosticado de un cncer y va recogiendo recuerdos, experiencias, sensaciones
 Qu les pasa a Carl y a Ellie cuando intentan tener hijos? TEVETSHIVHINjVWIPEWEWYLMNSERRSREGMHS ]EUYII\MWXIPETSWMFMPMHEHHIUYIRYRGE
 Qu le pasa a Ellie? lleguen a conocerse. Podemos abrir un debate con los adolescentes sobre:

170 171
 Qu emociones nos suscita? IR.ETzR 0SWRMySWIWGETERHIPGYMHEHSHIYREXuETIVZIVWE]WIVIJYKMERIRYRXRIP
 Es importante mantener recuerdos de las personas queridas que han fallecido? donde capturan lucirnagas y la pequea las entierra cada maana, estableciendo una
 Qu recuerdo o legado les gustara dejar? conexin entre ellas y su madre. El hermano mayor piensa que, a pesar de lo vivido, su
 Cmo les gustara ser recordados? LIVQEREXMIRIHIVIGLSEWIVJIPM^]EZMZMVGSQSYRERMyEHIGYEXVSEySW0ETIPuGYPEXMIRI
 'zQSIPEFSVEVuERIPPSWIWIPIKEHSHIVIGYIVHSWMQjKIRIWERqGHSXEWWIRWEGMSRIW# YRHIWIRPEGIQY]HYVS]VIUYMIVIUYIPSWEHSPIWGIRXIWWIERPSWYGMIRXIQIRXIQEHYVSW
 Trabajaremos cmo ponerse en ambas situaciones: la de un padre que no va a GSQS TEVE PPIKEV E YRE VII\MzR TVSJYRHE WSFVI IP XIQE 4SHIQSW MRHMGEVPIW EPKYREW
conocer a su hijo o que va a disfrutar poco de l y la de un hijo que pierde a un padre preguntas que guen el debate:
o que nunca lleg a conocerlo: qu emociones, sensaciones, ideas nos van surgiendo.
 Te parece injusta la muerte de la madre?
14. Tomates verdes fritos  Es justo que Seita cuide de su hermana Setsuko?
Aynet, J. (1992)  Qu representan las lucirnagas?
Preadolescentes  Cmo crees que afectan las grandes catstrofes a la poblacin?
0EZMHEHI2MRR]WIZMSQEVGEHETSVPEQYIVXIHIWYLIVQERS]IWSPILELIGLSGSRKYVEV  Conoces alguna catstrofe que se haya cobrado muchas vidas?
una personalidad y unas vivencias que trata de transmitir a Evelyn, una mujer que se siente  Cmo crees que afecta la muerte de la madre a cada nio?
MRXMP]EPEUYIE]YHEEQSWXVEVWIQjWEWIVXMZE]ZEPSVEHE 7ITYIHIRXVEFENEVEPKYREW  Crees que se debe ocultar la muerte a un nio cuando ste es muy pequeo?
cosas a travs de esta pelcula:  Qu te parecen las distintas muertes en la pelcula?
 Qu podan haber hecho los nios?
 Cmo crees que afecta la muerte a Ninny?
 'VIIWUYILEMRYMHSIRWYQSHSHIWIV#)RUYqGSWEW# 16. Los descendientes
 Una muerte nos marca? Payne, A. (2011)
 Qu emociones detectas en la pelcula? Adolescencia
 Cmo ayudaras a un amigo que ha perdido a su hermano? Se trata de una pelcula compleja, porque hay ciertos desengaos amorosos, pero la
parte que nos interesa es un accidente que deja a la esposa de George Clooney y madre
15. La tumba de las lucirnagas de dos nias en un estado de muerte cerebral. La historia narra la negacin y el enfado
Takahata, I. (1988) de una de las hijas, las emociones encontradas entre el amor que sentan por ella y la
Pelcula japonesa de animacin, que tambin se ha rodado con actores reales. GSRHIRETSVWYWPXMQSWEGXSW]PEHIWTIHMHE]PEEGITXEGMzRHIYRXIWXEQIRXSUYII\MKI
Recomendada para adolescentes. la desconexin del soporte vital para esos casos. Podemos aprovechar esa parte para
)PPQIIWEPKSPIRXSIRWYHIWEVVSPPS EWuUYITVIGMWEHIGMIVXSKVEHSHIQEHYVI^HIP trabajar con nuestros alumnos:
aula. Es la historia de dos nios afectados por la Segunda Guerra Mundial. Un da, tras
un bombardeo, no consiguen reencontrarse con su madre a la que encuentran despus  Cmo se sienten los distintos familiares?
malherida en un hospital improvisado. La madre fallece y es el hermano mayor, un  Cmo ves el enfado de la hija mayor?
adolescente, quien debe hacerse cargo de su hermana pequea de cuatro aos. La pelcula  Qu opinas de los testamentos vitales?
REVVEIPMRIVRSHIIWXSWHSWRMySWXVEWPSWFSQFEVHISWQEWMZSWHIPSWIWXEHSYRMHIRWIW  Crees que se deben usar los testamentos vitales?

172 173
 Te gusta la despedida que hace cada uno de su madre y de la esposa?
 'zQSLYFMIVEWLIGLSXIWILSQIRENI# 3$5$5(&25'$53HOtFXODVUHFRPHQGDEOHVSDUDUHH[LRQDU
sobre la muerte con los nios y los adolescentes
17. El nio con el pijama de rayas
1. &EQFM
Herman, M. (2008)
2. )PVI]PIzR
Adolescentes 3. )RFYWGEHIPZEPPIIRGERXEHS
Bruno, hijo del comandante de un campo de concentracin, conoce a Shmuel, un nio 4. 1MGLMGE
judo que vive al otro lado de la alambrada. Ambos tienen vidas paralelas muy distintas. 5. &YWGERHSE2IQS
6. 4SRIXXI
4SHVuEQSWYXMPM^EVPETEVEVII\MSREVEGIVGEHI
7. 4PERXE
8. )PLSQFVIFMGIRXIREVMS
 Qu te sugieren las muertes del campo de concentracin? 9. *VEROIR[IIRMI
 Qu te parecen los holocaustos o genocidios? 10. 0ERSZMEGEHjZIV
11. 9T
 'SRSGIWEGXYEPQIRXIEPKRKIRSGMHMSSQYIVXIGSRGEVEGXIVuWXMGEWWMQMPEVIW#
12. )PGPYFHIPSWTSIXEWQYIVXSW
 Te da miedo la muerte? 13. 1MZMHE
 Crees que la gente que va a morir pasa miedo? 14. 8SQEXIWZIVHIWJVMXSW
 Qu emociones te sugiere la pelcula? 15. 0EXYQFEHIPEPYGMqVREKEW
 Crees que los nios entienden lo que pasa? 16. 0SWHIWGIRHMIRXIW
17. )PRMySGSRIPTMNEQEHIVE]EW
 Crees que los nios entienden la muerte?
18. Cortos de animacin
 0EHEQE]PEQYIVXI
18. Estos son algunos cortometrajes de animacin que merecen la pena para  0EZMHEHIPEQYIVXI
trabajar el tema de la muerte en el aula:  'ERGMzRHIPSFSW
 )QM
a. La dama y la muerte.
b. 0EZMHEHIPEQYIVXI.
c. Cancin de lobos.
d. Emi.

174 175
9.3. OTROS MATERIALES WMRTVSJYRHM^EVIRPSWEWTIGXSWVIPEGMSREHSWGSRPEQYIVXIUYIXMIRIR%PKYRSWINIQTPSW
los encontramos en:
7IWEQI7XVIIX*EQMPMEWIRPEEMGGMzR
 ,EPPS[IIR]IP(uEHI(MJYRXSW
4jKMRE[IFGSRZuHISWHIPSWTIVWSRENIWHI)PQS6SWMXE]WYJEQMPMEUYIWMVZIRHIETS]S  Los fusilamientos del 2 de mayo.
para explicar la muerte a los nios.  Los bombardeos de Guernica y el cuadro de Picasso.
 El cuadro de 7EXYVRSHIZSVERHSEYRLMNS, de Goya.
6SWMXETMIVHIEWYTEHVI.EGOIPXuSHI)PQS]IRPSWZuHISWEWMWXMQSWEHMWXMRXEWWMXYEGMSRIW
 0EWIWXEWHIPSW1SVSW]'VMWXMERSW
en la familia: desde la envidia que siente Rosita al ver a Elmo jugar con su padre hasta la
elaboracin de una caja de recuerdos, o explicaciones sobre la permanencia de la muerte
y el sentimiento de echar de menos al ser querido. En la misma pgina hay un manual de
5. Trabajar las emociones
descarga para trabajar con los nios y las familias.
Sobre las emociones hay mucho material al que recurrir. Nos gusta especialmente el libro
2. Recortes de prensa )QSGMSREVMS(MPSUYIWMIRXIW, de Palabras aladas.Tambin podemos recurrir a emoticonos,
expresiones faciales, muecos o ilustraciones para trabajar las distintas emociones. Algunas
Algo fcil de trabajar es pedir a los alumnos que recojan noticias y recortes de prensa que, emociones que consideramos fundamentales en lo relativo a la muerte y los fallecimientos
en su opinin, tienen que ver con la muerte y trabajarlos en el aula. Pueden ser situaciones son:
de muerte directas o indirectas y, a partir de ah, trabajaremos las emociones que surgen,  Miedo.
las familias que pudieran estar conectadas, qu es una esquela, cul es el motivo para  Soledad.
contratar una esquela en un medio de comunicacin, etc.  Aceptacin.
 Incomprensin.
3. Usar el ciclo de la vida y las estaciones  Serenidad.
 Alivio.
4SHIQSWYXMPM^EVIPGEQFMSHIIWXEGMzRGzQSEJIGXEEHIXIVQMREHEWIWTIGMIWZIKIXEPIWE
 Culpa.
PSWjVFSPIWUYqTEWEIRPEREXYVEPI^ETEVEEFSVHEVIPXIQEHIPEQYIVXI0IWTIHMVIQSW
 Confusin.
TSV INIQTPS UYI WI NIR IR PSW LSVQMKYIVSW IR PSW MRWIGXSW ] IR PSW ERMQEPIW ] UYI
 Deseo.
averigen cules son los que ms viven, los que menos, en qu consiste el ciclo vital, qu
 Envidia.
es un depredador, etc. A partir de ah podemos abordar la muerte incluso con los nios
ms pequeos.  Odio.
 Ira.
4. Celebraciones populares, acontecimientos histricos y obras de arte  Desamparo.
 Ilusin.
,E]QYGLEWJIGLEWUYITYIHIRYWEVWIIRPSWGIRXVSWIHYGEXMZSWTEVEXVEFENEVEWTIGXSW
GSRGVIXSW ] KIRIVEPIW WSFVI PE QYIVXI 8EQFMqR WI TYIHIR YXMPM^EV GSRXIRMHSW HIP ,E]QYGLEWQjWIQSGMSRIW]WIRXMQMIRXSW TIVSHIYRQSHSYSXVSPEQE]SVuEIWXjR
currculo, como obras de arte o acontecimientos histricos que a menudo se estudian ligadas directamente a la muerte, a la prdida del ser querido.

176 177
10. Cuestiones prcticas
6. Uso de pictogramas

4SHIQSWYXMPM^EVTMGXSKVEQEWTEVEXVEFENEVIPGMGPSHIPEZMHE PEWIRJIVQIHEHIW PEZINI^


la muerte, etc. Los pictogramas, junto con el uso de pelculas, son muy adecuados para
habituales que se suelen plantear en
abordar el tema la muerte en el aula con los alumnos ms pequeos, en los primeros
cursos de Educacin Infantil.
el duelo infantil

PARA RECORDAR: Otros materiales de utilidad

1. Programa *EQMPMEWIRPEEMGGMzRde Sesame Street.


2. Recortes de prensa.
3. Las estaciones o el trabajo del ciclo de la vida.
4. Celebraciones populares, obras de arte y acontecimientos histricos.
5. Trabajo con las emociones.
6. Pictogramas para los ms pequeos.

178 179
10. Cuestiones prcticas
habituales que se suelen plantear en
el duelo infantil
En este apartado hemos recogido las preguntas que nos plantean con ms frecuencia.
Son tan comunes que hemos decidido dar aqu una respuesta -si la hay- que os pueda
E]YHEVSWIVXMP

1. Llevo a mi hijo al tanatorio? A qu edad es recomendable?

Esta es una de las preguntas que ms se repiten. A los adultos nos cuesta mucho llevar
a un nio a un tanatorio, tenemos arraigada la idea de que no es un lugar para ellos. El
adulto asume que es un espacio para que otros adultos expresen sus condolencias y se
despidan del fallecido, o acompaen a la familia tras la muerte.

Gran parte de la literatura seala que desde los seis aos los nios pueden celebrar
HIWTIHMHEW]TEVXMGMTEVIRPSWVMXSWJYRIVEVMSW7MRIQFEVKSLE]UYIKEVERXM^EVYREWIVMI
de factores para que los nios participen con calidad en las despedidas:

 Debemos asegurarnos de que comprenden los aspectos fundamentales de la muerte:


especialmente que el cuerpo no siente, que al fallecido no le duele nada, no oye, no
se asusta, no se ahoga si est en una caja, etc.
 ,E]UYIKEVERXM^EVUYIPSWQIRSVIWIWXEVjREGSQTEyEHSWIRXSHSQSQIRXSTSV
YREHYPXSHIGSRER^EUYIPIWTYIHEI\TPMGEVGSWEWSHEVPIWGEVMySWMPSRIGIWMXER
 Es prioritario que puedan anticipar lo que van a ver, por eso hay que explicarles
XSHSWPSWHIXEPPIWUYIWITEQSWWSFVIIPPYKEVIPEQFMIRXIPEZIWXMQIRXEIPEXEH
El objetivo es que puedan prever aquello que van a encontrarse para evitar que se
MQTVIWMSRIRSUYIWIIRGYIRXVIRGSRYREWMXYEGMzRMQTVIZMWMFPIERXIPEGYEPGEVI^GER
de recursos para reaccionar.

181
 Debemos protegerles de las emociones muy intensas o desbordantes, es decir: les momento de enfrentarnos a ese hecho nadie nos explic lo que bamos a ver, cmo era,
protegeremos de aquellas personas que estn muy afectadas o impactadas por la UYqTSHuEQSWIWTIVEVUYqETEVMIRGMEXIRuEIXG=RSTYHMQSWERXMGMTEVIPIWGIREVMSUYI
TqVHMHE]UYIQERMIWXIRHIWGSRXVSPIQSGMSREP nos bamos a encontrar.
 0IWTVSXIKIVIQSWHIPSWQIRWENIWEXIQSVM^ERXIWWSFVIPEQYIVXIHIPSWGSQIRXEVMSW
QSVFSWSWSHIPEWTVIHMGGMSRIWJYXYVEWWSFVIPSHIWKVEGMEHSHIPEWYRXSPEWHMGYPXEHIW 7MTSHIQSWKEVERXM^EVUYIIPRMySIWXEVjEHZIVXMHSHIPSWTSVQIRSVIW]PSWHIXEPPIWHIPS
de crecer as, el miedo, etc. UYIZEEZIVIRYRXEREXSVMSYRLSWTMXEPSYRJYRIVEPRSWIXVEYQEXM^EVj
 Es importante responder a todas las dudas que plantee el nio sobre cualquier
elemento presente en las despedidas. En caso de que la persona fallecida o que va a fallecer haya sufrido un gran deterioro fsico,
lo mejor es que el nio haya podido ser testigo del mismo, para que no se impacte por
7MRSWITYIHIRKEVERXM^EVIWXEWGSRHMGMSRIWIWTVIJIVMFPIRSMV7MUYIVIQSWUYIIPQIRSV el cambio que ha experimentado su ser querido. Si no ha podido ser, lo ms adecuado
participe y no sabemos lo que va a suceder, podemos solicitar al personal del tanatorio o es ir explicndole paulatinamente el proceso fsico que est sufriendo esa persona y, si es
del cementerio que despeje la sala unos minutos para que podamos entrar con el nio y posible, ir ensendole las imgenes. Si no se puede, hay que trabajar muy bien con los
ellos se encargarn de todo. nios lo que se van a encontrar.

Si el nio quiere ir y al llegar muestra inseguridad, duda o tiene miedo, lo mejor es 7MPETIVWSREJEPPIGMHELEWYJVMHSYREQYIVXIXVEYQjXMGE]IWXjHIWKYVEHEWIPSTSHIQSW
XVERUYMPM^EVPI]HIGMVPIUYIRSTEWEREHE UYIRSIWSFPMKEXSVMSEWMWXMV]UYITSHIQSW GSRXEVEPQIRSVTIVSRSIWRIGIWEVMSUYIPSZIERXERWzPSWMLEWMHSGETE^HIEWMQMPEVIP
HIWTIHMVRSWHISXVSQSHSTIVSIRRMRKRGEWSEVVEWXVEVIQSWEPRMySRMPISFPMKEVIQSW deterioro extremo.
a ir.
El hecho de ver al fallecido da un primer sentido de realidad a la muerte, permite a los
'SR PSW EHSPIWGIRXIW RS LEGI JEPXE KEVERXM^EV XSHEW PEW GSRHMGMSRIW ERXIVMSVIW TIVS Wu RMySWWEFIVUYIIWVIEPRSYREQIRXMVESYREJERXEWuE]IRRMRKRGEWSYRETIWEHMPPEHI
es conveniente buscar un momento ntimo en la familia para estar con ellos y dejarles la que van a despertar. As que, si queremos que sean capaces de tomar conciencia de
expresar lo que sienten sin sentirse cohibidos por las miradas de otros. Tampoco hay que la realidad, es importante que vean al fallecido o estn presentes en los ritos funerarios.
dejar que otros adultos les atosiguen tratando de expresar sus condolencias.
En estas despedidas es habitual que asistan los amigos de los adolescentes, as que les 3. Qu pasa si no se celebra ninguna despedida?
dejaremos irse con ellos y compartir las emociones o conversaciones con ellos, dejando
UYI WIER IWSW EQMKSW UYMIRIW XVEXIR HI EGSQTEyEVPIW IR IWI QSQIRXS % PE ZI^ Siempre ser mejor hacer frente a una despedida que no hacerla, pero a veces, cuando
buscaremos ese espacio familiar ntimo por si el adolescente necesita sentirse confortado YREQYIVXIWITVSHYGIHIJSVQEMQTVIZMWXESXVEYQjXMGE RSIWTSWMFPISVKERM^EVYRE
por otros adultos en los que confa y que le dan cario y seguridad. HIWTIHMHE4YIHIWYGIHIVMRGPYWSUYIIPJEPPIGMQMIRXSWITVSHY^GEEQYGLEHMWXERGME]RM
siquiera se pueda contemplar esa posibilidad.
4YIHIQMLMNSXVEYQEXM^EVWIEPZIVEYRQYIVXS#
'YERHSPEWHIWTIHMHEWWuWITYIHERSVKERM^EV EYRUYIPEWMXYEGMzRRSWTEVI^GEHYVES
)RTVMQIVPYKEVLE]UYIEGPEVEVUYIRSIWXERJjGMPXVEYQEXM^EVEYRRMyS7MPSWEHYPXSW desagradable, es preferible hacer la despedida antes que mentir al nio, ya que para l
XIRIQSWYRVIGYIVHSXVEYQjXMGSHIPEQYIVXISHIEPKRQYIVXSWYIPIWIVTSVUYIIRIP VIWYPXEVj ER QjW HMJuGMP WSFVITSRIVWI E PE HIWGSRER^E TSV LEFIV WMHS ETEVXEHS IR

182 183
QSQIRXSWGPEZI 0EHIWTIHMHERSXMIRITSVUYqWIVIRZMZS WMRSUYITSHIQSWYXMPM^EV o de no haberles tenido en cuenta en esos momentos tan importantes, y tambin
medios de expresin alternativos como cartas, dibujos, lbumes o cajas de recuerdos para TSHIQSWHEVPIYREMRJSVQEGMzRZIVE^]SFNIXMZEHIPLIGLSIRWuWMRIRXVEVIRGSRNIXYVEW
poder despedirnos del ser querido. Es importante atender sus emociones y responder a sus dudas. Tambin hay que evitar
VIWTSRWEFMPM^EVEPQYIVXS]GYPTEFMPM^EVIPWYMGMHMSEGPEVERHSUYIPEQYIVXIXMIRIGEYWEW]
Las despedidas no son imprescindibles, siempre se puede celebrar un homenaje privado el suicidio no es una causa, sino la parada cardiorrespiratoria que han podido provocar los
cuando sea necesario, de manera simblica, por lo que no tenemos que preocuparnos si medicamentos, la ruptura y seccin medular de un ahorcamiento, o que el cerebro dejase
IWMQTSWMFPIGIPIFVEVYRESPEJEQMPMEIWXjXEREJIGXEHEUYIRSWITYIHESVKERM^EV de funcionar tras un golpe o un disparo.

Cuando el nio est preparado trabajaremos con l el recuerdo y el homenaje a modo  'zQSPII\TPMGSUYIRSGSRSGMzETSVUYIQYVMzERXIWHIUYIqP
de despedida simblica. naciera?

4. Debo explicarle al nio un suicidio o es preferible ocultrselo? Este tema genera mucho dolor y preocupacin a los padres que ya han perdido a un hijo,
UYIXYZMIVSRYRLMNSUYIJEPPIGMz]HIWTYqWLERXIRMHSQjW7MIQTVIPIWEXIRE^EPEHYHE
Sabemos que las muertes inesperadas o repentinas tienen un gran impacto en una familia de si deben contarles que tuvieron un hermano, o cmo explicarles quin es el nio o
y, en el caso de un suicidio, a esto se une el hecho de que la persona ha decidido, querido nia que aparece en las fotos y el motivo de su muerte.
o elegido morir en un momento determinado y las personas de su alrededor perciben
cierta voluntariedad en ese abandono de la familia. La duda siempre est ah, porque a veces los padres creen que es ms fcil para el nuevo
hijo hacer como si no hubiera pasado nada y no exponerle al dolor de haber perdido a
Normalmente es un momento de mucha confusin y los nios suelen cuestionarse un hermano, ya que no ha vivido esa situacin.
muchas cosas: su responsabilidad en los hechos, la culpa, la posibilidad de desear ellos lo
mismo y ejecutarlo, si se poda haber hecho algo en esos momentos o la posibilidad de En primer lugar hay que aclarar que, aunque ese hermano haya fallecido, ha formado parte
salvarlo, etc. de la familia y ha sido importante con independencia del tiempo que viviera. Por tanto, es
un recuerdo importante para los padres, que deben compartirlo con el nuevo hijo o con
Igualmente el suicidio va asociado a un estigma social, por lo que es normal que a las los nios que tengan despus sin preocuparse de si les harn dao.
familias y, en mayor medida, a los nios les cueste ser sinceros con sus iguales ante un
suicidio y no sepan muy bien cmo afrontar este tema. (IFIRGSRXEVPIUYIXYZSYRLIVQERMXSUYIJEPPIGMzUYIPSLM^SERXIWHIUYIqPREGMIVE
por eso no lo puede ver, ni tocar, ni puede hablar con l. Es importante que los padres
Teniendo en cuenta que es un tema complicado y polmico, es cualquier caso es compartan con l recuerdos del hijo fallecido y le expliquen el motivo de la muerte: que
importante ser honestos con los nios y explicarles lo sucedido. Es preferible que seamos WITYWSQY]QEPMXSXERQEPMXSUYIPSWQqHMGSWRSTYHMIVSRE]YHEVPI]IPGSVE^zRHINz
sinceros a que se enteren por terceras personas. Adems, en estos casos siempre hay HIJYRGMSREVSUYIHIVITIRXIWYGSVE^zRHINzHIPEXMVIXG%HETXEVIQSWPEI\TPMGEGMzR
terceros que comentan los hechos y que hacen que llegue a odos del nio, causndoles del motivo del fallecimiento a la edad del nio y le dejaremos claro que aunque nos haya
EHIQjWQYGLSHSPSVTSVLEFIVWMHSIRKEyEHSW]QYGLEHIWGSRER^EIRIPWIRSJEQMPMEV pasado eso no es algo habitual, para que no se asuste pensando que a l le puede ocurrir
Si abordamos el suicidio con el nio, le protegemos de la sensacin de haber sido aislados lo mismo.

184 185
Es bueno que le enseemos algunas fotografas y recuerdos que conservemos del Cuando una persona desea ser incinerada, lo que se quema es el cuerpo, que ha dejado de
fallecido y que le hablemos de las cosas que le gustaban. Le iremos dando la informacin JYRGMSREV]RSWMIRXI)PGYIVTSWITSRIIRYRELEFMXEGMzRUYIIWXjQY]QY]QY]GEPMIRXIGSR
KVEHYEPQIRXIRSXSHSEPEZI^8EQTSGSLEFPEVIQSWGSRWXERXIQIRXIHIPJEPPIGMHS]EUYI YREXIQTIVEXYVEQY]EPXELEWXEUYIWIGSRZMIVXIIRGIRM^EW]TSPZS)WEWGIRM^EWWIKYEVHER
el protagonista es l y podra tener celos. IRYREIWTIGMEHIGENEUYIWIPPEQEYVREUYIVIGSKIRPSWJEQMPMEVIW]WITYIHIIRXIVVEVHINEV
IRYRPYKEVIWTIGMEPKYEVHEV]IWSWMVZIHIVIGYIVHSHIPWIVUYIVMHS
0IHINEVIQSWTVIKYRXEVPSUYIUYMIVE]GYERHSUYMIVE TIVSRSJSV^EVIQSWUYIHIWII
saber ms sobre su hermano o hermana fallecida: si l pregunta, le diremos lo que necesite. Si la familia tiene creencias religiosas, debemos explicar al menor que el alma no se
4YIHISGYVVMVUYIYREZI^UYIWIPSI\TPMUYIQSWRSLEKEQjWTVIKYRXEW)RIWIGEWSPI MRGMRIVEWzPSIPGYIVTSRMIPEPQERMIPIWTuVMXYWIMRGMRIVE7MPEWGIRM^EWWIZEREHITSWMXEV
VIWTIXEVIQSW]WMIREPKRQSQIRXSZYIPZIEQSWXVEVMRXIVqWPSEXIRHIVIQSW o a enterrar como parte de un homenaje, es importante dejar que los nios participen
en el ritual si lo desean.
Es posible que los padres quieran hacer un homenaje en alguna fecha especial, visitar el
PYKEVHSRHIIWXjIRXIVVEHSMVEEPKRWMXMSGSRGVIXSSTEVXMGMTEVHIYREWYIPXEHIKPSFSW Aunque la incineracin es un concepto algo complejo para los nios, es preferible
)R IWE WMXYEGMzR MRGPYMVIQSW IR RYIWXVS LSQIRENI E PSW RYIZSW LMNSW WMR JSV^EVPS 0IW explicrselo que mantenerlos apartados de esa realidad por los motivos que ya hemos
explicaremos lo que vamos a hacer y les preguntaremos si quieren acompaarnos porque mencionado.
para nosotros es importante. Tenemos que entender que para ellos no lo sea, por eso les
HINEVIQSWIPIKMVWMUYMIVIREGSQTEyEVRSWSWMTVIIVIRTEVXMGMTEVHIYRTPEREPXIVREXMZS 7. Cmo puedo explicarle a mi hijo las creencias religiosas?
con otros familiares o amigos, mientras nosotros estamos en el homenaje.
Las creencias religiosas son importantes para muchas familias, en ocasiones suponen
,E]UYIVIGSVHEVUYIIPPSWRSPSLERGSRSGMHS TIVSUYITEVERSWSXVSWIWMQTSVXERXI YRKVERGSRWYIPSERXIPETqVHMHE]JEGMPMXERUYIPEWTIVWSREWEJVSRXIRGSRJSVXEPI^EPSW
y eso es lo que les transmitiremos: que form parte de nuestra familia, que tuvieron procesos de duelo.
un hermano y que fue importante para nosotros igual que ellos son muy importantes;
que sabemos que sin conocerle es difcil hacerse una idea de cmo era, pero que les 7MWSQSWTIVWSREWVIPMKMSWEWTIVSIRIPQSQIRXSHIPEQYIVXIERRSLIQSWMRXVSHYGMHS
contaremos las cosas que puedan interesarles y, si no quieren saber ms, no pasa nada. al nio en nuestras creencias, es preferible no hacerlo, ya que una introduccin repentina y
algo compleja puede generarles temores y mucha confusin, as que es preferible esperar
6. Cmo explico una incineracin? a otro momento para hacerlo.

9RTVSFPIQEGSQRUYIWYVKIEPI\TPMGEVPEMRGMRIVEGMzREPSWRMySWIWUYIEQYGLSW ,E] UYI XIRIV IR GYIRXE UYI PSW RMySW TIUYIySW MRXIVTVIXER PSW QIRWENIW HI JSVQE
padres les da miedo explicar al nio que IWXEQSWUYIQERHSEPEFYIPS Ese es el problema: literal, por lo que hablarles del Cielo o de un lugar mejor puede confundirles, pudiendo
UYIWIKYMQSWZMIRHSELuEPEFYIPSEPEQEHVIEPTEHVIEPEEFYIPE2SUYIQEQSWEPE llegar a pensar que los muertos vuelan, o que realmente el cuerpo del fallecido tal y como
persona, incineramos el cuerpo, es importante que no equiparemos la incineracin de un lo conocan est en otro sitio y entonces barajarn la idea de que puede volver.
cuerpo con quemar a una persona.
Tampoco es conveniente apelar a la voluntad de Dios cuando expliquemos las creencias
El nio tiene que entender previamente que el cuerpo ha dejado de funcionar, que no religiosas, as que hay que huir de frases hechas como: (MSWLEUYIVMHSPPIZjVWIPS o porque
siente absolutamente nada y, entonces, podemos explicarle en qu consiste la incineracin, EWuPSLEUYIVMHS(MSW, ya que pueden generar miedo y bastante mal humor.
por ejemplo, con estas palabras:

186 187
,E]UYIEHETXEVPEI\TPMGEGMzRHIPEWGVIIRGMEWEPEIHEHHIPRMySEPKSUYIWYIPIJYRGMSREV No hay que tener miedo de explicarle al nio que alguien est muy, muy enfermo, de
es: %QuQIKYWXETIRWEVUYI PETIVWSREJEPPIGMHE IWXjIRIPGMIPS UYIIWSXVSPYKEVHIP hecho es bueno que lo sepa. Tambin conviene que pueda visitar a la persona en estado
UYIRSWITYIHIZSPZIV)PGMIPSIWYRVIGYIVHSIWGSQSEQuQIKYWXEVIGSVHEVEPETIVWSRE terminal y que la visite mientras dure su enfermedad. Lo normal es explicarles que el
Por ejemplo, para m el cielo del abuelo sera el jardn de su casa, y me lo imagino sentado abuelo est muy, muy malito, que los mdicos acaban de darse cuenta y que, aunque van
IRIPFERGSHIQEHIVEUYIXERXSPIKYWXEFEGzQSWIVuETEVEXM#'zQSXIPSMQEKMREWX#, a intentar ayudarle, es posible que siga estando muy, muy malito y se muera.
as podemos introducirle en un concepto abstracto de un cielo o de vida eterna en el
recuerdo. ,E] UYI PPIZEV EP RMyS E ZIV E IWE TIVWSRE QMIRXVEW IWXq IRJIVQE )W QINSV UYI ZE]E
viendo el deterioro progresivo a que de repente vea un gran cambio despus de varias
8. Mi hijo dice que ve a su abuela fallecida, debo preocuparme? semanas. Si no son posibles las visitas peridicas, es importante advertirle previamente de
lo que va a ver, por ejemplo: =EWEFIWUYIIPEFYIPMXSIWXjQY]QEPMXS'YERHSZE]EQSWZEW
No, no hay nada de qu preocuparse en estos casos. Al inicio del duelo es frecuente que EZIVUYIIWXjQY]HIPKEHSWIPIQEVGERPSWLYIWSW]RSWILETSHMHSEJIMXEVIWXjGSRIGXEHS
las personas creamos ver, oler e incluso escuchar a la persona fallecida. Son sensaciones EYRSWXYFSWUYIZEREPFVE^S]UYIPIE]YHEREEPMQIRXEVWI ]XMIRIGEFPIWTYIWXSWTSVIP
normales y suelen desaparecer con el paso del tiempo. TIGLSTEVEUYIRSWHINIRZIVWMWYGSVE^zRPEXI)WSWGEFPIWWIGSRIGXEREYREQjUYMREUYI
LEGIQYGLSVYMHSZEWEZIVUYIIWXjXYQFEHMXS]RSWITYIHIPIZERXEV4YIHIWEGIVGEVXIGSR
0SQINSVIWRSEWSQFVEVWIRMEPEVQEVWI XEQTSGSTVSJYRHM^EVTEVEUYIRSWHMKERUYq cuidado porque estn esos cables que te he dicho y los tubos, a lo mejor quieres darle un besito,
cosas les han dicho o cmo iban vestidos, as no daremos mucha importancia a algo que WMRSUYMIVIWRSTEWEREHE.
es normal y que al principio puede suceder durante un tiempo prudencial.
Es preferible explicarles la situacin y que nos pregunten lo que necesiten, aunque que
A veces ocurre que, cuando el nio dice que ha visto a una persona fallecida, causa ignoren nuestras informaciones, a tener que darles la noticia de manera repentina y sin
impacto en el adulto, as que luego lo repite en ms ocasiones buscando de nuevo ese preparacin. Lo importante en estos casos es que el nio pueda anticipar lo que se va a
asombro o impacto, por eso hay que ser precavidos ante las reacciones repetidas sobre encontrar si va a visitar al ser querido, en el hospital o ante situaciones nuevas. Por eso es
este tema. importante describirles muy bien lo que van a ver, cmo es, qu cosas se pueden hacer y
con cules hay que tener cuidado.
9. Al abuelo le han diagnosticado una enfermedad terminal, debe ir el nio
EPLSWTMXEPEZIVPI#,E]UYIGSRXEVPIUYIIPEFYIPSRSWIZEEVIGYTIVEVS 10. Cundo debo llevar al nio a terapia?
esperamos a que tenga lugar el fallecimiento?
Es difcil tras un duelo decidir cul es el momento exacto para llevar a un nio a terapia,
Es tentador ocultarle a un nio la enfermedad de un ser querido, sobre todo cuando pero hay algunas cosas que es conveniente que valore un profesional si nosotros tenemos
pensamos que as lo protegemos del sufrimiento que pudiera causarle ver al ser querido dudas.
IRJIVQS ,E]TIVWSREWUYITMIRWERUYIZIVEYRWIVUYIVMHSHIXIVMSVEHSTYHIPPIKEV
E MQTVIWMSREV S XVEYQEXM^EV EP RMyS TIVS REHE QjW PINSW HI PE VIEPMHEH )P RMyS RS WI Un criterio que nos puede servir es valorar si alguna de sus reas se ha visto daada
impresiona por el deterioro, se impresiona por la novedad, porque no espera ver lo que seriamente o interrumpida, que el nio no logra volver a la rutina o a la normalidad en
LE]RSIWGETE^HIERXMGMTEVPS]IWSWuPIWYTSRIYRMQTEGXS esa esfera de su vida, puede servirnos de gua lo siguiente:

188 189
a. rea social  Reticencia a participar en las reuniones familiares, se mantiene aislado.
 Problemas de relacin con sus compaeros y/o amigos.  Incomunicacin con los miembros de la familia.
 Incapacidad para mantener las amistades.  Excesiva preocupacin por el bienestar de sus parientes, comprueba constantemente
 No quiere salir con sus amigos. la salud de los supervivientes.
 No quiere participar en cumpleaos o eventos a los que antes asista.  Sugerencias constantes de llevar una vida ms sana y preocupacin por las costumbres
 2SUYMIVIVIEPM^EVEGXMZMHEHIWI\XVEIWGSPEVIW insanas de la familia.
 4VIIVIUYIHEVWIIRIPHSQMGMPMSJEQMPMEVERXIWUYIIRIPTEVUYISIRSXVSWPYKEVIW
 Agresiones a sus iguales.
5YMIVSLEGIVYRLSQIRENIUYqGSWEWTYIHSYXMPM^EVGSQSMHIEW#
 Irritabilidad en el juego cooperativo.

Los homenajes en familia pueden ser un buen trabajo y formar parte de la elaboracin del
b. rea acadmica
duelo, adems de ser una gran oportunidad para compartir el recuerdo del ser querido
 Problemas de concentracin evidentes.
 Trae los deberes sin hacer cuando antes no haba problema. que ya no est y hacer algo especial en su memoria.
 Se olvida de trabajos, exmenes, entregas, etc. Los ms habituales son:
 Se muestra distrado o ensimismado.
 Llora en el aula constantemente.  Escribirle una carta al fallecido con algunas ancdotas, recuerdos o sencillamente
 )WMRGETE^HITEVXMGMTEVIRPEWEGXMZMHEHIWGSXMHMEREWHIEYPE expresando la relacin que haba entre ellos.
 Bajada evidente en el rendimiento.  )PEFSVEVYREGENEHIVIGYIVHSW)WEPKSGSQR]WIRGMPPSTEVEUYIPSWRMySWTYIHER
 Evita ir al colegio. recordar. Se elige una caja entre todos, se puede decorar, y escogemos objetos que
 Intenta irse del colegio con distintas excusas. JYIVER WMKRMGEXMZSW TEVE PE TIVWSRE JEPPIGMHE TSV INIQTPS YR TEyYIPS WM IW UYI
PPIZEFE PE GEFI^E GYFMIVXE YR TMNEQE YRE JSXSKVEJuE JEQMPMEV EPKR EHSVRS UYI PI
c. rea personal KYWXEWIPPIZEVYRELSNEWMPIKYWXEFETEWIEVTSVIPTEVUYI4SHIQSWQIXIVGYEPUYMIV
 Come peor.
cosa, todo vale si nos recuerda alguna faceta del ser querido. Se mete todo en la caja
 Sntomas mdicos leves y constantes.
]WMIREPKRQSQIRXSUYIVIQSWVIGSVHEVIWSWHIXEPPIWTSHIQSWGSKIVPEGENEIMV
 Problemas para conciliar y mantener el sueo.
sacando las cosas para recordar.
 Pesadillas recurrentes.
 Escribir un diario de la persona fallecida: Esto sirve especialmente para que dejemos
 Problemas con la higiene y el cuidado personal.
un recuerdo a los nios que apenas conocieron al difunto. Podemos escribir cosas
 Temores que antes no estaban.
sobre su carcter, ancdotas, cosas de las que disfrutaba y otras que detestaba, detalles
GUHDIDPLOLDU de cmo era, cmo vesta, los sitios que le gustaban y eran especiales, recuerdos con
 Problemas de relacin en la familia. IPRMySSPERMyEEUYMIRZE]EHMVMKMHSIPHMEVMS%Wu GYERHSIPRMySGVI^GETSHVj
 Rebelda nueva. leer ese diario y hacerse una idea de cmo era el fallecido, o simplemente recordar
 Colaboracin absoluta: se muestra como un apoyo slido y responsable en las cosas cosas especiales.
de la familia.  Plantar un rbol o una planta en su honor.
 Escribirle una poesa o una cancin.

190 191
 Visitar en su memoria algunos lugares que fueran especiales para esa persona o para
la familia. parte de la familia y es un recuerdo importante. Compartiremos nuestros
 Una suelta de globos. recuerdos con l, se lo explicaremos gradualmente y responderemos a sus
TVIKYRXEW7MWIZEEVIEPM^EVEPKRLSQIRENIPIMRZMXEVIQSW
 Elaborar un lbum de recuerdos: para eso juntaremos fotografas de momentos
especiales en los que hubiera participado la persona fallecida. Tambin podemos 6. Cmo le explico una incineracin?
QIXIVEPKYREGEVXEJVEWIXuTMGEVIGYIVHSW7MIREPKRQSQIRXSIPRMySPSRIGIWMXE No equipararemos incinerar con quemar. Le explicaremos que se incinera el
para recordar puede coger el lbum y mirar su contenido. GYIVTSUYILEHINEHSHIJYRGMSREV0EYVREUYIGSRXMIRIPEWGIRM^EWWIHITSWMXE
en un lugar especial como homenaje. Si hay creencias religiosas aclararemos que
el alma no se incinera.

PARA RECORDAR: Cuestiones prcticas habituales 7. Cmo puedo explicarle a mi hijo las creencias religiosas?
TXHVHVXHOHQSODQWHDUHQHOGXHORLQIDQWLO Debemos asegurarnos previamente que tiene claro el concepto de muerte,
para no generarle confusin o temor. Adaptaremos las explicaciones a su edad
1. Es conveniente llevar a los nios al tanatorio? y tendremos en cuenta su pensamiento literal a la hora de usar conceptos
A partir de los seis aos pueden asistir, siempre que nos aseguremos de que abstractos.
entienden los aspectos fundamentales de la muerte, estn acompaados de un
adulto que pueda responder a sus dudas, sepan previamente lo que van a ver y 8. Mi hijo dice que ve a su abuela fallecida, debo preocuparme?
podamos evitar que presencien situaciones de gran intensidad emocional. No debe preocuparnos, son sensaciones normales al inicio del duelo, se pasan
con el tiempo. No conviene alarmarse ni sorprenderse, ya que si no, el nio
4YIHIQMLMNSXVEYQEXM^EVWIEPZIVEYRQYIVXS# suele repetirlo.
0SW RMySW RS WSR JjGMPIW HI XVEYQEXM^EV TIVS Wu TYIHIR MQTVIWMSREVWI WM RS
les hemos avisado antes de lo que van a ver. Si un ser querido padece una 9. El abuelo tiene una enfermedad terminal, llevo a mi hijo al hospital a verle o
enfermedad terminal es conveniente que sean testigos del deterioro fsico. Si el esperamos a que tenga lugar el fallecimiento para contrselo?
fallecido sufri una muerte traumtica, podemos explicrselo, no es necesario )WTVIJIVMFPIUYIWIEXIWXMKSHIPHIXIVMSVSKVEHYEPEUYIPSZIEIRIPPXMQS
que lo vean.Ver al fallecido ayuda al nio a dar sentido a la realidad de la muerte. momento y contemple un cambio fsico drstico. Responderemos de manera
clara y sincera a sus preguntas.
3. Qu pasa si no se celebra ninguna despedida?
Siempre es conveniente hacer una despedida. A veces no es posible por el tipo 10. Cundo debo llevar a un nio a terapia?
de muerte, la imprevisin de la misma o las circunstancias. En ese caso no pasa Cuando veamos que, debido al duelo, se ha visto interrumpida o daada
nada, podemos recurrir a homenajes privados y despedidas simblicas. WIVMEQIRXIEPKRjVIEHIWYZMHE]EWIEIRIPjQFMXSWSGMEPEGEHqQMGSTIVWSREP
o familiar.
4. Debo explicarle a mi hijo un suicidio o es preferible ocultrselo?
Lo ms importante en estas situaciones es la honestidad. Es preferible que se 5YMIVSLEGIVYRLSQIRENIUYqGSWEWTYIHSYXMPM^EVGSQSMHIEW#
entere por personas cercanas a rumores o terceras personas. Abordarlo les Algunas de las ms habituales son: cartas, canciones, dibujos o poesas en
protege del aislamiento de momentos importantes. Debemos aclararles las memoria del fallecido; un lbum o caja de recuerdos; escribir un diario; visitar
causas de la muerte y las responsabilidades. sus lugares especiales; una suelta de globos o plantar un rbol en su memoria.

'zQSPII\TPMGzUYIRSGSRSGMzETSVUYIQYVMzERXIWHIUYIqPREGMIVE#
Le explicaremos que el ser querido falleci antes de que l naciera, que form

192 193
Bibliografa
LIBROS DE CONSULTA

 Albo, P. y Auladell, P. (2009). -RqW%^YP Barcelona: Thule Ediciones.

 %PPIR6;]+VMTTS(  'YERHSJEPXERQEQjSTETj. Un libro para consolar a

los nios. Madrid: Editorial San Pablo.

 &EOIV.7IHRI]1]+VSW)  4W]GLSPSKMGEPXEWOWJSVFIVIEZIHGLMPHVIR. American

.SYVREPSJ3VXLSTW]GLMEXV]

 Barreto, P. y Soler, C. (2007). Muerte y duelo. Madrid: Sntesis.

 &EYIV.  El ngel del abuelo.7EPEQERGE0zKYI^)HMGMSRIW

 &E[MR1],IPPMRKW'  El abuelo de Tom ha muerto. Barcelona: Editorial Esin.

 &S[PF].  0ETqVHMHEEJIGXMZE8VMWXI^E]HITVIWMzR. Buenos Aires: Editorial Paids.

 &S[PI]8]4YHEPSZ2  Jack y la muerte. Pontevedra: Editorial OQO.

 &YRREK8].EYQI)  El arco iris de la abuela. Barcelona: Editorial La liebre de

QEV^S

 Canals, M. y Aguilar, S. (2011) 1MEQMKEMRZMWMFPI. Barcelona: Salvatella Editorial.

 Carrier, I. (2009). )PGE^SHI0SVIR^S&EVGIPSRE)HMXSVMEP.YZIRXYH

 Clark, L. (2008). 'zQS E]YHEV E YRE TIVWSRE GSR WuRHVSQI HI (S[R E EJVSRXEV PE

IRJIVQIHEHXIVQMREP]PEQYIVXIHIYRWIVUYIVMHS 6IZMWXE7uRHVSQIHI(S[R 

126-131.

 Cobo Medina, C. (1999). )PZEPSVHI:MZMV )PSKMS]6E^zRHIPHYIPS. Madrid: Ediciones

Libertarias.

 Durn, A. y Gliori, D. (2003). 4EVE7MIQTVI Barcelona: Editorial CEAC.

195
 )VPFVYGL;  El pato y la muerte. Barbara Fiori Editora.  Mundy, M. (2010). 'YERHS JEPPIGI YR WIV UYIVMHS +YuE TEVE RMySW ERXI PE QYIVXI HI

 (IPE,IVVjR+EWGzR%]'SVXMRE7IPZE1  La muerte y su didctica. Manual alguien. Madrid: Editorial San Pablo.

TEVE)HYGEGMzR-RJERXMP4VMQEVME]7IGYRHEVME. Madrid: Editorial Universitas, S.A.  Munilla, E. (2013). 4WMGSTEXSPSKuE-RJERXMP4VITEVEGMzR4WMGzPSKS-RXIVRS6IWMHIRXIMadrid:

 (IPE,IVVjR+EWGzR%+SR^jPI^-2EZEVVS1.&VEZS7]*VIMVI:  Todos Editorial Guillermo Cnepa.

PSWGEVEGSPIWWIQYIVIRWMIQTVI#'zQSXVEXEVPEQYIVXIIRIHYGEGMzRMRJERXMP Madrid:  1YyM^0zTI^.  )PZMSPuRHI4E^PW Madrid: Syllabus ediciones.

Ediciones de la Torre.  Neimeyer, R. (2002). %TVIRHIVHIPETqVHMHE9REKYuETEVEEJVSRXEVIPHYIPS. Barcelona:

 ,MKLQEVO'EVMRK*SYRHEXMSREl nio que est en duelo en el aula. Editorial Paids.

 *IVVjRHM^)  El abrigo de Pupa. Barcelona: Thule Ediciones.  2yI^4IVIMVE']:EPGjVGIP6  Emocionario. Madrid: Palabras Aladas.

 *MSVMRM..]1YPPIR.%  'SYRWIPMRKGLMPHVIRERHEHSPIWGIRXWXLVSYKLKVMIJERHPSWW  Olshaker, B. (2002). Cmo se lo decimos a los nios? Ed. Medici.

Champaign, IL: Research Press.  Pays, A. (2010). 0EWXEVIEWHIPHYIPS4WMGSXIVETMEHIHYIPSHIWHIYRQSHIPSMRXIKVEXMZS

 Gil Vila, M. y Pirola, M. (2007). El jardn del abuelo. Barcelona: Editorial Bellaterra. relacional. Barcelona: Ediciones Paids.

 ,YMWQER4IVVMR)  La muerte explicada a mi hija. Barcelona: El Aleph Editores.  Pea, L. y Montaa, C. (2005). 1ERINSHIPHYIPSIRRMySWHIWHIIPIRJSUYIGSKRMXMZS

 Ibarrola, B. (2006). Cuentos para el adis. Madrid: Ediciones SM. conductual. En V.E. Caballo y M.A. Simn (Coords). Manual de psicologa clnica infantil

 .EQIW.;*VMIHQER6]0ERHSR0  'YERHSPSWRMySWWYJVIR. Madrid: Editorial y del adolescente. Madrid: Pirmide

0SWPMFVSWHIP'SQMIR^S  4SGL'],IVVIVS3  0EQYIVXI]IPHYIPSIRIPGSRXI\XSIHYGEXMZS6II\MSRIW

 .IJJIVW3  )PGSVE^zR]PEFSXIPPE. Mjico: Fondo de cultura econmica. XIWXMQSRMSW]EGXMZMHEHIWBarcelona: Ediciones Paids.

 /VSIR;'  'zQSE]YHEVEPSWRMySWEEJVSRXEVPETqVHMHEHIYRWIVUYIVMHS9R  Ramn, E. y Osuna, R. (2003). 2S IW JjGMP TIUYIyE EVHMPPE Pontevedra: Kalandraka

manual para adultos. Barcelona: Ediciones Oniro, S.A. Editorial.

 Kbler-Ross, E. (2005). Los nios y la muerte. Barcelona: Ediciones Lucirnaga.  Ramos, R. (Coordinador) (2009). 1ERYEP 0EW IWXVIPPEW JYKEGIW RS GSRGIHIR HIWISW

 1IMRHIVXW/].IGOOIVW,  La balada del rey y la muerte. Buenos Aires: Adriana Madrid: TEA ediciones.

,MHEPKS)HMXSVE  6SHVuKYI^ 4 +EWWIX ( ](IPE,IVVjR%   (MWIyS ETPMGEGMzR]IZEPYEGMzRHI

 Mundy, M. (2001). Cuando estoy triste. Ante la prdida de un ser querido. Madrid: Editorial un programa de educacin para la muerte dirigido a personas adultas con discapacidad

San Pablo. intelectual. Revista Iberoamericana de Educacin, 63, 199-219.

196 197
 6SHVuKYI^ 4 ] (I PE ,IVVjR %   Y si me muero... HzRHI IWXj QM JYXYVS# PGINAS WEB

Hacia una educacin para la muerte en personas con discapacidad intelectual. Revista  7IWEQI7XVIIX[[[WIWEQIWXVIIXSVK

Educacin XXI, 16 (1), 329-50.doi: 10.5944/educxx1.16.1.729.  %]YRXEQMIRXS HI +PEWKS[ 'zQS EXIRHIV PE TqVHMHE ] IP HYIPS 9R EFSVHENI

 Rugg, S. (1997). 0SWVIGYIVHSWZMZIRIXIVREQIRXI 9RPMFVSHIVIGYIVHSWTEVEPSWRMySW escolar % [LSPI WGLSSP ETTVSEGL XS WYTTSVXMRK PSWW ERH FIVIEZIQIRX :

EMKMHSWTSVYREQYIVXI))994YFPMGEHSTSV7LEVSR6YKK0'7; LXXTW[[[KSSHPMJIHIEXLKVMIJSVKYOGSRXIRXVIWSYVGIW;LSPIC7GLSSPC

 6YM^12]7EMR^*  %poyo en el proceso de duelo de personas con discapacidad Approach_to_LossAndBereavement).pdf

intelectual. 6IGYTIVEHS HI LXXT[[[EWSGMEGMSRGISQSVKJIETW*IETW(SGYQIRXSW27  %WSGMEGMzR 'LMPHPMJI ,EFPEV GSR PSW RMySW WSFVI QSVMV ] WSFVI PE QYIVXI

F/16ff1b3f4ba7bdb5c1256bec0056f493/dddb2979a1e7d585c12578fe003361fc/$FILE/ 8EPOMRK XS GLMPHVIR EFSYX HIEXL ERH H]MRK  LXXT[[[GLMPHPMJISVKPIW

Apoyoalduelo_pdi.pdf 8EPOMRK[MXL'LMPHVIREFSYX(IEXLERH(]MRKTTX

 Santamara, C. (2010). El duelo y los nios. Cantabria: Editorial Sal Terrea.  1SVIRS 1YyS^ 8 4VIZIRGMzR HI HYIPS GSQTPMGEHS IR RMySW +YuE HMHjGXMGE)P

 Teckentrup, B. (2013). El rbol de los recuerdos. Nube ocho ediciones. camino en el duelo: http://helvia.uco.es/xmlui/bitstream/handle/10396/13474/

 8M^zR .   4qVHMHE TIRE HYIPS :MZIRGMEW MRZIWXMKEGMzR ] EWMWXIRGME Barcelona: 8IVIWE 1SVIRS 8*1  4VIZIRGMSR (' 2M ' &SW

Fundaci Vidal i Barraquer y Ediciones Paids. pdf?sequence=1

 Turner, M. (2004). 'zQSLEFPEVGSRRMySW]NzZIRIWWSFVIPEQYIVXI]IPHYIPS Gua para  Asociacin Childgrief.El duelo en nios. Cmo ayudarles tras una muerte 2EZMKEXMRK

padres. Barcelona: Ediciones Paids. GLMPHVIRW KVMIJ ,S[ XS LIPT JSPPS[MRK E HIEXL : http://childgrief.org/documents/

 Verrept, P. (2000). Te echo de menos. &EVGIPSRE)HMXSVMEP.YZIRXYH ,S[XS,IPTTHJ

 ;MPH1]&VSSOW6  Nana Vieja. :IRI^YIPE)OEVq  Estadios del desarrollo y reacciones de los nios ante el duelo: http://asbury.dpsk12.

 ;SPJIPX%   'SRWINSWTEVENzZIRIWERXIIPWMKRMGEHSHIPEQYIVXI Barcelona: SVK[TGSRXIRXYTPSEHW(IZIPSTQIRXEP7XEKIWSJ+VMIJTHJ

Editorial Diagonal.  *EMV ,STI ,SWTMGI %]YHEV E PSW RMySW ] EHSPIWGIRXIW E IRXIRHIV ] EXVEZIWEV

 ;SVHIR .;   El tratamiento del duelo: asesoramiento psicolgico y terapia. el duelo ,IPTMRK 'LMPHVIR ERH 8IIRW 9RHIVWXERH ERH 0MZI 8LVSYKL +VMIJ :

Barcelona: Ediciones Paids. LXXT[[[JEMVLSTILSWTMGISVKTHJ,IPTMRKC'LMPHVIRCERHC8IIRWC9RHIVWXERHC

 =EPSQ-  Psicoterapia Existencial. &EVGIPSRE)HMXSVMEP,IVHIV and_Live_Through_Grief.pdf

 =EPSQ-  Mirar al sol. La superacin del miedo a la muerte. Emec Editores.

198 199
 ,SWTMGI SJ 7ERXE 'VY^ 'SYRX] 'zQS E]YHEV E PSW RMySW E IRXIRHIV IP HYIPS

,IPTMRK GLMPHVIR XS YRHIVWXERH KVMIJ  LXXT[[[LSWTMGIWERXEGVY^SVK[TGSRXIRX

YTPSEHW,IPTMRK'LMPHVIR9RHIVWXERH+VMIJ*MREPTHJ

 'SQQYRMX] ,IEPXL ;SVO 0SW RMySW XEQFMqR WI HYIPIR /MHW KVMIZI XSS :

LXXTW[[[IGSQQYRMX]GSQWMXIWHIJEYPXPIWYTPSEHW/MHW+VMIZI8SS

booklet.pdf

 NAPEP 2EXMSREP%WWSGMEXMSRSJ4VMRGMTEP)HYGEXMSREP4W]GLSPSKMWXW . Duelo y prdida

0SWW
 &IVIEZIQIRX  LXXT[[[RETITSVK0SWW 
 FIVIEZIQIRX 

guidance.pdf

 Universidad de Toronto.Duelo y prdida: Un abordaje prctico +VMIJ


&IVIEZIQIRX

% TVEGXMGEP ETTVSEGL  LXXT[[[GTHYXSVSRXSGEIRHSMJI7PMHIW448 +VMIJ 

ERH &IVIEZIQIRXTHJ

 NCTSN. : http://nctsn.org/nctsn_assets/pdfs/reports/media_package.pdf

 Cleveland Clinic. Comprender la muerte, el duelo y el luto 9RHIVWXERHMRKHIEXL

KVMIJ ERH QSYVRMRK  https://my.clevelandclinic.org/ccf/media/Files/bereavement/

understanding-death-grief-mourning-resources-manual.pdf?la=en

 -S[E'MX],SWTMGI'YERHSPEQYIVXISGYVVI'zQSTVSTSVGMSREVETS]SIQSGMSREP

positivo a los nios ;LIRHIEXLLETTIRW,S[XSTVSZMHITSWMXMZIIQSXMSREPWYTTSVX

JSV GLMPHVIR  LXXTMS[EGMX]LSWTMGISVK[TGSRXIRXYTPSEHW;LIR(IEXL

,ETTIRWTHJ

200
o rg
m lc.
on
ci
n da
w . fu
ww

Primera edicin: Octubre de 2016


Edicin no venal
Fundacin Mario Losantos del Campo (FMLC)

Fundacin Mario Losantos del Campo


Avda. Espaa, 17 2a planta 28100 Alcobendas (Madrid)
Tel.: (+34) 91 229 10 80 Fax: (+34) 91 229 10 79
[[[JYRHEGMSRQPGSVK
fundacionmlc@fundacionmlc.org

Printed in Spain - Impreso en Espaa

Autora:
Patricia Daz Seoane
Coordinacin y correccin:
FMLC
Diseo y maquetacin:
Gema Gorjn
Ilustraciones:
Malagn

Impresin:
$UWHV*UiFDV7LHPSRGH3URGXFFLyQ
C/Povedilla 11
28009 Madrid

Con la colaboracin de:


Parcesa Parques de la Paz, S.A.
Servicios funerarios 24h.
Tel: 91 806 18 00
[[[TEVGIWEIW