CRM, marketing con enfoque al cliente

Autor: Hlldu del Curmen Cubreru López
Servlclo ul cllente

04 / 2004
Después de 1990 el mundo de los negoclos comlenzu u cumblur, el surglmlento del Internet,
el e-commerce y lu tecnologiu Web llevun u lus compunius u replunteur su enfoque
estrutéglco (hustu entonces orlentudo ul producto), por un enfoque orlentudo ul cllente, que
busque unu reluclón u lurgo pluzo con éste, puru guruntlzur, ul mlsmo tlempo, su leultud.
RESUMEN

Los cllentes, por su purte, se vuelven más exlgentes y el proceso de murketlng como
consecuenclu cumblu, uhoru se debe descubrlr prlmero lu necesldud del cllente, untes de
generur el producto o servlclo que le sutlsfugu, y luego este producto se debe vender. Puru
logrur estos cumblos son necesurlus herrumlentus tecnológlcus, que mune|en enormes
volumenes de lnformuclón y brlnden servlclos de muy ultu culldud, u ruzón de lo unterlor,
surge como respuestu el CRM (conocldo por sus slglus en lnglés como իCustomer
Relutlonshlp Munugementլ).

METODOLOGÍA

Puru reullzur este urticulo se consulturon fuentes de lu blbllotecu dlgltul del Tecnológlco de
Monterrey, en lus buses de dutos del Emeruld y el ProOuest, ulgunos ի|ournulsլ obtenldos en
Bluckwell Synergy y ulgunus revlstus electrónlcus.

INTRODUCCIÓN

En este urticulo se descrlben u grundes rusgos los cumblos suscltudos en los ultlmos unos,
en el enfoque de los negoclos, de ser huclu productos o trunsucclones, uhoru buscu unu
reluclón con el cllente. Se vlsuullzu lu lmportunclu que demundu el cllente, cómo es
necesurlo conocer sus necesldudes y sutlsfucer sus ultos requerlmlentos de servlclo. Lo
unterlor, murcu un cumblo drástlco en el Murketlng, de estur orlentudo u lus musus, uhoru
debe cumblur su enfoque u unu mercudotecnlu más personullzudu.

No obstunte, puru logrur lo unterlor, personullzur el murketlng y construlr reluclones
estrechus con los cllentes, es necesurlo upoyurse en tecnologius de lnformuclón, en slstemus
que estén dlsenudos puru mune|ur grundes volumenes de dutos y udmlnlstrur lu lnformuclón
u truvés del proceso de negoclos. Unu de lus tecnologius que sutlsfuce estu necesldud es el
CRM, un softwure que provee upllcuclones que lntegrun murketlng, ventus, e-commerce y
servlclos de soporte ul cllente puru lu empresu. El CRM es en si unu estruteglu de negoclos
que está plenumente orlentudo ul cllente.

NUEVAS TENDENCIAS

Anh et ul. (2003) cltu u Wuylund y Cole (1997) expresu que untes de 1990, el prlnclpul
lnterés de lus compunius se enfocubu en el desempeno de trunsucclones de negoclo con los
cllentes, sln emburgo, después de 1990, lus empresus empezuron u enfocur sus lntereses en
uspectos de cómo tener unu reluclón posltlvu con el cllente, como muntener su leultud y
como ugregur vulor.

El surglmlento del e-commerce cumbló muchos uspectos de los negoclos en exlstenclu y
generó nuevus compunius con lnnovudores modelos de negoclo, con dlferentes
oportunldudes y procesos. El reto puru lus compunius yu exlstentes está en replunteur sus
reluclones cluves de negoclos գ entre lu orgunlzuclón y sus cllentes (Pun y Lee, 2003).

El entorno se muestru cudu vez más competltlvo y lu dlferencluclón por producto se denotu
más compllcudu, por lo que lus empresus deben dlrlglr sus esfuerzos huclu lu dlferencluclón
en el servlclo (Soluclonu, s.f.); usi lo uflrmun Pun y Lee (2003): lu muyoriu de lus compunius
confrontun u unu creclente y soflstlcudu curteru de cllentes que demundun ultos nlveles de
servlclo y tlempos muy cortos de respuestu u truvés de los multlples cunules de ucceso.

CRM

Gulbreuth y Rogers (1999, p. 162) cltudo por Luw et ul. (2003) deflne ul CRM como el
con|unto de uctlvldudes que desempenu un negoclo puru ldentlflcur, cullflcur, udqulrlr,
desurrollur y retener de formu creclente y constunte lu leultud del cllente y sus ventu|us por
entregur el producto o servlclo sollcltudo, u lu personu correctu, por el cunul udecuudo, en el
tlempo prometldo y ul preclo |usto.

Segun Deck (2001) el CRM es unu estruteglu puru uprender más ucercu de lus necesldudes
de los cllentes y sus comportumlentos y con esu lnformuclón desurrollur unu estrechu
reluclón con los cllentes, que guruntlzu el éxlto del negoclo.

Con el CRM se recuudu grun volumen de lnformuclón ucercu de los cllentes, ventus,
efectlvldud del murketlng, respuestus y tendenclus del mercudo.

Soluzlonu (s.f.) munlflestu que el concepto de CRM propone ullneur los recursos de lu
orgunlzuclón y dlsponer de todu su cupucldud en cudu contucto con el cllente, con el fln de
entender, untlclpurse y responder u lus necesldudes del mlsmo, puru trunsformur lus
trunsucclones slmples en pequenos pusos puru lu construcclón de unu estrechu reluclón
entre el cllente y lu empresu.

Por su purte Luw et ul, (2003) expresu que el CRM lntegru ventus, murketlng, servlclo ul
cllente, pluneuclón de recursos de lu empresu y ulgunus funclones de lu cudenu de
sumlnlstro u lo lurgo del proceso de uutomutlzuclón del negoclo, con soluclones tecnológlcus
y recursos de lnformuclón puru muxlmlzur cudu contucto con el cllente. El CRM fucllltu lus
reluclones entre lu empresu y sus cllentes, soclos, proveedores y empleudos, pero su metu,
segun Deck (2001), es slmpllflcur los procesos de ventus y murketlng.

Ahoru blen, el CRM no es un nuevo concepto de murketlng, uunque está busudo en tres
uspectos de su udmlnlstruclón (Verhoef und Lungeruk, 2002): Orlentudo ul cllente,
murketlng reluclonul y buse de dutos de murketlng [flguru 1].






Flguru1. Lu esenclu del CRM. Verhoef und Lungeruk (2002). Buslness Strutegy Revlew.

El CRM es unu proceso de gestlón que buscu desurrollur y muntener lu reluclón con los
cllentes en formu lndlvlduul y usi generur vulor tunto puru el cllente como puru lu flrmu, con
el uso de lu buse de dutos del cllente, con herrumlentus de soporte u lu declslón y técnlcus
de comunlcuclón lnteructlvu (Verhoef und Lungeruk, 2002). Ahoru blen, Sheth und
Purvutlyur (1995) cltudo por Humlnd und Kusslm (2004) lndlcun que el ob|etlvo del
murketlng reluclonul es fucllltur y upoyur el consumo del cllente y sus procesos de
trutumlento (uso) dentro de lu reluclón.

Ahn (2003) resume ul CRM como un proceso dlsenudo puru conocer lus curucteristlcus de
los cllentes y upllcur estus curucteristlcus u lus uctlvldudes de իMurketlngլ. Dlflere del
իMurketlngլ cláslco en el punto en el cuul su mercudotecnlu tlene pensudo como centro ul
cllente. Lu prlnclpul ruzón puru lu upurlclón del CRM son los cumblos en el umblente de
իmurketlngլ y los uvunce en lu tecnologiu Web.

MARKETING

Lus compunius están cumblundo u estruteglus orlentudus ul cllente y los medlos de
murketlng están cumblundo repentlnumente. El murketlng de musus del pusudo está
cumblundo uhoru ul murketlng uno u uno viu իturget murketlngլ, իnlche murketlngլ,
իdutubuse murketlng,լ und իInternet murketlngլ (Anh et ul., 2003):

Muss murketlng: Presentu promoclones de ventu de muterlules puru un publlco generul no
especlflcudo y su medlo de trunsmlslón es muslvo como puede ser el perlódlco, lus revlstus,
lu televlslón y lu rudlo, donde cuulquleru puede ser receptor del mensu|e. Orlentudo u
producto. Un producto puru muchos cllentes.
Turget murketlng: Presentu estruteglus de murketlng puru un grupo especiflco de cllentes
puru resolver el problemu de muss murketlng y elevur lu eflclenclu.
One-to-one murketlng. Tlene unu reluclón lndlvlduul con el cllente y presentu estruteglus de
murketlng. Su estllo es orlentudo ul cllente. Muchos productos puru un cllente.
No obstunte los udmlnlstrudores del murketlng que hubiun estudo trudlclonulmente
entrenudos puru consegulr nuevos cllentes con lnstrumentos de murketlng estublecldos,
como el preclo, promoclones y udvertenclus u musus; uhoru están cumblundo su utenclón u
lu retenclón de cllentes y el desurrollo de unu reluclón con los mlsmos. El ob|etlvo es
muxlmlzur el vulor de tlempo de vldu del cllente ul muxlmlzur sus beneflclos desde
trunsucclones dlscretus con los cllentes. Puru logrur lo unterlor los udmlnlstrudores hun
volteundo ul CRM. (Verhoef und Lungeruk, 2002).

Ahoru blen, lu tecnologiu de Internet es esenclul puru el CRM y desde lu perspectlvu de
murketlng el Internet es unu herrumlentu que puede uyudur u lus compunius u entender
me|or ul cllentes, puru proveerle de servlclo personullzudo y retenerlos (Humlnd und Kusslm,
2004).

MARKETING DENTRO DEL CRM

El concepto de CRM electrónlco es dlsenudo puru entender qulenes son los cllentes y los
productos en los que están lnteresudos գ luego entonces es poslble proveerlos de los
productos y servlclos que ellos quleren. Equlpudo con unu lnfruestructuru que permlte u lu
compuniu creur vulor puru el cllente y uutomutlzur el իqulén, qué, cuándo, dónde y cómoլ de
lus ventus y el murketlng (Pun und Lee, 2003).

CRM tlene que estur dlsenudo puru soportur eflclentemente los slgulentes fuctores:
resultudos de unállsls de dutos, Gestlón de cumpunu, suporte u lus declslones en tlempo
reul, lntegruclón y mlneriu de dutos (Ahn et ul., 2003).Lu flguru 2 muestru el proceso de
negoclo con uuxlllo del CRM y lu ublcuclón de lu etupu de Murketlng dentro del mlsmo
proceso.



Flguru2. Proceso de negoclo con uuxlllo del CRM. Reluclón conceptuul entre lus
upllcuclones cluve del CRM. Comunlcutlons of the ACM 2003.

Informutlon lntegrutlon uppllcutlon consolldu los dutos del cllente y lu lnformuclón de
dlferentes fuentes գ slstemus de trunsucclón, cull centers, sltlos Web y slstemus ERP գ en
lnformuclón lntegrudu y centrudu en el cllente. Estu upllcuclón permlte u lus compunius
ldentlflcur y responder en muchus munerus y con preclslón u sus cllentes donde quleru que
los cllentes udqulerun sus productos (Pun und Lee, 2003).

Costumer unulysls uppllcutlon, predlce e lnterpretu lus preferenclus del cllente, permlte u lus
compunius entender lu efectlvldud de los esfuerzos en e-CRM u lo lurgo de umbos cunules
tunto lnternos como externos. Es uqui donde se llevu el proceso de Murketlng y lu
lnformuclón del cllente lntegrudu es usudu puru construlr unu estruteglu de cumpunu puru el
negoclo y evuluur resultudos. Generulmente huy tres grundes tlpos de upllcuclones de
unállsls ul cllente: procesumlento unulitlco en lineu, mlneriu de dutos y estudistlcus (Pun und
Lee, 2003). Lu funclón más lmportunte del murketlng orlentudo ul cllente es recolectur y
ucumulur lnformuclón ucercu de los cllentes y proveer de servlclos ul mlsmo. Es muy dlficll
obtener lnformuclón sl no se tomu ventu|u de lus TI y los rápldos uvunces como buses de
dutos, dutu wurehouslng, y mlneriu de dutos como purte centrul del cumblo en los
purudlgmus de murketlng (Ahn et ul., 2003). Anállsls/ mlneriu de dutos. Lee und Sluu (2001)
noturon que el éxlto en lu upllcuclón de técnlcus de mlneriu de dutos puede ser un enorme
umortlguudor puru lus orgunlzuclones. Un propóslto de lu mlneriu de dutos y su unállsls en
CRM es extruer lu lnformuclón necesurlu puru proveer un servlclo eflclente ul cllente
(Cooley et ul, 1997). Puru me|orur, se usun vurlus técnlcus, que se cluslflcun como: técnlcus
de descubrlmlento de putrones, clusterlng, cluslflcuclón, evuluuclón de cllente (RFM, ROI),
etc. (Ahn et ul., 2003).
Cumpulng munugement uppllcutlon: utlllzu el dutu wurehouse puru pluneur y e|ecutur
multlples ob|etlvos de cumpunu en el tlempo, usundo un dlspurudor que respondu u los
eventos progrumudos y ul comportumlento del cllente (Pun und Lee, 2003).

Reul tlme declslon uppllcutlon, coordlnun y slncronlzun lu comunlcuclón u truvés de los
dlstlntos slstemus de punto de contucto con los cllentes. Contlene lu lntellgenclu del negoclo
puru determlnur y comunlcur el mensu|e más upropludo, puru ofertur, y llberur cunules en
tlempo reul, y soportur un dlulogo de dos vius con el cllente (Pun und Lee, 2003).

Personullzed Messuglng Appllcutlon, dlstrlbuye puglnus de texto o en html, esculudus puru
soportur ulgunos volumenes, usundo mecunlsmos uutomutlzudos puru responder preguntus
y mune|ur destlnuturlos de lus páglnus Web (Pun und Lee, 2003).

CONCLUSIÓN

El CRM efectlvo hu llegudo u ser unu estruteglu domlnunte puru lus compunius, lus
empresus se están movlendo cercu de sus cllentes, esforzándose por encontrur nuevus
formus de creur vulor puru sus cllentes, y trunsformur lu reluclón con ellos en unu soluclón
de conflunzu (Purk und Klm 2003).

El CRM que reunen lus slgulentes curucteristlcus (Soluzlonu, s.f.):
Son concebldos como unu herrumlentu que soportu el clclo completo: murketlng, ventus,
cumpunus personullzudus, etc.
Soportun lu gestlón lntegrudu de contuctos por dlstlntos cunules y fucllltun lu lncorporuclón
de nuevos cunules.
Requleren el estubleclmlento de mecunlsmos de lntegruclón con los Slstemus de Dutu
Wurehouse, Dutu Mlnlng y Slstemus de Murketlng, usi como con otros slstemus
trunsucclonules corporutlvos, fucllltundo de formu lntegrudu todu lu lnformuclón dlsponlble
del cllente.
Además de estus curucteristlcus, su prlnclpul utrlbuto rudlcu en el soporte que du u lus
upllcuclones puru unállsls de los cllentes y lu uyudu que brlndu puru estublecer unu reluclón
estrechu entre lu orgunlzuclón y el cllente.

Referenclus Blbllográflcus

Ahn, Jeong Yong, Klm Seok Kl & Hun Kyung Soo. (2003). իOn the deslgn concepts for
CRM systemլ. Industrlul Munugement & Dutu Systems 103/5. Recuperudo de:
http://www.emeruldlnslght.com/0263-5577.htm

Deck, S. (2001, Muyo) իWhut ls CRM?լ Recuperudo el diu 13 de Muyo de 2004 de:
http://www.clo.com/reseurch/crm/edlt/crmubc.html

Humeed, I. իCRM Turnuround - Muklng lt Huppenլ. Internet Technology. Recuperudo el diu
13 de Muyo de 2004 de: http://lnternet.ubout.com/llbrury/uu¸crm¸120302.htm?terms=CRM

Humld, N. R. & Norlzun, K. (2004, Murzo). իInternet Technology us u Tool ln Customer
Relutlonshlp Munugementլ. Journul of Amerlcun Acudemy of Buslness,
Cumbrldge. Hollywood; Tomo 4 (1/2). Recuperudo el diu 12 de Muyo de 2004 de: http://0-
proquest.uml.com.mlllenlum.ltesm.mx

Luw, M., Luu, T. & Wong, Y.H. (2003) իFrom customer relutlonshlp munugement to
customer-munuged relutlonshlp: unruvellng the purudox wlth u co-creutlve perspectlveլ.
Murketlng Intelllgence & Plunnlng; Vol. 21 (1). Recuperudo el diu 12 de Muyo de 2004 de:
http://0-lrls.emeruldlnslght.com.mlllenlum.ltesm.mx

Pun, Shun L. & Lee, Jue-Num. (2003, Abrll) իUslng e-CRM for u Unlfled Vlew of the
Customerլ. Communlcutlons of the ACM. Vol. 46 (4).

Purk, C. & Klm, Y. (2003). իA frumework of dynumlc CRM: llnklng murketlng wlth
lnformutlon strutegyլ. Buslness Process Munugement Journul; Vol. 9 (5). Recuperudo el diu
12 de Muyo de 2004 de: http://0-lrls.emeruldlnslght.com.mlllenlum.ltesm.mx

Schnelder, L. իWhy Should I Outsource My Murketlng Functlons?լ Recuperudo el diu 13 de
Muyo de 2004 de: http://murketlng.ubout.com/gl/dynumlc/offslte.htm

Soluzlonu (2004, Enero).լEl slstemu CRM en lu nuevu empresuլ. Recuperudo el diu 13 de
Muyo de 2004 de: http://www.estudlstlco.com/urts.html?20040104

Verhoef, Peter C. & Lungeruk, Fred. (2002) իEleven mlsconceptlons ubout customer
relutlonshlp munugementլ. Buslness Strutegy Revlew Vol. 13 (4) 70-76.

SRUXQHQIRTXHRULHQWDGRDOFOLHQWHTXH EXVTXHXQDUHODFL´QDODUJRSOD]RFRQªVWHSDUDJDUDQWL]DUDOPLVPRWLHPSRVXOHDOWDG 5(680(1  /RVFOLHQWHVSRUVXSDUWHVHYXHOYHQP¢VH[LJHQWHV\HOSURFHVRGHPDUNHWLQJFRPR FRQVHFXHQFLDFDPELDDKRUDVHGHEHGHVFXEULUSULPHURODQHFHVLGDGGHOFOLHQWHDQWHVGH JHQHUDUHOSURGXFWRRVHUYLFLRTXHOHVDWLVIDJD\OXHJRHVWHSURGXFWRVHGHEHYHQGHU3DUD ORJUDUHVWRVFDPELRVVRQQHFHVDULDVKHUUDPLHQWDVWHFQRO´JLFDVTXHPDQHMHQHQRUPHV YRO»PHQHVGHLQIRUPDFL´Q\EULQGHQVHUYLFLRVGHPX\DOWDFDOLGDGDUD]´QGHORDQWHULRU VXUJHFRPRUHVSXHVWDHO&50 FRQRFLGRSRUVXVVLJODVHQLQJOªVFRPR &XVWRPHU 5HODWLRQVKLS0DQDJHPHQW .

  0(72'2/2*Ž$  3DUDUHDOL]DUHVWHDUW®FXORVHFRQVXOWDURQIXHQWHVGHODELEOLRWHFDGLJLWDOGHO7HFQRO´JLFRGH 0RQWHUUH\HQODVEDVHVGHGDWRVGHO(PHUDOG\HO3UR4XHVWDOJXQRV MRXUQDOV REWHQLGRVHQ %ODFNZHOO6\QHUJ\\DOJXQDVUHYLVWDVHOHFWU´QLFDV  .1752'8&&.”1  (QHVWHDUW®FXORVHGHVFULEHQDJUDQGHVUDVJRVORVFDPELRVVXVFLWDGRVHQORV»OWLPRVD²RV HQHOHQIRTXHGHORVQHJRFLRVGHVHUKDFLDSURGXFWRVRWUDQVDFFLRQHVDKRUDEXVFDXQD UHODFL´QFRQHOFOLHQWH6HYLVXDOL]DODLPSRUWDQFLDTXHGHPDQGDHOFOLHQWHF´PRHV QHFHVDULRFRQRFHUVXVQHFHVLGDGHV\VDWLVIDFHUVXVDOWRVUHTXHULPLHQWRVGHVHUYLFLR/R DQWHULRUPDUFDXQFDPELRGU¢VWLFRHQHO0DUNHWLQJGHHVWDURULHQWDGRDODVPDVDVDKRUD GHEHFDPELDUVXHQIRTXHDXQDPHUFDGRWHFQLDP¢VSHUVRQDOL]DGD  1RREVWDQWHSDUDORJUDUORDQWHULRUSHUVRQDOL]DUHOPDUNHWLQJ\FRQVWUXLUUHODFLRQHV HVWUHFKDVFRQORVFOLHQWHVHVQHFHVDULRDSR\DUVHHQWHFQRORJ®DVGHLQIRUPDFL´QHQVLVWHPDV TXHHVWªQGLVH²DGRVSDUDPDQHMDUJUDQGHVYRO»PHQHVGHGDWRV\DGPLQLVWUDUODLQIRUPDFL´Q DWUDYªVGHOSURFHVRGHQHJRFLRV8QDGHODVWHFQRORJ®DVTXHVDWLVIDFHHVWDQHFHVLGDGHVHO .

$6  $QKHWDO .&50XQVRIWZDUHTXHSURYHHDSOLFDFLRQHVTXHLQWHJUDQPDUNHWLQJYHQWDVHFRPPHUFH\ VHUYLFLRVGHVRSRUWHDOFOLHQWHSDUDODHPSUHVD(O&50HVHQV®XQDHVWUDWHJLDGHQHJRFLRV TXHHVW¢SOHQDPHQWHRULHQWDGRDOFOLHQWH  18(9$67(1'(1&.

FLWDD:D\ODQG\&ROH .

H[SUHVDTXHDQWHVGHHOSULQFLSDO LQWHUªVGHODVFRPSD²®DVVHHQIRFDEDHQHOGHVHPSH²RGHWUDQVDFFLRQHVGHQHJRFLRFRQORV FOLHQWHVVLQHPEDUJRGHVSXªVGHODVHPSUHVDVHPSH]DURQDHQIRFDUVXVLQWHUHVHVHQ DVSHFWRVGHF´PRWHQHUXQDUHODFL´QSRVLWLYDFRQHOFOLHQWHFRPRPDQWHQHUVXOHDOWDG\ FRPRDJUHJDUYDORU  (OVXUJLPLHQWRGHOHFRPPHUFHFDPEL´PXFKRVDVSHFWRVGHORVQHJRFLRVHQH[LVWHQFLD\ JHQHU´QXHYDVFRPSD²®DVFRQLQQRYDGRUHVPRGHORVGHQHJRFLRFRQGLIHUHQWHV RSRUWXQLGDGHV\SURFHVRV(OUHWRSDUDODVFRPSD²®DV\DH[LVWHQWHVHVW¢HQUHSODQWHDUVXV UHODFLRQHVFODYHVGHQHJRFLRV HQWUHODRUJDQL]DFL´Q\VXVFOLHQWHV 3DQ\/HH.

  (OHQWRUQRVHPXHVWUDFDGDYH]P¢VFRPSHWLWLYR\ODGLIHUHQFLDFL´QSRUSURGXFWRVHGHQRWD P¢VFRPSOLFDGDSRUORTXHODVHPSUHVDVGHEHQGLULJLUVXVHVIXHU]RVKDFLDODGLIHUHQFLDFL´Q HQHOVHUYLFLR 6ROXFLRQDVI.

DV®ORDILUPDQ3DQ\/HH .

ODPD\RU®DGHODVFRPSD²®DV FRQIURQWDQDXQDFUHFLHQWH\VRILVWLFDGDFDUWHUDGHFOLHQWHVTXHGHPDQGDQDOWRVQLYHOHVGH VHUYLFLR\WLHPSRVPX\FRUWRVGHUHVSXHVWDDWUDYªVGHORVP»OWLSOHVFDQDOHVGHDFFHVR  &50  *DOEUHDWK\5RJHUV S.

FLWDGRSRU/DZHWDO .

GHILQHDO&50FRPRHO FRQMXQWRGHDFWLYLGDGHVTXHGHVHPSH²DXQQHJRFLRSDUDLGHQWLILFDUFDOLILFDUDGTXLULU GHVDUUROODU\UHWHQHUGHIRUPDFUHFLHQWH\FRQVWDQWHODOHDOWDGGHOFOLHQWH\VXVYHQWDMDVSRU HQWUHJDUHOSURGXFWRRVHUYLFLRVROLFLWDGRDODSHUVRQDFRUUHFWDSRUHOFDQDODGHFXDGRHQHO WLHPSRSURPHWLGR\DOSUHFLRMXVWR  6HJ»Q'HFN .

HO&50HVXQDHVWUDWHJLDSDUDDSUHQGHUP¢VDFHUFDGHODVQHFHVLGDGHV GHORVFOLHQWHV\VXVFRPSRUWDPLHQWRV\FRQHVDLQIRUPDFL´QGHVDUUROODUXQDHVWUHFKD UHODFL´QFRQORVFOLHQWHVTXHJDUDQWL]DHOª[LWRGHOQHJRFLR  &RQHO&50VHUHFDXGDJUDQYROXPHQGHLQIRUPDFL´QDFHUFDGHORVFOLHQWHVYHQWDV HIHFWLYLGDGGHOPDUNHWLQJUHVSXHVWDV\WHQGHQFLDVGHOPHUFDGR  6ROX]LRQD VI.

PDQLILHVWDTXHHOFRQFHSWRGH&50SURSRQHDOLQHDUORVUHFXUVRVGHOD RUJDQL]DFL´Q\GLVSRQHUGHWRGDVXFDSDFLGDGHQFDGDFRQWDFWRFRQHOFOLHQWHFRQHOILQGH HQWHQGHUDQWLFLSDUVH\UHVSRQGHUDODVQHFHVLGDGHVGHOPLVPRSDUDWUDQVIRUPDUODV .

WUDQVDFFLRQHVVLPSOHVHQSHTXH²RVSDVRVSDUDODFRQVWUXFFL´QGHXQDHVWUHFKDUHODFL´Q HQWUHHOFOLHQWH\ODHPSUHVD  3RUVXSDUWH/DZHWDO .

H[SUHVDTXHHO&50LQWHJUDYHQWDVPDUNHWLQJVHUYLFLRDO FOLHQWHSODQHDFL´QGHUHFXUVRVGHODHPSUHVD\DOJXQDVIXQFLRQHVGHODFDGHQDGH VXPLQLVWURDORODUJRGHOSURFHVRGHDXWRPDWL]DFL´QGHOQHJRFLRFRQVROXFLRQHVWHFQRO´JLFDV \UHFXUVRVGHLQIRUPDFL´QSDUDPD[LPL]DUFDGDFRQWDFWRFRQHOFOLHQWH(O&50IDFLOLWDODV UHODFLRQHVHQWUHODHPSUHVD\VXVFOLHQWHVVRFLRVSURYHHGRUHV\HPSOHDGRVSHURVXPHWD VHJ»Q'HFN .

HVVLPSOLILFDUORVSURFHVRVGHYHQWDV\PDUNHWLQJ  $KRUDELHQHO&50QRHVXQQXHYRFRQFHSWRGHPDUNHWLQJDXQTXHHVW¢EDVDGRHQWUHV DVSHFWRVGHVXDGPLQLVWUDFL´Q 9HUKRHIDQG/DQJHUDN.

2ULHQWDGRDOFOLHQWH PDUNHWLQJUHODFLRQDO\EDVHGHGDWRVGHPDUNHWLQJ>ILJXUD@       )LJXUD/DHVHQFLDGHO&509HUKRHIDQG/DQJHUDN .

%XVLQHVV6WUDWHJ\5HYLHZ  (O&50HVXQDSURFHVRGHJHVWL´QTXHEXVFDGHVDUUROODU\PDQWHQHUODUHODFL´QFRQORV FOLHQWHVHQIRUPDLQGLYLGXDO\DV®JHQHUDUYDORUWDQWRSDUDHOFOLHQWHFRPRSDUDODILUPDFRQ HOXVRGHODEDVHGHGDWRVGHOFOLHQWHFRQKHUUDPLHQWDVGHVRSRUWHDODGHFLVL´Q\WªFQLFDV GHFRPXQLFDFL´QLQWHUDFWLYD 9HUKRHIDQG/DQJHUDN.

$KRUDELHQ6KHWKDQG 3DUYDWL\DU .

FLWDGRSRU+DPLQGDQG.DVVLP .

LQGLFDQTXHHOREMHWLYRGHO PDUNHWLQJUHODFLRQDOHVIDFLOLWDU\DSR\DUHOFRQVXPRGHOFOLHQWH\VXVSURFHVRVGH WUDWDPLHQWR XVR.

GHQWURGHODUHODFL´Q .

 $KQ .

QWHUQHWPDUNHWLQJ  $QKHWDO.1*  /DVFRPSD²®DVHVW¢QFDPELDQGRDHVWUDWHJLDVRULHQWDGDVDOFOLHQWH\ORVPHGLRVGH PDUNHWLQJHVW¢QFDPELDQGRUHSHQWLQDPHQWH(OPDUNHWLQJGHPDVDVGHOSDVDGRHVW¢ FDPELDQGRDKRUDDOPDUNHWLQJXQRDXQRY®D WDUJHWPDUNHWLQJ  QLFKHPDUNHWLQJ  GDWDEDVHPDUNHWLQJ DQG .(7.UHVXPHDO&50FRPRXQSURFHVRGLVH²DGRSDUDFRQRFHUODVFDUDFWHU®VWLFDVGH ORVFOLHQWHV\DSOLFDUHVWDVFDUDFWHU®VWLFDVDODVDFWLYLGDGHVGH 0DUNHWLQJ 'LILHUHGHO 0DUNHWLQJ FO¢VLFRHQHOSXQWRHQHOFXDOVXPHUFDGRWHFQLDWLHQHSHQVDGRFRPRFHQWURDO FOLHQWH/DSULQFLSDOUD]´QSDUDODDSDULFL´QGHO&50VRQORVFDPELRVHQHODPELHQWHGH PDUNHWLQJ \ORVDYDQFHHQODWHFQRORJ®D:HE  0$5.

  0DVVPDUNHWLQJ3UHVHQWDSURPRFLRQHVGHYHQWDGHPDWHULDOHVSDUDXQS»EOLFRJHQHUDOQR HVSHFLILFDGR\VXPHGLRGHWUDQVPLVL´QHVPDVLYRFRPRSXHGHVHUHOSHUL´GLFRODVUHYLVWDV ODWHOHYLVL´Q\ODUDGLRGRQGHFXDOTXLHUDSXHGHVHUUHFHSWRUGHOPHQVDMH2ULHQWDGRD SURGXFWR8QSURGXFWRSDUDPXFKRVFOLHQWHV 7DUJHWPDUNHWLQJ3UHVHQWDHVWUDWHJLDVGHPDUNHWLQJSDUDXQJUXSRHVSHF®ILFRGHFOLHQWHV SDUDUHVROYHUHOSUREOHPDGHPDVVPDUNHWLQJ\HOHYDUODHILFLHQFLD 2QHWRRQHPDUNHWLQJ7LHQHXQDUHODFL´QLQGLYLGXDOFRQHOFOLHQWH\SUHVHQWDHVWUDWHJLDVGH PDUNHWLQJ6XHVWLORHVRULHQWDGRDOFOLHQWH0XFKRVSURGXFWRVSDUDXQFOLHQWH 1RREVWDQWHORVDGPLQLVWUDGRUHVGHOPDUNHWLQJTXHKDE®DQHVWDGRWUDGLFLRQDOPHQWH HQWUHQDGRVSDUDFRQVHJXLUQXHYRVFOLHQWHVFRQLQVWUXPHQWRVGHPDUNHWLQJHVWDEOHFLGRV FRPRHOSUHFLRSURPRFLRQHV\DGYHUWHQFLDVDPDVDVDKRUDHVW¢QFDPELDQGRVXDWHQFL´QD ODUHWHQFL´QGHFOLHQWHV\HOGHVDUUROORGHXQDUHODFL´QFRQORVPLVPRV(OREMHWLYRHV PD[LPL]DUHOYDORUGHWLHPSRGHYLGDGHOFOLHQWHDOPD[LPL]DUVXVEHQHILFLRVGHVGH WUDQVDFFLRQHVGLVFUHWDVFRQORVFOLHQWHV3DUDORJUDUORDQWHULRUORVDGPLQLVWUDGRUHVKDQ YROWHDQGRDO&50 9HUKRHIDQG/DQJHUDN.

DVVLP .QWHUQHWHVHVHQFLDOSDUDHO&50\GHVGHODSHUVSHFWLYDGH PDUNHWLQJHO.  $KRUDELHQODWHFQRORJ®DGH.QWHUQHWHVXQDKHUUDPLHQWDTXHSXHGHD\XGDUDODVFRPSD²®DVDHQWHQGHU PHMRUDOFOLHQWHVSDUDSURYHHUOHGHVHUYLFLRSHUVRQDOL]DGR\UHWHQHUORV +DPLQGDQG.

(7.1*'(1752'(/&50  (OFRQFHSWRGH&50HOHFWU´QLFRHVGLVH²DGRSDUDHQWHQGHUTXLHQHVVRQORVFOLHQWHV\ORV SURGXFWRVHQORVTXHHVW¢QLQWHUHVDGRV OXHJRHQWRQFHVHVSRVLEOHSURYHHUORVGHORV .  0$5.

SURGXFWRV\VHUYLFLRVTXHHOORVTXLHUHQ(TXLSDGRFRQXQDLQIUDHVWUXFWXUDTXHSHUPLWHDOD FRPSD²®DFUHDUYDORUSDUDHOFOLHQWH\DXWRPDWL]DUHO TXLªQTXªFX¢QGRG´QGH\F´PR GH ODVYHQWDV\HOPDUNHWLQJ 3DQDQG/HH.

  &50WLHQHTXHHVWDUGLVH²DGRSDUDVRSRUWDUHILFLHQWHPHQWHORVVLJXLHQWHVIDFWRUHV UHVXOWDGRVGHDQ¢OLVLVGHGDWRV*HVWL´QGHFDPSD²DVXSRUWHDODVGHFLVLRQHVHQWLHPSR UHDOLQWHJUDFL´Q\PLQHU®DGHGDWRV $KQHWDO.

QIRUPDWLRQLQWHJUDWLRQDSSOLFDWLRQFRQVROLGDORVGDWRVGHOFOLHQWH\ODLQIRUPDFL´QGH GLIHUHQWHVIXHQWHV VLVWHPDVGHWUDQVDFFL´QFDOOFHQWHUVVLWLRV:HE\VLVWHPDV(53 HQ LQIRUPDFL´QLQWHJUDGD\FHQWUDGDHQHOFOLHQWH(VWDDSOLFDFL´QSHUPLWHDODVFRPSD²®DV LGHQWLILFDU\UHVSRQGHUHQPXFKDVPDQHUDV\FRQSUHFLVL´QDVXVFOLHQWHVGRQGHTXLHUDTXH ORVFOLHQWHVDGTXLHUDQVXVSURGXFWRV 3DQDQG/HH./DILJXUDPXHVWUDHOSURFHVRGH QHJRFLRFRQDX[LOLRGHO&50\ODXELFDFL´QGHODHWDSDGH0DUNHWLQJGHQWURGHOPLVPR SURFHVR    )LJXUD3URFHVRGHQHJRFLRFRQDX[LOLRGHO&505HODFL´QFRQFHSWXDOHQWUHODV DSOLFDFLRQHVFODYHGHO&50&RPXQLFDWLRQVRIWKH$&0  .

  &RVWXPHUDQDO\VLVDSSOLFDWLRQSUHGLFHHLQWHUSUHWDODVSUHIHUHQFLDVGHOFOLHQWHSHUPLWHDODV FRPSD²®DVHQWHQGHUODHIHFWLYLGDGGHORVHVIXHU]RVHQH&50DORODUJRGHDPERVFDQDOHV WDQWRLQWHUQRVFRPRH[WHUQRV(VDTX®GRQGHVHOOHYDHOSURFHVRGH0DUNHWLQJ\OD LQIRUPDFL´QGHOFOLHQWHLQWHJUDGDHVXVDGDSDUDFRQVWUXLUXQDHVWUDWHJLDGHFDPSD²DSDUDHO .

QHJRFLR\HYDOXDUUHVXOWDGRV*HQHUDOPHQWHKD\WUHVJUDQGHVWLSRVGHDSOLFDFLRQHVGH DQ¢OLVLVDOFOLHQWHSURFHVDPLHQWRDQDO®WLFRHQO®QHDPLQHU®DGHGDWRV\HVWDG®VWLFDV 3DQDQG /HH.

/DIXQFL´QP¢VLPSRUWDQWHGHOPDUNHWLQJRULHQWDGRDOFOLHQWHHVUHFROHFWDU\ DFXPXODULQIRUPDFL´QDFHUFDGHORVFOLHQWHV\SURYHHUGHVHUYLFLRVDOPLVPR(VPX\GLI®FLO REWHQHULQIRUPDFL´QVLQRVHWRPDYHQWDMDGHODV7.\ORVU¢SLGRVDYDQFHVFRPREDVHVGH GDWRVGDWDZDUHKRXVLQJ\PLQHU®DGHGDWRVFRPRSDUWHFHQWUDOGHOFDPELRHQORV SDUDGLJPDVGHPDUNHWLQJ $KQHWDO.

$Q¢OLVLVPLQHU®DGHGDWRV/HHDQG6LDX .

 QRWDURQTXHHOª[LWRHQODDSOLFDFL´QGHWªFQLFDVGHPLQHU®DGHGDWRVSXHGHVHUXQHQRUPH DPRUWLJXDGRUSDUDODVRUJDQL]DFLRQHV8QSURS´VLWRGHODPLQHU®DGHGDWRV\VXDQ¢OLVLVHQ &50HVH[WUDHUODLQIRUPDFL´QQHFHVDULDSDUDSURYHHUXQVHUYLFLRHILFLHQWHDOFOLHQWH &RROH\HWDO.

3DUDPHMRUDUVHXVDQYDULDVWªFQLFDVTXHVHFODVLILFDQFRPRWªFQLFDV GHGHVFXEULPLHQWRGHSDWURQHVFOXVWHULQJFODVLILFDFL´QHYDOXDFL´QGHFOLHQWH 5)052.

 HWF $KQHWDO.

 &DPSDLQJPDQDJHPHQWDSSOLFDWLRQXWLOL]DHOGDWDZDUHKRXVHSDUDSODQHDU\HMHFXWDU P»OWLSOHVREMHWLYRVGHFDPSD²DHQHOWLHPSRXVDQGRXQGLVSDUDGRUTXHUHVSRQGDDORV HYHQWRVSURJUDPDGRV\DOFRPSRUWDPLHQWRGHOFOLHQWH 3DQDQG/HH.

  5HDOWLPHGHFLVLRQDSSOLFDWLRQFRRUGLQDQ\VLQFURQL]DQODFRPXQLFDFL´QDWUDYªVGHORV GLVWLQWRVVLVWHPDVGHSXQWRGHFRQWDFWRFRQORVFOLHQWHV&RQWLHQHODLQWHOLJHQFLDGHOQHJRFLR SDUDGHWHUPLQDU\FRPXQLFDUHOPHQVDMHP¢VDSURSLDGRSDUDRIHUWDU\OLEHUDUFDQDOHVHQ WLHPSRUHDO\VRSRUWDUXQGLDORJRGHGRVY®DVFRQHOFOLHQWH 3DQDQG/HH.

  3HUVRQDOL]HG0HVVDJLQJ$SSOLFDWLRQGLVWULEX\HSDJLQDVGHWH[WRRHQKWPOHVFDODGDVSDUD VRSRUWDUDOJXQRVYRO»PHQHVXVDQGRPHFDQLVPRVDXWRPDWL]DGRVSDUDUHVSRQGHUSUHJXQWDV \PDQHMDUGHVWLQDWDULRVGHODVS¢JLQDV:HE 3DQDQG/HH.

LP.  &21&/86.”1  (O&50HIHFWLYRKDOOHJDGRDVHUXQDHVWUDWHJLDGRPLQDQWHSDUDODVFRPSD²®DVODV HPSUHVDVVHHVW¢QPRYLHQGRFHUFDGHVXVFOLHQWHVHVIRU]¢QGRVHSRUHQFRQWUDUQXHYDV IRUPDVGHFUHDUYDORUSDUDVXVFOLHQWHV\WUDQVIRUPDUODUHODFL´QFRQHOORVHQXQDVROXFL´Q GHFRQILDQ]D 3DUNDQG.

  (O&50TXHUH»QHQODVVLJXLHQWHVFDUDFWHU®VWLFDV 6ROX]LRQDVI.

 6RQFRQFHELGRVFRPRXQDKHUUDPLHQWDTXHVRSRUWDHOFLFORFRPSOHWRPDUNHWLQJYHQWDV FDPSD²DVSHUVRQDOL]DGDVHWF 6RSRUWDQODJHVWL´QLQWHJUDGDGHFRQWDFWRVSRUGLVWLQWRVFDQDOHV\IDFLOLWDQODLQFRUSRUDFL´Q GHQXHYRVFDQDOHV 5HTXLHUHQHOHVWDEOHFLPLHQWRGHPHFDQLVPRVGHLQWHJUDFL´QFRQORV6LVWHPDVGH'DWD :DUHKRXVH'DWD0LQLQJ\6LVWHPDVGH0DUNHWLQJDV®FRPRFRQRWURVVLVWHPDV WUDQVDFFLRQDOHVFRUSRUDWLYRVIDFLOLWDQGRGHIRUPDLQWHJUDGDWRGDODLQIRUPDFL´QGLVSRQLEOH .

L +DQ.LP6HRN.\XQJ6RR .GHOFOLHQWH $GHP¢VGHHVWDVFDUDFWHU®VWLFDVVXSULQFLSDODWULEXWRUDGLFDHQHOVRSRUWHTXHGDDODV DSOLFDFLRQHVSDUDDQ¢OLVLVGHORVFOLHQWHV\ODD\XGDTXHEULQGDSDUDHVWDEOHFHUXQDUHODFL´Q HVWUHFKDHQWUHODRUJDQL]DFL´Q\HOFOLHQWH  5HIHUHQFLDV%LEOLRJU¢ILFDV  $KQ-HRQJ<RQJ.

QGXVWULDO0DQDJHPHQW 'DWD6\VWHPV5HFXSHUDGRGH KWWSZZZHPHUDOGLQVLJKWFRPKWP  'HFN6 0D\R. 2QWKHGHVLJQFRQFHSWVIRU &50V\VWHP .

QWHUQHW7HFKQRORJ\5HFXSHUDGRHOG®D GH0D\RGHGHKWWSLQWHUQHWDERXWFRPOLEUDU\DDBFUPBKWP"WHUPV &50  +DPLG15 1RUL]DQ. :KDWLV&50" 5HFXSHUDGRHOG®DGH0D\RGHGH KWWSZZZFLRFRPUHVHDUFKFUPHGLWFUPDEFKWPO  +DPHHG. 0DU]R. &507XUQDURXQG0DNLQJLW+DSSHQ .

QWHUQHW7HFKQRORJ\DVD7RROLQ&XVWRPHU 5HODWLRQVKLS0DQDJHPHQW -RXUQDORI$PHULFDQ$FDGHP\RI%XVLQHVV &DPEULGJH+ROO\ZRRG7RPR . .

5HFXSHUDGRHOG®DGH0D\RGHGHKWWS SURTXHVWXPLFRPPLOOHQLXPLWHVPP[  /DZ0/DX7 :RQJ<+ .

QWHOOLJHQFH 3ODQQLQJ9RO . )URPFXVWRPHUUHODWLRQVKLSPDQDJHPHQWWR FXVWRPHUPDQDJHGUHODWLRQVKLSXQUDYHOLQJWKHSDUDGR[ZLWKDFRFUHDWLYHSHUVSHFWLYH  0DUNHWLQJ.

5HFXSHUDGRHOG®DGH0D\RGHGH KWWSLULVHPHUDOGLQVLJKWFRPPLOOHQLXPLWHVPP[  3DQ6KDQ/ /HH-DH1DP $EULO.

 8VLQJH&50IRUD8QLILHG9LHZRIWKH &XVWRPHU &RPPXQLFDWLRQVRIWKH$&09RO .

LP< .  3DUN& .

 $IUDPHZRUNRIG\QDPLF&50OLQNLQJPDUNHWLQJZLWK LQIRUPDWLRQVWUDWHJ\ %XVLQHVV3URFHVV0DQDJHPHQW-RXUQDO9RO .

5HFXSHUDGRHOG®D GH0D\RGHGHKWWSLULVHPHUDOGLQVLJKWFRPPLOOHQLXPLWHVPP[  6FKQHLGHU/ :K\6KRXOG.2XWVRXUFH0\0DUNHWLQJ)XQFWLRQV" 5HFXSHUDGRHOG®DGH 0D\RGHGHKWWSPDUNHWLQJDERXWFRPJLG\QDPLFRIIVLWHKWP  6ROX]LRQD (QHUR.

 (OVLVWHPD&50HQODQXHYDHPSUHVD 5HFXSHUDGRHOG®DGH 0D\RGHGHKWWSZZZHVWDGLVWLFRFRPDUWVKWPO"  9HUKRHI3HWHU& /DQJHUDN)UHG .

 (OHYHQPLVFRQFHSWLRQVDERXWFXVWRPHU .

UHODWLRQVKLSPDQDJHPHQW %XVLQHVV6WUDWHJ\5HYLHZ9RO .

  .

Sign up to vote on this title
UsefulNot useful