You are on page 1of 120

MODUL

SASTRA LISAN
KODE MK SIN.D.04
TIM PENYUSUN

PROGRAM STUDI SASTRA INDONESIA
FAKULTAS SASTRA
UNIVERSITAS PAMULANG
Jl. Surya Kencana No. Pamutang Barat, Tangerang Selatan, Banten
Telpon/Fax (021) 7412556

0

BAB I
TRADISI LISAN, SASTRA LISAN, DAN FOLKLOR

Kebudayaan di lndonesia merupakan hal yang tidak dapat lepas
dari tradisi. Tradisi itu sendiri bukanlah hal yang sudah selesai dan
berhenti, melainkan merupakan suatu hal yang masih ada dan terus
berkembang. Tradisi ini berkembang mengikuti arus perubahan sosial,
namun perubahan yangterjadi tidaklah melencengjauh dari akarnya.
Tradisi tetap menjadi seni tradisi bagi masyarakat setempat yang
mengalaminya.
Tradisi lisan telah berkembang di lndonesia sebelum masyarakat
lndonesia mengenal aksara. Tradisi lisan pada awalnya subur dan
berkembang di seluruh nusantara dan menjadi salah satu kekayaan
budaya masyrakat lndonesia. Setelah aksara masuk ke nusantara, tradisi
lisan tidak hilang, tetapi berkembang beriringan dengan tradisi tulisan.
Tradisi lisan menurut B.H. Hoed adalah berbagai pengetahuan dan
adat kebiasaan yang secara turun-temurun disampaikan secara lisan yang
mencakup tidak hanya cerita rakyat, mitos, dan legenda, tetapi juga
dilengkapi dengan sejarah, hukum adat, dan pengobatan. Hal-hat yang
terkandung dalam suatu tradisi lisan adalah hal-hal yang terlahir dan
mentradisi dalam suatu masyarakat yang merupakan warisan nenek
moyang. Pada dasarnya, suatu tradisi dapat disebut sebagai tradisi lisan
jika tradisi tersebut dikatakan (oleh penutur) dan didengar (oleh
penonton).
Hal-hal penting yang perlu diperhatikan dalam tradisi lisan adalah
sastra, antropologi, dan sejarah. Tradisi lisan tentu tidak akan lepas dari
sastra. Tradisi lisan juga erat kaitannya dengan antropologi karena
berhubungan dengan masyarakat dan kebudayaan di suatu daerah.
Tradisi lisan juga tidak dapat lepas dari sejarah karena tradisi merupakan
hal yang diwariskan secara turun temurun. ltu berarti tradisi lisan tentu
berhubungan dengan masa lalu atau sejarah suatu daerah.

1

Sastra lisan merupakan salah satu bagian dari tradisi lisan. Sastra
lisan disebarkan dari satu orang ke orang lain secara lisan kemudian
prosesnya dilihat, didengar, kemudian dilisankan kembali. Jadi, yang
dilihat dalam tradisi lisan adalah proses dan hasil melisankan.
Orang-orang sering salah paham mengira teknik lisan sebagai
sastra Lisan. Teknik lisan dilakukan saat musikalisasi puisi atau
pembacaan puisi. Teknik lisan tidak mernengaruhi proses penciptaan-
dalam hal ini, misalnya, musikalisasi puisi-saat ditampilkan. Saat
ditampilkan, proses penciptaan sudah selesai sehingga penonton atau
pendengar tidak dapat memengaruhi proses penciptaan. Teknik lisan
adalah salah satu contoh sastra yang dilisankan, seperti orang yang
mendongeng dan orang yang berpantun.
Selain tradisi lisan dan sastra lisan, satu lagi bidang yang
berhubungan dengan kelisanan adalah folklor. Dalam KBBI Edisi
Keempat, folklor adalah adat-istiadat tradisional dan cerita rakyat yg
diwariskan secara turun-temurun, tetapi tidak dibukukan. Pengertian
kedua adalah ilmu adat-istiadat tradisional dan cerita rakyat yg tidak
dibukukan. Menurut Dundles, folktor adalah kebudayaan yang diturunkan
secara turun temurun oleh sekelompok masyarakat atau dalam suatu
komunitas yang kolektif. lni berkaitan dengan pengertian folk yang berarti
komunitas yang kolektif dan lore yang berarti tradisi yang diturunkan
secara turun temurun.
Ciri-ciri folklor adalah anonim, berkembang dari versi yang
berbeda-beda, dan mewakili suatu kelompok masyarakat tertentu. Fungsi
folklor adalah sebagai hiburan, media penyampaian nilai-nilai sosial, dan
representasi masyarakat atau proyeksi dari keinginan masyarakat. Selain
itu, fungsi folklore lainnya adalah menyebarkan ajaran atau pranata
kebudayaan dan alat penguasa untuk memaksakan aturan-aturan masuk
dan diterima ke dalam masyarakat.
Untuk membedakan tradisi lisan, sastra lisan, dan folklor secara
jelas, sebaiknya kita metihat contohnya. Karena sastra lisan adalah

2

bagian dari tradisi lisan, semua yang kita sebut sastra lisan pasti juga
merupakan tradisi lisan. Didong adalah sastra lisan karena disebarkan dari
satu orang ke orang lain secara lisan dan proses pembuatan atau proses
kreatifnya didengar dan dilihat oleh penontonnya. Jadi, Didongjuga
merupakan tradisi lisan.
Perlu ditekankan kembali bahwa tidak semua yang termasuk ke
dalam tradisi lisan merupakan sastra lisan. Di Dalam tradisi lisan juga
terdapat dongeng, mitos, dan lain-lain yang tidak dapat dikategorikan ke
dalam sastra lisan karena proses kreatifnya tidak disaksikan langsung
oleh penonton. Dalam hal ini, yang masih menjadi pertanyaan saya
adalah apakah folklor juga termasuk ke Dalam tradisi lisan? Pertanyaan
tersebut muncul karena dalam pengertian folklor menurut Dundles tidak
disebutkan mengenai tradisi yang dilisankan. Dengan kata lain, saya
menangkap bahwa di dalam folkior tidak hanya terdapat tradisi dalam
bentuk lisan tetapi juga tradisi Dalam bentuk tulisan.
Di dalam folklor terdapat tarian, permainan, dan lain-lain yang
seluruhnya bersifat tradisional. Saya akan mengambil contoh wayang.
Wayang berkembang sangat pesat di Jawa. Walaupun cerita yang
diangkat berasal dari lndia-Ramayana dan Mahabharata-isi ceritanya
disesuaikan dengan masyarakat Jawa sehingga muncullah tokoh
Punakawan. Saya memasukkan wayang ke dalam salah satu contoh
folklor karena wayang mewakili suatu kelompck masyarakat tertentu,
dalam hat ini masyarakat Jawa. Akan tetapi, sebenarnyawayarrg-mewakii
kelompok masyarakat yang lebih kecil lagi karena wayang di daerah
Surakarta dengan wayang di daerah Sunda memiliki perbedaan. Tokoh
Cepot hanya terdapat di dalam wayang daerah Sunda.
Di samping itu, fungsi wayang adalah sebagai hiburan dan media
penyampaian nilai-nilai sosial. Tokoh Punakawan yang hanya terdapat di
wayang Jawa juga merupakan salah satu fungsi folklor sebagai proyeksi
dari keinginan masyarakat karena tokoh Punakawan sangat khas dengan
masyarakat Jawa. Tokoh Semar yang digambarkan sebagai rakyat jelata

3

sekaligus dewa dari segala dewa merupakan gambaran dari keinginan
masyarakat Jawa yang mayoritas merupakan kalangan menengah ke
bawah. Secara tidak langsung, masyarakat jawa ingin menunjukkan
bahwa rakyat jelata dapat mengalahkan penguasa mana pun.
lnilah sedikit pengertian dan contoh yang dapat menjadi pembeda
dalam tradisi lisan, sastra lisan dan folklor. Untuk dapat membedakan
ketiganya lebih jauh, tentu dibutuhkan lebih banyak contoh dan sumber
tertulis. Secara singkat, hal yang membedakan sastra lisan dari tradisi
lisan adalah bahwa sastra lisan dilisankan dan proses kreatif dan
pelisanannya dilihat oleh penontonnya, sedangkan folklor mencakup tidak
hanya lisan, tetapi juga tulisan. Di dalam tradisi lisan terdapat sastra lisan.
Mengenai apakah folklor juga termasuk di dalam tradisi lisan masih perlu
dilakukan pencarian sumber lebih lanjut.

Kerangka Studi Sastra Lisan di lndonesia
Patut diakui bahwa kesadaran untuk memahami sastra dan
kebudayaan lisan merupakan perkembangan yang relatif baru, termasuk
juga di dunia Barat (Sweeney, 1987: 279). llmuwan abad ke-19 kurang
memahami kebudayaan lisan itu. Teks lisan misalnya, dipandang sebagai
tulisan yang tidak tertulis (unwritten writing) yang kemudian ditulis, dan
pada akhirnya mencapai bentuk standar yakni prosa atau puisi tulisan
yang gramatik. Tradisi Lisan dipandang sebagai produk non-baku.
Hambatan-hambatan keilmuan yang di ungkapkan di atas
sesungguhnya merupakan wacana Barat yang bersifat teoritis dan bahkan
artifisial untuk situasi sastra di lndonesia. Berdasarkan penelitian yang
dilakukan oleh Milman Parry, Albert B. Lord, Amin Sweeney, dan Walterj.
Ong, Teeuw (1988a: 304-310;454-456) menyimpulkan secara
meyakinkan, bahwa khusus untuk teori sastra lndonesia tidak perlu dan
tidak baik diadakan pemisahan antara sastra lisan dan sastra tulis.
Menurut Teeuw, penggabungan sastra lisan dan sastra tulisan
dalam suatu kerangka teori saja justru merupakan hal yang penting dan

4

perlu dijadian frame of reference dalam memahami sastra se-Indonesia.
Ada empat faktor utama yang mendasari kesimpulan Teeuw tersebut di
atas. Keempat faktor itu adalah:
1. Ada kesamaan hakiki dalam struktur dan motif antara sastra lisan dan
sastra tulisan, sebagaimana tampak dalam Penelitian Manssers atas
penyebaran motif Panji. Selain itu Penelitian Fox pun menunjukkan
kesamaan struktur antara cerita geneatogik lisan Roti dengan teks
tulis seperti Sejarah Melayu, Pararaton, di Jawa dan Bali. Menurut
Teeuw, prinsip Bhineka Tunggal lka berlaku pula untuk sastra.
2. Prinsip variasi sebagai hal yang essensial dalam sastra tisan, ternyata
retevan pula untuk sastra tulis di Indonesia. Penelitian filologi
membuktikan, bahwa tradisi penurunan naskah di tndonesia selalu
memperlihatkan perbedaan variasi yang besar sekali. Kiranya ada
persamaan gaya antara tukang cerita dengan gaya penyalin naskah,
bahkan juga dengan gaya penyunting, penyadur, dan tukang set
dalam bidang tekstologi buku.
3. Ada kaitan antara sastra lisan dan sastra tulis dalam fungsi sastra
sebagai performing art. Sastra tulis di lndonesia ternyata berfungsi
dalam situasi sosiat (guyub), dan sering secara normal dibacakan
bersama, dengan segala konsekuensi untuk teknik, struktur dan
fungsinya. Penelitian sastra yang tidak memper-hitungkan unsur ini
mungkin sekali akan keliru dalam memahami sastra tulis secara baik.
Dalam hal edisi teks, H. Kern mengatakan bahwa norma terpenting
adalah jumlah suku kata, sehingga proses pemugarannya harus
mengikuti standar jumlah suku kata dan matra.
4. Dalam sastra lndonesia modern, ternyata fungsi sastra sebagai
performing art masih menduduki peranan yang penting. Aspek
improvisasi dalam penulisan dan pementasan, di samping
menggejalanya kebiasaan poetry readings menunjukkan hal tersebut
(Teeuw, 1988a: 304-310).

5

kebudayaan tulisan. Teeuw (1988a: 304-310. aspek kebudayaan lisan primer dalam bentuk pemikiran-pemikiran formulaik masih dipergunakan dalam berbagai situasi. Dalam situasi kebudayaan seperti ini. dapat dikatakan bahwa untuk situasi sastra di lndonesia tidak diPerlukan kerangka teori khas sastra lisan. Penelitian-penelitian filologi antara lain menghasilkan kesimpulan. Kesimpulan ini diperkuat lagi oleh pandangan Teeuw lainnya. 6 . bahwa berbagai bentuk folklor berkaitan erat dengan formula dan gaya penulisan dalam manuskrip-manuskrip. Pembedaannya bahkan akan membawa akibat negatif dalam memahami hakikat sastra lndonesia. aspek- aspek kebudayaan lisan primer masih dipergunakan. dan kebudayaan lisan sekunder. dalam bidang penulisan pun. 1988b: 454-456) mengemukakan bahwa kebudayaan yang kini hidup di lndonesia adalah campuran antara kebudayaan lisan primer. Pertemuan sastra lisan dan sastra tulisan (manuskrip dan buku) dalam lingkup budaya Nusantara sudah tercermin dalam berbagai studi fitologi dan sastra umum. lronisnya. Berdasarkan berbagai studi terhadap kesusastraan lndonesia selama ini. Berdasarkan uraian di atas.

Heddy Shri Ahimsya-Putra (1966) mengatakan bahwa sebagai suatu bentuk ekspresi budaya masyarakat pemiliknya. sebagai salah satu data budaya sastra lisan dapat dianggap sebagai pintu untuk memahami salah satu atau mungkin keseluruhan unsur kebudayaan yang bersangkutan. Dalam perjalanannya sastra lisan menemukan tempat dan bentuknya masing-masing di tiap-tiap daerah pada ruang etnik dan suku yang mengusung flok budaya dan adat yang berbeda-beda. Ketiga tradisi yang berbeda-beda tersebut tentunya sangat mewarnai sejarah perkembangan sastra di Indonesia khususnya sastra lisan. Namun. 7 . sastra lisan tidak hanya mengandung unsur keindahan (estetik) tetapi juga mengandung berbagai informasi nilai-nilai kebudayaan tradisi yang bersangkutan. cukup panjang. Satu pengaruh tradisi cina yang masuk melalui jaiur perdagangan kemudian pengaruh lndia atau Hindu-Budha yang saat itu merupakan agama yang dianut sebagian besar kerajaan-kerajaan di Indonesia. Baik sastra lisan maupun sastra tulisan mempunyai peranan penting dalam sejarah perkembangan kesusastraan Indonesia. Oleh karenanya. Ditambah dengan sumbangan kebudayaan Arab-lslam yang dibawa oleh para musafir. a. Sastra Lisan Dalam khazanah kesusastraan Melayu kuno tradisi sastra lisan baik syair maupun prosa merupakan kekhasan corak tersendiri yang memiliki retasi lajur sejarah yang. yaitu sastra lisan dan sastra tulisan. BAB II SASTRA LISAN DAN SASTRA TULISAN Dalam khazanah kesusastraan lndonesia terdapat dua penggolongan besar sastra. Sastra lisan telah bertahan cukup lama dalam mengiringi sejarah bangsa tndonesia dan menjadi semacam ekspresi estetik tiap- tiap daerah dan suku yang tersebar di seluruh nusantara.

Sastra Tulisan Sastra tulisan (written /iterature)yaitu sastra yang menggunakan rnedia tulisan atau literat. Menurut Ayu Sutarto (2004) dan Daniel Dakhidae (1996) tradisi sastra lisan menjadi penghambat bagi kemajuan bangsa. Ditambah lagi oleh arus modernisasi yang masuk dan membawa corak kebudayaan baru. Pendapat ini mungkin tidak keliru. Hal ini mulai berkembang ketika muncul anggapan bahwa sastra tulis mempunyai nilai yang lebih tinggidibanding sastra lisan dalam konteks pembangunan kepribadian bangsa yang lebih maju. tradisi lisan harus diubah menjadi tradisi menulis. seiring dengan perkembangan zaman. 8 . Berdasarkan penemuan prasasti bertuliskan huruf Pallawa peninggalan kerajaan Sriwijawa di Kedukan Bukit (683) Tatang Tuo (684) Kota Kapur (686) dan Karang Berahi (686). Menurut Sulastin Sutrisno (1985) awal sejarah sastra tulis melayu bisa dirunut sejak abad ke-7 M. tetapi prasasti-prasasti yang merupakan benda peninggalan sejarah itu dapat disebut sebagai cikal bakal lahirnya tradisi menulis atau sebuah bahasa yang dituangkan dalam bentuk tulisan. b. dalam khazanah kesusastraan modern lndonesia baik dalam ekspresi proses verbal kesastrawanan maupun dalam kajian. sastra tulisan lebih mendimonasi. Maka. Sastra tulis dianggap sebagai ciri sastra modern karena bahasa tulisan dianggap sebagai refieksi peradaban masyarakat yang lebih maju. bukan berarti kita dengan begitu saja mengabaikan atau bahkan meninggalkan tradisi sastra lisan yang sudah mengakar dan menjadi identitas kultural masing-masing suku dan daerah di seluruh kepulauan lndonesia. Tapi. maka posisi sastra lisan dalam masyarakat mulai pudar bahkanhampirdilupakan. Waiaupun tulisan pada prasasti- prasati tersebut masih pendek-pendek. Karena budaya tulis-menulis selalu identik dengan kemajuan peradaban keilmuan.

kemudian mulai menunjukan wujudnya yang lebih nyata pada periode Balai Pustaka yang bisa disebut sebagai tonggak perkembangan sejarah kesusastraan modern lndonesia. Theeuw (1983) bahwa dari segi sejarah maupun tipologi adalah tidak baik jika dilakukan pemisahan antara sastra lisan dan sastra tulis. pada dasarnya dua bentuk sastra ini tidak bisa dipisahkan satu sama lain sebagaimana dalam konsepsi A. Tapi.bidang kesusastraan mulai dikembangkan secara lebih terorganisir. terus berkembang secara lebih luas. yang menunjukan kapan tepatnya tradisi sastra tulis dimulai. religi hingga aspek politik. Keduanya harus dipandang sebagai kesatuan dan keseluruhan sehingga tidak boleh 9 . seperti yang sudah disinggung sebelumnya bahwa sastra lisan mempunyai akar yang berkaitan erat dengan sejarah bangsa lndonedia baik aspek sosio-kultural. bagaimanapun proses Pertumbuhan sastra akan mengarah dan berusaha menemukan bentuk yang lebih maju dan lebih sempurna sebagaimana terjadi pada bidang yang tainnya. proses pergeseran dari tradisi sastra lisan menuju sastra tulisan tidak dapat dihindari. Karena proses perubahanseperti ini merupakan sebuah keniscayaan terutama dalam struktur masyarakat yang dinamis. pada periode berikutnya. c. Jadi. Dan. Kedudukan Sastra Lisan dan Sastra Tulisan Sejatinya baik sastra lisan maupun tulisan masing-masing mempunyai kedudukan yang sama-sama penting dalam perkembangan sastra di lndonesia. Walaupun pada kenyataannya sastra lisan sering kali dianggap sudah tidak relevan lagi dengan perkembanfan zaman. Dimana dengan lahirnya penerbit pertama di lndonesia ini. Pada akhirnya. Karena sadar atau tidak. yaitu pada periode Pujangga Lama. Sastra tulis yang tercarat dalam sejarah kesusastraan lndonesia-mungkin bisa dikatakan dimulai sejak sebelum abad ke-20. moral. Belum ditemukan data yang pasti. Dan.

1989: 361). Jika sambutan ini diberikan makajenis itu telah mendudukiarus utama tradisi sastra. Jika tidak. Mukarovsky (1978: 5) mengungkapkan bahwa setiap karya seni.dan pengembangan. yang berproses secara lamban untuk menjadi genre yang official (Guillen. tetapi juga yang bersifat eksternal. 10 . intelektual. karena keinginan mencari pengucapan baru. Tidak ada karya seni yang bukan bagian dari arus ini. genre tersebut mendapat sambutan dari masyarakat sastra. 1971:125). Dalamteori sastra masalah sistem konvensi seringkali dipandang sebagai salah satu masalah pokok. bagaimanapun originalnya.lebih mengutamakan satu dari pada yang lain. ltu pula sebabnya mengapa Rene Wellek menyebut jenis sastra sebagai Iernbaga sastra yang memaksa sastrawan mematuhi hukum-hukum yangtelah ditentukan. dan perubahan budaya lainnya (Wellek. sekalipun ada karya seni yang kelihatannya agak sukar diperhitungkan hubungannya dengan arus kesinambungan tersebut. Perubahan dapat terjadi secara internal. pengenalan dan pemberian makna oleh pembaca. menciptakan kejutan baru. 1983: 20-21). Karena pada hakikatnya sastra Iisan merupakan sumber utama bagi penciptaan sastra tulisan sebagaimana sastra lama merupakan penunjang lahirnya sastra modern. dua jenis karya sastra ini seyogianya saling mendukung dan melengkapi untuk lebih memperkaya khazanah kesusastraan bangsa. Perubahan-perubahan ini sesuai dengan hakikat pelembagaan sebuah genre sastra. Jelaslah di sini peranan atau fungsi sistem konvensi sastra yang merupakan alat yang memhataskan dan mengarahkan kemungkinan pemberian makna yang sesuai terhadap sebuah karya sastra (Teeuw. menjadi inner circle. sebab sistem konvensi sastra sangatlah menentukan kemungkinan identifikasi. Konvensi-konvensi sastra tidak pernah kaku dan statis melainkan selalu dalam proses perubahan. Maksudnya. Sebaliknya. tetap menjadi bagian arus kesinambungan sepanjang masa. yakni disebabkan oleh perubahan sosial.

HaI itu terlihat.yang tidak berasal dari konvensinya sendiri. Budi Darma dan Danarto tetap berada di luar lingkaran pernovelan lndonesia. puisi. Adaptasi khazanah puisi lisan dalam puisi lndonesia modern terasa Iebih dinamis dan prospektif. ltulah sebabnya novel-novel absurd seperti karya Iwan Simatupang. dan lebih gampang pula menerima kebaruankebaruan yang asing. Perkembangan novel lndonesia moderntampaknya berjalan lebih Iamban. 1. sampai sekarang. Dari ikhtisar mengenai. segar. Kehidupan pujsi Indonesia modern akan lebih bhineka tunggal ikajika berbagai tradisi puisi lisan Nusantara Iainnya dikaji dan dipergunakan sebagai idiom atau sumber inspirasi bagi para seniman Indonesia. tampak bahwa Perkembangan cerpen dalam sastra Indonesia modern lebih cepat. Arus utama novel lndonesiamasih bertahan dalam konvensi tradisional dan sukar menerima kebaruan-kebaruan yang asing. jernih. Dalam hal teknik.makaia berada di lingkaran luarsebagai arus pinggiran yangtidak pernah berhasil masuk ke lingkaran inti. Bahkan sastra lisan dalam bentuk aslinya dapat menjadi wadah untuk mengekspresikan jiwa kebudayaan lndonesia baru. cerpen dan novel di atas. Dalam bidang cerpen. kita dapat melihat Perkembangan arus kesusastraan lndonesia modern dalam kaitan dengan sastra lisan dan sastra daerah sebagai berikut. tidak menjadi official. Di Iain pihak. Berbeda dengan cerpen. optimistis dan sederhana tidak memasuki arus utama penulisan cerpen lndonesia modern. tampak bahwa tradisi Penuturan cerpen yang berakar dari khasanah sastra tradisional lndonesia yang bercirikan jujur. Sebaliknya novel- novel pop bisa memasuki Iingkarari dalam. 2. Putu Wijaya. 11 .jenis novel yangmemasuki inner circle hanyalah novel yang berceritadengan teknik plotnya yang menarik. 3. misalnya dalam KodaKnalan masyarakat Lamaholot (Flores Timur). Bini di Pulau Rote dan Wor dalam masyarakat Biak.

saya menyimpulkan bahwa untuk sebagian. dan penerbitan sastra lisan memang sudah memberi sumbangan yang berarti bagi penulisan sastra lndonesia modern di masa depan. Untuk itu perlu direncanakan secara Iebih serius dan sistematis. memasuki lingkaran inti sastra lndonesia modern. HaI itu akan terjadi apabila sastra lisan dan sastra daerah tidak clipandang sebagai ancaman atau tandingan terhadap sastra nasional. penerjemahan. mulai dari seleksi materi. dokumentasi. pengajaran sastra di sekolah- sekolah formal melalui muatan lokal perlu melibatkan materi sastra lisan dan sastra daerah. Yang diperlukan sekarang adalah redefinisi clan reorientasi kebudayaan nasional agar lebih mencakup dan lebih apresiatif terhadap sastra lisan dan sastra daerah. dan lebih mencerminkan falsafah bhineka tunggal ika. perekaman. dokumentasi dan penerbitan sastra lisan dan daerah secara teratur dan sistematis dan terencana. Dengan berakhirnya era Orde Baru. penyusunan materi pelajaran maupun dalam cara mengajarkannya. Sebaliknya sastra lndonesia modern perlu dipandang sebagai jawaban kolektif yang diberikan kepada perubahan-perubahan yang terjadi di sekitar kita. maka reformasi di bidang politik kebudayaan pun harus dilaksanakan. dan sastra lisan perlu diakui sebagai salah satu wadah pengungkap semangat manusia lndonesia baru. Upaya-upaya sejak awal tahun 1990-an melalui Asosiasj Tradisi Lisan Nusantara (ATL) berupa inventarisasi. 12 . Selain itu. sastra lisan telah dipergunakan sebagai idiom atau sumber inspirasi bagi para seniman Indonesia dalam menciptakan kesusastraan lndonesia modern. Pemerintah lndonesia perlu mempunyai suatu kebijaksanaan yang memberikan dorongan atas upaya inventarisasi. Dengan demikian. Melihat perkembangan yang demikian. dalam beberapa tahun mendatang khazanah sastra lisan dan sastraNusantara dapat memasuki inner circle.

studi sastra lisan dalam rangka ilmu sastra dapat mengungkapkan berbagai segi kemanusiaan secara memadai. pandangan Lefevere. 1977 tentang sastra sebagai existential knowledge. Dengan menempatkan sastra Iisan sebagai sebuah ekspresi fundamentaI dalam mengkristalisasikan pengalaman-pengalaman kemanusiaan (bdk. 13 .

pantun. apakah masih relevan membicarakan sesuatu yang berlabel daerah. Sangat mungkin fakta yang sama terdapat di daerah-daerah lain di wilayah Nusa Tenggara 14 . Guru Besar Ilmu Sastra pada Fakultas Keguruan dan llmu Pendidikan (FKIP) Universitas Tanjungpura Pontianak. agar kandungan sastra lisan itu terinternalisasikan sebagai pedoman bagi hidup mereka dalam menyikapi tantangan kehidupan (Kompas. teka-teki. 12 Mei 2009). Selasa.com. dan ungkapan merupakan jenis-jenis sastra lisan yang pating banyak saya temui ketika berkunjung ke beberapa desa di witayah Timor Barat. dan sebagainya yang kesemuanya merupakan sistem pengetahuan masyarakat. keluh-kesah. Chairil Effendy. Dongeng. Dr. keinginan. sastra lisan merupakan fakta mental yang menggambarkan mimpi-mimpi. Masih relevankah sastra lisan (yang merupakan bagian dari sastra daerah) dalam alam modern ketika orang-orang seakan-akan sedang berlomba-lomba memberi label internasional kepada hampir segala sesuatu (mulai dari terasi hingga sekolah)? Boleh jadi mengutak-atik hal-hal yang berbau daerah dianggap sama dengan mudik ke dusun terpencil karena-urusan mendesak setelah bertahun-tahun menetap di kota besar yang berfasilitas serba luks.S. Definisi Sastra Lisan Menurut Prof. aspirasi. dari generasi ke generasi. cita-cita. seperti sastra lisan. harapan. M. pada zaman semodern ini. Kalimantan Barat. Tulisan ini hanya mengulas sekilas tentang pengamatan penulis terhadap situasi sastra lisan hari ini. BAB III SASTRA LISAN PADA MASA KINI: SEKILAS PANDANG Yohanes Manhitu Barangkali pembaca akan bertanya. Masyarakat pemiliknya mentransmisikan sastra lisan dari waktu ke waktu.

salah satu bahasa daerah mayoritas di Timor Barat (NTT). Tentu semuanya ini dilakukan dalam bahasa Dawan (Uab Meto) . Sepenggal Kisah Berbicara tentang sastra lisan. saya teringat akan kisah masa kecil. Lebih parah lagi kalau mereka sampai dianggap sejajar dengan tukang jual obat 15 . Sambil menunggu hingga singkong matang. Dongeng-dongeng yang diceritakan itu tentu bukan karangan kami sendiri tetapi kami dapatkan dengan gratis dari orang lain. Kenyataan Sekarang Puluhan tahun telah berlalu dan hari ini bukan lagi kemarin. entah dari orangtua kami atau orang-orang dewasa yang gemar mendongeng. Para datuk sastra lisan sepertinya telah kehilangan pengagum dan kehabisan kisah indah yang sanggup menarik minat pendengar mereka. telah terbentuk satu rantai dongeng yang tidak putus hingga generasi kami. perubahan telah terjadi dengan berjalannya waktu. searah perputaran jarum jam. televisi telah mengisi panggung cerita dan tampaknya diyakini sanggup menghilangkan dahaga ingin tahu dengan seribu satu kisah yang tidak jarang membuat benak makin gersang. Setelah berdongeng. Untuk memastikan. Setiap anak laki-laki yang memperoleh kehangatan dari api unggun itu wajib mengisahkan sebuah dongeng secara bergantian. kami lanjutkan dengan berteka-teki. Anak-anak yang tidak bisa berdongeng bertugas membakar singkong untuk para pendongeng. kami mendongeng untuk mengisi waktu. atau asyik membaca komik asing yang laris bagai kacang goreng. saya dan teman-teman SD di salah satu pelosok daerah Dawan duduk melingkari api unggun dan membakar singkong. perlu dilakukan penelitian yang terencana dengan metode yang tepat. ketika di bawah terang bulan purnama. Jadi. Budaya menulis mulai mengemuka dan terus mendesak budaya lisan. yang lebih betah berlama-lama di depan kotak ajaib.Timur.

Padahal menurut konstitusi. hal itu termasuk tanggung jawab pemerintah. 16 . sastrawan Sunda dan Ketua Yayasan Kebudayaan Rancage. Tanggung Jawab dan Langkah-Langkah Pelestarian Pada suatu peristiwa. (5) memasukkan sastra lisan ke dalam kurikulum pendidikan dasar (sebagai muatan lokal). seperti kacang tanah dari ladang sebelah desa yang setelah dikeringkan. merasa prihatin atas keberadaan sastra dan bahasa daerah di lndonesia sekarang ini. Kenyataan ini membuat pelaku sastra lisan kehilangan selera untuk memelihara kisah lama dan mengemasnya dengan sampul baru agar tetap laris. baik pemilik sastra maupun pemerintah. biar dangkal asal mudah dimengerti. Kemarnpuan berpantun daerah bila tidak diasah akan hilang dengan sendirinya. Ragam bahasa pantun yang sangat indah itu tidak akan sampai kepada generasi berikut bila tidak ada minat dan usaha nyata untuk mewariskannya. yang struktur dan maknanya makin sulit dimengerti. dikemas dengan label Kacang Super Gurih dari negeri sebelah. Menuturnya. khususnya para orangtua. Daripada malu karenadisindir dengan ungkapan sok pujangga lu lebih baik berbicara apa adanya saja. Untuk melestarikan sastra lisan. Jadi. kiranya langkah-langkah berikut ini dapat ditempuh: (1) mendongeng kepada anak-anak sejak dini (misalnya ketika sebelumtidur).yang hanya mampu menawarkan kisah-kisah bohong dan kumal yang telah usang dimakan zaman. pemerintah nyaris tak memberi perhatian yang mamadai terhadap kehidupan sastra- sastra daerah tersebut. (2) memperkenalkan pantun dan teka-teki kepada generasi muda dan kalangan umum. Dalam menggunakan bahasa daerah. kita mungkin sudah jarang menghiasi pembicaraan kita dengan pantun. pelestarian dan kelestarian sastra lisan adalah tanggung jawab bersama. (3) mengadakan pelatihan-pelatihan mendongeng kepada berbagai pihak. (4) menyelenggarakan perlornbaan mendongeng dan berpantun. Ajip Rosidi.

dll. Begitu banyak nilai luhur yang terkandung dalam sastra lisan. pantun. tekateki. Hanya insan yang tidak memahami nilai mutiara saja yang akan membiarkan barang berharga ini berceceran dan jatuh ke tangan orang lain. Tentu masih banyak ungkapan kaya makna yang dapai ditemukan dalam bahasa-bahasa daerah lain di NTT. ungkapan. Oleh karena itu. Sastra lisan sebagai bagian dari sastra daerah tetap relevan untuk masa kini dan masa depan karena mengandung nilai-nilai yang tak lekang oleh waktu.Masih Tetap Relevan Kita kembali kepada pertanyaan utama: Masih relevankah sastra lisan dalam alam modern? Sastra lisan adalah kekayaan budaya yang turut membentuk jati diri kita sebagai bangsa beradab. syair-syair lagu daerah. para pemilik sastra lisan dan pemerintah diharapkan selalu bergandengan tangan dalam upaya peiestarian sastra 17 . Kita dapat menggali kembali nilai-nilai itu dari dongeng. ketika kita berhadapan dengan arus globalisasi yang makin deras dan terus menawarkan nilai-nilai baru yang belum tentu cocok dengan kepribadian bangsa kita. Apabila makna ungkapan di atas sungguh-sungguh dijiwai oleh penuturnya. peribahasa. Pada zaman modern ini. sastra lisan sebagai suatu alternatif pencerahan dapat menjadisolusi yang tepat-obat mujarab untuk menyembuhkan penyakit zaman. kisah perjalanan suku. maka kita dapat berharap agar mentalitas instan cepat atau lambat boleh pupus dari masyaraka kita. Kearifan lokal yang terkandung di dalam berbagai jenis sastra lisan yang dikenal luas oleh masyarakat dapat dimanfaatkan untuk mencegah atau mengatasi persoalan dalam masyarakat. Nilai-nilai luhur yang masih relevan untuk zaman ini bertaburan di mana-mana laksana mutiara. Ungkapan timeup onle ate henait tah onle usif (bekerjalah laksana hamba supaya makan seperti raja) dalam masyarakat Dawan adalah salah satu dari khazanah ungkapan daerah yang mengandung kearifan lokal.

yakni: murni pembacaan sastra (mebasan dan macapatan). maupun meditasi-meditasi Tecayahuatzin. kisah petualangan dan heroisme rakyat jelata. tirik-lirik Orpheus. nyanyian pribadi hasil meditasi. mantra-mantra. cerita misteri dan supernatural. makyong. yang berbeda dari epos heroik kelas atas. lirik cinta. dalam banyak sastra lisan dunia. seperti halnya mazmur-mazmur Daud. puisi lisan adalah nyanyian. 1994). Baik puisi lisan maupun prosa lisan Amerika terdapat dalam kesusastraan pribumi seperti puisi 18 . teka-teki. dialog dan tarian pemeran. kisah cinta. Menurut Wiget (lihat Lauter. 1998) menyusun sebuah gradasi dari sastra lisan yang paling murni sastra hingga ke Pertunjukan teater yang paling tengkap media pengungkapannya. Menurut Wiget. satir pertempuran. genre sastra lisan dapat di klasifikasikan ke dalam sub-sub genre yang terdiri atas puisi lisan. balada. falsafah hidup. sastra lisan dipertunjukkan di hadapan pendengar yang melakukan evaluasi baik cara maupun isi Pertunjukan. dan penyajian cerita melalui aktualisasi adegan. dan drama lisan. wayang gong. dan iringan musik (wayang wong. melainkan merupakan sebuah kegiatan yang berlangsung yang tercermin dalam tingkat perhatian dan komentar. dan lain-lain). satir. prosa Iisan. pembacaan sastra disertai gerak sederhana dan atau iringan musik terbatas (cekepung dan kentrung). penyajian cerita disertai gerak tari (randai). cerita rakyat. Edi Sedyawati (lihat Pudentia. Dari berbagai varietas di atas. nyanyian misteri para pendeta. menunjukkan bahwa semua genre penting sastra yang muncul pada awal masyarakat beradab adalah: epos heroik. nyanyian pujaan untuk pendeta dan raja. Terdapat varietas yang sangat mengejutkan dari sastra lisan yang bertahan hidup di antara orang-orang pra-aksara.lisan. dan mitologi. himne. evaluasi bukan merupakan kesimpulan dari Pertunjukan tersebut. dan sebagaimana kata- kata tertulis muncul dalam sejarah. dogeng tragedi rakyat dan pembunuhan. Yang bersifat lisan pun mengandung intan. fabel. pepatah. yang turut memberikan sumbangsih bagi perkembangan sastra daerah dan lndonesia.

lnuit. cara tradisi tersebut diturunkan dari guru kepada murid. Aleut. Navajo. dan historik-struktural. historik-geografik. terdapat adegan siap pakai yang oleh Lord disebut theme. Dengan menggunakan metodologi kajian tradisi lisan. Sedangkan untuk melakukan penelitian terhadap teater rakyat dapat menggunakan metodologi kajian tradisi lisan. Hipotesis Parry dan Lord ternyata dapat dibuktikan dengan meneliti puluhan contoh epos rakyat seperti yang dinyanyikan oleh tukang cerita. 19 .Zuni. Parry dan Lord berkesimpulan bahwa epos rakyat tidak dihafalkan secara turun-temurun tetapi diciptakan kembali secara spontan. dan bagaimana resepsinya oleh masyarakat. Lakota. Hal ini penting karena teater rakyat tidak hanya merupakan bagian dari sastra lisan tetapi juga bagian dari seni Pertunjukan rakyat yang memiliki jaringan dengan berbagai unsur kebudayaan. dan lain-lain. Dengan meneliti teknik penciptaan epos rakyat. Menurut A Teeuw (1988). dan variasi merupakan ciri khas puisi lisan. dan cerita-cerita dari suku-suku lndian Hitchiti. penelitian teater rakyat dapat dilakukan secara menyeluruh tidak hanya terbatas pada aspek kesastraannya saja tetapi juga mencakup aspek-aspek kebudayaan yang melingkupinya. lroquois.Aztec. Zuni. si penyanyi memiliki persediaan formula yang disebut stock-in-trade. dan lain-lain. perkembangan dalam studi sastra lisan terutama yang menyangkut puisi rakyat antara lain dilakukan oleh Parry dan Lord. Perkembangan penelitian terhadap sastra lisan yang merupakan sastra rakyat dilakukan dengan menggunakan metode-metode historik- komparatif.

Sebagai sebuah bidang keilmuan. Dalam proses penciptaan itu. menemukan. sastra lisan dipandang sebagai sebagai hasil kreativitas manusia yang mengandung keindahan. Karena itulah. ltulah sebabnya. dan legenda itu menentramkan dan menggembirakan manusia. kita mengenal manusia yang luluh dengan keindahannya: aspek-aspek manusiawi diterobos. manusia mengalami semacarn ekstase di mana dia merasa berada di luar ruang dan waktu sehari-hari. dan luar biasa. agung. berguna untuk memahami manusia dengan cara yang mendalam (verstehen). Para penutur sastra lisan itu tak ubahnya dengan novelis-novelis atau penyair- penyair yang menyusun cerita panjang denganimaginasi dan sensitivitas 20 . Sastra yang memiliki medium kelisanan itu membawa pesan keharmonisan dari dan untuk masyarakat. buku Studi Sastra Lisan (Lemera: 2010) yang ditulis oleh Yoseph Yapi Taum. Di dalamnya manusia mengenali hubungan yang akrab dan hangat antara dirinya dengan kukuatan-ke+kuatan lain. Sastra lisan dipandang sebagai sebuah bidang existential knowledge yang penting dipelajari sebagai upaya mencari dan menemukan kebenaran kemanusiaan. mengikat dan memikat. Memahami legenda itu sebagai sastra lisan. dan pendekatan untuk menyelidiki. BAB IV SASTRA LISAN Sastra lisan termasuk dalam bidang seni dan ilmu. Ekspresi-ekspresi sastra lisan dalam bentuk mitos. dongeng. bahwa dia bukan hanya sekadar makhluk duniawi semata. sastra lisan muncul dari keterpesonaan manusia menyaksikan kekuatan ilahi yang dahsyat. Manusia menyerahkan dirinya kepada yang indah. memahami Legenda Ratu Roro Kidul. Sebagai sebuah bidang kesenian. melihat sastra lisan sebagai proyeksi pikiran dan emosi manusia yang paling jujur manifestasi nya. bahkan dengan sumber atau asas segala sesuatu yang menarik. Sebagai sebuah bidang kesenian. studi sastra lisan memiliki seperangkat teori. Sastra lisan adalah kreasi estetik dari imaginasi manusia. misalnya. dan meningkatkan pemahaman manusia. metode.

1980). kesukuan tidak banyak diberikan. Sebagai sebuah bidang kajian akademis.khusus yang kompleks. Sebagai sebuah bidang ilmu yang baru. sastra remaja. Sastra lisan dipisahkan dari pembicaraan resmi karena dipandang tidak sesuai dengan ciri formal dan kualitas yang biasanya diterima dalam pembicaraan sastra lndonesia. termasuk juga di dunia Barat. sastra yang diremehkan (sastra populer. Dalam politik kebudayaan nasional. tradisional. Hambatan-hambatan semacam itu perlu segera diatasi. misalnya. dan sastra yang dipisahkan (sastra lisan) (Heryanto. karya-karya Ki Panjikusmin). akademis. yaitu sastra yang diajarkan di sekolah-sekolah formal dan mewakili sastra lndonesia serta yang diabsahkan oleh politik. Kesadaran untuk memahami sastra dan kebudayaan lisan secara akademis memang merupakan hasil perkembangan yang relatif baru. serta aplikatif dalam bidang studi sastra lisan. Seperti dikatakan dalam buku ini. selain tidak terdapat mata kuliah sastra lisan. Perhatian para perencana pembangunan dan kalangan akademisi terhadap kebudayaan lisan. 21 . yang muncul dari rangsangan yang hebat antara permainan kekuatan alam dan manusia. mahasiswanya pun tidak diperbolehkan untuk menulis skripsi dalam bidang sastra lisan dengan alasan sastra lisan bukan merupakan bidang kajian akademik. teoretis. studi sastra lisan memiliki sejumlah objek kajian dengan metodologi yang beragam sesuai dengan tujuan dan objek kajian yang dihadapi. Sastra lisan merupakan sebuah bidang ilmu yang baru. Di luar sastra resmi tulisan terdapat sastra terlarang (sastra Lekra. Pertumbuhan studi sastra lisan di lndonesia masih menghadapi berbagai hambatan yang tidak mudah. yang diidealkan sebagai sastra dan menduduki domain estetika hanyalah sastra resmi tulisan. memandang teks lisan sebagai tulisan yang tidak tertulis (unwritten writing) yang kemudian ditulis. dan pada akhirnya mencapai bentuk standar yakni prosa atau puisi tulisan yang gramatik. sastra radio). studi sastra lisan di lndonesia perlahan-lahan tumbuh menjadi sebuah bidang kajian akademis dan kini mulai memasuki arus utama dan arus populer ilmu sastra. llmuwan abad ke-19. Di beberapa fakultas sastra ataupun jurusan pendidikan bahasa dan sastra Indonesia. Buku ini mengulas dan menghadirkan berbagai persoalan historis.

yang kini sangat populer dengan dibentuknya Kementerian Pariwisata dan Ekonomi Kreatif. menciptakan kejutan baru. Lalu. Hasil cipta sastra tersebut haruslah memancarkan pengalaman rohani suatu bangsa. Selain itu. Peranan Sastra Lisan dalam Pembentukan Sastra lndonesia Modern Sastra yang baik seharusnya mampu mengungkap-kan wawasan.J. apa pentingnya sastra lisan ini? Sastra lisan itu merupakan kesadaran kolektif yang tersebar dan diwariskan turun-temurun. Ekonomi kreatif adalah usaha-usaha danproduksi kreatif yang berkaitan dengan kebudayaaan sebuah bangsa. banyak contoh kajian sastra lisan yang mernberi inspirasi bagi pembaca untuk memahami dan mengkaji berbagai fenomena sastra lisan. citarasa. Karena itu. pengalaman dan peradaban yang muncul melalui refleksi. yakni disebkanoleh perubahan sosial. lstilah ekonomi kreatif. Teori Parry-Lord. A. Telah disebutkan di atas bahwa sastra lndonesia modern adalah suatu bentuk kesusastraan yang baru. studi sastra lisan pun pada gilirannya mampu memberikan kontribusi yang besar bagi pengembangan ekonomi kreatif. intelektual. 22 . 1989: 361). dan James J. antara lain Madzab Finlandia. karena keinginan mencari pengucapan baru. bangsa lndonesia masih perlu mencari jati dirinya.Beberapa teori analisis sastra lisan dikemukakan secara komprehensif dalam buku ini. dan perubahan budaya lainnya (Wellek. termasuk juga dalam bidang kesusastraan. Sebagai bangsa yang masih muda. Perubahan di bidang sastra itu dapat terjadi secara internal. Claude Levi-Strauss. sikap dan visi kepengarangan. Fox. Vladimir Propp. khususnya Kesusastraan Barat. Greimas. Persentuhan itu tidak hanya terbatas rnenghasiikan perubahan-perubahan dalam strukturkesusastraan tapi juga dalam tema. dialog. mata rantai dan kontinuitasnya dengan sejarah masa lampaunya. dan dialektika dengan sistem pemikiran dan sistem nilai suatu bangsa. seringkali digunakan secara bergantian dengan istilah creative industries dan culture industry. dan yang merupakan hasil persentuhan dengan tradisi sastra asing. tetapi juga yang bersifat eksternal. yang sebelumnya tidak dikenal dalam tradisi sastra asli.

Para pelopor puisi lndonesia modern seperti Muhammad Yamin dan Sanusi Pane memperlihatkan model penulisan puisi Melayu tradisional. Para ahii sastra umumnya sependapat bahwa bentuk awal (prototipe) puisi lndonesia adalah mantra. Pantun juga merupakan sebuah bentuk puisi asli yang cukup penting kedudukannya dan sangat memasyarakat dalam berbagai kebudayaan Nusantara. Sekalipun kondisi kehidupan sastra daerah dan sastra lisan dalam era Orde Baru itu termarginalisasi dan kurang menguntungkan. Memang. Kelompok ini tidak melihat kemungkinan syair dan pantun sebagai 23 . Akan dibahas menurut masing-masing genre sastra. cerpen. khususnya jenis puisi formulaik. Dalam sub-uraian berikut ini. Peranan Tradisi Puisi Khazanah sastra daerah dan sastra Iisan di lndonesia sangat kaya akan tradisi puisi. kadang-kadang kita meremehkan daya tahan budaya dan identitas lokal terhadap pengaruh dari luar. 1. Akan tetapi. kekuatan resistensi tidak padam begitu saja. untuk sekian lama tradisi puisi lokal dan puisi lisan tidak berkembang dalam kehidupan puisi lndonesia modern. dan novel. Penerimaan gurindam (yang berasal dari Tamil) dan syair (yang berasal dari dunia Arab) dimungkinkan karena kedekatan bentuknya denganmodel pantun yang sudah lebih dahulu ada dalam tradisi sastra lndonsia. Nyanyian-nyanyian suku primitif pada zaman pra-sejarah yang digunakan untuk membangkitkan tenaga sihir dan magis termasuk bentuk-bentuk puisi Iisan yang paling tua. Akan tetapi dalam perkembangan selanjutnya puisi-puisi modern kian menjauh saja dari puisi Melayu. Pembangunan nasional dalam banyak hal memang mengancam keanekaragaman budaya lokal yang merupakan aset kekayaan bangsa. dia tidak dapat lestari bertahan hanya dengan kekuatan eksternal saja. yaitu puisi. sambil melestarikan budaya tersebut. STA sangat keras mengejek bentuk pantun dan syairsebagai ucapan nenek-nenek tua yang terbuai antara kuap dan kantuk. Sambutan yang diberikan terhadap jenis puisi soneta oleh para penyair Pujangga Baru disebabkan karena soneta masih sangat dekat dengan model pantun yang telah lebih dahulu ada dalam tradisi sastra lndonesia. secara singkat akan dibicarakan daya tahan sastra iisan bahkan kemampuan adaptasinya Dalam kehidupan sastra lndonesia modern. karena bagaimanapun kuatnya sebuah rezim.

Gaze (Kemak). dan Tei (Fataluku). lbrahim Sattah dan Hamid Jabbar mengikuti jejak Sutardji Calzoum Bachri menulis puisi mantra. dengan munculnya penyair Sutardji Calzoum Bachri berusaha membangkitkan kembali roh puisi asli lndonesia yaitu mantra sebagai bentuk pengucapan puisinya. (Tetun). kini sudah diterima dalam kehidupan puisi lndonesia modern. Aibabelen. puisi maupun prosa. Linus Suryadi AG dan Darmanto Yatman dan beberapa penyair lain dari kebudayaan Jawa menulis puisi dengan menggunakan cita rasa dan warna tradisi daerahnya. misalnya. 1987: 83). 1995: 90-96). Husni Djamaluddin dan Rusli Marzuki Saria menulis puisi yang bertolak dari sastra lisan kabaMinangkabau (Esten.H. dan Ayatrohaedi menulis puisi dalam bahasa lndonesia dengan mempergunakan bentuk puisi tradisional Sunda yang disebut dangding (Rosidi. 1995:103). Akan tetapi kejutan baru mulai muncul dalam tahun 1 970-an. Sastra dan seni bagi orang Lamaholot di Flores Timur. Berbagai tradisi dan nilai sastra daerah. Nololo.dilaksanakan selalu dengan gairah dan 24 .M. Sastra dalam konsep pribumi Timtim adalah sesuatu yang dipandang realistik immanen di tengah dunia wadag biasa. Di bidang sastra lisan. tetapi juga yang meng-aktualisasikan dimensi-dimensi transendens-nya. Tea (Bunak) adalah ragam-ragam puisi rakyat yang bangun komposisi dan isi naratifnya benar-benar memenuhi kriteria Horatio dulce et utile (indah dan berguna). Melalui sastra masyarakat mengaktualisasikan dirinya. Hamulak. Dalam bahasa-bahasa daerah mereka mengenal ragam-ragam sastra. Perubahan yang cukup radikal ini memberikan warna tersendiri dan menumbuhkan kesadaran baru dalam jagat puisi lndonesia modern: bahwa sastra daerah dan sastra lisan merupakankekayaan kesenian lndonesia yang dapat dipergunakan sebagai idiom atau sumber oleh para seniman lndonesia. adalah kenyataan sehari-hari. Pengungkapan sastra di Flores -juga kebanyakan wilayah lainnya di kawasan timur lndonesia. Sanusi Pane. melainkan jelas-jelas mencerminkan semangat lndonesia baru. terdapat sastra yang isinya mencerminkan bukan saja semangat kebudayaan baru. Mamunu.wadah untuk meng-ekspresikan seni lndonesia baru (Ajib Rosidi. SurachmanR.. dalam penghayatannya sekarang ini. Ramadhan K. Aiknanoik.termasuk sastra lisan.

Perhatikan misalnya sastra lisan Bini masyarakat Pulau Rote (Fox. Kata- katanya dianggap menyampaikan dan menunjukkan kebenaran. Di desa-desa di seluruh Timor Timur. pendambaan keselamatan. Dalam bahasa-bahasa daerah Timtim. yakni Muhammad Kasim dan Suman Hs menulis cerpen yang justru berakar dari khasanah sastra tradisional fndonesia. Berbagai jenis puisi lisan tersebut masih bertahan sebagai sarana yang mengungkapkan semangat baru. 25 . Sangat menarik untuk dicatat bahwa dua orang perintis penufisan cerpen lndonesia. permohonan mengatasi maut. 1986) dan Wor masyarakat suku Biak di lrian Jaya (Rutherford. memahami. Sampai sekarang masih terlalu banyak kekayaan tradisi lisan Nusantara yang belum digali. yang jujur. kesakitan. Peranan Tradisi Cerpen Cerita pendek (cerpen) lndonesia merupakan sebuah genre sastra modern yang mulai berkembang pada dekade tahun 1930-an. dan sebagainya. Sastra lisan telah menjadi perbendaharaan kehidupan rohani masyarakat berbagai masyarakat lokal. Mereka yang menguasai. Lia Nain (Tetun).kreativitas yang menakjubkan. 1996). yang tentu saja bersifat estetis dan metaforis. sambil mewartakan peristiwa eksistensial mengenai realita-realita paling besar dalam eksistensi manusia: kelahiran. bahkan dapat disebut sebagai a+at transformasi masyarakatnya dengan dunia luar. mendengar. Akan tetapi bukan estetika itulah yang dipentingkan. Mereka berseni dan bersastra untuk menghayati dimensi transendensnya. Makoan. dikenal istilah Nawarana (Fataluku). 2. sastra bukanlah hal yang asing.kehidupan. Tuturan-tuturannya dianggap lebih berharga daripada mutiara. dalam kesadaran partisipasi dengan totalitas Sang Realitas Sejati. ltu semua diungkapkan dalam gerak yang simbolis. Makdean. dalam bahasa yang berwibawa. Perkembangan sastra lisan yang semacam ini patut terus-menerus didorong dengan lebih banyak mengungkap dan mengenal secara mendalam nilai-nilai dan tradisi puisi lisan di berbagai daearah di Nusantara. ketakutan. dan menghayati sastra lisan dianggap tinggi kedudukannya. yang melukiskan orang yang berilmu tinggi dan memiliki kedudukan tinggi dalam masyarakat karena menguasai cipta sastra.

tutu koda tutu maring dalam lingkungan masyarakat Lamaholot di Flores Timur. optimis dalam kehidupan. kaba di Minangkabau. Akan tetapi pada hakikatnya jenis cerita panjang ini cukup akrab dengan masyarakat lndonesia yang sudah mengenaj seni bercerita dalam bahasa daerah seperti pantun di Tanah Sunda. jenis cerita panjang itu sudah mempunyai tradisi yang panjang. 1983). Misalnya Lia nain dalam kebudayaan Tetun di Timor Timur. penuturan cerita panjang bahkan dapat berfangsung beberapa malam secara suntuk. Efek tertawa gembira adalah tujuan yang hendak mereka capai dengan cerpen- cerpennya. Dalam berbagai tradisi iisan di berbagai wiiayah di Nusantara pun. kentrung di Jawa Timur. Dalam perkembangan selanjutnya. Kasim dan Suman Hs. yang berorientasi pada masalah-masalah sosial maupun kedalaman ide pemikiran. Kasim dan Suman Hs ini tidak dilanjutkan oleh pengarang-pengarang lainnya. Sebaliknya mulailah tradisi penulisan cerpen menurut konsep Barat. tidak menjadi official. maka lepasfah pula mata rantai penghubung dengan cerita rakyat tradisional nusantara. lni berarti. Mereka banyak mengambil tokoh-tokoh rakyat biasa yang bodoh. dan yang mengangkat dan melanjutkan tradisi cerita rakyat tradisional. Novel sebagai bentuk cerita panjang yang diperkenalkan dari dunia Barat ini sesungguhnya tefah dihayati dengan baik dalam sastra lisan hampir di semua wilayah Nusantara. Mereka sebenarnya menimba dan melanjutkan cerita-cerita lisan seperti Si Kabayan atau Demang Kedangkrang. babad di Tanah Jawa. jernih dan sederhana (lihat Soemardjo. M. Dengan lenyapnya pengaruh cerita-cerita M. dan lain sebagainya. sistem konvensi sastra yang sudah dirintis jafannya olehM.segar. Peranan Tradisi Novel/Roman Novel atau ‘roman’ adalah nama baru yang diterima dari persentuhan dengan kesijsastraan Barat. yang dijadikan bufan-bulanan untuk berseforoh. Di beberapa daerah. Cerita panjang dalam tradisi lisan ini ternyata menjadiarus dasar dalam sejarah perkembangan novellndonesia 26 . Untuk lelucon- leluconnya itu. Kasim dan Suman Hs mencari segi-segi humor dafam kehidupan sehari-hari. model cerita asli itu tidak dapat memasuki arus utama cerpen Indonesia. 3. Dafam sejarah cerpen Indonesia hanya sekali itu timbul jenis cerita yang demikian: cerita yang penuh humor.

Mas Tirto Adhisuryo menulis romanBoesono (1 91 O) dan Nyi Permana (1 91 2). Penulisan dan penerbitan kembali cerita-cerita rakyat masih terus berlangsung sampai sekarang.R. Semaun menulis sebuah roman berjudul Hikayat Kadiroen (1924). Mas Marco Martodikromo menulis Mata Gelap (1 91 4). Keadaan ini secara tidak langsung menunjukkan bagaimana prosesadaptasi antara cerita panjang dalam tuturan lisan dengan novel modern. Proses adaptasi itu sudah dimujai dalam kegiatan persuratkhabaran yang berkembang sejak pertengahan abad ke-19 (lihat Abdullah. Roman-roman pertama yang mengisahkan kehidupan nyata sehari-hari muiai dimuat secara bersambung dalam koran-koran itu yang dituiis dalam bahasa Melayu Rendah. 1990: 17). Ada beberapa nama yangdisebut: H.M. dan Rasa Merdeka (1 924). Ada pula gubahan cerita rakyat untuk konsumsi anak-anak yang diterbitkan oleh Penerbit Gramedia (Grasindo). Di samping itu dua orang pengarang berpaham kiri ketika itu menulis pula sejumlah roman berbahasa Melayu Rendah. Dajoh. Persoalannya. Susunan kejadian dalam kebanyakan novel selalu berlangsung secara kronologis (plot lurus). Bandung. Dari Minahasa: Pahlawan Minahasa (1935) oleh M. 27 .selanjutnya. Moekti m. dan sebagainya. Studen Hidjo (1 91 9). Rd. muncul banyak rornan yang bersamaan pula dengan penerbitan beberapa mitos dan legenda tradisional dalam bentuk prosa (Teeuw.enulis cerita bersambung Hikayat Siti Mariah. Dalam kurun waktu tahun 20-an dan 30-an. 1978). Taulu. Tjerita Malim Deman (1 932) oleh Aman Dt. Madjoindo dan Tjerita si Umbut Muda (1930). Syair Rempah-rempah (1 91 9). Bintang Minahasa (1931) oleh H. Ceiita Minangkabau misalnya: Sabai nan Aluih (1 931) oleh Tulis St. Sati. Sang Kuriang. Cerita-cerita panjang yang berasal dari sastra daerah tersebut sebenarnya telah memperlancar adaptasi masyarakat sastra lndonesia dengan bentuk cerita panjang yang diperkenalkan dari dunia Barat. Perhatikan misalnya: Roro Jongrang. apakah novel atau rornan berhasil menjadi pelanjut cerita panjang yang telah ada dalam khazanah sastra lisan daerah? Ciri-ciri kedekatan struktur antara tradisi cerita panjang dengan novel dengan mudah dapat kita lihat. semuanya ditulis secara bersambung dalam koran Medan Prijaji.

Tampak di sini bahwa akar budaya nusantara terangkat nienjadi landasan dan wawasan sastra para pengarang. 28 . terutama di masa Balai Pustaka dan Pujangga Baru. Daya tarik novel masih bertumpu pada kekuatan narasinya. Penjelasan ini pun dapat diterapkan pada gejala penerimaan dan sambutan yang positif dari masyarakat lndonesia terhadap te!enovela dan beberapa serial sinetron yang daya tarik terkuatnya terletak pada teknik alur yang menarik. Putu Wijaya. Kedekatan lainnya tampak dalam penggambaran tokoh gadis dan pemuda. sebab kebanyakan pengarang novel menggambarkan tokohnya sebagai pernuda atau gadis terbaik di desanya. Pengamatan yang cermat (Iihat misalnya Abdullah. kaba dan berbagai cerita lisan. Perwatakan tokoh jahat dan tokoh baik juga masih tampak.seringkali relasi sebab-akibatnya agak longgar sehingga unsur digresi banyak dijumpai. Sebaliknya novel-novel pop bisa memasuki lingkaran dalam. Susunan plot semacam ini jelas menunjukkankedekatannya dengan susunan plot hikayat. ltulah sebabnya novel-novel absurd seperti karya lwan Simatupang. jenis novel yang memasuki inner circle hanyafah novel yang bercerita dengan teknik alurnya yang menarik. Budi Darma dan Danarto tetap berada di luar fingkaran pernovelan lndonesia. tetapi pefukisan kedua tokoh tersebut merupakan transformasi putri dan putra raja. Sekalipun bahan cerita telah diambif dari dunia nyata. yang tidak berasal dari konvensinya sendiri. lainnya. ltu berarti arus utama novel lndonesia masih bertahan dafam konvensi tradisional dan sukar menerima kebafuan-kebaruan yang asing. dan teknik klasik lainnya masih sering kita jumpai dafam novel-novel lndonesia modern. rama!an perbedaan garis keturunan. Demikian pufa teknik pengembangan cerita lewat mimpi. 1990) terhadap perkembangan novel lndonesia modern menunjukkan bahwa sampai sekarang.

bentuk rambut yang sama. Kata tersebut merupakan kata majemuk yang berasal dari dua kata yaitu kata folk dan Iore (Danandjaja 2002:2). Sedangkan sastra lisan adalah kesusastraan yang mencakup ekspresi kesusastraan warga suatu kebudayaan yang disebarkan dan diturun-temurunkan secara lisanHutomo (1991:1). taraf pendidikan yang sama. BAB V FOLKLOR DAN SASTRA LISAN Folklor adalah sebagian kebudaaan suatu kolektif yang tersebar dan diwariskan turun temurun. diantara kolektif macam apa saja secara tradisional dalam versi yang berbeda. Sastra lisan merupakan bagian dari folklor. dan agama yang sama. yakni kebudayaan yang telah mereka warisi turun-temurun sedikitnya dua generasi yang dapat mereka akui sebagai milik bersama. yang paling penting adalah mereka sadar akan identitas kelompok mereka sendiri. penyebaran dan pewarisannya biasanya dilakukan 29 . bahasa yang sama. Namun yang lebih penting lagi bahwa mereka telah memiliki satu tradisi. Di samping itu. Sementara itu. yang dimaksud !ore adalah tradisi folk yaitu sebagian kebudayaan yang diwariskan turun-temurun secara lisan melalui suatu contoh yang disertai dengan isyarat atau alat pembantu pengingat (mnemonic diviace). yaitu sebagai berikut: Pertama. sehingga dapat dibedakan dari kelompok-kelompok lainnya. mata pencaharian yang sama. dan kebudayaan. baik dalam bentuk lisan maupun contoh yang disertai gerak isyarat atau alat pembantu pengingat (mnemonic device) lstilah folkior merupakan penglndonesiaan dari bahasa lnggrisfolklore. Ciri-ciri pengenal itu antara lain dapat berwujud: warna kulit yang sama. Ciri-ciri folklor dijelaskan Danandjaja (2002: 3-4). sosiai. Dundes (Danandjaja 2002:1-2) menyebutkan bahwa folk adalah sekelompok orang-orang yang memiliki ciri-ciri mengenal fisik. Jadi sastra lisan ini memiliki cakupan yang lebih spesifik.

folklor bersifat anonim. yakni disebarkan melalui tutur kata dari mulut ke mulut (atau dengan suatu contoh yang disertai dengan isyarat. folklor menjadi milik bersama (collective) dari kolektiftertentu. sehingga setiap anggota kolektif yang bersangkutan merasa memilikinya. yaitu mempunyai logika sendiri yang tidak sesuai dengan logika umum. biasanya bukan melaluicetakan atau rekaman. yaitu nama penciptanya sudah tidak diketahui lagi. folklor pada umumnya bersifat polos dan lugu. Hal ini diakibatkan oleh cara penyebarannya dari mulut ke mulut (lisan). kesembilan. folklor mempunyai kegunaan (function) dalam kehidupan bersama suattj kolektif. Hal ini sudah tentu diakibatkan karena penciptaan yang pertama sudah dapat diketahui lagi. kelima. folklor bersifat tradisional. Walaupun demikian perbedaannya hanya terletakpada bagian luarnya.secara lisan. kedelapan. terlalu spontan. yakni disebarkan dalam bentuk tetap atau dalam bentuk standar. dan proyeksi keinginan terpendam. keenam. ketiga. protes sosial. folklor bersifat prologis. folklor ada (exist) dalam versi-versi atau bahkan varian-varian yang berbeda. ketujuh. disebarkan di antara kolektiftertentu dalam waktu yang cukup lama (paling sedikit dua generasi). Cerita rakyat misalnya mempunyai kegunaan sebagai alat pendidik. dari suatu generasi ke generasi. keempat. dan alat pembantu pengingat) dari suatu generasi ke generasi berikutnya. Ciri pengenai itu terutama berlaku bagi folklor lisan dan sebagian lisan. mengajar membatik. sedangkan bentuk dasarnya dapat tetap bertahan. Folklor -dengan mudah dapat mengalami perubahan. yang kadang-kadang penuturnya disertai dengan perbuatan (misalnya mengajar tari. dapat digolongkan kedalam tiga kelompok besar 30 . kedua. pelipur lara. sehingga oleh proses lupa diri manusia atau proses interpolasi. folklor biasanya mempunyai bentuk berumus atau berpola. Jadi folklor itu disebarkan secara lisan. Adapun bentuk folklor menurut Jon Brundvard (Danandjaja 2002:21-23). mengajar mendalang dan sebagainya). sehingga sering kali kelihatannya kasar.

Yang kedua folklor sebagian lisan (partly verbafolklore). Yang ketiga folklor bukan lisan (non verbal folklore). perkawinan). dan lain-lain). folklor bukan lisan adalah folktor yang bentuknya bukan lisan. Yaitu meliputi: 31 . batas umur pengkhitanan anak.  cerita prosa rakyat seperti mite. folklor lisan adalah folklor yang bentuknya memang murni lisan.  nyanyian rakyat. Yang termasuk folklor sebagian lisan adalah bahan- bahan folklor yang berupa:  kepercayaan rakyat. Di dalam hubungannya dengan folklor lisan. Sunda mandah dan lain-lain). dan lain-lain).  adat istiadat (gotong royong.  ungkapan tradisional seperti peribahasa. dan syair.  pertanyaan tradisional. gurindam. legenda. maka bahan-bahan folklor lisan mencakup:  bahasa rakyat (folk speech) seperti logat.  teater rakyat. seperti teka-teki. jutukan.berdasarkan tipenya yaitu:pertama. ruwatan.  upacara-upacara (kematian.  puisi rakyat seperti pantun.  tari rakyat.  pesta-pesta rakyat (skaten. folklor sebagian lisan ini adalah folklor yang bentuknya merupakan campuran unsur lisan dan bukan lisan. pepatah dan pameo. folklor lisan (verbal folklore).  permainan rakyat dan hiburan rakyat (semacam gobaksodor. dan titel kebangsawanan. dan dongeng. pangkat tradisional.

Perbedaan keduanya terletak 32 . Tradisi lisan sendiri berarti those tradition which have been transmitted in time andspace by the word and act. lstilah sastra lisan terkadang disenadakan dengan tradisi lisan. dan sebagainya).  yang berupa bukan material: gerak isyarat tradisional (gesture). bentuk lumbung padi.  sebagai alat pendidikan anak (predagogical device). yang artinya kurang lebih tradisi yang di transmisikan dalam waktu dan ruang dengan ujaran dan tindakan. di antara macam kolektif macam apa saja. Bali). pakaian dan perhiasan tubuh adat. makanan dan minuman rakyat.  berupa materiat: arsitektur rakyat (bentuk rumah asli daerah. bunyi isyarat untuk komunikasi rakyat (kentongan tanda bahaya di Jawa. Adapun konsep tradisi hampir sama pengertiannya dengan folklor. obat-obatan rakyat. Fungsi folklor menurut Bascom (Danandjaja. 2002:19) adalah sebagai berikut:  sebagai sistim proyeksi (projective System) yakni sebagai alat pencermin angan-angan suatu kotektif.  sebagai alat pengesahan pranata-pranata dan lembaga-lembaga kebudayaan. musik rakyat (gamelan Sunda. secara tradisional dalam versi yang berbeda. Jawa. kerajinan tangan rakyat. baik dalam bentuk lisan maupun contoh yang disertai gerak isyarat atau alat pembantu mengingat (mnemonic deviace) Danandjaja (2002:2). Folklor berarti sebgian kebudayaan suatu kolektif yang tersebar dan diwariskan turun-temurun. atau gendang untuk mengirim berita seperti dilakukan di Afrika).  sebagai alat pemaksa dan pengawas agar norma-norma masyarakat akan selalu dipatuhi anggota kolektifnya.

pada unsur-unsur yang ditransmisi secara lisan yarig kadang-kadang
diikuti dengantindakan Hutomo (1991:1).

Tradisi lisan menurut keputusan atau rumusan UNESCO mencakup
beberapa hal (Hutomo, 1991:11), yakni:

 yang berupa kesusasteraan lisan;
 yang berupa teknologi tradisional;
 yang berupa pengetahuan folk diluar pusat-pusat istana dan kota
metropolitan;
 yang berupa unsur-unsur religi dan kepercayaan fo!k diluar batas
normal agama-agama besar;
 yang berupa kesenianfo!k di luar pusat-pusat istana dan kota
metropolitan; dan
 yang berupa hukum adat.

Sastra rakyat itu milik komunal, milik bersama rakyat bersahaja,
maka sastra ini juga disebut orang sebagai folk literature, atau sastra
rakyat. Hal ini bukanlah berarti bahwa sastra tersebut tidak terdapat di
dalam masyarakat kota yang telah maju. Adapun ciri-ciri sastra lisan
menurut Hutomo (1991:3-4) yakni:

 penyebarannya melalui mulut, maksudnya, ekspresi budaya yang
disebarkan, baik dari segi waktu maupun ruang melalui mulut;
 lahir di dalam masyarakat yang masih bercorak desa, masyarakat
di luar kota, atau rnasyarakatyang belum mengenal huruf;
 menggarnbarkan ciri-ciri budaya sesuatu masyarakat, sebab
sastra lisan itu merupakan -warisan budaya yang
menggambarkan masa lampau, tetapi menyebut pula hal-hat baru

33

(sesuai dengan perubahan sosial). Oleh karena itulah, sastra lisan
disebut juga sebagai fosil hidup;
 tidak diketahui siapa pengarangnya, dan karena itu menjadi milik
masyarakat;
 bercorak puitis, teratur dan berulang-ulang, maksudnya untuk
menguatkan ingatan dan menjaga keaslian sastra lisan supaya
tidak cepat berubah;
 tidak mementingkan fakta dan kebenaran, lebih menekankan
pada aspek khayalan/fantasi yang tidak diterima oleh masyarakat
modern, tetapi sastra lisan itu mempunyai fungsi penting di dalam
masyarakatnya;
 bahasa: menggunakan gaya bahasa lisan (sehari-hari),
mengandung dialek, kadang-kadang diucapkan tidak lengkap.

Fungsi sastra lisan sendiri, masih menurut Hutomo (1991:67-74) adalah
sebagai berikut:

 sebagai sistim proyeksi;
 pengesahan kebudayaan;
 sebagai alat pemaksa berlakunya norma-norma sosial, dan
sebagai alat pengendalian sosial;
 sebagai alat pendidikan anak;
 untuk memberikan suatu jalan yang dibenarkan oleh masyarakat
agar dia dapat lebih superior daripada orang lain;
 untuk memberikan seseorang jalan yang diberikan oleh
masyarakat agar dia dapat mencela orang lain; -
 sebagai alat untuk memprotes ketidakadilan dalam masyarakat;
 untuk melarikan diri dari himpitan hidup, atau dengan kata lain
berfungsi sebagai hiburan semata.

34

Sesuai penjelasan mengenai fotktor dan sastra lisan di atas rnaka
semakin jelaslah jika umpasa merupakan tradisi yang berkembang secara
lisan, umpasa digolongkan kedatarn salah satu bentuk tradisi lisan yang
berbentuk puisi rakyat yang termasuk dalam Kelompok folklor Iisan hal ini
dikarenakan bentuknya murni lisan. HaI tersebut sesuai dengan
penggolangan bentuk folktor rnenurut Jon Harold Brundvard (Danandjaja
2002:21-23).
Karena umpasa te-rmasuk puisi yang memitiki bentuk, maka dalam
penelitian ini Struktur sastra lisan yang dibahas meliputi bentuk, formula,
tema, bunyi, diksi dan gaya bahasa. Unsur-unsur tersebut adalah unsur
yang selatu ada dalam teks sastra lisan (Badrun, 2003:23).
Dalam khazanah kesusastraan Melayu kuno, tradisi sastra lisan,
baik yang berbentuk syair maupun prosa, merupakan corak kekhasan
tersendiri yang terbangun melalui relasi lajur sejarah yang panjang. Satu
tradisi dari bangsa Yunan (China) yang diyakini sebagai nenek moyang
bangsa lndonesia, dan satu tradisi dari ranah India ketika ajaran Hindu-
Buddha menjadi sistem kepercayaan utama masyarakat, ditambah oleh
sumbangan tradisi Arab-lstam yang disebarkan oleh para musafir Timur
Tengah, tak pelak menjadi unsur sejarah teramunya corak kekhasan
tradisi sastra lisan bangsa lndonesia yang asli.
Di dalam tiga tradisi yang berbeda tersebut, secara simultan
meniscayakan terjadinya dialektika budaya yang diharapkan saling
mengisi dan metengkapi. Ekpresi estetik tradisi sastra lisan lndonesia
dalam bentuk mantra, tembang macapat, cerita rakyat, hikayat-hikayat,
atau pun syair pantun serta gurindam yang berkembang di lndonesia
menjadi serangkaian manifestasi dialektika dari tiga unsur kebudayaan
kuno tersebut.
Corak khas tradisi sastra lisan pada akhirnya mendapatkan tempat
dan menemukan bentuknya masing-masing di tiap-tiap daerah dalam
ruang etnis dan suku yang mengusung flok budaya dan adat yang
berbeda-beda. Heddy Shri Ahimsa-Putra (1966) mengatakan bahwa

35

tradisi sastra lisan tidak hanya mengandung unsur-unsur keindahan (estetik). terutama apabila mengacu pada konsepsi awal yang dilontarkan A. sedangkan kajian-kajian sastra Iisan cenderung sebagai anak tiri yang dinomorduakan. baik yang berkenaan dengan ekspresi proses verbal kesastrawanan maupun dalam bentuk kajian sastra tulis dari segi kuantitas lebih mendominasi. Keduanya harus dipandang sebagai kesatuan dan keseluruhan. Ketimpangan sernacam ini sungguh menggelisahkan. Karena itu. dalam khazanah kesusastraan modern lndonesia. Tradisi sastra lisan ini bertahan cukup lama dan telah menjadi semacam ekspresi estetik masyarakat dalam tiap-tiap daerah atau suku yang tersebar seantero Nusantara. tetapi keduanya menciptakan keterpaduan menyangkut konvensi atau struktur. ketika sebagian kalangan menganggap bahwa tradisi sastra tulis itu mempunyai nilai lebih tinggi dalam konteks ihwal pembangunan karakter bangsa yang lebih maju dan mengikuti perkembangan arus zaman. tetapi juga mengandung berbagai informasi tentang nilai-nilai kebudayaan tradisi yang bersangkutan. sastra lisan dapat diperlakukan sebagai gerbang untuk memahami salah satu atau keseluruhan unsur kebudayaan daerah yang bersangkutan. baik pada genre syair maupun cerita rakyat. maka eksistensi tradisi lisan terlihat semakin dekaden. baik dari segi sejarah maupun tipotogi. Teeuw (1983) bahwa sastra. Oleh karena itu.sebagai salah satu bentuk ekspresi budaya masyarakat pemiliknya. yang notabene 36 . bahkan hampir saja punah. Fenomena penganaktirian sastra lisan ini pada dasarnya tidak sejalan dengan realitas empiris sejarah yang menunjukkan bahwa sastra lisan dan sastra tulis tidak sekadar hidup berdampingan. tidak terpecah-belah berdasarkan pertentangan yang tidak hakiki. Namun. tidak dapat kita pungkiri. Sastrawan Sapardi Djoko Damono (1999) menunjukkan bahwa puisi lndonesia modern. tidak baik apabila dilakukan pemisahan antara sastra lisan dan sastra tulis. sebagai salah satu data budaya.

seperti rima.modern. sehingga mempunyai nilai tawaryang cukup tinggi nantinya di pasar budaya global. tidak bisa tepas dari konsepsi kemapanan. Bertolak dari fenomena tersebut. Bahkan. Apalagi dewasa ini. Tradisi lisan yang merupakan corak masyarakat kuno (awam). Tradisi lisan yang berkembang sebagai corak kebudayaan kita yang azali dalam dimensi dan aspek apa pun saja pada akhirnya akan mengundang decak kagum bangsa-bangsa asing. asonansi.adalah sastra tulis. tradisi lisan merupakan salah satu bentuk semangat. dapat dikatakan bahwa sastra lama sebagai penunjang berkembangnya sastra modern. Dengan begitu. irama. mengapa tradisi sastra lisan mesti dianaktirikan dari pada sastra tulis? Adakah sesuatu yang rnerupakan kesatuan dan keseluruhan itu dapat pisah-tempatkan secara timpang? Persoalan ini. dan onomatope. harga diri dan tradisi bangsa lndonesia. di mana sekat-sekat ruang budaya tidak lagi dapat mempertahankan dirinya dari arus zaman. karena tradisi tulis-menulis selalu identik dengan kemajuan sebuah peradaban keilmuan. terinspirasi oleh tradisi lisan seperti pantun dan mantra. Pendapat ini menciptakan adanya tendensi penganaktirian dan seakan mengabaikan terhadap terjadinya suatu paratetisme dari kedua konsepsi (tisan dan tulis) yang sesungguhnya bersifat kesatuan dan keseluruhan itu. Supaya suatu bangsa menjadi maju seiring arus zaman. paralelisme. maka tradisi lisan harus diubah kepada budaya menutis. piranti puitis yang kini lekat menjadi idiomatis dalam puisi lndonesia. metrum. suatu corak yang dibawa oleh modernisme. 37 . dipandang misatnya oleh Ayu Sutarto (2004) dan Daniel Dhakidae (1996). repetisi. Tapi. apakah semangat pemberdayaan budaya tulis menjadi umpan-balik pengabaian terhadap tradisi lisan? Jika kita sadari. tampaknya menjadi semacam keniscayaan bahwa tradisi lisan merupakan sumber paling utama bagi penciptaan sastra tulis. aliterasi. merupakan bagian urgen dari konvensi kelisanan. sebagai pcngharnbat kernajuan bangsa. menurutnya. Lalu yang menjadi pertanyaan.

karena pada hakikatnya seluruh entitas kebudayaan senantiasa membentuk suatu jejaring hidup antara satu dan lainnya. 38 . Demikian juga dengan persoalan ini. yang berkenaan dengan penganaktirian atau penomorduaan suatu kebudayaan daripada kebudayaan lain semestinya tidak harus ada. Selain dari pada itu. selain juga untuk memuaskan sebentuk rangkaian dari sejumlah kebutuhan nalur! kehidupan kita yang harus disadari. terciptanya paraletisme antara tradisi tulis dan tradisi lisan akan semakin memperkaya khazanah kesusastraan kita. pemenuhan tujuan akan suatu kebudayaan sesungguhnya terletak pada bagaimana kebudayaan itu dapat dilestarikan sepanjang zaman. Fungsi dari unsur-unsur kebudayaan ini adalah dipergunakan untuk memelihara keutuhan konstruksi dua kebudayaan tersebut. Paralelisme. Dengan demikian. tidak mengharapkan terciptanya konstruksi budayabaru (komodifikasi budaya) dari dua kebudayaan yang berbeda.kehadiran tradisi sastra lisan dari berbagai banyak modelnya akan mengesankan bahwa bangsa lndonesia tidak lupa dan tidak gampang melupakan sejarah tumpah darahnya. dalam arti yang sebenarnya. Paralelisme di sini dimaksudkan sebagai kerangka konseptual yang mencoba untuk mengintegrasikan antara dua kebudayaan atau lebih. Pelestarian tradisi sastra lisan semestinya bersanding dengan pemberdayaan tradisi sastra tuhs. Karenanya. bahwa tradisi sastra !isan tidak harus dipisahkan atau bahkan dianaktirikan dari pada tradisi sastra tulis. tetapi ingin memenuhi niatan bahwa peiestarian budaya adalah hal yang niscaya untuk diiakukan. karena dua kebudayaan ini merepresentasikan kekayaan khazanah kesusastraan kita.

Hal ini menunjukkan bahwa sastra lisan adalah milik bersama. nilai dan adat kebiasaan yang ada 39 . Kadang juga dengan mnemonic devices yang artinya dengan menggunakan alat bantu gerak isyarat atau bantu pengingat agar masyarakat yang lain mudah memahami maksud dari cerita yang diceritakan tersebut. Cerita tersebut menjadi milik masyarakat Padang karena pelatarannya berada di Padang. bukan milik pribadi dari anggota masyarakat. Tradisional Sikap dan cara berfikir serta bertindak yang selalu berpegang teguh pada norma. Taiigkuban Perahu. 2. Contoh : Kisah Malin Kundang. Hal ini dilakukan karena banyaknya masyarakat yang belum mengenal aksara sehingga sulit untuk menyampaikan pesan dan amanah yang terkandung dalam cerita.CIRI SASTRA LISAN 1. Contohnya: Kisah Timun Mas. Anonirn adalah tidak diketahui. 4. Contoh:penyebaran dakwah para wali songo yang menggunakan sastra lisan dalam dakwahnya. Cirri anonym adalah bukti bahwa sastra lisan adalah milik bersama-sama yang seolah-olah diciptakan oleh masyarakat itu sendiri. 3. BAB VI CIRI . Bukan milik anggota masyarakat dari Sumatera Barat. Milik bersama suatu kolektif Maksudnya sastra lisan adalah milik masyarakat. dan lain-lain. Diwariskan secara lisan. masyarakat tidak ada yang mengetahui siapa awal mula yang memiliki cerita tersebut. pada mulanya pengarang tidak menyebutkan dirinya dalam karyanya tersebut. Sumatera Barat. para guru atau petuah-petuah menyampaikan dan disampaikan dengan lisan agar dapat dipahami oleh masyarakat dengan mudah. kadang dengan mnemonic devices Pewarisan sastra iisan ini adalah dengan lisan atau dari mulut ke mulut secara turun-temurun. Sastra lisan tidak diketahui pengarangnya. Dan tidak ada pula masyarakat yang mengaku- ngaku tefah memiliki sastra lisan tersebut.

Diwariskan dalam rentang waktu tama Sastra lisan diturunkan dari satu generasi ke generasi berikutnya. dalam waktu yang relative lama. secara turun-temurun. Contoh: kisah Malin Kundang. entah ditambahkan atau dikuranngi yang tanpa menyebabkan perubahan makna cerita. Sehingga keutuhan jalan cerita suatu sastra lisan tersebut sangat kuat dan berperan di dalam masyarakat. Perbedaan versi tersebut. karena para pencerita mempunyai gaya masing-masing dafam menyampaikan amanah dari suatu cerita tersebut. Kebanyakan cerita dari sastra lisan menggambarkan keadaan masyarakat tersebut dan membuka konsep-konsep kebudayaan yang berkembang pada masyarakat pada zaman itu. Eksis dalam versi dan varian Karena kekreatifan si pencerita menyebabkan adanya sedikit banyak dari isi cerita mengalarni perubahan. 7. tapi masih hidup sampai sekarang. 40 . Bentuknya tetap Plot atau alur dan makna yangterkandung dalam sebuah cerita tersebut tetap dan tidak berubah. Dari awal cerita itu dikenalsampai sekarang isi ceritanya tidak ada perubahan dan tetap. Contoh: kisah Wafi Songo yakni ada yang mengatakan bahwa wali songo telah membunuh Syeikh Siti Jenar. 6. Terdapat unsur interpofasi Suatu sastra lisan memiliki keterkaitan dengan keadaan masyarakat yang menjadi setting dari cerita tersebut. sastra ini bisa tersebar fuas dikalangan masyarakat dengan mengandalkan keaktifan pencerita. 5. Contoh: cerita Malin Kundang menggambarkan adat masyarakat setempat yakni budaya merantau berlaku bagi anak laki-laki dewasa. sehingga menimbutkan beragam versi dan varian dalam cerita yang disampaikan. tidak mengurangi amanah cerita yakni tidak ada makhuk yang seimbang dengan Tuhan apalagi mengaku Tuhan. Contoh: dijadikan sebagai hiburan masyarakat tetapi tidak menyalahi adat. sedangkan di versi cerita lain ada yang mengatakan bahwa Syeikh Siti Jenar belum meninggal. begitu pula dengan amanat yang terkandung di dalamnya. 8.

b.yakni sastra lisan berfungsi sebagai penghibur dalam masyarakat. Tetapi serta-merta. Ada formula Ada banyak kreasi masyarakat yang berperan sebagai pencerita menambahkan atau membubuhkan kalimat yang pada mulanya tidak tertera dalam cerita. Ada pola-pola tertentu Dalam cerita tersebut terdapat motif-motif atau unsure-unsur yang terdapat dalam cerita sehingga mempunyai gambaran fuar biasa tetapi tetap menarik perhatian untuk tetap didengar dan dilestarikan. Ada fungsi: a. Menggunakan kalimat klise Pencerita cenderung banyak menirukan gaya bahasa atau gaya bercerita sesuai dengan siapa dan dari mana ia memperoleh cerita tersebut. c. Didaktik. 9. Spontan Sastra lisan diturunkan tidak dengan unsure kesengajaan. 14. Protes sosial. Pencerita menurunkan atau mewariskan cerita tersebut adalah karena dengan doronga hati tanpa unsure penekanan atau tidak karena anjuran. Ada proyeksi keinginan Pencerita mempunyai peran penting dalam berkembangnya sastra lisan. Formula-formula yang terdapat dalam cerita misalnya pesan cerita sebagai pendukung pencerita dan penarik perhatian pendengar cerita. yakni memiliki unsure pendidikan. Misalnya dongeng si kancil yang sangat humoris dan kental akan imajinasi. 12. tanpa pikir panjang. Banyak berbagai sastra fisan yang bertema humoris dan mengandung unsure pelipur lara. Sastra lisan juga berfungsi sebagai media pendidikan masyarakat karena didalamnya terkandung berbagai amanah dan pesan penting yang juga harus dipahami oleh masyarakat. Tapi tidak mengandung unsur apa- apa. 10. Bahasa atau kafimat sering dijumapi sama atau identik denga cerita semula atau pencerita asal. Pelipurlara. 11. Misalnya dengan bersantai atau dengan memasukkan cerita dan menjadikan sebuah contoh dalam kegiatan belajar. Biasanya awal mula pencerita menceritakansastra lisan adalah dengan gaya seadanya. 13. yakni sastra lisan yang berkembang juga 41 . tanpa rencana lebih dahulu.

termasuk bentuk media pada jaman yang bersangkutan untuk
menyampaikan apa yang menjadi aspirasi masyarakat. Sebuah cerita
bisa mewakilkan isi hati masyarakat. d. Sindiran, yakni sebuah
ungkapan yang disampaikan oleh masyarakat dalam bentuk sastra
lisan, misalnya lagu rakyat, pantun rakyat dan lain sebagainya.
15. Bersifat pralogis Kadang kala dalam sastra lisan memiliki alur yang
kompleks, akan tetapi dalam ceritanya juga mendahului dan melangkahi
logika. Karena turun-temurun dan tanpa diketahui kebenarannya
dengan pasti, banyak pula cerita mengandung jalan cerita yag tidak
asuk akal dan diluar nalar dan ajaib. Misalnya: cerita Tangkuban Perahu
yang ceritanya adalahsebuah perahu ditendang dan bisa menjadi
gunung. Cerita tersebut sangat sulit dipercaya apabifa terjadi di jaman
yang sekarang ini.
16. Berbentuk puisi, prosa(panjang-pendek) dan prosa beriramd Sastra
lisan memiliki berbagai jenis dan tersebar dalam masyarakat.
Diantaranya folkstory. folktale, folkspeach,volkskunde, dan lain-lain.
Contohnya: fagu rakyat misalnya lir-ilir, pantun-pantun rakyat yang
menyebar di masyarakat dan dijadikan petuah dan lain-lain.
17. Ada piranti paraklisme Ada petimbangan atau perbandingan dan saling
berhubungan dengan zaman yang sekarang. Kebanyakan isi atau
amanah dari sastra lisan adalah cerminan kehidupan masyarakat
sekarang atau generasi berikutnya. Haf ini berperan untuk masyarakat
pandai-pandai mencerna isi dan maksud dari amanah yag terkandung
dalam sastra lisan agar tidak salah jalan dan salah pengertian.
18. Beris kearifan hidup universal isi dan amanah dari sastra lisan adalah
menyinggung tentang kenyataan. Ajaran dan amanahnya adalah
berlaku bagi sernua kalangan dan patut dijadikan acuan untuk hidup
oleh berbagai kalangan masyarakat. Amanahnya tidak berlaku hanya
untuk satu golongan kaum saja tetapi menyeluruh

42

BAB VII
TEORITEORI ANALISIS SASTRA
LISAN: MADZAB FINLANDIA
DAN TEORI PARRY-LORD

A. Pengantar
Minat dan perhatian berbagai kalangan dalam berbagai disiplin ilmu
untuk meneliti sastra rakyat berkembang sesuai dengan Perkembangan
ilmu-ilmu humaniora seperti ilmu sejarah dan ilmu sastra. Sepertj
dikatakan Teeuw, sebuah teks merupakan mozaik kutipan-kutipan dari
pusat kebudayaan. Hanya pembaca yang dapat menciptakan mozaik atau
jalinan teks tersebut. Dari luas bacaannya, dja menciptakan keseluruhan
makna yang tentu saja hanya berlaku baginya; karena setiap pembaca
memiliki medan bacanya sendiri, dan medan ini tidak ada batasnya
(Teeuw, 1 990: 220).
Pada awal Perkembangannya, studi sastra lisan sangat
berorientasi historis-komparatif, yang terutamatampak dalam kajian
Madzab Finlandia. Studi sastra lisan kemudian bergeser dari orientasi
historis-komparatif ke orientasi strukturalis (Vladimir Propp) dan orientasi
puitika (Parry dan Lord). Oleh karena kajian-kajian tersebut memiliki sifat
dan ciri kesastraan, dalam bab ini akan diulas pendekatan-pendekatan
tersebut, disertai dengan tinjauan mengenai kekuatan dan kelemahan
serta kemungkinan penerapannya dalam kajian sastra lisan di lndonesia.
Pendekatan-pendekatan ini tentu saja dapat dimanfaatkan oleh berbagai
disiplin ilmu, termasuk kajian ilmu sastra, untuk kepentingan kajiannya.

B.Madzab Finlandia: Historis Komparatif
1. Latar Belakang
Madzab Finlandia adalah sebuah aliran kajian sastra lisan yang
berkembang di Finlandia dan berpusat di ibu kota negaranya, Helsinki.
Aliran ini mengembangkan metcde dan teori historis-komparatif yang

43

bersifat sistematik. Perlu diketahui bahwa pada awal abad ke-1 9, minat
utama ilmu pengetahuan lebih terarah pada penciptaan, asal-usui cerita
rakyat, sesuai dengan pendekatan sejarah yang umum berlaku dalam
ilrnu sastra. Sastra rakyat di Eropa Barat dibandingkan dengan sastra
rakyat di bagian dunia lain seperti Eropa Selatan dan Eropa Timur. Studi
bandingan mereka bertujuan untuk a) memperlihatkan hubungan antara
berbagai sampel sastra rakyat; b) mengungkapkan pola penyebaran atau
migrasi sastra rakyat itu; c) melacak dan menjelaskan tempat asal sebuah
cerita rakyat; dan d) sedapat rnungkin mengetahui bentuk asli sebuah
cerita rakyat yang telah rnengalami berbagai transformasi.
Krohn dan Aarne adalah pelopor studi historis-komparatif itu.
Mereka memulai kajiannya dengan metakukan studi terhadap epos
nasional Finlandia yang berjudul Kalevala, yang sesungguhnya
merupakan ciptaan abad ke-19 berdasarkan berbagai macam cerita epos
rakyat klasik. Mereka mengupayakan dilakukannya sebuah usaha raksasa
untuk mengumpulkan, mengklasifikasikan, dan membandingkan cerita
rakyat selengkap mungkin dan seluas mungkin, bahkan mereka-memiliki
cita-cita untuk menjangkau cerita rakyat di seluruh dunia (Teeuw,
1984:288-229).

2. Cara Kerja Penelitian
Bagaimana cara kerja Madzab Finlandia ini? Putuhan ribu cerita
rakyat dari seluruh dunia dikumputkan, diklasifikasikan dan disusun
sedemikian rupa sehingga perbandingan dan penelusuran sejarah setiap
cerita rakyat dimungkinkan. Untuk penggotongan cerita rakyat, madzab ini
menggunakan dua kriteria dasar yaitu type dan motif. Type berarti cerita
tersebut digolongkan berdasarkan tipe atau jenisnya. Berdasarkan tipe-
tipenya, Aarne-Thompson membuat sistem ktasifikasi dongeng yang
meng-golongkannya ke dalam tujuh jenis sebagai berikut.
1) Animal Tales (dongeng binatang), metiputi: binatang buas (serigala
yang pintar dan binatang buas lainnya), binatang buas dan binatang

44

kekuatan atau pengetahuan supranatural. barang-barang magis. raksasa ditakut-takuti oleh manusia. kebenaran yang terwujud. binatang peliharaan. 4) Realistic Tales atau Novelle (dongeng realistik). dan dongeng- dongeng keagamaan lainnya. perampok dan pembunuh. dan dongeng-dongeflg realistic lainnya. peliharaan. dan 45 . 3) Religious Taies (dongeng keagamaan). manusia menaklukkan raksasa. istri yang keras kepala belajar menjadi setia. suami yang bodoh dan istrinya. seorang wanita biasa menikah dengan sang pangeran. cerita tentang pasangan yang sudah menikah (istri yang bodoh dan suaminya. istri atau suami atau kerabat supranatural. Legenda terjadinya Gunung Kelud di Kediri termasuk animal tales karena melibatkan s9sok manusia berkepata kerbau bernama Lembu Sura. dan dongeng-dongeng lainnya tentang supranatural. hantu. meliputi: tantangan supranatural. hubungan antara manusia dan raksasa. surga. 5) Tales ofthe Stupid Orgre/Giant/Devil (dongeng tentang raksasa atau hantu yang bodoh). persaingan antara manusia dan raksasa. 6) Anecdotes andjokes (anekdot dan lelucon) meliputi:cerita-cerita tentang si pandir. tugas-tugas supranaturat. tindakan dan kata-kata yang cerdas. manusia membunuh atau rnelukai rciksasa. meliputi:imbalan hadiah atau hukuman dewa. bukti kesetiaan dan kemurnian. meliputi: kontrak kerja. Legenda terjadinya Gunung Kelud di Kediri dan Legenda Candi Loro Jongrang di Yogyakarta termasuk pula jenis ta!es of magic karena berkaitan dengan kekuatan-kekuatafl supra natural yang dimiliki tokoh Lembu Sura (Gunung Ketud) dan Bandung Bondowoso (Candi Loro Jongrang). 2) Tales of Magic (dongeng tentang hal-hal magis). dan binatang serta objek-objek Iainnya. binatang buas dan manusia. penolong supranatural. meliputi: cerita-cerita seperti seorang pemuda biasa menikahi putri raja. prinsip-prinsip hidup yang baik. jiwa diselamatkan dari gangguan setan. dongengtentang nasib.

sapu ajaib. lelaki bodoh). 1984: 53). lelucon tentang tokoh-tokoh agama (tokoh agama ditipu. cerita tentang seorang wanita (mencari istri. 2) Motif berupa hewan yang luar biasa. hewan 46 . pasangan yang bodoh). yang selalu dikaitkan dengan kematian. dan dongeng- dongeng formula lainnya. meliputi: dongeng- dongeng kumulatif (yang didasarkan pada jumlah. misalnya: tongkat wasiat. lelucon tentang kelompok masyarakat lain. atau kejadian-kejadian lainnya). Ada berbagai motif yang dapat ditemukan dalam berhagai cerita rakyat. lelucon tentang seorang nyonya tua). terdapat berbagai motif. benclabenda angkasa. raksasa. Beberapa rnotifyang biasa dijumpai dalam cerita-cerita rakyat aclalah sebagai berikut. mereka menyusun index atau katalogus tipe-tipe dan motif-motif yang dapat diterapkan secara universal pada cerita-cerita rakyat. manusia berasal dari sejenis pohon tertentu. dll. cerita tentang seorang laki-laki (pria yang cerdas. Hal ini akan berkaitan dengan keyakinan religious ataupufl fauna dan flora toten). lampu ajaib. objek. Cerita asal- usul manusia. yang dimaksud-kan dengan motif adalah unsur-unsur suatu cerita (narratives elements). 7) Formula Tales (dongeng yang memiliki formula). singa berkepala manusia. atau nama. Secara lebih lengkap. keberuntungan. buaya siluman. tanah Iiat. binatang. Berdasarkan kriteria tersebut. misalnya kuda yang bisa terbang. 1) Motif berupa benda. Motif didefinisikan sebagai anasir terkecil dalam sebuah cerita yang mempunyai daya tahan dalam tradisi. Motif teks suatucerita rakyat adalah unsur dari cerita tersebut yang menonjol dan tidak biasa sifatflya (Danandjaja. makan. Ada yang mengatakan manusia dibuat dari tanah liat. manusia berasal dari telur burung garuda. tokoh agama dan perihal seks). bunga mawar. misalnya. dongeng tentang jebakan.

flora dan fauna. Misalnya konsep yang menjelaskan mengapa wanita hamil tak boleh makan pisang kembar. menyamar sebagai fakir miskin. moksa. Mengapa wong sukerto atau orang yang dianggap sial harus diruwat atau harusmenjalankan ritual. Mengapa seorang anak gadis tidak boleh makan di ambang pintu. mengapa manusia perlu hidup dalam keseimbangan kosmos. menghambakan diri. yakni menyamar (Pangeran Asmara Bangun menyamar sebagai Ande Ande Lumut dan Dewi Sekar Taji sebagai Kleting Kuning). Mengapa perludilakukan ritual bersih desa. Motif tentang Jarangan menghina ibu kandung. yang bisa berbicara. Jawa Timur. Dalam dongeng Ande Ande Lumutdari Kediri. dll. Mengapasetelah sunat tradisional (sifon) seorang lelaki harusmelalui hubungan seks ritual dengan tiga perempuanyangbukan istrinya. misalnya. Misalnya mengapa manusia perlu menjaga kelestarian hutan. 4) Motif berupa suatu perbuatan (ujian ketangkasan. Mengapa pohon- pohontertentu di hutan tidak boleh ditebang atau diambilkayunya. Jika dikaji secara lebih mendalam. misalnya laranganatau tabu. dapat dijumpai dalam Legenda Malin Kundang (Minangkabau) dan Legenda Batu Menangis (Kalimantan Barat). melakukan tindakan Iaku tapa. minum alkohol. Dalam dongeng Ande Ande Lumut. ayam jantan. bertemu di gunung. bertarung dengan raksasa. menghambakan diri (Dewi SekarTaji menjadi 47 . turun dari gunung. terdapat motif perbuatan ini. misalnya. ular naga. dikisahkan tentang seekor kepiting raksasa bernama Yuyu Kangkang dan seekor burung bangau raksasa yang bisa berbicara. akan dijumpai berbagai kearifan lokal kelompok-kelompok etnis melalui motif ini. 3) Motif yalg berupa suatu konsep. Mengapa perlu dilakukan ritual sedekah lautoleh masyarakat nelayan. Motif yang berupa konsep-konsep larangan ataupun anjuran seperti ini banyak dijumpai dalam cerita-cerita rakyat di lndonesia. burung phoenix. melewati alam gaib.

dan si Kahayan. Dalam legenda Candi Roro Jongrang. 6) Motif yang menggambarkan tipe orang tertentu. Jaka Budug pun menikah dengan putri raja Prabu Aryo Seto bernama Putri Kernuning. Jawa Timur. raksasa yang bisa menelan manusia yang mudah ditipu. 48 . Ketika galian sumuritu hampir mendapatkan air. tokoh : yang selalii tertimpa nasib sial seperti si Pandir. pembantu Nyai Intan). dll. tokoh pelaut ulung seperti Hang Tuah. Sang Putri dan Prabu Brawijaya menyuruh orang untuk menutup sumur itu dengan tanah dan batu- batuan yang besar. ditipu oleh sang putri Dyah Ayu Pusparani dengan menyuruhnya menggali sumur di puncak gunung Kelud. hewan). tokoh pemberani seperti Si Pitung. Legenda Gunung Kelud dan Legenda Candi Loro Jongrang memiliki motif penipuan. Bandung Bondowoso pun mengutuk Roro Jongrang menjadi salah satu candi. sengaja digagalkan oleh Roro jongrang. 5) Motif tentang penipuan terhadap suatu tokoh (raksasa. Dalam kajian Madzab Finlandia. Lembu Sura yang telah berhasil memenangkan sayembara merentang busur sakti Kyai Garudayeksa dan mengangkat gong Kyai Sekardelima. Di lndonesia banyak dijumpai motif hewan-hewan yang luar biasa. Dongeng Jaka Budug dan Putri Kemuning dari daerah Ngawi. seperti cerita tentang kancil. Merasa telah dibohongi oleh Roro Jongrang. Jaka Budug (budug artinya kudis) berhasil mendapatkan daun sirna ganda setelah membunuh ular naga yang menjaga daun tersebut. Dalam Legenda Gunung Kelud. maka mereka mengajukan dua pandangan teoretis yang berbeda. Bandung Bondowoso yang hampir sukses mendirikan seribu candi dan dua buah sumur dalam waktu semalam. bermotifkan sayembara uji ketangkasan mendapatkan daun sirna ganda. jika ditemukan dua motif yang sama pada dua kelompok etnis yang berbeda. misalnya yang sangat pandai seperti Abu Nawas. tokoh yang sangat bijaksana seperti raja Sulaiman.

Fablia•ux. Dengan metode perbandingan yang cukup sulit dan memakan waktu yang lama. Examp!a. yakni: teoriyang mengatakan bahwa motiftertentu pasti berasal dari satu daerah. berkembang menurut tingkatan-tingkatan. Bandingkan pula teori poligenesis ini dengan pandangan Carl Gustav Jung tentang arketipe. 2) Teori Poligenesis. dan teori Indianist Theodore Benfey. and Local Legends (1 966) yang terdiri dari enam jilid. Mediaeval Romances. savage) sampai ke tingkat tinggi (modern. jest-Books. canggih). Fables.1) Teori Monogenesis. yakni dari tingkat rendah (primitif. yakni: teori yang berpandangan bahwa motif-motif tersebut merupakan penemuan-penemuan ter-sendiri yang tidak ada kaitannya (independent invention) atau sejajar (parallel invention). Stith Thompson (1885-1976) berhasil menyusufl sebuah buku yang memuat berbagai motif dan index cerita--erita rakyat di seluruh dunia dalam sebuah biiku berjudul Motif-lndex of FoIk Literature: A Classificat ion of Narra tive E!ernents in Folktaies. Menurut mereka. Penganut dan peloporteori ini antara lain:Jacob dan Wilhelm Grimmm. 49 . seperti halnya tanaman dan hewan. Dalam buku itu dapat diketahui apakah cerita rakyat yang kita petajari itu unik atau hanya merupakan salah satu versi atau variafl dari cerita rakyat yang ada di dunia. Penganutteori ini antara lain teori survival dari anggota English Antropologist. teori mitologi matahariMax Muller. antropolog lngris yang mendasarkan teorinya pada teori evolusi kebudayaan (berdasarkan pandangan Charles Darwin). Buku itu memuat katatogus tipe-tipe dan motif-motif yang dapat diterapkan secara universal pada cerita rakyat. kebudayaan. Ballads. Baru kemudian terjadi proses penyebaran atau difusi (diffusion). Myths. Berdasarkafl penggolongafl ini sejarah hidup (life history)sebuah cerita rakyat kemudian ditelusuri oleh peneliti dengan membandi ngkan sebanyak mungkin varian-varian cerita yang tipe dan motifnya sama.

Kemakmuran mereka diketahui oleh orang-orang suku Soge (Maumere). Cahaya api itu sampai ke perkampungan Paji. Di puncak gunung itu. Pada suatu malam. Lia Nurat membuat api unggun di puncak lIe Mandiri. 3. Prinsip pendekatan dan hasilnya yangterpenting dituangkan dalam buku Thompson (1977) berjudul The Folktale. lahirlah tujuh orang anak yang kelakmenurunkan suku-suku Ile Jadi di Baipito. yang kemudian dinamakan Wato Wele (seorang wanita) dan Lia Nurat (seorang Iaki-laki). Mereka hidup berkecukupan. Dari sebutir telur itu. Di sana dia bertemu dengan Lia Nurat. Mazhab Fintandia yang berpusat di Helsinki ini kemudian dikenal sebagai pusat organisasi peneliti dari seluruh dunia yang disebut Historico Geographico School. Lia Nurat berjanji akan turun ke perkampungan Paji. sebuah mitos genealogis masyarakat Baipito yang tinggat di seputar Gunung Ile Mandiri. Sinar api itu menimpa seorang gadis Paji bernama Hadung Boleng Teniban Duli. Suku Suban Lewa Hama. Lia Nurat mengantar adiknya Wato WeIe untuk menempati bagian selatan lIe Mandiri sedangkan Lia Nurat sendiri menempati bagian utaranya. Pada mulanya Ema Wato Sem Bapa Madu Ma yang tinggal di Sina Jawa menyuruh orangtuanya yakni burung garuda untuk terbang menuju ke puncak gunung IIe Mandiri. Wato Wele dan Lia Nurat dipelihara dan dibesarkan oleh hantu gunung hingga menjadi dewasa. saudara Hadung Boleng itu disuruh pergi ke puncak IIe Mandiri mencari asal api unggun itu. Analisis HistoriS-Komparatif Kisah WatoWele -Lia Nurat Berikut ini dikemukakan sebuah contoh sebagai ilustrasi analisis historis-komparatif dengan Kisah Wato Wele -Lia Nurat. Iahirlah dua orang anak kembar. Dari pernikahan itu. Raja suku Soge pun mengantarkan anaknya yang bernama 50 . sang garuda meletakkan telurnya. Lia Nurat pun turunlah ke perkampungan Paji dan menikah dengan Hadung Boleng.

kehidupan mereka kembali menjadi makmur. Raja Suku Soge sangat marah. Kedua tokoh mitologis (mythical figure) ini pun dikenal sebagai manusia pertama yang menurunkan suku- suku asli yang disebut Suku Baipito di seputar gunung Ile Mandiri. Cerita Wato Wele -Lia Nurat dapat digolongkan ke dalam Tales of Magic (dongeng tentang hal-hal magis). Dalam cerita ini. Terjadi perang di Adonara.Uto Watak untuk diperistri Lia Nurat. Klasifikasi dan kajian berdasarkan motif cerita terhadap cerita Wato Wele-Lia Nurat akan menghasilkan dua temuan yang menarik. tokoh yang tidak dilahirkan dari rahim seorang wanita biasa. Menghadapi cerita mitologis semacam ini. Suatu ketika Hadung Boleng bermimpi melihat pusat gunung. Berdasarkan klasifikasi tersebut. Kedua tokoh kembar ini adalah tokoh mitologis. 1) Motifhewan yang luar biasa. Kelima putra Lia Nurat ikut berperang mernbela adik perempuan mereka. Dia pun mengusir Uto Watak. putra sulung Lia Nurat. Keempat putra Lia Nurat yang masih hidup kembali ke IIe Mandiri dan membagi tanah warisan di antara mereka. Kadar 51 . Unsur-unsur supra-natural lainnya dari kedua tokoh ini adalah orang yang mengasuh dan membesarkan mereka bukanlah manusia biasa melainkan hantu gunung. Mereka datang menyerbu dan membunuh Lia Nurat. kehidupan Hadung Boleng dan ketujuh anaknya sangat menderita. kajian selanjutnya akan difokuskan pada perbandingan dengan teks-teks lainnya untuk meneliti asal-usul dan pola persebarannya. Dalam perang tersebut. Hal ini menunjukkan asal-usul kedua tokoh ini yang sangat mistis. pendekatan penelitian historis-komparatif pertama-tama akan melakukan klasifikasi berdasarkan type dan motif. melainkan dari sebutir telur burung garuda. Hadung Boleng tidak senang dengan kehadiran Uto Watak. Setelah Lia Nurat meninggal. yakni Blawa Burak Sina Puri tewas terbunuh. Dengan mimpi itu. Berdasarkan tipe-nya. tokoh Wato Wele dan Lia Nurat diceritakan berasal dari sebutir tetur burung garuda.

Diceritakan bahwa Uto Watak Teluma Bura diantar ke puncak gunung. dan dengan demikian membawa malapetakabagi keluarga Lia Nurat. Pertama. yaitu nama ritual untuk menyebutkan tokoh Sem. Dikisahkan bahwa Nabi Nuh memiliki tiga orang anak. Dalam cerita Wato Wele - Lia Nurat. Dikisahkan bahwaLia Nurat turun dari gunung mendatangi perkampungan Paji dan menikahi Hadung Boleng. konsep tentang kepatutan adat pernikahan. Sem adalah putra sulung Nabi Nuh yang dipercaya menurunkan semua penduduk Sina Jawa. ke rumah LiaNurat.Hadung Boleng Teniban Duli dan Uto Watak TelumaBura. yang tidak bisa diidentifikasi). dan tidak pernah menganggapperempuan sebagai bahan persembahan kepada pihaklaki-laki. 2) Motif berupa konsep-konsep aturan adat-istiadat daerah. Ham. Nenek moyang mereka adalah Ema Wato Sem Bapa Madu Ma.dikisahkan bahwa Lia Nurat memiliki dua orang istri. Pernikahan denganUto Watak Teluma Bura adalah pernikahan yang tidak layak. 52 . 6: 9-22). Kajian historis-komparatif selanjutnya akan membandingkan kesamaan tipe dan motif tersebut dengan tipe dan motif dari daerah yang lainnya untuk mengungkap wilayah persebaran dan asal-usul cerita tersebut. Perhatikan bahwa kisah ini telah mengalami interteks dengan Kitab Suci Perjanjian Lama (Kej. Pernikahan dengan Hadung Boleng Teniban Duliadalah pernikahan yang ideal. mitologis kedua tokoh ini diperkuat dengan cerita bahwa nenek- moyang mereka sesungguhnya berasal dari sebuah negeri yang sangat jauh (Sina Jawa adalah ungkapan khas masyarakat Lamaholot Flores Timur untuk rnenyebutkan sebuah tempat yang sangat jauh. dan Yafet. di mana pihak laki-lakimendatangi rumah pihak wanita. Masyarakat Flores Timur sangat menghargaipihak perempuan. yaitu Sem. dan bahwa ketiga anak ini berpencar ke semua bangsa di muka bumi ini.

Motif burung garuda dapat ditemui di zaman para kaisar di Kerajaan Romawi Kuno. Jepang. padang Siberia. Pertanyaan bermula dari manakah motif garuda itu akan sangat sulit dijelaskan. Motif burung garuda adalah sebuah motif yang sangat penting dalam banyak peradaban di dunia ini. 4. Motif konsep tentang adat-istiadat amat menarikuntukditelusuri dan dipetakan wilayah persebarannya narnun sukar menentukan asal usul konsep tersebut. 1982: 233-328). dan Afrika. Selain itu. Penggolongan itu 53 . Keberatan utama terhadap metode historis-geografis ini adalah tidak mudah melakukan klasifikasi terhadap berbagai cerita rakyat berdasarkan tipe dan motif. 1984: 290). Garuda dipandang sebagai king ofthe birds yang bertugas sebagai pembawa pesan dari kekuatan langit. dan lnclian Amerika. Langit dan Bumi diganibarkan dengan oposisi garuda dan ular atau pertarungan malaikat melawan setan. Akan tetapi metode mereka memiliki kelemahan dan banyak mendapat kritikan (Teeuw. Garuda pun clapat terhang tiiiggi sendirian di langit dan menatap tajam tanpa berkedip (Chavalier. kesimpulan tentang tua mudanya dan asli tidaknya varian tertentu sebuah cerita rakyat pun sangat sukar dibuktikan. garuda adalah simbol matahari. Napoleon Bonaparte. Keunggulan dan Kelemahan Berbagai pakar dunia mengakui bahwa metode penelitian mazhab Finlandia menghasilkan banyak sekalistudi yang menarik dan memperkaya pengetahuan kita mengenai cerita rakyat di seluruh dunia. Kekacauan klasifikasi pasti akan mudah dialami oleh para peneliti yang mencoba menggolong- golongkan sebuah cerita rakyat ke dalam tipe dan motif tertentu. Dalam mitotogi Artik (Kutub Utara). Garuda adalah simbol primitif dan kolektif untuk bapak atau segala gambaran tentang bapak. Amerika Utara. Klasifikasi Aarne dan index Thomson sampai sekarang masih tetap memiliki nilai yang penting untuk penelitian cerita rakyat. Asia Utara. Cina.

C. Latar Belakang Masalah penciptaan sastra lisan menjadi bidang perhatian utama dua ahli bahasa Yunani. yakni Milman Parry (1902-1935) dan asistennya Atbert B. dan sebuah cerita rakyat dipecah-pecah ke dalam sejumlah motif. Sekalipun banyak ditemui kendala dalam menggunakan klasifikasi Aarne dan index Thomson. tanpa dicampuri berbagai konvensi yang muluk-muluk tetapi yang 54 . tidak konsisten. Sudah cukup tama Homerus sebagai penyair dipermasalahkan dalam ilmu sastra klasik Barat. khususnya penciptaan puisi Odysee dan llias karya Homerus. Dalam contoh Kisah Wato WeJe-Lia Nurat di atas. Lord (1912-1991). Kedua peneliti ini memberikan sumbangan berharga bagi penelitian sastra lisan dari segi metode Penelitian dan konsep teori umum. Dengan demikian jetaslah bahwa mazhab ini tidak melihat sastra rakyat sebagai karya sastra karena sastra rakyat itu dipecah-pecah dalam motif-motif tanpa memperhatikan fungsi dan makna motif-motif terebut. seorangpeflyair Yunani Kuno.seringkali bersifat subjektif. karena dalam karyanya diungkapkan hakikat emosi manusiawi. Klasifikasi semacam itu perlu diperluas jangkuannya agar dapat mencakup pula kajian mengenai makna dan fungsinya di dalam kelompok masyarakat pendukungnya.Lord: Penciptaan Sastra Lisan 1. bukubuku mereka masih tetap mempunyai nilai sebagai acuan yang berharga dalam melakukan studi sastra rakyat. yang kaitan satu sama lainnyatidakjelas Jagi. Teori yang mereka temukan kemudian dikenal sebagai teori Parry-Lord. yang herakibat pada sulitnya memberikan sebuah penafsiran tunggal tentang asal-usul dan penyebarannya. Di satu pihak Homerus dikagumi sebagai seorang penyair klasik primitif dalam arti positif. Minat terhadap aspek penciptaan sastra lisan ini diilhami oleh ilmu sastra klasik Barat. tampak bahwa sebuah motif dapat saja memiliki wilayah persebaran yang sangat luas. Teori Parry .

abad ke-18. Dengan demikian. Akan tetapi. 1984: 295). Di Sorbone. yang biasanya dirumuskan dalam dua pertanyaan. sebuah penataan ulang yang memiliki konsekuensi yang besar pada berbagai disiplin lainnya. Homerus hanyalah seorang Rhapsodis ataupenyambung cerita. dia dibimbing seorang Jinguist Antoine Meil•let. Homerus mulai dipisahkan dari tradisi pengarang klasik yang agung. Alasannya Homerus adalah seorang buta huruf. (1) Siapakah Homerus itu? Dan (2) apa sajakah puisi-puisi Homerus itu? Pertanyaan Homerus ini sudah pernah d. Satualiran beranggapan bahwa pada awalnya karya Homerus terdiri atas nyanyian- nyanyian tersendiri. dan ArnoJd van Gennep. yang mernbimbingnya kearah pemahaman yang mendalam mengenai formula. Sumbangan Parry adalah mem-pertanyakan kembali asumsi-asumsi dasar yang mem-pengaruhi penelitian. Menurut Parry. seperti Marcel Jousse.kehitangan keasliandan dirusakkan oleh kebudayaan (Teeuw. Aliran lain menganggap puisi Homerus sangat halus dan berjalinan erat sehingga epos tersebut pasti diciptakan sebagai satu kesatuan yang utuh oleh seorang pengarang yang jenius. formula adalah sekelompok 55 . Cara penciptaan puisi Homerus juga mulai dipermasalahkan.ijawab oJeh para pakar sebelumnya. sangat ironis bahwajustru di zaman klasik. seorang urakan. Teori dan Metode Parry . Odysee dan llias. Milman Parry mulai bergelut dengan apa yang saat itu disebut sebagai Pertanyaan Homerus (Homeric Question). 2. Segera setelah selesai pendidikannya dalam bidang Klasik pada Universitas California. Pada akhir abad ke-19 ada dua anggapan yang saling bertentangan.Lord Milman Parry adalah lulusan Universitas Catifornia di Berktey dan Universitas Sorbone di Paris. Berkeley. gaya bahasanya dan gambarannya tentang dewa-dewa dan manusia bersifat kerakyatan dan kasar. yang kemudian oleh tradisi dipadukan menjadi dua epos yang terkenal. Matija Murko.

dan b) cara tradisi jni diturunkan dari guru ke muridnya. dia melakukan penelitian Japangan di Yugoslavia untuk membuktikan sendiri proses penciptaan epos rakyat itu. 1984: 297). teori Parry -Lord tentang penciptaan sastra lisan itumencakup aspek-aspek: formula dan ungkapan formulaik. Guslar). Maka bersama dengan muridnya Albert B. Hasil penelitian mereka. Mereka juga meneliti c) resepsi karya sastra ituoleh masyarakat. Parry adalah orang pertama yang mencoba membuktikan bahwa karya Homerus merupakan karya utuh dan sempurna. Milman Parry tidak puas dengan hipotesisnya itu karena dihangun herdasarkan bahan-bahan yang berasal dari tiga ribu tahun yang lalu. tetapi berdasarkan konvensi tradisi Lisan itu dia menciptakan karya sastranya sebagai suatu keseluruhan. proses penciptaan sastra lisan dapat dicermati dari cara mereka memanfaatkan persediaan formula yang siap pakai sesuai dengan konvensi sastra yang berlaku. Bahwa Homerus memang memanfaatkan dan menggali kekayaan tradisi lisan pada zamannya. Yugoslavia dipilih karena di sana masih cukup banyak penyanyi epos rakyat. diterbitkan Lord dalam buku berjudul Thesinger of Tales (1960) yang kini menjadi sebuah buku klasik ilmu sastra (Teeuw. lincah dan hidup karena selalu diciptakan dan dihayati kembali sesuai dengan daya cipta pembawa maupunpenikmatnya (Teeuw. Menurut teori Parry-Lord. tema-tema 56 . Parry & Lord membuktikan bahwa struktur sastra lisan selalu berubah-ubah. mereka meneliti a) teknik penciptaan epos rakyat.kata yang secara teratur digunakan dengan kondisi metris yang sama untuk mengekspresjkan sebuah gagasan yang esensial. Di sana mereka meneliti puluhan contoh epos rakyat seperti yang dinyanyikan oleh tukang cerita (dalam bahasa Yugoslavia. Dari berbagai epos itu. yaitu audience yang menghadiri performance. Jika diringkas. sesudah Parry meninggal. Lord. Berdasarkan penelitian yang dilakukan di Yugoslavia. 1988b: 299).

Formula dan ungkapan formulaik dalam penuturan sastra lisan bahkan tidak hanya berfungsi sebagai wadah menceritakan atau menjelaskan pokok isi suatu cerita tetapi merupakan pokok itu sendiri (Sweeney. Unsur-unsur itu biasanya dihafal sehingga wacana kebudayaan lisan sangat tergantung pada penggunaan ungkapan- ungkapan yang cukup baku dalam bentuk bergaya (fixed utterance in stylised form). misalnya dalam peribahasa-peribahasa dan kata-kata adat lainnya.atau kelompok gagasan. Formula adalah kelompok kata yang secara teratur dimanfaatkan dalamkondisi matra yang sama untuk mengungkapkan satu ide pokok. Sedangkan ungkapan formulaik adalah larik atau separuh larik yang disusun berdasarkan formula (Lord. Epitheton adalah kata sifat atau ktausa yang berfungsi sebagai kata sifat yang memerikan ciri khas seseorang atau sesuatu benda. Dalam penyusunan cerita. 1987: 96-97). a. 57 .dan teori penciptaan atau pewarisan. 1988b: 449-452). dalam epos Homerus terdapat sangat banyak epitet (epitheton). 1991: 523). yang dimanfaatkan langsung dalam posisi matra tertentu. keadaan dan lain-tain. Perhatikan tabel di bawah ini. Dengan demikian. bahwa modal utama penciptaan karya Homerus adalah dengan memanfaatkan persediaan formula dan ungkapan formulaik yang sangat menonjol. Formula dan Ungkapan Formulaik lde baru yang dilontarkan Parry adalah. Baik formula maupun ungkapan formulaik merupakan unsur-unsur yang siap pakai (stock-in- trade). cerita lebih menyerupai proses perakitan formula (Teeuw. unsur-unsur tersebut pasti dipergunakan. orientasi Lisan terutama tampak pada perangkaian potongan-potongan formula menjadi akumulasi formula. Sebagai ilustrasi. Abdullah. dalam arti setiap kali tukang cerita bertutur. Penggunaan epitheton yang begitu banyak tentu bukantah suatu kebetulan. 1976: 47. Hal-hal ituakan dibahas di bawah ini.

58 .

dari pengalaman para penyair Lisan ataupun pengalaman kita mendengarkan puisi yang sama dari berbagai penyair atau mendengarkan penyair yang sama menyampaikan puisi yang sama pada beberapa kesempatan berbeda. 1994: 218-262). Dalam strukturformal puisi. pola-pola lisan terlihat dalam penggunaan sarana retorika seperti: paraletisme. 1991: 522-558. Dalam struktur sintaksis. formula dan ungkapan formulaik sebagai orientasi lisan terlihat dalam struktur formal puisi dan struktur sintaksis puisi. terungkap bahwa sistem formula tidak hanya terdapat dalam tataran struktur formal dan struktur sintaksis melainkan juga dalam tataran struktursemantik. jumlah kata dalam larik dan bait. sistem pembaitan. Lord menyebut kelompok-kelompok ide itu sebagai tema-tema atau thernes (Lord. tidak ada alasan untuk mengatakan 59 . metonimia dan sinekdoke. mereka menemukan bahwa ternyata ada kelompok-kelompok gagasan yang secara teratur digunakan dalam penceritaan puisi tradisional yang bergaya formulaik. 1981: 68). repetisi dan erwrnerasi (lihat studi yangdilakukan Abdullah. dan gaya hahasa kiasan seperti: metafora dan perumpamaan. b.Tabel 2: Epitheton NO NAMA/KEADAAN/BENDA EPITHETON 1 Odyseus Polutlas (=yang banyak menderita) Polumetis (=yang banyak akalnya) 2 Achilles Poodas Ookus (=yang cepat kaki) 3 LiaNurat Koda Lia Nurat/Nurat Nunu Nama (=tali pencipta penunjuk jalan) Selain terwujud Dalam epitheton. Menurut Lord. Tema atau Kelompok Gagasan Dalam studi Parry dan Lord. pleonasme dan tautotogi. ironi dan sinisme seri ngkali dipergunakan secara berulang-utang. dan Taum. Dalam kajian naratif.

pengalaman para penyair lisan ataupun pendengar menyimak sebuah cerita yang sama dari beberapa penyair menunjukkan bahwa tema-tema tertentu seringkali muncul dalam cerita tersebut. tema-tema itu sering kati dimunculkan kembali. tema sebuah cerita tidak dapat diekspresikan hanya dalam sebuah rangkaian kata-kata saja. Pemakaian gaya bercerita semacam itu dalam rangka pembacaan menampilkan pula berbagai tataran semantik. Lord mengungkapkan bahwa tidak ada atasan bagi kita untuk menyatakan bahwa sebuah cerita hanya memitiki satu tema saja. Demikian pula jika kita mendengarkan sebuah kisah yang sama dari penyair yang sama dalam kesempatafl kesempatan berbeda. Dalam studi Abdullah (1991: 559-564. Taum. Tema-tema itu dapat berupa adegan-adegan siap pakai ataupun deskripsi bagian-bagian cerita yang 60 . Berdasarkan kenyataan itu. Jadi di samping formula dan ungkapan formulaik. Kelompok-kelompok ide itu oleh Lord disebut sebagai themes.barangkali dapat disejajarkan dengan pandangan Sweeney (1980: 33) tentang komposiSi skematis sebagai sebuah cara membangun komposisi cerita berdasarkan suatu kerangka jalan cerita yang dihafal (tema-tema yang juga siap dipakai oleh tukang cerita). Dengan kata lain. Kesimpulan ini ditarik berdasarkan penelitian tapangannya. Menurut dia. Dalam jagat sastra lisan.bahwa sebuah tema dapat diekspresjkan hanya dalam sebuah rangkaian kata-kata. Sebatiknya tema sekalipun bersifat verbaldirumuskan dalam kelompok-kelompok gagasan. khususnya dalam cerita-cerita bergaya formulaik. 1994: 263-301) disebutkan berbagai adegan dan deskripsi bagian-bagian cerita yang siap pakai yang tersedia dalam konvensi sesuaj dengan horizon harapan penikmat. Sebaliknya tema harus diungkapkan dalam kelompok-kelompok gagasanberdasarkan perbandingan terhadap variasi-variasi teks. Lord (1981: 70) menyebutkan bahwa ada sejumlah ide atau kelompok-kelompok ide yang secara teratur digunakan dalam penceritaan. siap pakai. seorang penyair juga memiliki adegan siap pakai yang disebut tema. Istilah tema-tema yang oleh Lord diartikan sebagai kelompok-keIompok ide.

Menurut ahli-ahli psikologi. adegan-adegan siap pakai ataupun deskripsi bagian-bagian cerita yang disiapkan dalam konvensi. dapat dikatakan bahwa formula-formula itu hanyalah sarana atau instrumen untuk menyampaikan sistem nilai atau unsur-unsur didaktik sesuai dengan pandangan dunia konvensional. Formula-formula itu dapat ditemukan dalam berbagai genre cerita dalam berbagai kebudayaan. perlu dicermati pula berbagai adegan siap pakai dan deskripsi bagian-bagian cerita yang disiapkan dalamkonvensi kebudayaan masyarakat pendukung sastra lisan tersebut. Dalam berbagai kebudayaan di dunia. misalnya. selain formula dan ungkapan ungkapan formulaik yang dianalisis dalam struktur formal teks. Apakah artinya ini? Jika kita menerima pandangan bahwa fungsi sastra Lisan dalam masyarakat tradisional lebih kuat tekanannya pada unsur utile (berguna). lstilah kompleks Oedipus terutama diperkenalkan oleh tokoh psikoanatisis Sigmund Freud untuk rnenyebut cinta seksual anak kepada orangtuanya yang berbeda jenis kelaminnya (misalnya anak perempuan kepada ayahnya. mudah ditemukan tema atau motif kompteks Oedipus. ataupun kelompok-Kelompok ide dan deskripsi bagian-bagian cerita dalam alur mengacu kepada berbagai realitas.tersedia dalam konvensi dan sesuai dengan horizon harapan penikmatnya. Dalam Penelitian sastra lisan. Rasa cinta ini seringkali ditekan ke alam bawah sadar karena dianggap sebagaidosa. Telah ditunjukkan di atas bahwa dalam sastra Lisan. ungkapan-ungkapan formulaik. seorang peneliti harus membandingkan versi-versi sebuah cerita yang sama ataupun beberapa cerita yang berbeda untuk menunjukkan manakah. atau anak laki- laki kepada ibunya). sesungguhnya formula-formula itu merupakan simplifikasi gagasan-gagasan yang kompleks. Dengan demikian. formula. kecemburuan 61 . Untuk mengungkapkan tema-tema yang terdapat dalam sebuah karya sastra lisan. yang dalam arti tertentu bersifat simbolik. Formula-formula itu sering kali diulang-ulang dalam sebuah korpus kebudayaan.

Sebagian ahli lainnya seperti Whellwright (1965) dan Malinovsky (lihat Caims. Oedipus membunuh ayahnya dan mengawini ibunya sendiri secara tegas menunjukkan pergolakan bawah sadar manusia itu. motif- motif yang sama dapat saja memiliki makna berbeda sesuai dengan pengalaman sejarah masing-masing kebudayaan. Ada sebagian ahli (terutama para ahli psikoanatisis) yang menganggap bahwa kisah-kisah itu menunjukkan alam bawah sadar manusia yang dapat diterima kebenarannya sesuai dengan ungkapan bahasanya. suku-suku tertentu. (4) cerita Gunung Darapung masyarakat Bone. (2) cerita terjadinya orang Kalang di Pekalongan. motif semacam itu antara lain dijumpai dalam (1) cerita Sangkuriang di Sunda. (5) cerita Kebo Mundar dari masyarakat Bali. 62 .anak kepada orang tua lawan jenisnya itu seringkali muncul dalam berbagai cerita rakyat. Dengan lain perkataan. (3) cerita Watu Gunung dan Dewi Sinto Dalam Babad Tanah Jawa. apa adanya. Dapat pula kita sebuitkan legenda Pangeran Samudra yang mengawini ibunya di Gunung Kemukus. (6) cerita Gua Batu Sepong dalam masyarakat Bone. Jawa Tengah. Dengan demikian. Bertahannya tema-tema semacam itu menarik untuk ditelusuri makna dan terutama fungsi cerita itu bagi masyarakat pendukungnya. misalnya. Kisah Oedipus. 1944) menganggap bahwa penafsiran terldapattema- temasemacam itu Perlu dikaitkan dengan data-data historis setiapmasyarakat karena cerita-cerita rakyat seringkali memitiki makna diaphoris dengan tradisi. dan (7) cerita perkawinan ibu dengan anak laki-Iakinya di Nias. Di lndonesia motif Oedipus dapat dijumpai dalamberbagai cerita. cerita itu diterima sebagai sebuah kebenaran ilmah. Menurut Rusyana (1 993). Anak laki-laki membunuh ayahnya dan mengawini ibunya sendiri secara mengherankan dapat ditemukan dalam semua kebudayaan dunia. Sragen. menunjukkan bahwa Dalam diri setiap manusia terdapat cinta seksual kepada orang tuanya yang berlainan jenis kelaminnya.

Prosedur Pewarisan Teknik-teknik penciptaan dan cara tradisi itu diturunkan penyair Lisan (di Yugoslavia penyair lisan disebut. kelompok-keIompok ide itu dirakit menjadi sebuah bentuk yang utuh. Menurut Parry- Lord. cerita-cerita rakyat (khususnya mitologi-mitologinya) merupakan atat logika yang digunakan untuk memecahkan kontradiksi- kontradiksi yang berkaitan dengan masalah-masalah mendasar (situasi batas manusia) yang dialami dalam kehidupannya. cerita-cerita tidak dihafalkan turun-temurun. baik dalam tataran arti (meaning) maupun dalam tataran makna (significance) Dengan demikian. dan waktu yang disediakan. terutama dalam masyarakat primitif. c. merupakan jawaban manusia terhadap pertanyaan mendasar Bagaimana mungkin manusia (one) dapat dilahirkan dari pria dan wanita (two)? Mengapa kita tidak diturunkan dari seorang pencipta saja? Bagi para peneliti sastra Lisan. Cerita-cerita itu menawarkan suatu modelpemahaman yang sedapat mungkin masuk akal terhadap hal-hal yang secara sepintas tampak kontradiktif. teksnya diciptakan kembali secara spontan dan disesuaikan dengan minat pendengar. pendekatan sastra dapat leluasa menafsirkan tema-tema itu tanpa terikat pada satu makna tunggal. Menurut dia. sebaliknya setiap kali cerita itu dibawakan. menurut Levi-Strauss. Levi-Strauss (1958) mengungkapkan perspektif yang berbeda tentang fungsi formula-formula tersebut. Dengan bantuan formula dan ungkapan-ungkapan formulaik yang baku. Cerita Oedipus. berbagai metode dan teknik-teknik penelitian yangdikenaldalam ilmu sastradan ilmu kritik teks dapat dijadikan pedoman untuk menafsirkan formula-formula teks. Hal yang tetap pada cerita-cerita lisan bukan alur cerita melainkan kelompok-kelompok ide yang disediakan oleh konvensi.Guslar) kepada murid- murid/pengikutnya menarik perhatian kedua peneliti ini. 63 . keadaan pembawaannya.

cerita Wato Wele -Lia Nurat yang relatif cukup panjang menimbulkan 64 . si calon menemani gurunya mengadakan Perlunjukkan. Contoh Penerapan teori Parry-Lord: Koda Knalan di Flores Timur Sebagaimana disebutkan di atas. Prosedur ini mirip dengan proses pewarisan sastra lisan Minangkabau (tukang sijobang) (Philips. Prosedur pewarisan teknik bercerita dari seorang penyair Yugoslavia (guslar) kepada muridnya dilaksanakan melalui semacam sistem pendidikan formal (lihat Abdullah. Abdullab dan Yoseph YapiTaum (lihat studi yang dilakukan Abdullah. dan Taum. pasangan kata. Studi Taum (1994) berjudulTradisi dan Transformasi Cerita Wato Wele-Lia Nurat dalam Sastra lisan Flores Timur melibatkan deiapan teks puisi lisan masyarakat Jamaholot di Kabupaten Flores Timur yang disebut koda klaken atau koda knalan. Masa berguru ini mencapai waktu rata-rata tiga tahun lamanya. 1991: 68). 1994: 218-262). 3. 1981) dan penyair lisan Aceh (Abdullah. Pelajaran pertama bagi calon guslar adalah mendengarkan guru nya menyanyikan satu bagian cerita. dan kombinasi pasangan kata) dalam sistem pembaitan (yang memiliki pola konstruksi bait yang teratur) yang diikuti secara ketat dan konsisten. Berikut ini dikemukakan beberapa pokok gagasan dari studi yang dilakukan Taum sebagai ilustrasi penerapan teori Parry-Lord. Sebagai pelajaran terakhir. yang disusul atau diulangi oleh muridnya. Koda klaken memiliki strukturformal (berupajumlah kata dalam larik. teori Parry-Lord pernah diterapkan oleh lmran T. Kemiripan ini dapat dipahami karena penceritaan dilakukan sehagai semacam kegiatan profesional. 1991: 522-558. Dalam setiap kesempatan ini ia diberi waktu oleh gurunya melanjutkan cerita selama beberapa menit ketika gurunya beristirahat. Keindahan bahasa puisi koda klaken dalam menuturkan . yakni sampai calon mampu menyanyikan sebuah cerita secara utuh. 1991).

65 .pertanyaan tentang proses penciptaan dan pewarisannya. Teori Parry- Lord dapat dipergunakan untuk menjelaskan rahasia tersebut.

bahasa- bahasa kiasan dan sarana-sarana retorika sering kali dipergunakan oleh si penutur. diteiiitikan gaya bahasa metafora. dan perumparndan. Dalam kutipan (2). (4) Wato pesang maik ile jadi// Batu pecah bagai gunung melahirkan// Parak beta moion woka dewa Wadas terbelah serupa bukit beranak (5) Rupan maik ina nitung// Rupanya bagaikan ibu hantu// NopenoIon ema lolong Wajahnya laksana bunda jin 66 . 1) Doan na lali muda hugu haga// Jauhnya ujung jeruk tak mencapainya// Lela na lali pao wutun buno jauhnya pucuk mangga takmenggapainya 2) Ehin wengi keleket deket// Buahnya lebat kilat menyambar// Wain dene hetedo redo Bulirnya banyak gempa mengguncang (3) Deketape ptala tapo// Menyatakan api bintang pagi// Hemo ape belia hire Membuat api bintang timur Untuk menggambarkan betapa jauhnya kampung Sina jawa. Dalam 1)enutLiran cerita Wato Wete -Lia Nurat. Metafora api bintang pagi//api bintang tirnur menggambarkan api ghaib (ape be-open) yaitu api yang dibuat oleh Lia Nurat. metafora kilat menyambar//gempa mengguncang dimanfaatkan untuk melukiskan hasit panen yang melimpah. Gaya bahasa metafora atau gaya bahasa perbandingan imptisit tertihat dalam kutipan berikut ini. Formula dan Ungkapan Formulaik Dalam menuturkan cerita mitologis Wato Wele-Lia Nurat. kutipan (1) menjelaskan bahwa tempat itu tidak dapat dicapai oleh ujung jeruk//pucuk mangga.a. personifikasi. meskipun digunakan secara terbatas. Gaya bahasa perbandingan eksplisit terlihat dalam dua kutipan berikut ini.

(8) Paji tewo pulo kae// Kampung Paji sudah sepuluh// Beda tana lema kae Desa Beda sudah lima (9) Soge haka liu ile// Soge datang menembak gunung// Kewa gere reja woka Kewa tiba membunuh bukit Sepuluh dan lima dalam kutipan (8) ingin menggambarkan bahwa perkampungan Paji dan Beda sudah banyak (tidak hanya 10 dan 5 kampung). gunung dan bukit adalah metonimia yang 67 . Pengalihan arti dari sesuatu yang hidup kepada sesuatu yang tidak bernyawa (yakni gaya bahasa personifikasi) tampak pada kutipan-kutipan berikut. Sinekdoke adalah semacam gaya bahasa figuratif yang mempergunakan sebagian dari sesuatu hal untuk menyatakan keseluruhan atau mempergunakan keseluruhan untuk menyatakan sebagian (Keraf. Beberapa contoh dikemukakan di bawah ini. Metonimia yang dominan dalam penuturan Wato Wele -Lia Nurat adalah akibat digantikan jsi dengan wadah (relasi togik). Dalam kutipan (9). Gaya bahasa yang lebih banyak dijumpai adalah metonimia dan sinekdokhe. (6) Nuren tutu neda maring// Mimpi berkisah mimpi berucap// Na iba sesa Iemah banu Mencari kian rnenangkap belut (7) Lewo di uteng tobo hala// Kampung tak memintanya menetap// Tana di lakang pae hala Desa pun tak mengajaknya berdiam. Metonimia adalah suatu gaya bahasa yang mempergunakan sebuah kata untuk menyatakan sesuatu hat yang lain karena mempunyai pertalian yang sangat dekat. 1985: 142).

yang dalam pemahaman niasyarakat setempat memang identik dengan Gunung Ile Mandiri. (2) Deskripsi tentang burung garuda. yang merupakan asal-usul tokoh Wato Wete dan Lia Nurat. (10) Ehin uro Paji// Hasilnya melebih Paji// Wain epa Beda Tuaiannya me{ampaui Beda (1 1) Tilun e{u sope anal/ Telinganya terbayarkan anaknya Nuti wihiin sope ana terlunaskan//Belis diberikan mas kawin clibayarkan. dan H). dan kampung yang dlbangun. B. 68 . Tema-tema atau Kelompok Gagasan Tema-tema atau Kelompok-kelompok gagasan di dalam cerita Wato We)e-Lia Ntirat. Tentu saja bukan hanya tefinga yang dibayar tunas melaink•an juga keseluruhan badan dan jiwa istrinya. Dalam kutipan (11). tetur burung garuda. yang dinamakan Sina jawa. Gaya bahasa Sinekdoke terlihat dafam kutipan berikut ini. Kutipan (10) menggambarkan bahwa Lia Nurat Lebihunggul dibandingkan dengan orang-orang Paji. dan kelahiran manusia dari telur burung garuda itu.digunakan untuk menggantikan tokoh Lia Nurat. Kesemua gaya bahasa tersebut merupakan ungkapan-ungkapan formulaik yang sudah disiapkan oleh tradisi. (3) Cerita tentang perjaianafl mencari tempat untuk menetap dan identifikasi lokasi. b. terdiri dari delapan Kelompoktema sebagai berikut. bukanhanya dalam bidang hasil bumi. kebun. (1) Cerita tentang sebuah tokasi yang sangat jauh. nuba nara. teJitiga menggatiil)drkafl istri Lia Nurat. khususnya dalam versi X (teks A. dan yang dapat dipergunakan oleh siapapun dalam menuturkan berbagai kisah dan peristiwa serupa.

yang berakhir dengan kematian putra sulung Lia Nurat bernama Blawa Burak Sina Puri. (7) Adegan peperangan di Adonara antara putra-putra Lia Nurat melawan suku Paji.(4) Adegan Lia Nurat menyatakan api di puncak gununglle Mandiri merupakan sebuah adegan siap pakai. mungkin saja penuturan sastra lisan tidak dilakukan sebagai sebuah kegiatan profesi. Hadung Boleng Teniban Duli dan Uto Watak Teluma Burak. yang berakhir dengan kematian Lia Nurat sebagai akibat pembalasan dendam dari keluarga Uto Watak Teluma B urak. c. karena berkaitan dengan legitimasi pemilikan tanah. selalu dilukiskan bahwa nyala apiitu sangat terang. Prosedur Pewarisan Di daerah-daerah tertentu. yang sampai sekarang ditempati oleh keturunannya masing-masing di wilayah Baipito. (6) Adegan pertengkaran kedua istri Lia Nurat.mengenat tradisi puisi lisan (yang disebut koda knalan atau koda klaken) dengati sistem dan kaidah- 69 . dalam arti si penutur sastra lisan mengikuti proses pendidikan tertentu. (5) Adanya bagian cerita yang mendeskripsikan secara rinci mengenai anak-anak Lia nurat dan Hadung Boleng. yang dapat dimanfaatkan oleh berbagai tukang cerita setiap kali mereka ingin menuturkan kisah Wato Wele-Lia Nurat. Deskripsi ini merupakan sebuah konvensi penceritaan yang sangat penting. Kedelapan tema tersebut merupakan adegan-adegan siap pakai yang telah disiapkan oleh konvensi. mencapai kampung Paji dan menarikperhatian bakat istrinya yang bernama Hadung Boleng Teniban Duti.Dalam adegan ini. misalnya. (8) Adegan penutup cerita berupa pembagian tanah antara anak-anak Jaki-Jaki Lia Nurat. Masyarakat Flores Timur.

Pencipta sastra lisan bertugas merakit formula-formufa tersebut ke dalam sebuah cerita yang utuh. ungkapan-ungkapan formulaik. menukik). Menurut paham resepsi sastra. Penciptaan sastra lisan pada umumnya dipermudah berkat adanya formula. 1995: 46-51). Kemampuan dan kemahiran menggunakan bahasa sastra koda knalan umumnya dipercaya sebagai suatu rahmat atau karunia (kurnia) Tuhan. Berbagai gaya retorika dalam komposisi sastra lisan menunjukkan ciri-ciri formulaik. Variasi-variasi•teks dapat dikaji dalam hubungannya dengan aspek tanggapan (resepsi) penutur cerita terhadap norma-norma konvensional tersehut. akan tetapi proses menjadi seorang pembawa puisi lisan yang mahirtidak melalui pola yang demikian (Taum. dan tema-tema siap pakai. Ada keyakinan bahwa selalu ada salah seorang anak dari keluarga tua adat yang muncul dengan kemampuan bersastra. Perlu dipahami bahwa perubahan-perubahan kemasyarakatan mengakibatkan muncul-nya variasi-variasi suatu teks tertentu. dia didatangi dan didampingi oleh Manuk Sili Gokok yaitu seekor burung garuda yang memberinya kemampuan bersastra itu. Dalam istilah mereka. NTT. penyampaian dan pewarisan berbagai norma. pergeseran unsur-unsur teks berkaitan erat dengan horison harapan penutur terhadap sistem konvensi tersebut. buno = jatuh. sastra 70 . Dengan demikian. konvensional dan sistem nilai dalam lingkup suatu kebudayaan tertentu.kaidah poetika yang diikuti secara ketat dan teratur. yaitu orang-orang tertentu yang kejatuhan bintang. kemampuan itu diakibatkan mnuno buno (mnuno = bintang. entah norma-norma kesusastraan maupun norma-norma sosial kemasyarakatan. Di wilayah Tanjung Bunga di Kabupaten Flores Timur. Ciri-ciri formulaik itu dapat dipahami dalam konteks fungsi sastra lisan sebagai sarana bagi penyimpanan. ada kepercayaan bahwa pada waktu seseorang bercerita. baik dalam tataran struktur formatnya maupun dalam tataran semantisnya.

maka kaidah-kaidah formal yang diuraian di atas dapat menjadi salah satu petunjuk untuk menemukan arti dan makna teksnya. waktu yang tersedia. The tales the thing. Jika dipandang bahwa dalam sastra lisan terdapat kesatuan formal dan semantik. teks itu diciptakan secara baru dan spontan sesuai dengan situasi pendengar. fisan tampak sebagai akumulasi formula-formula. Dalam kebudayaan-kebudayaan tertentu. dan pembentukan atau komposisi sebuah cerita. struktur sastra lisan sesungguhnya tidak beku karena setiap kali diceritakan. maupun keadaan si penggubah sendiri. Lord (1981:68) mengungkapkan bahwa formula dan ungkapan-ungkapan formulaik hanya menjadi sarana penyampaian cerita. D. dapat dijumpai berbagai aspek intertekstuafitas dalam sebuah teks. seorang sastrawan (penyair Lisan atau tukang cerita) adalah seorang profesional yang mencapai status tersebut melalui sistem pendidikan tertentu yang diikuti dengan teratur. Pandangan ini memberikan wawasan baru dalam teori ekspresivisme. cerita atau kisah itulah pokoknya. Pada tataran sintaksis terdapat formula dan ungkapan formulaik yang 71 . pewarisan. seorang sastrawan lisan tidak mengikuti sistem pendidikan tertentu. Dalam kebudayaan yang lain. Meskipun demikian. Parry adalah orang pertama yang membuktikan bahwa karya Homerus merupakan karya utuh dan sempurna. khususnya menyangkut proses penciptaan. Jika dilacak Lebih jauh mengenai sumber-sumber cerita. Kekuatan dan Kelemahan Studi Parrydan Lord enjawab misteri penciptaan Homerus yang buta huruf dapat menciptakaii puisi Odysee dan llias yang sangat terkenal itu. Kajian terhadap hal ini dapat menjefaskan migrasi dan difusi sebuah bentuk kebudayaan. tetapi berdasarkan konvensi tradisi lisan itu dia menciptakan karya sastranya sebagai suatu keselurLlIan. Dalam ungkapan Lord sendiri. Bahwa Homerus memang memanfaatkan dan menggali kekayaan tradisi lisan pada zamannya.

E. Seorang tukang cerita (dalang) tentu memiliki formula dan ungkapan-ungkapan formulaik serta adegan- adegan siap pakai yang dapat dimanfaatkannya setiap kali melakukan pementasan.pologi. upacara ritual. tradisi juga sudah menyiapkan tema atau kelompokgagasan yang merupakan adegan-adegan siap pakai yang merupakan kekayaan tradisi lisan setempat. seperti antro. pemberian kembang dan mahar tertentu. Dalamberbagai kebudayaan tradisional di lndonesia. Kepandaian seorang tukang cerita dapat dipandang sebagai sebuah ketrampilan yang dapat dipelajari siapapun yang berminat menjadi tukang cerita. pernyataan Parry dan Lord bahwa keahlian seorang tukang cerita selalu tidak terlepas dari ketrampilannya merangkai kalimat dan adegan-adegan siap pakai merupakan sebuah kenyataan artistik yang sulit dibantahkan Tanpa kemampuan tersebut. Teori penciptaan Lord ini kiranya berlaku pula pada penceritaan kisah-kisah yang panjang seperti dalam cerita wayang ataupun kisah-kisah perjalanan Panji. sukar diharapkan adanya tukang cerita yang mampu membawakan berbagai cerita rakyat yang sudah dikenal masyarakat secara memuaskan.seperti bertapa. Pada tataran wacana. Sekalipun demikian. yang sap dimanfaatkan oleh tukang cerita.sudah disediakan oleh tradisi bahasa dan yang siap digunakan oleh tukang cerita dalam merangkaikan kalimat di dalam penceritaan. Rangkuman Teori-teori analisis sastra lisan sesungguhnya sudah lebih dahulu berkembang dalam disiplin ilmu-ilmulain. 72 .Hal ini tidak disinggung samasekali dalam teori Milman-Parry. psikologi. Teori penciptaan Parry dan Lord kiranya tidak dapat begitu saja diterapkan dalam proses penciptaan prosa maupun puisi-puisi lisan yang relatif pendek. kadang-kadang muncul fenomena bahwa proses pewarisan kemampuan bercerita dari seorang tukang cerita ke tukang cerita lainnya melibatkan hal-hal yang bersifat magis. doa dan slametan.

Secara khusus pendekatan dalam rangka ijmu sastra dirintis jalannya oleh pendekatan Madzab Finlandia yang terutama menyoroti tipe dan motif yang terkandung dalam berbagai cerita rakyat di dunia. sesuai dengan semangat keilmuan pada zamannya. dan aspek-aspek sosial kemasyarakatan yang terkandung dalam teks tersebut. Lord yang memperkenalkan model anaiisis sastra isan dengan memperhatikan aspek-aspek formula. Studi sastra lisan Madzab ini sangat berorientasi historis-komparatif. ungkapan formulaik.filsafat. pendekatan sastra terhadap studi sastra lisan sudah mulai menyebar dan memasuki arus utama ilmu sastra. Pergesaran kemudian terjadi dengan munculnya pandangan Milman Parry dan Albert B. 73 . dan sosiologi. orientasi penelitian ekspresionis mulai dikembangkan oleh penelitian Parry-Lord. teks itu sendiri. Dalam hal ini. dan tema-tema siap pakai yang merupakan konvensi penciptaan sastra lisan. gejala sastra lisan dapat didekati dan dipahami sebagai sebuah komunikasi tekstual yang melibatkan pencipta. Sekalipun masih boleh terbilang baru. Dengan pendekatan ilmu sastra. pendengar.

Dia kuliah di Universitas St. teori aktansial dan fungsional A. studi sastri lisan juga mulai mengembangkan pendekatan analisis struktur cerita rakyat. Petersburg tanggal 17 April 1895 dari sebuah keluarga imigran Jerman. GREIMAS Teori-teori analisis sastra lisan yang akan dikemukakan dalam bab ini adalah teori analisis morfologi cerita rakyat Vladimir Propp. A. Tahun 1932. Propp adalah tokoh strukturalis pertama yang melakukan kajian secara serius terhadap struktur naratif. Penelitian Propp adalah usaha untuk menemukan pola umum alur dongeng pada umumnya. Latar Belakang Sejalan dengan Pertumbuhan pendekatan strukturalisme dalam ilmu bahasa dan ilmu sastra. Dalam sejarah kajian sastra lisan. kedua teori ini memiliki kedudukan yang sangat kuat karena sering dimanfaatkan untuk melakukan kajian terhadap teks-teks naratif.Perintis usaha ini adalah VladimirPropp (1895-1970). Petersburg (1913-1918) dalam bidang studi filsafat Rusia dan Jerman. Petersburg) dan menjabat Ketua Jurusan Folklor. Vladimir Propp: Morfologi Cerita Rakyat 1. Kedua teori ini dikemukakan dalam satu bab yang sama karena memiliki kesamaan pendekatan serta saling merevisi. BAB VIII TEORI-TEORI ANALISIS SASTRA LISAN: VLADIMIR PROPP DANA. salah seorang tokoh aliran Formalis Rusia yang melakukan analisis yang cermat tentang struktur cerita rakyat (folktale).J. sekaligus memberikan makna baru 74 . Vladimir Propp lahir di st. Greimas. Setelah menyelesaikan kuliahnya. dia mengajar bahasa Rusia dan Jerman di SLTA dan kenlLicIiail menjadi dosen bahasa Jerman. Fropp menjadi staf pengajar Universitas Leningrad (yang sebelumnya bernama Universitas St.J.

(4) putri dan ayahnya. yaitu perbuatan sebagai unsur yang stabil. yaitu: (1) penjahat. dalam sebuah cerita para pelaku dan sifat-sifatnya dapat berubah. yaitu pelaku dan penderita. misalnya. Artinya. misalnya seorang perampok (pelaku) menculik seorang anak kecil (korban). fungsi perbuatan menculik di dalam konstruksi tersebut tidak terpengaruh. perbuatan. Propp memandang sjuzhet sebagai tema bukan alur seperti yang dipahami oleh kaum formalis. Unsur perbuatan menculik adalah unsur yang paling penting karena tindakan itu dapat membentuk suatu tungsi tertentu dalam cerita. Motif dibedakan menjadi tiga macam. Menurut Propp.Bagi Propp. Sekalipun pelaku dan korban diganti. dalam struktur naratif yang penting bukanlah tokoh-tokoh. pelakunya raksasa. perbuatannya menculik. Ketiga motif ini dikelompokkan menjadi dua. Sjuzhet atau cerita dengan demikian hanyalah produk dari serangkaian motif. (6) pahlawan. dan (7) pahlawan palsu. (3) penolong. Propp (1987:93-98) menyimpulkan bahwa semua cerita yang diselidiki memiliki struktur yang sama. yaitu: pelaku. Dalam konstruksi raksasa menculik seorang gadis.terhadap dikotomi fahula dan sjuzhet. (2) donor. Propp menyimpulkan bahwajumlah fungsi yang terkandung dalam dongeng yang ditelitinya memiliki 31 fungsi yang dikelompokkan ke dalam tujuh ruang tindakan atau peranan. Unsur yang dianalisis adalah motif (elemen). semua cerita memiliki pola konstruksi yangtetap.Pada tahun 1928. tidak berubah. yang merupakan satuan unitterkecil yang membentuktema. (5) orang yang menyuruh. Menurutnya. yang terpenting adalah unsur yang tetap (perbuatan) yaitu fungsi itu sendiri. Propp melakukan penelitian terhadap seratus dongeng Rusia. Menurutnya. motif merupakan unsur yang penting sebab motiflah yang membentuk tema. tetapi perbuatan dan peran-perannya sama. yang tidak tergantung dari siapa yang rnelakukan dan unsur yang tidak stabil dan bisa berubah-ubah. Menurut Propp 75 . melainkan aksi tokoh-tokoh yang selanjutnyadisebut fungsi. dan penderita. dan penderitanya seorang gadis.

tujuan penelitiannya bukan sekadar tipologi struktur melainkan melalui struktur dasar. Sejak edisi bahasa lnggris pertama diterbitkan tahun 1958 dan diperbaiki 1968. Claude Levi-Strauss dan Roland Barthes. dan seriat televisi. Buku ini sangat berpengaruh di bidang folklore dan morfologi serta mempengaruhi tokoh-tokoh strtikturalis seperti Ai Greimas. Cara kerja Propp ini banyak dipuji dan diikuti penetiti-peneliti selanjutnya. Analisis dan tipologi struktural itu bukan tujuan utama dan terakhir. seperti sastra. Berdasarkan anatisis struktur itu. berharap dapat menemukan bentuk purba cerita rakyat itu. Model penelitian ini Prop mendasari penelitian Greimas. 1 984: 292- 293). Sejak Ferdinand de Saussure. pertama kali ditulis dalam bahasa Rusia tahun 1928. Hasil penelitian Propp dibukukan dengan judut The Morphology of theFolktales. dapatditemukan bentuk-bentuk purba dongeng. sebab perbandingan perkembangan sejarah hanya mungkin dilakukan jika kita mengetahui setepat mungkin fungsi unsur-unsur sebuah cerita dalam 76 . dia:. Akar-akar Sejarah Dongeng (1946). Hat ini terutama dituangkannya dalam bukunya yang berbahasa Rusia. Dengan menggabungkan struktur dan genetiknya (struktur mendahului sejarah). seperti pada Mazhab Finlandia. teater. Klasifikasinya terhadap jenis-jenis tokoh digunakan dalam media pendidikan dan dapat diaplikasikan hampir dalam semua cerita. yang kemudian berkembang ke berbagai witayah dengan tokoh dan peristiwa yang berbeda-beda tewat sejumlah transformasi. penyebarannya (Teeuw. tetapi tetap mempertahankan kerangka struktur fungsi yang sama. Propp ingin menggabungkanmetode struktural dengan metode penelitian genetik. Dia ingin memanfaatkan hasil tipotogi struktural itu untuk Penelitian historis juga. penelusuran asat-usul dan. pengaruh Propp di Eropa mulai berkembang. maka akan ditemukan proses penyebarannya kemudian.(Teeuw 1985: 290-294).cukup umum disetujui bahwa penelitian struktur harus mendahului penelitian sejarah. Dengan demikian.

2. 1984: 293). Transformasi baru menjadi jelas berdasarkan pemahaman makna bagian-bagian dan rnotif-motif dalam keseluruhan cerita (Teeuw. (c) Urut-urutan fungsi di dalam sebuah dongeng setatu sama. (a) Unsur dongeng yang paling stabil dan tak berubah bukanlah tokoh atau motifnya. Propp menyebut jumlahnya adalah 31 fungsi.keseluruhan karya itu. tetapi fungsinya tidak berubah. Sekalipun pelaku dan penderita dalam setiap dongeng berubah. defiried from the point ofview ofits significance for the course ofthe action (1975: 21). Propp melakukan analisis terhadap 100 buah dongeng Rusia (fairy tales). (d) Dari segi struktur. Sebagaimana dikemukakan di atas. (b) Furigsi dalam dongeng jumlahnya terbatas dan merupakan satuan pokok dalam alur cerita. yang kemudian berkembang ke berbagai wilayah lainnya. Dialah ilmuwan pertama yang mengkaji komponen dasar alur cerita dongeng Rusia untuk menemukan elemen-elemen naratif yang tetap.rutan dan peranan (character) dalam cerita. Cara Kerja Penelitian Propp berusaha menemukan aturan yang rnenguasai atau menentukan struktur alur di dalam dongeng Rusia. Apakah fungsi itu? Fungtionis understood as actof a character. Jadi. Perhatiannya terutama ditujukan pada penggunaan fungsi (function) pelaku menurut u. Tujuan analisis struktur Propp adalah menemukan struktur purba (awal). semua dongeng mewakili hanya satu tipe saja. Hasil penelitiannya dituangkannya dalam buku The Morphology of the Folktales. fungsi adalahtindakan tokoh yang dibatasi dari segi 77 . Dalam menyusun teorinya. melainkan fungsi atau peranannya. beberapa pokok pikiran Propp yang penting adalah sebagaiberikut.

raja. 4. Pahlawan tetap sajamengabaikan larangan.Pembacamungkininginmengingatkanpahlawannya untuk mengikuti larangan. 3.Iation oflnterdiction). Para pembaca biasanya meng-identifikasikan tokoh ini sebagai diriku. Seorang anggota meninggalkan rumah dengan berbagai atasan. Karena itu. dll. 2. Perhatikan ke-31 fungsi. tidak boleh meninggalkanadik sendirian. 1. adik. pergilah ke sini!. Pembaca membangunharapan tertentu terhadap tokoh ini untuk mengikutiataupun melanggar larangan. Penjahat secara aktifmencari inforrnasi. misalnya menelusuri informasi-informasi yang berharga atau secara aktif 78 . meskipuntidak secarafrontal melawan sang pahlawan. Pelaranganitu dilanggar. Penjahat mencobamemata-matai. misainya dengan cara menemukanpermata. tidak boleh memetik bunga atau buah tertentu.maknanya untukjalan lakonnya. Lingkaran Pertama: Pengenalan Langkah 1 sampai 7 memperkenalkan situasi dan para pelakunya.Peringatan terhadap the dangers oflife ini pun seolah. tetapi jelas pahlawan tidak bisamendengarnya. Larangan (interdiction). dan lain-tain. Tokoh utama atau pahlawan dikenai larangan. Meninggalkan rumah (absentatiofl). Anggota ketuarga dapat siapa saja: entah orang tua. tidak boleh melewati jalan ini. Larangan itu misalnya:jangan pergi ke tempat itu. Tokoh yang pada mulanya digambarkan sebagai orang biasa inilah yangkemudian perlu dicari dan diselamatkan. Fungsi-fungsi ini dapat dikelompokkan puta ke dalam empat lingkaran(sphere) satuan naratif sebagai berikut. tidak boleh meninggalkan rumah. Misalnya: tidak boleh berbicara lagi.penjahat mulai memasuki cerita.olah ditujukan kepada pembaca. Memata-matai (reconnaissance). Pelanggaran terhadap larangan (vio. mempersiapkan adegan-adegan untuk petualangan selanjutnya. anak yang hilang.

Pembaca kecewa dan putus asa terhadap korbanatau pahlawan yang kini dianggap sebagai penjahatjuga.. 79 . mempengaruhi pahlawan untukmendapatkankeinginannya. Penjahat bahkan dapat saja berbicara dengan anggota keluarga yang poIos. Pembaca menjadi bingung dengan posisipahlawan yang sudah keluar jauh dari harapan. Hal inimemperdalam ketegangan pembaca mengenaikeselamatan korban atau pahlawan yang telah ditipu. Korban benar-benar tertipudan tanpa disadarinya dia menolong musuhnya. Tindakan ini memperkuat posisipenjahat sebagai orang yang benar- benar jahat. Penjahat memperolehinformasi mengenai korbannya.Penjahat mungkin menangkap korban. Hal ini membuat cerita semakinmenegangkan. misalnya peta atau senjata magis yangdigunakan secara aktif untuk melawan orang- orangbaik. atau yanglainnya. Penjahat mencoba menipu danmeyakinkan korbannya untuk mengambil-alihkedudukan ataupun barang-barang miliknya. Penipuan (trickery). 5.misalnya tentang peta atau Lokasi harta karunataupun tujuanpahlawan. berusahamenangkapseseorang. yang memberikaninformasi berharga itu. penjahat menipu korban atau pun pahlawan denganberbagai cara.Pembaca barangkali ingin meng-ingatkan pahlawan mengenai bahaya sang penjahat. 7. 6. binatang buruan. Upaya penjahatberhasil mendapatkan informasi biasanyamengenaipahlawan ataupun korban. Denganmemanfaatkan informasi yang sudah diperolehnya.Penipuandanpengkhianatanadalahsa lah satu tindakan kriminal sosial terburuk dan sejenispelecehanfisik. inilah fase di dalam cerita yang memihak pada penjahat. Korbanataupun pahlawan memberikan sesuatu kepada penjahat. Komplesitas (cornplicity). Berbagai informasi diperoleh.menciptakan ketakutanseakan-akan penjahat memenangkanpertarungan dancerita akan berakhir dengan tragis. Penyampaian (delivery).

Salah seorang anggota keluargakehilangan sesuatu atau mengharapkan untuk memiiikisesuatu. misalnya dengan menculik. misalnyadengan menemukan barang magis. dia dibiarkan pergiatau ditahan. Kita mungkin tidak menyadari bahwapahlawan benar-benar seorang pahlawan karena diabelum menunjukkan kualitasnya sebagai pahlawan. fungsi ini memiliki dua alternatif yangdapat terjadi bersamaan di dalam cerita ataupun salahsatunya terjadi dan yang lainnya tid.Pahlawan mungkin menemukan keluarga atau komunitasnya yang sedang menderita.dan diteruskan dengan keberangkatan sang pahlawan. Kekuranganitulah yang membuat kita berharap dan mencaripahlawan untuk mengisi kekurangan tersebut. melakukan kawinpaksa. Kegagalan atau kehilangan itujustru menjadi pengenal. mencuri kekuatan magis.Kita pun tidak menaruh simpati padatindakan penjahat. menukar seorang anak. Hal inimembuat pembaca menyadari apa yang terjadisekarang. menyelamatkanorang- 80 .Lingkaran Kedua: lsi Cerifa Pokok cerita dimulai pada fase cerita ini . Pencari menyetujui atau memutuskan melakukan aksibalasan.ak. Kekuranganadalah sebuah prinsip psikoanalisis yang mendalamyang pertama kali kita alami ketika menyadariindividualitas kita terpisah dari dunia. Pahlawan menyadari adanya tindakan kejiataumengetahui kekurangan yang dimiliki anggota keluarga. b) Kekurangan (lack). 8.tetapi pahlawan pun belum juga muncul. Mediasi (mediation). 10. Pahlawan sekarang memutuskan mengambiltindakan untuk mengatasi kekurangan.menahan atau memenjarakan orang. menghitangkan atau membuang seseorang. Jadi. merusak hasil panen. a) Kejahatan (villainy). 9. Aksi Batasan Dimulai (beginning counter-action). pahlawan datang dengansebuah permintaan atau suruhan. Penjahat merugikan atau metukai salah seorang anggota keluarga. membunuh orang.

menyatukan yang bertikai. Pahlawan dibawa. 17. dapat diselesaikan. yang merupakan persiapan baginya menerima pelaku atau penotong magis (donor). Bimbingan (guidance).Inilali saat bagi pahlawan untuk memutuskan sesuatu tindakan yang akan membuatnya menjadi seorang pahlawan. tamat. Pahlawan rneneliti cara penggunaan benda magis. Pahlawan bereaksi terhadap tindakan penotong masa depan berhasil atau gagal tes. 14. Pahlawan diuji. dipesan.). Kepergian (departure). Perhatikan bahwa sesungguhnya melalui rangkaian. misalnya terluka. menerima cincin atau selendang. Lingkaran Ketiga: Rangkaian Donor Pada lingkaran ketiga. Pahlawan pergi meninggalkan rumah. menggunakan kekuatan musuh untukmengalahkannya. 12. Pertempuran (strugg!e). dsbnya. membebaskan tahanan. atau dibimbing ke sebuah tempat dari suatu objek pencaharian. ini kisah dari sebuah cerita sudah utuh dan. Keputusan tidak dapat dibatalkan karena jika hal itu terjadi dia akan sangat malu dan tidak dapat dianggap sebagai pahlawan. 11. Reaksi pahlawan (heros reaction). Pahlawan dikenali. Fungsi pertama bantuan (first function of the donor. 13. Setelah keputusan dibuat. mendapatkan bantuan berupa hal-hal magis dari Donor. Pahlawan dan penjahatterlibat dalam pertempuran langsung. Resep Benda Magis (receipt of a magical agent). melayani. dia akan melaksanakan nya dengan penu h konsekuen. Pengenalan (branding). Perubahan spasial antara dua kerajaan. 81 . pahlawan mencari cara memecahkan masalah. diinterogasi. 16. diserang. orang yang ditahan atau mengalahkan penjahat. 15.

orang yang sudah dibunuh hidup kembali). 24. Pencaharian (pursuit). Pembuangan (exposure). Kedatangan orang tak dikenal (unrecognized arrival).18. pahlawan menyamar. berharap tidak adainsiden lagi dan pahlawan disambut baik. Tugas itu dapat disetesaikan dengan baik. atau dibuang. Klaim palsu (unfounded claims). 23. tidak wajib ada) dari rangkaian penceritaan. Penjahat dihukum. Kegagalan pertama (liquidation). Pahlawan palsu atau penjahat dibuang. memakannya ataupun memperlemah posisi pahlawan). diheri pakaiiti haru. Kemenangan (victory). dJl. 30. Penghukuman (punishrnent). 21. 25. Pahlawan palsu memberikan pernyataan yang tak berdasar/palsu. tiba di rumah atau sampai di negeri lain. Perubahan penampilan (transfiguration). 29. pahlawan diselamatkan). dibunuh ketika sedang tidur. uji kemampuan. teka-teki. 27. Pahlawan kembali ke rumah. sayembara. Pahlawan dikenali (dengan tanda pengenat yang diberikan kepadanya). Penyelesaian (solution). Kepulangan (return). Pahlawan dicari (orang yang mencarinya ingin membunuh. 82 . 28. Penjahat dikalahkan. 20. 19. Pahlawan yang belum dikenali. Penyelamatan (rescue). pihlawanpulang ke rumah. Pahlawan diselamatkan dari pencaharian (mujizat menghalangi orang yang mencari. misalnya terbunuh dalam pertempuran. tawanan lepas. dikatahkan dalam sebuah sayembara. Pahlawan mendapatkan penampilan baru menjadi semakin ganteng. Pengenalan (recognition). 26. pahlawan bersembunyi atau disembunyikan. (Kemalangan dihadapi. Tugas yang sulit diberikan kepada pahlawan (cobaart berat. Lingkaran Keempat: Kembalinya Sang Pahlawan Pada tahap final (dan kadang-kadang bersifat optional. Meskipun demikian. hal semacam ini tidak harus terjadi demikian. Tugas yang sukar (difficult task). dll). 22.

6. The heroor victimlseeker hero. Analisis Morfologi Cerira Rakyat Kisah Wato WeIe-Lia Nurat Berikut ini akan diterapkan model analisis morfoiogi cerita rakyat terhadap Kisah Wato Wele -Lia Nurat3 yang merupakan sebuah cerita rakyat masyarakat Lamaholot. peran putri raja dan ayahnya tidak dapat dibedakan dengan jelas. pahlawan sejati yang memberikan reaksi terhadap donor dan menikahi putri raja. Pahlawan menikah dan menerima mahkota sebagai imbalan. The princess and her father. puteri raja dan ayahnya yang memberikan tugas kepadapahlawan. pembantu magis yang berusaha menolong pahlawan ketika dia menghadapi kesulitan. 7. 3. 5. 4. Menurut Propp (1975: 79-80) pelaku atau dramatis personae dalam 100 cerita rakyat yang dianalisisnya pada umumnya dapat diKelompokkan ke dalam tujuh jenis sebagai berikut. Pada 83 . Dia tinggal di sebuah tempat yang dikenal sebagai Sina Jawa. Sinopsis Cerita Adalah seorang tokoh purba bernama Ema Wato Sem Bapa Madu Ma. yang pantas cliterimanya. The donor. donor/pemberi mempersiapkan pahlawan atau memberi pahlawan barang-barang magis tertentu. The dispatcher. The faise hero. secara fungsionai. penjahat yang bertarung melawan pahlawan. mengenali pahlawan palsu. Propinsi Nusa Tenggara Timur. Pernikahan (wedding). pengutus yaitu tokoh yang mengetahui adanya kekurangan dan menghalangi pahlawan sejati. 2. pahlawan palsu yang mengambil keuntungan dari tindakan-tindakan pahlawan sejati dan mencoba menikahi putri raja. 3. 1.-di Kabupaten Flores Timur.31. The villain. MenurutPropp. The magical helper. menikah dengan pahlawan.

Wato Wele dan Lia Nurat dipelihara dan dibesarkan olehseorang hantu gunung. Dia pun mengusir Uto Watak. Terjadi perang di Adonara. yang kemudian dinamakan Wato Wele (seorang wanita) dan Lia Nurat (seorang taki-taki). lahirlah tujuh orang anak yang kelak menurunkan suku-SukuIIe jadi di Baipito. saudari Hadung Boleng disuruh pergi ke puncak Ile Mandiri mencari asal api unggun itu. Kelima putra Lia Nurat ikut berperang membela adik perempuan mereka. Sejak masih bayi hingga menjadi dewasa. Mereka datang menyerbu dan membunuh Lia Nurat. Hadung Boleng tidak senang dengan kehadiran Uto Watak. Kemakmuran mereka diketahui oleh orang-orang suku Soge (Maumere). Cahaya api itu sampai ke perkampungan Paji. Dari pernikahan itu. menetas dan lahirlah dua orang anak kembar. sang garuda meletakkan sebutir teturnya. kehidupan mereka kembali menjadi makmur. Raja Suku Soge sangat marah. Raja suku Soge pun mengantarkan anaknya yang bernama Uto Watak untuk diperistri Lia Nurat. Lia Nurat mengantar adiknya Wato Wele untuk menempati bagian selatan Ile Mandiri sedangkan Lia Nurat sendiri menempati bagian utaranya. Lia Nurat berjanji akan turun ke perkampungan Paji. Dalam perang tersebut. kehidupan Hadung Boleng dan ketujuh anaknya sangat menderita. Suatu ketika Hadung Boleng bermimpi melihat pusat gunung. Dengan mimpi itu. yakni Blawa Burak Sina Puri tewas terbunuh. Pada suatu malam. Dari sebutir telur itu. Lia Nurat menyalakan api unggun di puncak IIe Mandiri.suatu hari. putra sulung Lia Nurat. Suku Suban Lewa Hama. Ketika tiba di sana dia bertemu dengan Lia Nurat. Sinar api itu menimpa seorang gadis Paji bernama Hadung Boleng Teniban Duli. Lia Nurat pun turunlah ke perkampungan Paji dan menikah dengan Hadung Boleng. Keempat putra Lia 84 . dia menyuruh orang tuanya yakni burung garuda untuk terbang ke timur menuju ke puncak sebuah gunung yang bernama lle Mandiri di bagian timur Pulau Ffores. Ketika tiba di puncakgunung itu. Setelah Lia Nurat meninggal. Mereka hidup berkecukupan.

Dari tokoh mistis dan legendaris inilah cerita dimulai. mengingat cerita tentang Nabi Nuh (Ema Wato Sem Bapa Madu Ma. yang kemudian dinamakan Wato Wele -seorang wanita) dan Lia Nurat (seorang laki- laki). Lingkaran Ketiga: Rangkaian Donor 3. Seorang anggota meninggalkan rumah dengan berbagai alasan.Nurat yang masih hidup kembali ke Ile Mandiri dan membagi tanah warisan di antara mereka. Di puncak gunung itu. Kisah dimulai dengan fungsi mediation. lahirlah dua orang anak kembar. a. The first function ofthe donor. Dalam lingkaran ketiga. Dalam lingkaran pertama cerita Wato Wele-Lia Nurat. Tokoh legendaris Ema Wato Sem Bapa Madu Ma meminta ayahnya seekor garuda meninggalkan rumahnya di sebuah tempat bernama Sina Jawa. sang garuda meletakkan telurnya. Lingkaran Pertama: Pengenalan 1. Dari sebutir telur itu. Dalam kisah ini tidak disebutkan secara eksplisit alasan tokoh meninggalkan rumahnya untuk pergi ke sebuah tempat yang baru.adalah putra sulung Nabi Nuh). tokoh Wato Wele dan Lia Nurat mendapatkan bantuan berupa hal-hal magis dari 85 . yaitu Absentation atau ketakhadiran. Lingkaran Kedua: Isi Cerita 2. yang belum diketahuinya sama sekali. hanya ada satu fungsi saja. Analisis Fungsi Pelaku Sesuai dengan klasifikasi fungsi pelaku yang dilakukan oleh Propp di atas. dapat diidentifikasi 1 1 fungsi pelaku dalam mitos Wato Wele-Lia Nurat sebagai berikut. Mediation. motivasi itu tentu berkaitan dengan mengembangkan keturunan di muka bumi. Akan tetapi.

Branding. Lingkaran Keempat: Kembalinya Sang Pahlawan 8. Bimbingan. 9. 4. Exposure. Difficult Task. Liquidation. donor. 6. Hadung Boleng mengusir Uto Watak. kehidupan Hadung Boleng dan ketujuh anaknya sangat menderita. lnilah awal malapetaka karena Hadutig Boleng tidak senang dengan kehadiran Uto Watak. Kemenangan dalam cerita ini tidak berkaitan dengan peperangan. melainkan kemenangan Lia Nurat mendapatkan seorang gadis Paji yang bakal diperistri. Keduanya dipelihara dan dibesarkan oleh hantu gunung hingga menjadi dewasa. yang pada akhirnya dinikahinya dan hidup berbahagia. Unrecognized Arrival. Setelah Lia Nurat meninggal. 10. Dikisahkan bahwa sinar api yang dibuat Lia Nurat itu menimpa seorang gadis Paji bernama Hadung Boleng Teniban Duli. Pembuangan. Cahaya api itu sampai ke perkampungan Paji. Kegagalan pertama atau kemalangan dihadapi oleh keluarga Lia Nurat. Pada suatu malam. Raja suku Soge pun mengantarkan anaknya yang bernama Uto Watak untuk diperistri Lia Nurat. Raja Suku Soge sangat marah. Pengenalan. Kemakmuran mereka diketahui oleh oring-orang suku Soge (dari wilayah Kabupaten Sikka). Lia Nurat membuat api unggun di puncak lle Mandiri. 86 . 5. Mereka datang menyerbu dan membunuh Lia Nurat. Guidance. 7. Tokoh Lia Niirat mulai dikenal oleh orang- orang Paji yang sudah ada di kaki gunung lle Mandiri. Victory. Lia Nurat mengantar adiknya Wato WeIe untuk menempati bagian selatan lle Mandiri sedaiigkan kia Nurit sendiri menempati bagian utaranya.

Pembantumagis yang menolong pahlawan. yang disebut dengan nama rituat Lamaholot Ema Wato Seni Bapa Madu Ma. yang kemudian menurunkan suku-suku di Baipito. The Princess. The Hero. Yang menjadi pahlawan dalam cerita ini adalah Lia Nurat. yaitu masyarakat luar. terdapat 5 jenis pelaku sebagai berikut: 1. yaitu tindakan pembunuhan terhadap tokoh Lia Nurat yang dilakukan oieh masyarakat Suku Soge karena Hadung Boleng mengisir Uto Watak. 87 . yang menurut Propp hanya berjumlah 7 jenis. yaituhantu gunung. Peran putri raja dalam cerita ini dijalankan oleh Hadung Boleng Teniban Duli. ldentifikasi Pelaku Dari analisis di atas. Perubahan penampilan. 5. kehidupan mereka kembali menjadi makmur. yaitu pihak wanita yang mendatangi pihak laki-laki untuk dinikahi. orang yang mempersiapkan pahlawan. Dari 11 fungsi tersebut. dapat diidentifikasi pelaku cerita. penjahatdalam cerita ini. yaitu Suku Soge beserta raja dan putrinya. OIeh karena mimpi itulah.11. yang menjadi istri Lia Nurat. 3. Tindakan pidana. Transfiguration. 2. yaitu tokoh Kitab Suci Perjanjian Lama. b. yaitu Sem. Tindakan melawan hukum adat. The donor. Diatah tokoh mistis legendaris yang kehadirannya diselimuti cerita-cerita mistis. The villain. pemberi. The Magical Helper. Dalam cerita Wato Wele-Lia Nurat. yang merawat dan membesarkan Wato Wele- Lia Nurat. terlihat bahwa cerita Wato Wele-Lia Nurat memiliki 11 fungsi. yang melakukan tindakan melawan adat dan pidana. Suatu ketika Hadung Boleng bermimpi melihat pusat gunung. 4.

seperti terlihat dalam aplikasi terhadap cerita rakyat Flores Timur Wato Wele-Lia Nurat. Propp menggunakan tanda dan lambang-lambang khusus untuk mengidentifikasi fungsi-fungsi dalam satuan liaratif yang ada.4. Secara akademis. Keunggulan dan Kelemahan Hasil analisis Propp mengejutkan banyak peneliti sastra lisan. hasil ini sangat gemilang. Seorang peneliti Betanda. Akan tetapi kelemahan ini dapat diatasi dengan mengabaikan tanda dan lambang-lambang tersebut. kita dapat menyimpulkan bahwa cerita-cerita rakyat Rusia lebih berkaitan dengan. Propp tidak punya kriteria yang jelas dan pasti. seperti yang dilaksanakan di atas. Kritik terhadap nietode Propp banyak dilontarkan. tetapi ditentukan oleh cocok tidaknya peristiwa atau tindakan tertentu dalam urutan fungsi yang menurut Propp harus ada. Propp cukup berhasil memberikan sebuah dasar penggolongan cerita rakyat yang sungguh-sungguh bersifat strukturaldan berlaku umum. P. Dengan demikian. Menurut Guepin. Tampak bahwa gambaran tanda dan lambang-Iambang tersebut membuat cara analisis Propp menjadi rumit dan sukar diterapkan begitu saja. seleksi terhadap fungsi tidakdidasarkan padafungsi tokoh dalam cerita. tergantung cocok tidaknya fungsi itu dalam struktur dan urutan tungsi yang menurut Propp harus ada. sehingga dia secara serampangan menganggap sebuah unsur itu sebagai fungsi. penerapan model analisis ini pada cerita-cerita yang tidak bertemakan kepahlawanan menjadi agak sukar. dan kemenangan. Guepin secara khusus menulis buku Propp Kan Niet an Waarom (Propp Tidak Mungkin dan Mengapa) (lihat Teeuw. pengkhianatan. J. Dari analisis fungsi-fungsi cerita tersebut.. yang tidak digunakan dalam analisis cerita Wato Wele-Lia Nurat. 88 . strategi. Tanda dan lambang-lambang itu terutama digunakannya dalam menggambarkan struktur-skema. Dengan kata lain. 1 984: 293- 295).kisah-kisah kepahlawanan: perang. Kritik Guepin itu terutama menyangkut cara Propp menentukan sebuah unsur tertentu sebagai fungsi atau bukan fungsi.

Dongeng tersebut bisa Anda dapatkan sendiri langsung dari seorang narasumber atau Anda peroleh dari sumber-sumber tertutis. Para pembela Propp membantah kritik Levi-Strauss dan mengatakan bahwa kritik itu berlebihan karena pendekatan Propp memang tidak bertujuan meng-ungkapkan makna setiap cerita rakyat yang dikajinya (seperti yatig dilakukan kauni strltktllralis ataupufl kaum pasikoanalisis). Baginya. Greimas adalah professor pada Ecole des Hautes Etudes en Sciences Sociates (EHESS) di Paris. seorang strukturalis Perancis juga mengeritik karya Propp yang dinilainya menghilangkan semua pertimbangan verbal dari kajiannya. Claude Levi-Strauss. Levi- Strauss ingin membuktikan bahwa pendekatan struktural lebih unggul dibandingkan pendekatan formalisme. Latar Belakang Algirdasiulius Greimas (1917—1992) adalah seorang ahli bahasa dan ahli semiotik yang berasal dari Lithuania dan banyak meneliti mitologi Lithuania. dan watak (character) tentu selalu berbeda dari satu cerita ke cerita lainnya. 5. Sejak tahun 1965. Lakukan kajian terhadap fungsi atau tindakan tokoh sesuai dengan teori Vladimir Propp. kemudian klasifikasikan tokoh-tokoh tersebut ke dalam jenisnya. AJ Greimas: Skema Aktan dan Model Fungsional 1. suasana (mood). Propp juga tidak bermaksud mencari unsur-unsur yang membedakan satu cerita dengan cerita lainnya. B. Tugas Carilah sebuah dongeng yang berkaitan dengan tokoh pahlawan(cultural hero) yang berasal dari daerah Anda. bentuk cerita rakyat selalu lisan sehingga pertimbangan mengenai nada (tone). dia memimpin penelitianlinguistik-semiotik di Paris. Tujuan Propp adalah mengungkap unsur-unsur bangunan yang paling elementer yang menjadi dasar bagi pembentukan struktur naratif dari berbagai cerita rakyat. Prancis. yang kemudian menjadi 89 .

Demikian juga tujuh ruang tindakan disederhanakan menjadi enam aktan (peran. yakni tataran bagairnana cerita dikernukakan (penceritaan). Yang ada hanyalah subjek atau manusia semu yang dibentuk oleh tindakan. objek pertetitian Greimas tidak terbatas pada dongeng tetapi diperluas pada mitos. Claude Levi-Strauss dan Marcel Detienne dituangkannya dalam buku berjudul Of Cods and Men (1979) dan ln Search of National Memory (1990). yaitu tataran imanen. menawarkan konsep yang lebih tajam. menurut Greimas.dasar berkembangnya aliran semiotikParis. Greimas dikenal sebagai pelopor semiotic square (semiotika segi empat) Dalam teori signifikasi dan penemu skema naratif aktansial. yang meliputi (a) tataran naratif anatisis sintaksis naratif (skema aktan dan skema fungsional). kemudian dikelompokkan menjadi tiga struktur dalam tiga pasang oposisi biner. dengan tujuan yang lebih umum. Keduanya dapat berarti suatu tindakan tetapi tidak selalu tindakan manusia. yang dikelompokkan menjadi 90 . dan (b) tataran diskursif. para pembuat). Sebagaimana Propp. Teori dan Metode Greimas Analisis naratif. yaitu (1) struktur Iahir. Penelitian Greimas yang intens terhadap mitologi Lithuania berdasarkan metode George Dumezil. yang disebut actans dan acteurs. Strauss dengan modet Sintagmatis Propp. Naratologi Greimas merupakan kombinasi antara model paradigmatis Levi. Dibandingkan dengan penelitian Propp.melainkan juga nonmanusia. Baginya tidak ada subjek di balik narasi. Greimas meninggal tahun 1992 di Paris. Greimas memberikan perhatian pada relasi. yaitu membentuk sebuah tata bahasa naratif universal. dan (2) struktur batin. Greimas menyederhanakan fungsi-fungsi Propp (31 fungsi) menjadi 20 fungsi. pelaku. Greimas juga Lebih mementingkan aksi (fungsi) dibandingkan dengan pelaku. 2. meliputi dua tahapan struktur.

3. Rosa adalah penerima sedangkan apel adalah objeknya. Dalam kalimat (b) Andi membelikan dirinya sendiri sebuah baju. Cara Kerja Penelitian Skema PoIa-Aktansial Teori AJ Greimas sebenarnya merupakan penghalusan atas teori Propp. dan penolong versus penentang. Semuafungsi tersebut sifatnya tetap serta urutannya sama dalam setiap dongeng (Hutomo. religi. Andi dan Kevin merupakan pengirim. Andi adalah satu aktor yang memiliki dua fungsi aktan. Sebelumnya. baik sebagai pengirim maupun penerima. pengirim (kekuasaan) dan penerima (orang yang dianugrahi).(Todorov. 1985: 48). Dalam kalimat (a) Andi dan Kevin memberikan apel kepada Rosa. perhatikan dua kalimat berikut ini. Propp merumuskan fungsi cerita sebanyak 31 buah.tiga pasangan oposisi biner. 91 . memperkenalkan unsur naratif terkecil yang sifatnya tetap dalam sebuah karya sastra yang disebutnya sebagai fungsi . Kemampuan Greimas dalam mengungkapkan struktur aktan dan aktor menyebabkan teori struktur naratologinya tidak semata-mata bermanfaat dalam menganalisis teks sastra melainkan juga filsafat. 1991: 25). yaitu: subjek versus objek. Propp telah. Berdasarkan penelitiannya tentang dongeng Rusia. Sebagai ilustrasi. dan ilmu sosial lainnya.

Fungsi adalah satuan dasarcerita yang menerangkan tindakan logis dan bermakna yang membentuk narasi. Seorang tokoh dapat menempati fungsi aktan yang berbeda. sedangkan aktor merupakan manifestasi konkret dari aktan. Tanda panah dari pengirim yang mengarah ke objek berarti ada keinginan dari 92 . Kajian terhadap sebuah cerita tidak harus terpaku pada satu skema aktan saja. Setiap aktan dalam sebuah skema dapat mempunyai fungsi ganda. kebebasan. Sebaliknya beberapa tokoh bisa menempati satu aktan. Seperti terlihat dalam keenam pola aktansial di atas. pembunuhan. dapat juga berupa sesuatu yang abstrak seperti cinta. Aktan merupakan peran-peran abstrak yang dimainkan oleh seorang atau sejumlah pelaku. Satit tokoh dapat memiliki beberapa fungsi aktan. Jika tidak ada aktan yang tidak terisi oleh sebuah fungsi atau tokoh maka digunakan tanda ø dan disebut fungsi zero dalam aktan. berupa unsur sintaksis yang mempunyai fungsi tertentu. karetia sebuah cerita dapat saja memiliki beberapa skema aktan. Tanda panah dalam skema merupakan unsur penting yang menghubungkan fungsi sintaksis naratif masing-masing aktan. Pengirim dapat berfungsi sekaligus sebagai subjek atau penerima. aktan dapat berupa tokoh. Table 1 Pola Aktansial Greiman Yang dimaksud dengan aktan adalah satuan naratit terkecil. Aktan tidak identik dengan aktor.

Tanda panah dari pembantu menunjukkan bahwa pembantu memudahkan subjek untuk mendapatkan objek. mengganggu. Adapun fungsi atau kedudukan masing-masing aktan adalah sebagai berikut. 5) Penentang (opponent) adalah aktan (seseorang atau sesuatu yang menghalangi usaha subjek atau pahlawan dalam mencapai objek. Tanda panah dari objek ke penerima berarti objek yang diusahakan oleh subjek dan diinginkan oleh pengirim diserahkan atau ditujukan kepada penerima. Pengirim memberikan karsa atau keinginan kepada subjek untuk mencapai atau mendapatkan objek. 1) Pengirim (sender) adalah aktan (seseorangatau sesuatu) yang menjadi sumber ide dan berfungsi sebagai penggerak cerita. diburu atau diinginkan oleh subjek atas ide dari pengirim. dicari. Tanda panah dari subjek menuju objek berarti subjek bertugas menemukan atau mendapatkan objek yang dibebankan oleh pengirim. 1992:19. menghalangi. atau memiliki objek. 2003:52-54). 93 . Suwondo. merusak atau menolak usaha subjek. 4) Penolong (helper) adalah aktan (sesuatu atau seseorang) yang membantu atau mempermudah usaha subjek atau pahlawan untuk mendapatkan objek. 2) Objek (object) adalah aktan (sesuatu atau seseorang) yang dituju. menemukan.pengirim untuk mendapatkan. 6) Penerima (receiver) adalah aktan (sesuatu atau seseorang) yang menerima objek yang diusahakan atau dicari oleh subjek (Zaimar. 3) Subjek (subject) adalah aktan pahlawan (sesuatu atau seseorang) yang ditugasi pengirim untuk mencari dan mendapatkan objek. Sebaliknya. tanda panah dari penentang menuju subjek berarti penentang rnempunyai kedudukan untuk menentang.

Suwondo. transformasi (2). Dalam tahap ini pula muncul pembantu dan 94 . di situlah subjek mengatami uji kecakapan. pembunuhan. keberangkatan. sehinggadinamakan struktur fungsional. Transformasi meliputi tiga tahap cobaan.akhir (3) (lihat Zaimar: 1991. Dalam tahap cobaan awal. dan sebagainya. Struktur Fungsional Selain menunjukkan struktur aktansial. dan situasi . Modelfungsional terbangun oleh berbagai peristiwa yang dinyatakan dalam kata benda seperti. Modet Fungsionaldibentuk dalambagan sebagai berikut: Tabel 3 Struktur Fungsional I II III Situasi Transformasi Situasi Awal Akhir Tahap Uji Tahap Tahap Kecakapan Utama Kegemilangan Situasi awal cerita menggambarkan keadaan sebelum ada suatu peristiwa yang mengganggu keseimbangan (harmoni). kematian. subjek mulai mencari objek. Model fungsional dibagi menjadi tiga bagian yaitu situasi awal (1). 2003: 54-55). Ketiga tahapan. Greimas juga mengemukakan model cerita yang tetap sebagai alur. perkawinan. sedangkan di antara ponolong dan penentang ada bantuan atau pertentangan.cobaan ini menunjukkan usaha subjek untuk mendapatkan objek. Model fungsionalberfungsi untuk menguraikan peran subjek dalam melaksanakan tugas dari pengirirn yang terdapat dalam fungsi aktan. Perlu dicatat bahwa di antara subjek dan objek ada tujuan. di antara pengirim dan penerima ada komunikasi. Terdapatberbagai rintangan. Model itu dinyatakan dalam berbagai tindakan yang disebut fungsi.

di daerah Ngawi. a. Analisis Struktur Aktan dan Fungsional Dongeng Jaka Budug dan Putri Kemuning Berikut ini akan dilakukan analisis struktur aktan dan fungsional Greimaas terhadap Dongeng Jaka Budug dan Putri Kemuning. misatnya musuh Dalam selimut. Sang Prabu menjadi sedih karena khawatir tak seorang pun pangeran atau pemuda yang mau menikahi putrinya ttu. seperti memberikan putrinya obat-obatan tradisional 95 . (2) Pada suatu hari. Tubuhnya yang semula berbau harum. situasi telah kembali ke keadaan semula. tiba-tiba mengeluarkan bau yang tidak enak. Sesuai namanya. Jawa Timur. Melihat kondisi putrinya itu. Baginda mempunyai seorang putri yang rupawan bernama Putri Kemuning.penentang. Berbagai upaya telah dilakukan oleh baginda. Prabu Aryo Seto adalah seorang raja yang adil dan bijaksana. Putri Kemuning tiba-tiba terserang penyakit aneh. atau seseorang yang berpura-pura baik padahal jahat dan tabir pahlawan palsu terbongkar. Bila tidak ada pahlawan palsu maka subjek adalah pah(awan. tersebutlah seorang raja bernama Prabu Aryo Seto yang bertahta di Kerajaan Ringin Anom. Tahap cobaan membawa kegemilangan merupakan bagian subjek dalam menghadapi pahlawan palsu. Tahap cobaan utama berisi gambaran hasil usaha subjek dalam mendapatkan objek. 4. Di sinilah cerita berakhirdengan subjek yang berhasi) atau gagal mencapai objek. Semua konflik telah berakhir. Dalam tahap utama ini sang pahlawan berhasil mengatasi tantangan dan melakukan perjalanan pulang. (1) Pada zaman dahulu. tubuh sang Putri sangat harum bagaikan bunga kemuning. Dongeng Jaka Budug dan Putri Kemuning Pertama-tama akan disajikan cerita dongeng Jaka Budug dan Putri Kemuningsecara lengkap. Sedangkan situasi akhir berarti keseimbangan.

ujar Sang Prabu di depan rakyatnya. ruang tertutup di dalam istana. la sering duduk melamun seorang diri memikirkan nasib malang yang menimpa putri semata wayangnya. (5) Keesokan harinya. Sang Prabu dengan tekad kuat dan hati yang suci melakukan semedi di dalam sebuah. Wahai. berupa daun kemangi dan beluntas. demikian pesan yang disampaikan oleh suara gaib itu. 96 . Suatu ketika. Daun itu hanya tumbuh di dalam gua di kaki Gunung Arga Dumadi yang dijaga oleh seekor ular naga sakti dan selalu menyemburkan api dari mulutnya. jika ia perempuan. Pada saat baginda larut dalam semedi. (4) Pada saat tengah malam. Namun. aku mendapatkan petunjuk bahwa putriku dapat disembuhkan dengan daun sirna ganda yang tumbuh di gua di kaki Gunung Arga Dumadi. Barang siapa yang dapat mempersembahkan daun itu untuk putriku. Prabu Aryo Seto segera mengumpulkan seluruh rakyatnya di alun-alun untuk mengadakan sayembara. ia akan kuangkat menjadi anakku. wahai Prabu Aryo Seto! Satu-satunya obat yang dapat menyembuh-kan penyakit putrimu adalah dauii sirna ganda. tiba-tiba terlintas dalam pikirannya untuk melakukan semedi dan meminta petunjuk kepada Tuhan Yang Maha Kuasa agar penyakit langka yang menimpa putrinya dapat disembuhkan. tiba-tiba terdengar suara bisikan yang sangat jelas di telinganya. seluruh rakyatku! Kalian semua tentu sudah mengetahui perihal penyakit putriku. namun tak seorang pun yang mampu menyembuhkan sang Putri. (3) Hati Prabu Aryo Seto semakin resah. Setelah semalam bersemedi. Dengarlah. jika ia laki-laki akan kunikahkan dengan putriku. Sang Prabu juga telah mengundang seluruh tabib yang ada di negerinya. namun penyakit sang putri belum juga sembuh.

Penyakit aneh itu sudah dideritanya sejak masih kecil. la dipanggit Jaka Budug karena mempunyai penyakit tangka. yaitu seluruh tubuhnya dipenuhi oleh penyakit budug. (7) Salah seorang pemuda yang ingin sekali mengikuti sayembcira tersebut aclalalt Jaka Budug. sLiclah banyak warga yang menjadi korban keganasan naga itu. Jaka Budug dengan tekadnya yang kuat memberanikan diri datang menghadap kepadaSang Prabu. Meski demikian. (8) Sementara itu. Banyak warga yang tidak berani mengikuti sayembara tersebLit karena mereka semua tahu bahwa gua itu dijaga oleh -eekor tiaga yaiig sakti dan sangat ganas. Meski demikian. banyak pula warga yang memberanikan diriuntuk mengikuti sayembara tersebut karena tergiur oleh hadiah yang dijanjikan oleh Sang Prabu. Bahkan.Ampun. Setiap orang pasti akan senang jika menjadi menantu atau pun anak angkat raja.(6) Mendengar pengumuman itu. katajaka 97 . Baginda! lzinkan hamba untuk mengikuti sayembara ini untuk meringankan beban Sang Putri. belum satu pun peserta yang mampu mengalahkan naga sakti itu. Jaka Budug pun semakin gelisahmendengar kabar itu. Namun. Jaka Budug adalah pemuda miskin yang tinggal di sebuah gubuk reyotbersama ibunyadi sebuah desaterpencil di dalam witayah Kerajaan Ringin Anom. Dengan kesaktiannya itu. para peserta sayembara telah berkumpul di kaki Gunung Arga Dumadi untuk menguji kesaktian mereka. Berita tentangsayembara itu pun tersebar hingga ke seluruh pelosok negeri. seluruh rakyat Kerajaan Ringin Anom menjadi gempar. jaka Bitdug adalah seorang pemuda yarig sikti. ia ingin sekali menolong sang Putri. Di hadapan Prabu Aryo Seto. ia merasa malu dengan keadaan dirinya. la sangat mahir dan gesit memainkan keris pusaka yang diwarisi dari almarhum ayahnya. (9) Pada hari ketujuh. Sejak hari pertama hingga hari keenam sayembara itudilangsungkan. ia memohon izin untuk ikut dalam sayembara itu.

Baiklah. sampailah ia di kaki gunung Arga Dumadi. Jaka Budug! Karena tekadmu yang kuat. (12) Jaka Budug melangkah perlahan mendekati naga itu dengan sangat hati-hati. la sudah tidak sabar ingin membinasakan naga itu dengan keris pusakanya. akhirnya Sang Prabu menyetujuinya. Prabu Aryo Seto ragu-ragu dengan kemampuan Jaka Budug. Namun. setelah Jaka Budug menunjukkan keris pusakanya dan tekadnya yang kuat. Hamba akan mengalahkan naga itu dengan keris pusaka hamba ini. Setelah berjalan cukup jauh. (11) Jaka Budug pun berangkat ke Gunung Arga Dumadi dengan tekad membara. Prabu Aryo Seto tidak menjawab. ia melihat semburan- semburan api yang keluar dari mulut naga sakti penghuni gua. Dari kejauhan. (13) Ketika naga itu lengah. Budug. jawab Jaka Budug seraya memperlihatkan keris pusakanya kepada Sang Prabu. Jaka Budug pun segera melompat mundur untuk menghindari serangan itu. Sungguh ajaib. la harus mengalahkan naga itudan membawa pulang daun sirna ganda. Semoga kamu berhasil! ucap Sang Prabu. tiba-tiba naga itumenyerangnya dengan semburan api. (10) Pada mulanya. Lama-kelamaan. Jaka Budug segera menghujankan kerisriya ke perut naga itu. Begitu ia mendekat. anak muda? Dengan apa kamu bisa mengalahkan naga sakti itu? tanya Sang Prabu. kesabaran Jaka Budug pun habis. tangan jaka 98 . Naga itu terus bertubi-tubi menyerang sehingga Jaka Budug terlihat sedikitkewalahan. Baginda. maka keinginanmu kuterima. Siapa kamu hai.Hamba Jaka Budug. Darah segar pun memancar dari tubuh naga itu dan mengenai tangan Jaka Budug. ia terdiam sejenak sambil memperhatikan Jaka Budug yang tubuhnya dipenuhi bintik-bintik merah.

Setelah itu. Prabu Aryo Seto meninggal dunia. Sang Prabu hampir tidak percaya jika pemuda di hadapannya itu Jaka Budug. Naga sakti itu pun tewas seketika. Dengan gesitnya. jaka budug segera mengambil darah naga itu lalu mengusapkan ke seluruh badannya yang terkena penyakit budug. (15) Setelah memetik beberapa lembar daun sirna ganda di dalam gua. jaka Budiig segera pulang ke istana denganperasaan gembira. Jaka Budug semakin bersemangat ingin membinasakan naga itu. ia kembali menusukkan kerisnya ke leher naga itu hingga darah mernancar dengan derasnya. setelah Jaka Budug menceritakan semua peristiwa yang dialaminya di kaki Gunung Arga Dumadi. Sesuai dengan janjinya. Sang Prabu segera menikahkan Jaka Budug dengan putrinya. 99 . barulah Sang Prabu percaya dan terkagum-kagurn. Putri Kemuning kembali sehat setelah memakandaun sirna ganda itu. Kini. Selang berapa lama setelah mereka menikah. Tak sedikit pun bintik-bintik merah yang tersisa. Namun. Setibanya di istana. (14) Melihat keajaiban itu. Seketika itu pula seluruh badannya menjadi bersih dan halus. Sungguh ajaib. Budug yang terkena darah sang naga itu seketika menjadi halus dan bersih dari penyakit budug. (16) Jaka Budug kemudianmempersembahkan daun sirna ganda yang diperolehnya kepada Sang Prabu. jaka Budug dan Putri Kemuning pun hidup berbahagia. tubuh Sang Putri kembali berbau harum bagaikan bunga kemuning. Putri Kemuning. Jaka Budug berubah menjadi pemuda yang sangat tampan. Kini. Prabu Aryo Seto tercengang ketika melihat Jaka Budug yang kini kulitnya menjadi bersih dan wajahnya berseri- seri. Jaka Budug pun dinobatkan menjadi pewaris tahta Kerajaan Ringin Anom. (17) Prabu Aryo Seto pun menetapkan Jaka Budug sebagai pemenang sayembara tersebut.

100 .

Daun sirna ganda mengobati Putri Kemuning dan darah ular naga sakti mengobati penyakit kudis Jaka Budug. 101 .n membunuh utar naga sakti (penentang). diketahui bahwa Prabu Aryo Setyo menduduki peran sebagai pengirim yang menginginkan agar putrinya Putri Kemuning (objek) sembuh dari penyakit aneh yang menderanya. Skema Aktansial Untuk kepentingan penulisan buku ini. Jaka Budug berperan sebagai subjek atau pahlawan bagi Putri Kemuning karena hanya diatah yang berhasil mengambit obat daun sirna ganda (penolOng) da.b. Atas keberhasilan-nya memenangkan sayembara jaka Budug pun berhasil memperoleh (penerima) dan memperistri Putri Kemuning. sebuah skema aktansial saja dipandang cukup untuk menjelaskan dongeiig Jaka Budug dan Putri Kemuning. Prabii Aryo Setyo -pnyetenggarakan sayembara untuk mendapatkan obat yang bisa menyembuhkan Putri Kemuniflg. Penelitian terhadap dongeng-dongeng dengan struktur penokohan dan alur cerita yang panjang perlu mengemukakan beberapa skema aktansial untuk menentukan skema aktansial yang paling tepat menggambarkan hakikat cerita yang dipelajari. Karena itu. Sesuai dengan skema aktansiat di atas.

Situasi AwaI Sesuai dengan skema aktansial di atas. 1). Struktur Fungsional . Tahap Kegemilangan: tahap kegemilangan dalam dongeng ini ditandai dengan persembahan daun sirna ganda yang diperoleh Jaka Budug kepada Sang Prabu. Berbagai upayatetah dilakukan oleh baginda. struktur cerita dimulai dengan kekalutan Prabu Aryo Setyo dari Kerajaan Ringin Anom karena putrinya yang semula sangat harum mewangi diserang penyakit aneh: tubuhnya mengeluarkan bau yang tidak enak. namuntak seorang pun mampu menyembuhkan sang Putri. 102 . Dengan obat itulah. yaitu darah sang naga menyembuhkan penyakit Jaka Budug dan mengubahnya menjadi seorang pemuda. namun penyakit sang putri Belum juga sembuh. Transformasi Tahap Kecakapan: transformasi mulai dirasakan dengan munculnya seorang pemuda buruk rupa bernama Jaka Budug yang tubuhnya berbintik-bintik karena penyakit kudis. Tahap Utama: cerita bergerak pada kisah kepahlawanan tokoh Jaka Budug mendapatkan obat daun sirna ganda dan membunuh ular naga sakti dengan keris pusakanya. Prabu Aryo Seto pun menetapkan Jaka Budug sebagai pemenang sayembara tersebut. Melihat kesedihan yang diderita putri semata wayangnya. 2).tampan. seperti memberikan putrinya obat-obatan tradisional berupa daun kemangi dan beluntas. Sebuah peristiwa dramatis terjadi pada tahap ini.c. Satu-satunya kekuatan yang dimilikinya adalah sebilah keris pusaka. Sang Prabu juga telah mengundang seluruh tabib yang ada di negerinya. Prabu Aryo Setyo berupaya sekuat kemampuannya untuk dapat menyembuhkan penyakit sang putri. Putri Kemuning kembali sehat dan kembali berbau harum bagaikan bunga kemuning.

Tujuan penelitiannya adalah menemukan pola umurn alurdongeng pada umumnya. Setang berapa lama setelah. Greimas juga 103 . religi. Sesuai dengan janjinya. Greimas memberikan perhatian pada relasi. Bagi Propp semua cerita memiliki struktur yang sama. dengan tujuan yang Iebih umum. Rangkuman Kekuatan model analisis struktur Greimas adalah menyederhanakan fungsi-fungsi dan poia-pola pelaku dalam sebuah cerita. seperti sastra. Kemampuan Greimas dalam mengungkapkan struktur iklan dan stuktur fungsional menyebabkan teori struktur naratologinya tidak semata- mata bermanfaat dalam menganalisis teks sastra melainkan juga filsafat. dan serial televisi. Sebagaimana Propp.3). dan ilmu sosial lainnya. tetapi perbuatan dan peran- perannya sama. Propp menyimpulkan bahwa jumlah fungsi yang terkandung dalam dongeng yang ditelitinya memiliki 31 fungsi yang clikelonipokkan ke dalam tujuh ruang tindakan atauperanan. Prabu Aryo Seto meninggat dunia. teater. Jaka Budug pun dinobatkan menjadi pewaris tahta Kerajaan Ringin Anom. menawarkan konsep yang lebih tajam.mereka menikah. Klasifikasinya terhadap jenis-jenis tokoh digunakan dalam media pendidikan dan dapat diaplikasikan hampir dalam semua cerita. dalam sebuah cerita para pelaku dan sifat-sifatnya dapat berubah. Putri Kemuning. Setetah itu. Perbuatan dan peran itu disebut fungsi. yaitu membentuk sebuah tata bahasa naratif universal. merupakan upaya akademis pertama yang mencQba melakukan analisis yang cermat tentang struktur cerita rakyat (folktale). Sang Prabu segera menikahkan Jaka Budug dengan putrinya. tidak berubah. Artinya. C. Teori analisis morfologi cerita rakyat yang dikembangkan oleh tokoh formalis Rusia Vladimir Propp (1895-1970). jaka Budug dan Putri Kemuning pun hidup berbahagia. Situasi Akhir Dongeng Jaka Budug dan Putri Kemuning berakhir bahagia.

pengirim (kekuasaan) dan penerima (orang yang dianugrah i). 104 . yang dikelompokkan menjadi tiga pasangan oposisi biner. para pembuat). kemudian dikelompokkan menjadi tiga struktur dalam tiga pasang oposisi biner. pelaku.lebih mementingkan aksi (fungsi) dibandingkan dengan pelaku. Greimas menyederhanakan fungsi-fungsi Propp (31 fungsi) menjadi 20 fungsi. yaitu: subjek versus objek. Demikian jugatujuh ruang tindakan disederhanakan menjadi enam aktan (peran. dan penolong versus penentang.

f) memohon kesuburan. Hamulak merupakan salah satu khazanah sastra lisan masyarakat Tetun di NTT maupun Timor Leste yang masih tetap diciptakan dan dihayati sebagai salah satu bentuk sastra yang sangat merakyat. e) penguburan orang mati. c) pentahbisan imam baru. lstilah Hamulak. Tradisi Hamulak ini tersebar dalam berbagai wilayah kebudayaan Tetun dan 105 . sesuai dengan fungsi dan tujuan penuturannya. memperoleh kekayaan. BAB IX TRADISI HAMULAK: PUISI LISAN MASYARAKAT TETUN A.. Hamulak dituturkan antara lain untuk kepentingan-kepentingan seperti: a) menerima tamu penting.baik masyarakat Teun diKabupaten Belu. -antara rakyat biasa(reni)dengan para penguasa (Iiurai). Hamulak biasanya dituturkan atau dilahtunkan oleh orang-orang tertentu (Lia Na’in)yang secara tradisional memang bertugas menuturkan Hamulak. Pendahuluan 1. metaforis dan umumnya bersifat naratif. (bahasa Tetun) secara harfiah berarti -berdoa. Penuturan dan tatacara yangberkaitan dengan penuturannya berbeda-beda. Jenis sastra lisan ini mengandung nilai-nilai budaya yang amat kaya karena Hamulak dapat dituturkan pada berbagai kesempatan dan kepentingan ritual formal. dan g) berbagai fungsi magis. NTT maupunmasyarakat Tetundi Timor Leste yangberciri puitis. d) peresmian rumah adat. Para penutur itu adalah imam ritual yang disebut Mako’anatau Makdean. seperti: lulus ujian. jodoh. Kadang-kadang pola penuturan ataupun pelantunan berbeda-beda pula menurut masing-masing desa. dll. suksesdalam usaha. turunnya hujan. yang dalam struktur organisasi-sosialtradisional selalu berperan sebagaipenghubung antaraduniamanusia dengan dunia leluhur. b) penelusuran asal-usul. Latar Belakang Hamulak merupakan salah satu tradisi doa ritual masyarakat Tetun.

2. Penjelasan di atas menunjukkan secarajelas. serta menumbuhkan rasa bangga terhadap kebhinekaan kebudayaan bangsa kita.diungkapkan secara lebih mendalam dan terperinc. Penger-alan yang lebih mendalam terhadap struktur dan• fungsi sastra lisan Hamulak dapat menjadi-dasar untuk memahami adat istiadat. Meskipun dem ikian. Pengenalan dan pemahaman ini dapat memperkaya khazanah kebudayaan Nusantara. tampak bahwa Tradisi Hamulak memiliki konvensi-konvensi. dapat dipastikan bahwa tradisi 106 .i. 2.Jjterer dan fungsi estetik yang khas. penerjemahan dan penerbitan sastra lisan itu secara lengkap berdasarkan berbagai tradisi lokalnya. Ada kepercayaan bahwa penceritaannya secara benar akan. Untuk itu. betapa trad isi hamulak mengandung nilai-nilai sastra dan berbagai fungsi estetik yang sangat rnenarik untuk dikaji dan . danberbagai norma bahkan pandangan dunia yang dianut masyarakatTetun di NTT dan Timor Leste. akselerasi pembangunan dapat mendesak tradisi-tradisi lokal tersebut. masih tetap hidup. 1. pencatatan. . diciptakan dan diapresiasimasyarakat pendukungnya.Mambae. perlu dilakukan perekaman. Perumusan Masalah Masalah utama dalam penelitian ini dapat dirumuskan sebagai berikut. mendatangkan kekuatan supranatural ataupun preternatural yang bersumber dari para leluhur. sistem n-lai. Untuk itu perlu dilakukan studi yang lebih cermat terhadap konvensi-konvensi literer tersebut agar dapat dipahami k9nvensi puitik danfungsi estetiknya bagi masyarakat Tetun di Timor Leste. Mengingat tradisi Hamulak itu. Dari sudut komposisinya. Hamulak sebagai salah satu jenis sastra lisan masyarakat Tetun di Timor Leste masih terpelihara dengan baik sampa•i sekarang dan menduduki posisi yang penting dalam kehidupan sosial-budaya masyarakatnya. baik di Timor Leste maupun di propirisi NTT. konvensi. 3.

 Untuk teori sastra lisan. hasil penelitianinidapat menjadi salah satu bahan sastra lisan. di manfaatkan untuk merumuskan poetika dan retorika hamulak. agar dapat diketahui. khususnya di dunia persekolahan. Menggaii dan merumuskan struktur atau bangun komposisi Hamulak. Menghimpun dan mendokumentasikan teks-teks Hamulak disertai dengan terjemahan dan catatan agar dapat dinikmati oleh kalangan yang lebih Iuas. serta pandangan duniamasyarakatTetun. maka tujuan yang ingln dlcapai oleh penelitian ini adalahuntuk: 1. OIeh karena itu studi ini diharapkan memberikan sumbangan pemikiran bagi. 107 . 3. iImu maupunbagi pembangunan. poetika dan konvensi estetika Tradisi Hamulak masyarakat Tetun 3 Melacakdan merumuskan pandangan dunia masyrakat Tetun sepertt yang tersirat maupun tersurat dalam berbagai teks Hamulak : 4. 2. Tujuan Penelitian Sesuaidengan perumusan masalah tersebut di atas. Manfaat Penelitian Penelitian ini merupakdn studi sastra yang pertamadilakukan terhadap khazanah sastra Iisan yang sangat terkenal di dalamkebudayaan Tetun-yaitu tradisi hamulak. ini memiliki peluang untuk merumuskan pandangan dunia masyarakat pendukungnya.  Untuk dunia pendidikan. Keindahanbahasa dansarana retorika hamulak dapat dipelajari oleh generasi muda untuk dipergunakahdaIam berbagai kesempatan ritual formal. Studi yang cermat terhadap teks-teks sastra lisan Hamulak tersebut dapat mengungkap world-view masyarakat Tetun.

yakni: kritik. Pandangan dunia di sini secara khusus akan dibatasi pada sistem religi lokal masyarakat Tetun. seperti:inagurasi rumah adat. Secara lebih terperinci. Cakupan Penelitian Sesuai dengan masalah dan tujuan penelitian yang diuraikan di atas. maka cakupan penelitian ini adalah analisis konvensi struktur penceritaan. ungkapan formulaik dan tema-tema konvensional sastra Lisan Hamulak sesuai dengan teori puisi lisanMilman Parry dan Albert B. a) Menyajikan transkripsi dan terjemahari teks-teks Hamulak menurut berbagai kepentingan ritual. ceritagenealogis. c) Menyajikan analisis mengenai pandangan dunia masyarakat Tetun. . penjemputan liurai. analisisSastra tanpa terlebih dahulu meninjau secara kritis sumber-sumber teksnya dapat membawa kepada kesimpulan yang keliru (Teeuw. tema-tema penceritaan. panen. analisis fungsi estetik dan fungsi sosial sastra lisan Hamulak. 108 . pewarisan. Kedua model pendekatan ini dipandangmemiliki kaitan erat dan hubungan timbal balik. upacara kematian. Kerangka Teoritis Penelitian ini akan memanfaatkan dua model pendekatan. Kritik teks tanpa analisis dan interpretasi sastra tidak akan membawa hasil yang memadai bagi pemahaman teks. dan konteks sastra dan budaya Tetun. teks (tekstologi) dan kritik sastra (ilmu sastra). Menyajikan analisis terhadap ciri-ciri formula. dan sebagainya. b) Menyajikan analisis sastra berdasarkan teks dan konteks sastra lisan Hamulak. cakupan anaiisis dalam studi ini dapat dirumuskan sebagai berikut. 1991: 225-226). Analisis konvensi penceritaan akan mencakup: kedudukan tukang cerita. untuk memahami konvensi struktur penceritaan dan poetika sastranya. Analisis struktur akan mencakup komposisi cerita. 6. Sebaliknya. Lord.5.

Tambahan pula. sesuai dengan model pendekatan dalam penelitian ini. 1986: 62) maupun dengan rnenggunakan bukti-bukti luar (outside evidence) (Dejong. bahwa antara sastra tulis dan sastra lisan tidak terdapat pembagian fungsi yang jelas (Sulastin Sutrisno. Kerangka teori yang akan dipakai sebagai acuan dalam penelitian ini akan diambil dari putaka-puStakate0n maupun pustaka-pustaka hasil penelitian yang relevan bagi studi sastra lisan dalam disiplin ilmu sastradan ilmufilologi. rnasalah asal-usul teks perkembangan. sekaiipun diupayakan agar terbitan teks dapat dibaca dan dipahami oleh berbagai kalangan. se-lndonesia clari berbagai segi harus dipandang sebagai. variasi teks sebagai aspek hakiki sastra rakyat. Pemanfaatan bidang ilmu kritikteks dan kritik sastra dalam penelitian sastra Lisan ini terutama didasarkan pada asumsi. Dalam rangka kritik teks. Dalam tataran historik maupun tipologik. Penentuan bentuk teks yang paling dapat dipercaya memperhatikan berbagai kbnteks yang menentukan wujud teks-teks tertentu (Fox. terdapat simbiosis antara sastra tulis dan sastra lisan. 1988: 300-310) Kesatuan dan keterkaitan sastra tulis dan sastra lisan dapa dibuktikan. maupun fun sastra Dalam masyarakat. 1 981: 1 0). pemisahan antara sastra tulis dan sastra lisan dalam kebudayaan Nusantara -baik dari. sehingga sastra. baik dari segi struktur kesastraan. bentuk teks yang paling dapat dipercaya (Sulastin Sutris. segi sejarah maupun tipoiogi sastra. 1980). Menurut Thompson (1977: 367-368). Dalam studi yang melibatkan masalah konve struktur penciptaafl ini. 1981: 17-19). terbitan teks dan interpretasi sastra diperhatikan secermat mungkin ciri-ciri sastra lisannya. kesatuan dan keterkaitan (Teeuw.justru dapat menyesatkan pemahaman terhadap hakikat sastra itu sendiri. Inti kegiatan kritikteks (tekstologi) adalah penentu. serta wilayah persebarannya akan diperhatikan secara khusus. segi-segi yang perlu 109 . proses penciptaan sastr resepsi masyarakat terhadap sastra Iisan.

Dalam kaitan ini. dan (5) Kaitan antara cerita tertentu dengan cerita-cerita lainnya -seperti: sage. epos. 1982:39). sebab fungsi sosial karya sastra hanya sungguh-sungguh terwujud bila pengalaman sastra -sang penikmat terlihat dalam horison harapari mengenai kehidupannya yang praktis. Pengungkapannya dalam. Lord (1981) sebagai pedoman umum. dansebagainya. 1 988:115). (2) Makna cerita rakyat: apakah sesuaidengan ekspresi li-guistiknya ataukah memiliki makna tersembunyi (hidden significance). dan berimplikasi pada sikap sosiainya (Jauss.sistem sastra akan memper-lihatkan bahwa manifestasi sastra dalam sebuah bahasa selalu mempunyai unsur-unsur sistematiknya (Teeuw. dan mengapa terjadi perbedaan variasi itu. Untuk itu analisis struktur puisi Hamulak akan menggunakan pandangan Albert B. mengapa terjadi. tradisi Hamulak diduga memanfaatk-an kaidah-kaidah penyajian lisan sesuai dengan konvensi forrnula sebagai dasar pembentukan larik. pola-pola penciptaan sastra lisan mendapat perhatian sesuai dengan kondisi sosial budaya masyarakat pendukungnya. Selanjutnya. (1) Deskripsi mengenai sumber sastralisan tersebut. 4) Variasi-variasi teks.apakah variasi itu berdiri sendiri. Dalam penyampaiannya. Dalam rangka signifikasi kategori estetika.: kebiasaan penuturan dan bagaimana peneliti mendapatkan teks itu. Parry & Lord mengemukakan tentang formula dan ungkapan formulaiksebagai dasar komposisi puisi lisan. (3) Penyebaran ceritarakyat itu sifat-sifat penyebarannya. Iengan fungsi estetika Dengan kata lain. legenda. penelitian ini emandang perlunya penilaian yang seimbang antaraestetika dan fungsi estetika. Pembacaan dan penafsiran karya sastra dalam studi ini menjembatani kategori estetik berdasarkan poetika.dicermati oleh seorang peneliti sastra lisan mencakup Iima hal sebagai berikut. penyebaran. tinjauafl terhadap pengaturan fakta-fakta kesusastraan dari teks yang digubah tukang cerita dengan memperhatikan lingkungan sejarah sastradan sejarah umum dapat memberikan pemahaman yang 110 . mitos.

perekaman.aspek-aspek sastra dan budaya Tetun. Gambaran Umum Lokasi Penelitian Tidak banyak tersedia literatur yang membicarakan mengenai masyarakat Tetun. para tua adat yang secara tradisional memang berfungsi sebagai penutur hamulak yang disebut makoan. Kritik sastra diarahkan pada upaya menggali muatan makna (content analysis) yang terkandung dalam teks-teks saksi. 7. lnforman yang menjadi sasaran dalam penelitian ini ditentukan secara purposif. sikap dan sambutanpenikmat serta keterangan-keterangan lainnya seperti kolofon dan variasi teks. Hamulak dalam Konteks Sastra. data observasi tentang. usia penutur. Teknik perekaman digunakan untuk meng-himpun teks-teks sastra lisan Hamulak.lebih baik mengenai segi estetika dan fungsi estetika suatu jenis karya sastra. dan pencatatan. maupun informasi-informasi lainnya yang mendukung analisis. B. Buku David Hicks (1985) berjudul Roh Orang Tetum di Timor Leste merupakan sebuah karya antropologi simbolis yang meneliti 111 . dan Budaya Masyarakat Tetun 1.syarakat subyek penelitian. Teknik -wawancara digunakan untuk memperoleh keterangan-keterangan menyangkut bentuk dan isi tuturan maupun .situasi penuturan. Teknik pencatatandi maksudkan untuk mengumpulkan. Metode Penelitian Pengumpulan data untuk kepentingan penelitian ini dilakukan dengan teknik wawancara. Kritik teks dimaksudkan untuk memperoleh teks yang benar-benar dapat mewakili korpus kebudayaan ma. cara penuturan. Diutamakan penutur asli. yakni mempertimbangkan kedudukan sosial penutur. dan kebe-rlayakannya ditinjau dari sudut pandang adat setempat. Analisis data dilakukan dengan menggunakan pendekatan kritik teks (FiloLogi) dan kritik sastra (llmu sastra).

dan kabupaten Kovalima). tidak ada suatu wilayah kabupaten pun di Timtim maupun di NTT yang dihuni suku bangsa Tetun secara inklusif. Timor Barat) dan sebagiannya lagi menetap secara sporadis di 7 kabupaten di propinsi Timor Timur (yakni kabupaten DiLi. Bahasa Tetun merupakan keluarga bahasa Melayu-Polinesia. Akan tetapi patut diperhatikan bahwa detail kebudayaan antara satu wilayah dengan wilayah lainnya tidak selalu menunjukkan kemiripan. sastra lisan dan agama yang menyertai siklus tersebut. mendiami tanah atau wilayah Tetun (Rai Tetun) (Parera. arsitektur. kabupaten Manatuto. yakni: Tetun Utara. bahasaTetun telah dipergunakan sebagai bahasa pengantar (Iingua franca) di antara 112 . ritus. Daerah Kabupaten Viqueque termasuk kelompok Tetun Timur (Hicks. yang berbicara Tetun (Dale Tetun). Beberapa informasi menyebutkan bahwa lebih dari 60% masyarakat Timtim menggunakan bahasa Tetun. Di Timor Leste. Penyebutan istilah Kebudayaan Tetun Lebih mengacu pada penggunaan bahasa yang sama yakni Bahasa Tetun. Bahasa ini secara umum terbagi dalam tiga kelompok-besar. Sementara itu. Secara demografis. penutur bahasa Tetun mencakup lebih dari separuh jumlah penduduknya. 1985:14). Tetun Selatan dan Tetun Timur. kabupaten Ainaro. kabupaten Bobonaro. Sejak masa pemerintahan hangsa Portugal sampai sekarang. Suku bangsa Tetun secara sporadis mendiami kawasan yang cukup luas.kehidupan masyarakat Tetun di tahun 1966 pada masa pemerintahanPortugal. kabupaten Viqueque. yang berbahasa Tetun (Lia Tetun). ADM Parera (1994) dalam bukunya Sejarah Pemerintahan Raja-raja Timor tidak secara khusus memberikan gambaran tentang masyarakat Tetun. kabupaten Ermera. Sebagiannya menetap di propinsi NTT (terutama di kabupaten Belu. dan yang . 1994:47). Masyarakat Tetun adalah sekelompok suku bangsa di Pulau Timor yang dikenal dengan sebutan orang Tetun (Ema Tetun). Kelompok Utara dan Selatan sama-sama dikenal dengan nama Tetun Barat. Karya ini terfokus pada daur kehidupan manusia beserta segala mitos.

Mendes Correia berpendapat bahwa di seluruh Timor Leste dapat dijumpai pengaruh proto Melayu dengan kecenderungan euorid dan melanoindid. diperoleh keterangan bahwa ada unsur Melayu Muda di samping unsur Melanesia (Parera. Akan tetapi lama kelamaan versi cerita ini terdesak oleh versi cerita baru yang mengatakan bahwa leluhur mereka datang dari Sina Mutin-Malaka. merupakan. tetapi W. Versi yang lebih tua menyatakan bahwa leluhur mereka berasal dari Seram (Seran Kora) atau tempat tertentu di Maluku. Dengan kedua manusia inilah penduduk pertama -bercampur. Dari sudut ras (antropologi fisik). Parera (1 995: 48) mengemukakan dua versi cerita tentang nenek moyang orang BeIu (Tetun). Sastra dan Budaya Lisan 113 . Namun demikian tidak dijumpai tanda-tanda negroid atau mongoloid. 1995: 32. Homo Soloensis dan Homo Wajakensis.suatu pusat atau daerah pertemuan rasial. Dia bahkan rnengatakan bahwa penduduk pertama sama tuanya dengan Pithecantopus. Catatan terakhir Mendes Correia menginformasikan bahwa penduduk Timor Leste bukanlah keturunan dari para pengungsi yang datang terakhir. Cerita tentang Sina Mutin-Malaka ini sangat populer terutama karena selalu dikisahkan di pusat kerajaan besar yakni Kerajaan Wehiku-Wehali. menurut Mendes Correia. Demikian juga unsur deutero Melayu yang mirip dengan mongofoid sedikit sekali ditemukan di Timor Leste. Keers membuktikan bahwa unsurMelayu itu hampirtidak berarti. Bila masuk ke daerah pedalaman. 2.berbagai suku bangsa dan bahasa di Timor Leste yang jumlahnya sangat banyak itu. Bahasa ini dapat dipandang sebagai bahasa resmi di Timtim sehingga harus. 48). Timor. dapat dijumpai unsur veddo australoid yang punya hubungan dengan Melanesia dan Papua. dikuasai baik oleh para pejabat maupun rakyat biasa.

nal bertugas menjaga keberlangsungan tradisi lisan dan berbagai sistem nilailainnya. Sastra dan budaya lisan itu sangat dominan karena penduduk daerah ini tidak mengenal tulisan. Masyarakat Tetun sangat kaya akan tradisi lisan. Pada jaman duiu. baik prosa maupun puisi.Hamulak dapat diucapkan oleh tua-tua adat dari uma rnanapun asalkan memenuhi syarat-syarat yang sudah ditentukan. Makdean . cerita genealogis (Ai- Knanoik) dan cerita kepahlawanan (Ai-Babelen). Orang Tetun seringkali menganggap bahasa ritual itu sebagai suatu bahasa leluhur 114 . baik yang dituturkan maupun yang dilagukan dengan irama tertentu yang panjang dan monoton. Dalam berbagai kepenti ngan ritual formal. atau Makoan adalah sebuah jabatan dalam fungsi ritual. kini konvensi tersebut telah rnengalami pergeseran. Hal ini tentu saja menimbulkan kesulitan tersendiri dalam mengungkap sejarah masa lampau masyarakat Tetun karena cerita-cerita lisan pada umumnya muncul dalam beberapa versi yang bahkan bisa saling bertentangan satu dengan yang lain. Mereka. Ragam prosa secara umum dikenal sebagai Lia Nain. Lia Nain mencakup berbagai dongeng.. yang hanya boleh diduduki ataudiperankan oleh tua-tuaadat dari kelompok suku Uma Lia Nain. Tukang cerita (itau penyair lisan Tetun disebut Makdean atau Makoan.-lnilah sebabnya segala bentuk tuturan sastra lisanTetun disebutjuga dengan istilah Lia Nain. puitis. dan puisi doa ritual (hamulak). Akan tetapi. Berbagai informasi penting seperti sejarah asal-usul kerajaan dan adat-istiadat tersimpan dalam cerita-cerita lisan. penuturannya d ilaksanakan dengan lagu (dilagukan).umumnya berperanan sebagai imam ritual yang berfungsi menjalin hubungan antara anggota suku dengan pendiri suku maupun sang pencipta. Mereka adalah tua-tuaadat Tetun yang secara tradisio. pantun berbalas-balasan (Ai- Knananuk). teka-teki-(Ai-Sasik). Pada dasarnya hamulak adalah semacam narasi doa yang diungkapkan dengan menggunakan konvensi bahasa ritual yang berciri liris. Ragam puisi meliputi perumpamaan (dadolin). fabel. legenda. dan metaforis.

Uma Kanek. Adat lstiadat dan StrataSosial Telah disebutkan di atas.yang harus menggunakan kosa kata yang unik dan aturan tersendiri yang khas pada hamulak. panen. terdapat empat kelompok organisasi sosial (pola empat). Mengenai hal imi masih perlu dilakukan penelitian lanjutan. pemberkatan gereja. pentahbisan imam baru. Selain dalam upacara-upacara ritus tradisional.Wehiku-Wehali dan kisah perjalanan leluhur mereka dari Sina Mutin-Malaka. yakni: Uma Metan. akhir-akhir ini Hamulak juga disampaikan dalam upacara- upacara modern seperti penerimaan tamu penting. Hamulak biasanya diucapkan pada saat dimulai atau berakhirnya penyelenggaraan upacara-upacara ritus tradisional. dll. pembangunan rumah adat (uma lulik).Barangkali hal inilah yang menjadi perekat persatuan kebudayaan Tetun. seperti. hampir semua wilayah Tetun di Timor Leste menyirnpan sebuah kisah yarg sarna mengenai kerajaan. Dalam lingkungan suku Uma Metan. Masing-masiflg uma rnempunyai kedudukan dan fungsi sosial-ritual tertentu. bahwa detail kebudayaan Tetun tidaklah mirip antarasatu wilayah dengan wilayah lainnya sekalipun mereka menggunakan bahasayangsama yakni bahasa Tetun Sekalipun demikian. pembukaan lahan baru. upacara pernikahan. Penjelasan tentang adat-istiadat dan strata sosial berikut ini lebih rnengacu pada kebudayaan Tetun di Kabupaten Kovaiima. dan berbagai acara penting lainnya. 3. Sebagai ilustrasi akan dikemukakan komunitas suku masyarakat Tetun Terik di wilayah Kecamatan Fohoren (Kabupaten Kovalima). Masyarakat Tetun biasanya hidup dalam komunitas-komunitas suku yang dinamakan Uma. Masyarakat di tempat ini dibangun dalam organisasi sosial dalam struktur suku Uma Metan. Uma Ferik Katuas. kematian. khusu-nya di kecamatan Fohorem. Wilayah tempat tinggal masing-masing uma disebut Nua 115 . dan Uma Lia Nain.

Dato. dua tokoh kakak- beradik yang dipandang sebagai cikal-bakal penduduk Fohoren. rumah adat Uma Ferik Katuas disebut Uma Lulik Manewa!u.diperoleh keterangan-bahwa keempat uma tersebut memiliki hubungan yang erat dengan leluhur mitologis yang sama yakni Sawak (tokoh perempuan) dan Koli (tokoh laki-laki). Dari kisah mitologis Manumatadador-sebuah kisah genealogis masyarakat Fohoren. Kelompok Uma Kanekadalah keturunan Suri lkun. Sedangkan kelompok Uma Lia Nain adalah Manumatadador. Semuanya itu merupakan simbol-simbol yang kemudian berkembang secara penuh dalam religi dan sistem-sistem kepercayaan lainnya. hampir 116 . dan sering kali melegitimasi tatanan sosial. pada umumnya menyatakan sudah beragama Katolik. Uma Ferik Katuas adalah tokoh mitologis pemelihara Sawak dan Koli. dalam teks Hamulak Uma Manewalu. seorang panglima. 4. Kelompok Uma Metan merupakan keturunan langsung dari Koli. ritus dan legitimasi strata sosial berkaitan erat dalam kehidupan sehari-hari masyarakat Tetun. Hamulak. saksi yang berhasil mempertemukan Sawak dan Koli dengan kedua orang tua mereka. Agama dan Kepercayaan Masyarakat Tetun.termasuk rumah adatnya sendiri. Hal tersebut di atas menjelaskan pula. akan tampak adanya aspirasi dan apresiasi mereka terhadap harmoni sosiologis maupun kosmologis. dan dengan demikian menduduki fungsi sebagai kepala panitia empat. rumah adat Uma Kanek disebut Uma Lulik Kanek.sebagairnana masyarakat Timor Leste secara keseluruhan. mengapa masyarakat Tetun cenderung berupaya membina dan membangun kohesi yang erat antara- anggota masyarakatnya. perang yang kawin dengan Sawak. Hal-hal itu berfungsi untuk menerangkan kehidupan sebagaimana adanya. Laporan David Hicks menyebutkan bahwa pada tahun 1966. Rumah adat Uma Metan disebut Uma Metan Ri Mean. dan rumah adat Uma Lia Nain disebut Uma Lulik Lia Na’in.

1985: 18). Data tahun 1 998 menyebutkan bahwa di Proppinsi. 117 .semua orang Tetun beragama Kristen Katolik sehingga dirasakanbahwa ada hubungan tertentu antara bahasa (Tetun) dan agama (Katolik). Timor Leste terdapat 94%penduduk yang beragama Katolik. Disebutkan pula penduduk Timor Leste yang berbicara bahasa lain (misalnya Makasaae dan Cairui) semuanya penyembah berhala (Hicks.

London: University Of Texas Press. Yoseph Yopi. Taum.Jakarta : Gramedia. 2011. Austin. William. ADM.1975. Muhammad. Jakarta : Gramedia.“Sastra dan Ilmu Sastra: Pengantar Teori Sastra”.” The forms of Foklore: Prose Naratives”. Taum. Bascom. Taufik. Suripan Sadi. Jakarta: Pustaka Jaya. 1986. Abdullah. Surabaya : Hiski Jawa Timur Parera. Rene dan Austin Waren. 118 .1993. 1995.”Sejarah Pemerintahan Raja-Raja Timor”.1994.”Puji-Pujian:Sebuah Tradisi Lisan Dalam Sastra Pesantren”.”Teori Kesustraan”. Vladimir.“Sutdi Sastra Lisan”. Hutomo. 1984. Dongen. dan lain-lain”. 1985.”Ilmu Sejarah Dan Historiografi”. DAFTAR PUSTAKA Abdullah. James.dalam Allan Dundes (ed) Danandjaya. Yogyakarta: Penerbit Lamalera. A.”Morfologi Of The Foklore”. Wellek. Warta ATL Edisi Perdana. Jakarta: Grafiti Press. 1991. Propp.”Mutiara Yang Terlupakan: Pengantar Studi Sastra Lisan”.Jakarta : Pustaka Sinar Harapan.“Folklor Indonesia: Ilmu Gosip. 1991.

.................. 7 BAB III SASTRA LISAN PADA MASA KINI: SEKILAS PANDANG................... 19 BAB V FOLKLOR DAN SASTRA LISAN .............................. 1 BAB II SASTRA LISAN DAN SASTRA TULISAN ..........................J...... SASTRA LISAN...... 99 DAFTAR PUSTAKA 119 ............... 13 BAB IV SASTRA LISAN ........... 29 BAB VI CIRI .......... GREIMAS ............ 71 BAB IX TRADISI HAMULAK: PUISI LISAN MASYARAKAT TETUN ..... 43 BAB VIII TEORI-TEORI ANALISIS SASTRALISAN: VLADIMIR PROPP DANA....................................CIRI SASTRA LISAN .................................. DAFTAR ISI BAB I TRADISI LISAN................ DAN FOLKLOR ....................................................... 39 BAB VII TEORI-TEORI ANALISIS SASTRALISAN: MADZAB FINLANDIADAN TEORI PARRY-LORD .................................