You are on page 1of 1156

XV ENCUENTRO

NACIONAL CONEICC

O S ,
S I TAM
E NE C E
O S
AC IÓ N Q U
U E REM
CO MUN I
Q
C
U EQ
LA
PA Í S
E L

Ma. de Lourdes López Gutiérrez


COORDINADORES José Luis López Aguirre
José Samuel Martínez López

ISBN 978-607-95703-0-9
LA COMUNICACIÓN QUE NECESITAMOS,
EL PAÍS QUE QUEREMOS

XV Encuentro Nacional CONEICC

Ma. de Lourdes López Gutiérrez


José Luis López Aguirre
José Samuel Martínez López
COORDINADORES
La comunicación que necesitamos, el país que queremos.
XV Encuentro Nacional CONEICC

María de Lourdes López Gutiérrez


José Luis López Aguirre
José Samuel Martínez López
Coordinadores

ISBN 978-607-95703-0-9

Consejo Nacional para la Enseñanza y la Investigación de las Ciencias de la Comunicación


México , D.F. 11 de octubre de 2011.

Diseño y maquetado de este e-book: Luisa María Sánchez Ortega, Jorge Alejandro Espinosa Decelis y
Rodrigo Del Oso Cortés.

Apoyo en la edición: Andrea Tashe González M.

Antes de imprimir el documento, piense en su compromiso con el ambiente.


COORDINACIÓN EDITORIAL

Ma. de Lourdes López Gutiérrez


Universidad del Valle de México campus Tlalpan

José Luis López Aguirre


Universidad Panamericana campus Ciudad de México

José Samuel Martínez López


Universidad Iberoamericana campus Ciudad de México

COMITÉ EDITORIAL DEL CONEICC

Dra. María Concepción Lara Mireles


Presidenta

Dr. Manuel Ortiz Marín


Coordinación de Investigación

Mtro. Mauricio Ortiz Roche


Coordinación de Asuntos Académicos

Mtra. Eva María Pérez Castrejón


Coordinación de Difusión

Mtra. Alma Reyes Perales


Coordinación de Documentación
DICTAMINADORES

Juana Lilia Delgado María Teresa Nicolás Gavilán

Adjani Gabriela Tovar Pimentel María de Lourdes López Gutiérrez

Eduardo Fernando Aguado Cruz María Eugenia Campo Orozco

Edwin Arreola Rueda Silvia Gutiérrez y Vera

Eugenia García Robles Clemente Sánchez Uribe

Iñigo Fernández Fernández Hugo Armando León Zenteno

José Luis López Aguirre Sandra Flores Guevara

María de la Luz Ruiz Figueroa Carmen Elizabeth Aguilar Lara

Nora Espino Amor Elena Sáinz de la Maza

Vanessa Muriel Amezcua Cecilia Sabido Sánchez

Verónica Alvarado Durán 1VZtÍUNLS.HYÄHZ-YxHZ

Verónica Ochoa López

Marcela Moreno Cueto

Roberto Alejandro López

Eugenio Pablo Leyva


INDICE
Capítulo 1. Nuevas Tecnologías, Internet y Sociedad de la Información.....16

Análisis de la apropiación de las TIC en el aula:


Más allá de las habilidades tecnológicas......................................................................17
MARÍA CONSUELO LEMUS POOL, ENRIQUE GARZA MEJÍA Y LETICIA CALOCA CARRASCO

La comunidad virtual de “mis amigas Ana y Mía”


y la representación social del culto al cuerpo...............................................................28
DRA. MARÍA CONCEPCIÓN LARA MIRELES, ANAHÍ MONSERRAT HERNÁNDEZ RODRÍGUEZ Y
MARTHA FABIOLA JUÁREZ RODRÍGUEZ

Consolidación y construcción del periodismo digital...................................................46


DRA. LIZY NAVARRO ZAMORA

Economía alternativa y redes sociales en línea


El caso TRUEQMX........................................................................................................61
DRA. CECILIA SABIDO

El papel del sonido en el diseño de los medios interactivos audiovisuales.


Aspectos retóricos en la construcción del diseño Auditivo..........................................71
MIGUEL RAFAEL AMADOR LEÓN

Enrédate. Tecnologías Comunitarias:


Experiencia de la comunidad rural Lequeitio, municipio de Francisco I. Madero,
Coahuila.........................................................................................................................81
MAYRA VIRIDIANA OLIVARES GÓMEZ, M.C. JOSÉ ALFREDO MORALES PÉREZ Y DRA. BLANCA
CHONG LÓPEZ

Experiencia comunitaria de gestación y aplicación de un proyecto formativo por


competencias a través del uso y apropiación de las TIC´s...........................................88
DRA. JUANA MARÍA ALANÍS RAMÍREZ, CARLOS IVÁN SERRANO GARCÍA Y MARIEL CORONADO
FUENTES

Internet como herramienta educativa:


Del usuario funcional al usuario intelectual.................................................................105
IRMA VILLALPANDO HERNÁNDEZ

3HWVSx[PJHVÄJPHSKLPUJS\ZP}UKPNP[HSWHYHSVZW\LISVZPUKxNLUHZ
Un estudio de caso: Los Matlatzincas.........................................................................113
JAIME ENRIQUE CORNELIO CHAPARRO Y ANGÉLICA BERENICE HERNÁNDEZ CHÁVEZ
Los museos de migración en línea, una forma diferente de democratizar
el acceso y preservación del patrimonio cultural........................................................130
MA. ALEJANDRA ROCHA SILVA

Brecha digital en México:


Hacia una propuesta de políticas públicas..................................................................139
DRA. ALMA ROSA ALVA DE LA SELVA

Productos culturales digitales:


Estrategias formales e informales de distribución en México.....................................145
DR. GABRIEL PÉREZ SALAZAR

Redalyc: ocho años haciendo presente la ciencia iberoamericana


en el contexto de la Sociedad de la Información........................................................158
ROSARIO ROGEL SALAZAR Y EDUARDO AGUADO LÓPEZ

9LKLZZVJPHSLZLUILULÄJPVKLSHLK\JHJP}UWHYHSHZHS\K
Experiencia de trabajo colaborativo en la comunidad en línea estudiabetes.org.......169
MARÍA ELENA SÁINZ DE LA MAZA VIADERO

TIC’s, implicaciones en el ámbito electoral.................................................................181


LUIS ALFONSO GUADARRAMA RICO Y JANNET VALERO VILCHIS

Capítulo 2. Comunicación Política y Legislación..........................................206

Análisis de la opinión pública, a partir de la imagen proyectada por candidatos


a gobernador de Puebla, México, durante el proceso electoral 2010........................207
ANA KAREN MÁRQUEZ CASTRO Y ALEJANDRO IVÁN VÁZQUEZ ÁLVAREZ

Análisis del impacto de los procesos comunicativos en el interés ciudadano


hacia la política en México...........................................................................................217
CARLOS MUÑIZ

Comunicación política en procesos electorales en el estado de Puebla.


Una propuesta de análisis............................................................................................226
ANGÉLICA MENDIETA RAMÍREZ Y JOSÉ DE JESÚS ESPARZA BAUTISTA

Democratización y esfera pública.


Análisis de la prensa política en la Ciudad de Querétaro............................................237
GABRIEL A. CORRAL VELÁZQUEZ
Estrategia de comunicación para fomentar el derecho de acceso a la información..253
MIRIAM CARRILLO RUIZ Y SANTA ISABEL CAMARILLO REYES

La comunicación desde los ojos del Derecho.............................................................262


R. MARGARITA PUENTE MUNGUÍA

Hacia un modelo de análisis sobre transparencia y acceso a la información


a partir de indicadores.................................................................................................272
JOSÉ ANTONIO MEYER RODRIGUEZ, MARÍA JOSEFINA RIVERO VILLAR Y
TANIA YASMINE DOMINGUEZ LÓPEZ

Los procesos sociopolíticos en la prensa bajacaliforniana (2009-2010)


desde la perspectiva del Observatorio Global Mediático de la Frontera Norte:
El caso de La Crónica de Mexicali y El Mexicano de Tijuana.....................................287
DR. MANUEL ORTIZ MARÍN, EDDY MEZA DÍAZ, ANGÉLICA LABRADA, VÍCTOR FERREL,
KARLA L. BARAJAS Y MELISSA ANGUIANO

Capítulo 3. Estudios sobre Prensa y Periodismo..........................................300

A 200 años de la libertad de imprenta: perspectivas y balance..................................301


MTRA. ELBA CHÁVEZ LOMELÍ

Ampliación del espacio público y rudimentos de la actividad periodística en la


Gaceta de México y Noticias de Nueva España (1722)..............................................311
DR. ARMÍN GÓMEZ BARRIOS

Efectos del framing de las noticias en la actitud y apoyo a políticas


sobre extranjeros en México. Un análisis experimental..............................................327
CARLOS MUÑIZ

El derecho a acceder a la agenda de los medios como fuentes de información.


Una revisión crítica desde las perspectivas de la Agenda-Setting, el Framing y
el Indexing....................................................................................................................339
DRA NATALIA ARUGUETE Y DR CARLOS MUÑIZ

Incidencia de las nuevas tecnologías de la información en las rutinas de producción


periodística dentro de la sala de redacción
El caso del diario público Milenio................................................................................349
ELVA ARACELI FABIÁN GONZÁLEZ
La tercer cultura y los medios de comunicación en la frontera
México- Estados Unidos..............................................................................................361
ROBERTO VALERO BERROSPE, GUADALUPE VILLASEÑOR AMÉZQUITA Y
LILIA MARTÍNEZ LOBATOS

La opinión publicada en la prensa de México (columna, artículo y editorial).............369


LIZY NAVARRO ZAMORA

Los periodistas culturales: Una identidad anómala....................................................380


EDUARDO ANDIÓN

Alumbra pero no abrasa. Visión panorámica de la prensa católica de la


capital mexicana de la primera mitad del siglo XIX....................................................395
DR. IÑIGO FERNÁNDEZ FERNÁNDEZ

La construcción sociocultural del “joven que no estudia y no trabaja” desde los


medios de comunicación, la opinión pública y el Estado en el Distrito Federal.........415
MARÍA EUGENIA CAMPO, ERNESTO CISNEROS, IVONNE GARCÍA Y GABRIELA FLORES

5HYJV[YmÄJVTLKPVZ`YLWYLZLU[HJPVULZZVJPHSLZ
JUAN CARLOS HERNÁNDEZ ROSETE

Capítulo 4. Discurso, Semiótica y Lenguaje..................................................452

Análisis del discurso de acuerdo al modelo greimasiano de la resistencia


maya colonial en la Rebelión de Jacinto Canek en 1761 en Cisteil, Yucatán.............453
MTRO. ISRAEL LEÓN O’FARRILL

Análisis semiótico de dos personajes políticos:


más allá del ser hacia el decir-verdad.........................................................................463
M.C. NARDA ISABEL QUEZADA GARCÍA

El papel del discurso en la formación de identidades.


,SJHZVKLSHZJVT\UPKHKLZJPLU[xÄJHZ`SHZ7OPSVZVWOPJHS;YHUZHJ[PVUZKLSH
Royal Society of London.............................................................................................467
GUSTAVO GARDUÑO OROPEZA Y MA. FERNANDA ZÚÑIGA ROCA

Hacia un modelo de comunicación pública de base semiótica:


las Instituciones como elementos básicos de interacción en los debates y
asuntos públicos..........................................................................................................486
EVELYN ÁVILA ALCARAZ
Hacia un modelo de comunicación pública de base semiótica:
el Espacio Público como condición para la emergencia de los debates públicos.....492
YESSICA ANNAY ARANDA GARCÍA

3HPKLU[PKHKZPNUPÄJHKH!
El sicario mexicano en Youtube...................................................................................500
ULISES PINEDA

La representación de la mujer en la novela “Los recuerdos del porvenir”:


análisis semiótico del texto..........................................................................................507
LIC. LIDIA AURORA ALMANZA OROZCO

*HWx[\SV,Z[\KPVZ*PULTH[VNYmÄJVZ

Aproximación compleja y fractal a la realidad ambiental del planeta:


el uso del documental como estrategia de comunicación ambiental.........................521
RAFAEL TONATIUH RAMÍREZ BELTRÁN

El análisis sonoro en “Mil nubes de paz cercan el cielo” de Julián Hernández..........535


NOÉ SANTOS JIMÉNEZ

La otra imagen, el imaginario juvenil a través del video y el cine.


El caso de la muestra internacional de cortometraje Golosina Visual (2004-2010)....546
JESÚS ADOLFO SOTO CURIEL, LAURA FIGUEROA LIZÁRRAGA Y MARCOS RAMÍREZ ESPINOSA

Nuevas nociones sobre el Cine Mexicano:


Confrontaciones, negociaciones y resistencias entre lo global y lo local...................557
MANUEL ANTONIO PÉREZ TEJADA DOMÍNGUEZ

Capítulo 6. Estudios sobre Televisión y Recepción......................................569

Comunicación, escuela y violencia:


Una mirada desde las mediaciones.............................................................................570
ZOYLA HERNÁNDEZ BLANCO, GABRIELA DE LA PEÑA ASTORGA Y FRANCESCO GERVASI

Consumo mediático y apelación crítica en niños de sexto grado en dos escuelas


privadas del área metropolitana de Monterrey............................................................613
LIC. ISIS CAMPOS MARTÍNEZ Y LIC. BEATRIZ ELENA INZUNZA ACEDO
3HULNVJPHJP}UKLZPNUPÄJHKVZKLSHWHY[PJPWHJP}UWVSx[PJHH[YH]tZKLSH
mediación familiar y las fuentes informativas noticiosas,
en dos grupos de niños de la ciudad de Querétaro....................................................625
ROSA ISELA SÁNCHEZ BENAVIDES

Capítulo 7. Escuelas de Comunicación y Formación de Profesionales.....633

Aprendizaje del problema de investigación:


Un análisis cognitivo, lingüístico, epistemológico y metodológico.............................634
DRA. ENRIQUETA LEONOR RIVERA CAÑIZALES

Las deudas pendientes entre el arte y la comunicación.............................................656


VIVIAN ROMEU

El papel de las escuelas de comunicación en la formación de comunicadores


y comunicólogos: problemas, retos y prospectiva......................................................668
DRA. MARTA RIZO GARCÍA

La comunicación intercultural como herramienta para el periodista ante los


JVUÅPJ[VZZVJPHSLZ!<UHHZPNUH[\YHWLUKPLU[LLULSWSHUKLLZ[\KPVZ
TERESA NICOLÁS GAVILÁN

Formar profesionales ¿en Comunicación o en Difusión?............................................690


DR. JOSÉ CISNEROS E.

La formación humanista: reto de la educación actual.................................................700


ALBA DEVO COLIS

Representaciones sociales de estudiantes universitarios sobre el periodismo


y sus riesgos................................................................................................................712
ROSA MARÍA GONZÁLEZ VICTORIA Y ROSA MARÍA VALLES RUIZ

Capítulo 8. Estudio sobre Arte y Gestión Cultural.........................................722

Cultura juvenil mexicalense: gestión institucional.......................................................723


MA. ELENA ZERMEÑO ESPINOSA, ELSA DEL CARMEN VILLEGAS MORÁN,
SUSANA ESPINOSA VELÁZQUEZ Y GRISELDA GUILLÉN OJEDA

Distribución espacial de la oferta de bienes culturales en Mexicali, B.C....................747


LUZ MARÍA ORTEGA VILLA Y JUDITH LEY GARCÍA
Los museos como restauradores de una remembranza para el futuro......................761
M.A. MONCERRAT ARANGO MORALES, M.E.S. LUCINDA SEPÚLVEDA GARCÍA Y M.C. BLANCA
IDELMA VARGAS RAMOS

Capítulo 9. Sociedad Civil, Participación y Comunicación Alternativa.......777

Comunicación para el desarrollo y movimientos sociales en red para


la justicia global............................................................................................................778
DR. JACOB BAÑUELOS CAPISTRÁN

Comunicación para el desarrollo: mnemotecnia del pensamiento teórico de


Juan Díaz Bordenave...................................................................................................793
LAURA GONZÁLEZ MORALES Y GUILEBALDO LÓPEZ LÓPEZ

La comunicación vecinal ante la inseguridad pública:


una plaza en la colonia Jardines de Valle de Saltillo, Coahuila...................................806
GABRIELA DE LA PEÑA ASTORGA

Cultura, identidad y subjetividad/pedagogía y política conforme al futuro.................835


EVELYN ABIGAIL UNZUETA GONZÁLEZ

Diagnóstico de la percepción de valores cívicos a 200 años de iniciada


la independencia de México.
Caso: Colegio Inter Canadiense de Puebla.................................................................846
LCC. ROSA ANGÉLICA MARTÍNEZ TÉLLEZ Y LCC. JESÚS ROBERTO SÁNCHEZ REINA

Educación, comunicación y participación política de los jóvenes..............................862


DR. MELITÓN GUEVARA CASTILLO, MTRA. AMPARO CASTILLO MARROQUÍN Y
MTRA. ROSA MARÍA VALLES SAAVEDRA

El desarrollo de competencias comunicativas y valores a través del séptimo arte....874


CARMEN CATALINA TIJERINA RENDÓN, AÍDA GRACIELA HERNÁNDEZ CHÁVEZ Y
OMAR ANTONIO MUÑOZ CARDONA

Estrategias para la comunicación de riesgo desde la participación ciudadana........884


ARELY MILLÁN OROZCO Y JOSÉ LUIS DE LA CRUZ ROCK

Para solucionar tu problema, pídele a San Judas Tadeo:


Formas de expresión en la devoción a San Judas Tadeo en la Ciudad de México...895
DR. FRANCESO GERVASI, MTRA. ZOYLA HERNÁNDEZ BLANCO Y
MTRA. GABRIELA DE LA PEÑA ASTORGA
Jóvenes, educación y cultura de participación:
Un reto por asumir desde la investigación..................................................................912
EDGAR JOSUÉ GARCÍA LÓPEZ

La comunicación como herramienta social para la prevención del riesgo


en la conurbación de Tampico.....................................................................................924
FERNANDO TREVIÑO ESPINOSA Y ALFONSO TELLO ITURBE

Radio comunitaria “Frecuencia libre 99.1 FM”:


Espacio de participación ciudadana en San Cristóbal de las Casas, Chiapas..........936
SOFÍA VIDAL DÍAZ, JOSÉ MANUEL RAMOS RODRÍGUEZ Y ROSA ELBA DOMÍNGUEZ BOLAÑOS

La sociedad civil como concepto y como caso empírico en la discusión de la reforma


a la Ley Federal de Radio y TV....................................................................................945
ISRAEL TONATIUH LAY ARELLANO

Capítulo 10. Derechos Humanos, Género y Comunicación.........................955

Hermila Galindo, primera candidata a diputada federal en México y


primera Censora legislativa..........................................................................................956
ROSA MARÍA VALLES RUIZ Y ROSA MARÍA GONZÁLEZ VICTORIA

La mujer como candidata en elecciones de Nuevo León...........................................971


DRA. MARÍA MIRNA GRANAT RAMOS, DR. SERGIO MANUEL DE LA FUENTE VALDEZ Y
JOSÉ GABRIEL GARCÍA ROMERO

¸5PKLHX\xUPKLHSSm¹9LJVUÄN\YHJP}UKLSHPKLU[PKHKZVJPHS`KLNtULYVKL
las mujeres migrantes mexicanas en Estados Unidos:
Estudio de caso..........................................................................................................981
L.C.C. MAYRA PATRICIA TORRES GUTIÉRREZ

Capítulo 11. Relaciones Públicas y Comunicación en las


Organizaciones.................................................................................................999

La cultura organizacional y la comunicación, como ejes generadores


de valores corporativos..............................................................................................1000
HILDA GABRIELA HERNÁNDEZ FLORES Y ALMA ROSA MEJÍA CASTILLO
La organización como gestora de sentido.
Una aproximación teórica desde la perspectiva de los sistemas sociales
de Niklas Luhmann.....................................................................................................1017
MTRA. MARÍA FERNANDA ZÚÑIGA ROCA Y DR. GUSTAVO GARDUÑO OROPEZA

La aplicación de la Gestión del Conocimiento y la Infonomía


en los procesos organizacionales:
El comunicólogo como gestor de la información......................................................1027
MA. GUADALUPE CURRO LAU Y GEORGINA PALACIOS ARIAS

Comunicación no violenta en las organizaciones......................................................1046


MTRA.RUTH ILDEBRANDA LÓPEZ LANDEROS

Comunicación organizacional:
9LLUJVU[YHUKVWH\[HZKLYLÅL_P}U`YLJVTLUKHJPVULZWHYHZ\KLZHYYVSSV
en México..................................................................................................................1059
CLEMENTE SÁNCHEZ URIBE

Gestoría de las Relaciones Públicas desde la Web universitaria.


Diagnóstico situacional para fortalecer el programa de información y comunicación de
la UANL.....................................................................................................................1085
YOLANDA LÓPEZ LARA

La comunicación en las organizaciones desde distintos enfoques..........................1106


YAZMIN VARGAS GUTIÉRREZ Y GRACIELA PAZ ALVARADO

La comunicación integral y organizaciones del tercer sector....................................1116


MTRA. PATRICIA DURÁN BRAVO

Los retos de la comunicación organizacional en el modelo neoliberal.....................1128


ROSA MA. MACÍAS

Y la comunicación organizacional ¿Para qué sirve?.................................................1136


MARÍA DEL CARMEN TORRES SALAZAR Y MARCO ANTONIO PETRIZ MAYEN
INTRODUCCIÓN

La comunicación que necesitamos, el país que queremos compila 84 ponencias que


fueron expuestas y dictaminadas en las mesas de trabajo durante el XV Encuentro
Nacional CONEICC, realizado del 6 al 9 de octubre de 2010 en las instalaciones de la
Universidad Iberoamericana, Ciudad de México.

Esta publicación electrónica responde a uno de los objetivos primordiales del Consejo
Nacional para la Enseñanza y la Investigación de las Ciencias de la Comunicación:
fomentar la producción y divulgación del saber de las Ciencias de la Comunicación.

,Z[HVIYHTHUPÄLZ[HHKLTmZSHZKP]LYZHZTPYHKHZJVUSHZX\LHJ[\HSTLU[LSHHJHKLTPH
mexicana aborda el complejo objeto de estudio de la Comunicación. Argumentos,
métodos, análisis, cuestionamientos, críticas, hallazgos, propuestas y tendencias
JVUÄN\YHULZ[HYPJHHNLUKHKLSKL]LUPYJVT\UPJHJPVUHSKLHOxZ\PTWVY[HUJPH

Las temáticas que integran este e-book están organizadas en once capítulos, los cuales
YLÄLYLUHSHZTLZHZKL[YHIHQVLUSHZX\LK\YHU[L[YLZKxHZM\LYVUWYLZLU[HKHZKPZJ\[PKHZ
y evaluadas las ponencias aquí publicadas. Los temas tratan desde el impacto de las
nuevas tecnologías, los estudios sobre los medios de comunicación, el periodismo, la
publicidad, la formación de los profesionales, la comunicación organizacional, hasta la
relación entre sociedad civil, derechos humanos y comunicación.

Consideramos que esta obra colectiva constituye una aproximación a los fenómenos
que enmarcan el desarrollo del entorno comunicacional. Asimismo, esperamos que
SHZ PKLHZ HX\x WSHZTHKHZ WYV]VX\LU SH YLÅL_P}U ZVIYL SVZ KLZHMxVZ X\L LUMYLU[H SH
enseñanza, la investigación y el quehacer profesional de la Comunicación ante el
inquietante proceso de cambios que vive nuestra sociedad.

Finalmente, deseamos que las aportaciones contenidas en esta publicación consoliden


o promuevan líneas de investigación, enriquezcan la labor docente y, sobre todo,
contribuyan, desde la Comunicación, a la construcción de un proyecto de nación en
ILULÄJPVKL[VKVZSVZTL_PJHUVZ

Coordinación editorial
?=,5*<,5;965(*065(3*65,0**

?=,5*<,5;965(*065(3*65,0**

Capítulo 1.
Nuevas Tecnologías, Internet y
Sociedad de la Información

Coordinador: Dr. José Luis López Aguirre.


Análisis de la apropiación de
las TIC en el aula: Más allá de las
habilidades tecnológicas
María Consuelo Lemus Pool, Enrique Garza Mejía
y Leticia Caloca Carrasco
UNIVERSIDAD AUTÓNOMA DE TAMAULIPAS
UNIDAD ACADÉMICA DE CIENCIAS JURÍDICAS Y SOCIALES
Resumen
El presente trabajo aborda el análisis de los niveles de apropiación de Internet que tienen los
estudiantes de la Unidad Académica de Ciencias Jurídicas y Sociales de la Universidad Autóno-
ma de Tamaulipas. Entre los resultados más relevantes destaca que las habilidades tecnológicas
que presentan los estudiantes en el uso de Tecnologías de Información y Comunicación (TIC), se
  
ubican en un nivel medio-alto y alto; sin embargo, esto no corresponde directamente a un mayor
nivel de apropiación de esta tecnología dentro del aula de clase ni mucho menos contribuyen a
[YHUZMVYTHYSHWYmJ[PJHWLKHN}NPJHSVJ\HSYLÅLQH\UHJHYLUJPHKLHY[PJ\SHJP}ULU[YLSHZWVSx[PJHZ
educativas que tiene la institución para incorporar TIC a la enseñanza, las habilidades tecnológi-
cas de los profesores y la apropiación que poseen los estudiantes, para cumplir con el objetivo
de preparar profesionistas competentes en la Sociedad de la Información y el Conocimiento.
La relevancia académica del trabajo estriba en un nuevo abordaje de la comprensión de la apro-
piación de la tecnología desde la óptica de los estudiantes; sus opiniones permitieron detectar
variables contextuales como el uso no académico de las TIC y su repercusión en las dinámicas
dentro del aula, la apertura del profesor y el interés de éstos para hacerlas parte integral de su
vida escolar.

Palabras Clave:
Educación, Apropiación, Internet, Habilidades tecnológicas, Sociedad de la Información

Introducción: J\S[\YHSLZX\LZLKHULULSHJ[\HSÅ\QVYL[PJ\SHYKL
Ante los vertiginosos desarrollos tecnológicos que comunicaciones y procesos de poder, demandan
se dan en el ámbito de la convergencia digital, la de ellos habilidades tecnológicas que los haga
educación se ha posicionado como un discurso competentes para adaptarse a la nueva estructura
clave para construir la Sociedad de la Información productiva y de generación del conocimiento
` LS *VUVJPTPLU[V :0* ,Z[L JHTWV LZWLJxÄJV (Castells, 2000, 2009; Sunkel, 2006).
se ha mostrado como un interesante terreno La transformación principal que se ha dado en
de transformación de las praxis de los actores el sector educativo, y principalmente en las
educativos, los cuales merecen especial atención Instituciones de Educación Superior (IES), ha sido
puesto que la múltiple interdependencia entre la incorporación constante de Tecnologías de
los sectores sociales, económicos, políticos y
Análisis de la apropiación de las TIC en el aula

Información y Comunicación (TIC)1, las cuales han las naciones más desarrolladas de aquellas
propiciado nuevas formas de distribuir y trabajar dependientes (Becerra, 2003; Crovi, 2004, 2007;
las interacciones en el aula de clase, gestando Rengifo, 2002).
otras dinámicas de interacción entre estudiantes Sin embargo, la importancia de seguir profundizando
y profesores, la posibilidad de trabajar a través en el análisis de las dinámicas de la educación en
de redes de colaboración, así como el acceso a red, es decir, aquella que es la que promueve la
múltiples fuentes que amplían la construcción de creación de nuevos ambientes de aprendizaje,
una arquitectura de intercambio de información en favorecidos por la convergencia tecnológica y el
red a nivel global (Barriga, Padilla, & Morán, 2009). desarrollo cada vez más transversal de las TIC,
Cabe destacar, que la presencia de cambios en la radica en la necesidad de no fetichizar la tecnología,
educación a raíz de las innovaciones tecnológicas pensando que por sí misma va a provocar un
no es reciente. Desde la introducción de los cambio en la dinámica educativa (Ortega &
impresos y el correo convencional, pasando por Chacón, 2007). Aunque bien, cabe resaltar que la
la radio y la televisión educativa, hasta las actuales mayoría de las políticas públicas de las IES se han
incursiones de la computadora e Internet, este ceñido a este determinismo tecnológico que ha
campo se ha llenado de promesas futuristas de apostado por un cambio en las universidades con
mayor acceso y democratización de la educación, el simple desarrollo de infraestructura tecnológica
abatir el rezago educativo, un mayor desarrollo Z\ÄJPLU[LWHYHNHYHU[PaHYLSHJJLZVZPUWYVM\UKPaHY
intelectual, así como el tan anhelado discurso de en las variables de apropiación de las TIC por los
vencer las brechas2 que separan históricamente actores educativos, ni las pautas más elementales
1 Las Tecnologías de Información y Comunicación (TIC)
son el conjunto de herramientas tecnológicas que hacen posible la
de incorporación a las prácticas de los docentes y
interacción entre los usuarios que comparten un espacio (virtual) alumnos (Moreno, 2009).
sin necesidad de coincidir en espacio y tiempo, algunas de ellas
son la videoconferencia, el e-mail, los foros de discusión, el En la presente investigación, se puede evidenciar
Internet, el videoteléfono, la audio conferencia, las tele sesiones,
entre otros. Estos medios en conjunto o individualmente son
este doble proceso de transformación que se
utilizados como auxiliares en la obtención e intercambio de la ha venido exponiendo: una parte, la presión de
información donde la innovación tecnológica no pertenece a una
sola cultura, no son el invento de un sujeto, ni de una empresa, actores nacionales e internacionales por incorporar
sino el resultado de la cultura global que vive la humanidad de
este siglo (González-Linares, 2004).
SHZ;0*HSHLK\JHJP}UJVULSÄUKLLSL]HYSHJHSPKHK
2   Según Delia Crovi (2004), la actual brecha, que es la de los procesos de educación (ANUIES, 2001;
digital, puede analizarse desde cinco dimensiones: a) Tecnológica:
referida a la infraestructura material disponible así como al grado de
CEPAL, 2005; OCDE, 2002; OEI, 2003; SEP, 2007;
actualización de dicha infraestructura; b) De conocimiento: vinculada UNESCO, 2005), y por otra parte, la interacción
a las habilidades y saberes que deben poseer los individuos para
apropiarse adecuadamente de los nuevos medios y de las TIC; c) De de estas tecnologías por profesores que tienen
información: dimensión en la que es posible distinguir dos sectores
sociales: uno sobre informado, con acceso a diferentes medios
mínimos niveles de alfabetización digital y escasas
y generaciones tecnológicas; y otro desinformado, con acceso herramientas pedagógicas de las tecnologías
limitado a las innovaciones tecnológicas, sus actualizaciones y sus
contenidos; d) Económica: por la falta de recursos para acceder educativas, frente a estudiantes “nativos digitales”
HSHZ;0*X\LZLTHUPÄLZ[H[HU[VHUP]LSWLYZVUHSJVTVLU[YLSVZ
sectores gubernamentales y algunos privados; y e) De participación:
cuya apropiación y habilidades tecnológicas le
X\L ZPNUPÄJH X\L SVZ YLJ\YZVZ HWVY[HKVZ WVY SHZ PUUV]HJPVULZ han orientado a un uso social y de entretenimiento
tecnológicas puedan emplearse en un contexto democrático, con
un marco legal y social adecuado, que permita a los individuos y a (Granados, 2008; Guitert, Romeu, & Pérez-Mateo,
las naciones igualdad de oportunidades para expresarse e intervenir
en las decisiones de un mundo global (Crovi, 2004: 18).
2007; Sánchez, 2008). Si bien esta condición no

?=,5*<,5;965(*065(3*65,0** 18
Análisis de la apropiación de las TIC en el aula

es unívoca, evidencia la carencia de estrategias y subjetividades, es el punto intermedio entre


integrales que hayan partido de modelos de lo individual y lo colectivo” (2007: 11), lo cual
incorporación de TIC al aula y que consideren la da cuenta de la estrecha interrelación entre los
apropiación y las habilidades tecnológicas de los usos socialmente dados por los jóvenes para
actores educativos. la tecnología, y el discurso que se legitima en el
Particularmente, estudiar los niveles de apropiación ámbito institucional educativo respecto al uso que
de la tecnología en la educación, surge de la la misma debe tener para el desarrollo de mejores
inquietud de conocer el grado de incorporación prácticas académicas.
que ha tenido la infraestructura tecnológica Este punto de quiebre, aunado a la brecha digital
instalada en la IES en una dinámica educativa y generacional existente, producen una forma
que sea verdaderamente transformadora gracias heterogénea de mirar al mismo proceso, la
al apoyo de las TIC. Merece atención resaltar educación con tecnología. Esto ha resultado claro
que esta tecnología constituye un apoyo, no un en el presente estudio, que a través de la medición
desplazamiento del profesor, antes bien, es un de la apropiación de las TIC en la Unidad Académica
eje de evolución de los procesos de enseñanza- de Ciencias Jurídicas y Sociales, de la Universidad
aprendizaje tradicionales. Autónoma de Tamaulipas, se ha constatado que
La apropiación es el “conjunto de procesos los niveles de habilidades tecnológicas que poseen
socioculturales que intervienen en el uso, la los jóvenes no corresponden necesariamente a un
ZVJPHSPaHJP}U ` SH ZPNUPÄJHJP}U KL SHZ U\L]HZ mejor nivel en el uso académico de las TIC.
tecnologías en diversos grupos socioculturales” Para lograr el objetivo de medir la apropiación
(Winocur, 2006: 554). En este trabajo, puede ser tecnológica, se empleó el modelo teórico
entendida como el proceso de asimilación cognitiva propuesto por Hooper y Rieber (1995), teaching
de las TIC para adecuarlos a una aplicación with technology, el cual evidencia cinco fases o
académica (González-Marín, 2009: 10). niveles que se pueden lograr a partir del análisis
Sin embargo, el cuadro social y cultural que ha de la integración de TIC en el aula. Una de las
enmarcado el surgimiento de la computadora aportaciones que pretende tener esta investigación,
e Internet, condiciona fuertemente las actuales es la adaptación de este modelo para poder medir
dinámicas que se gestan en las prácticas la apropiación desde la óptica de los estudiantes,
académicas que tratan de aprender con la ya que esencialmente ha sido aplicado al ámbito
tecnología. Esta relación entre el uso escolar y el docente (Montes & Ochoa, 2005).
cotidiano de las TIC ha venido cargado de fuertes El modelo y cada una de las etapas, se han
connotaciones simbólicas. conceptualizado como lo expresan los autores
Gladys Ortiz (2007), al analizar la apropiación de en su modelo, con la única diferencia de que, la
la computadora e Internet en la vida cotidiana, medición original que se orientaba a conocer
menciona que “la apropiación ocurre cuando cómo los docentes eran responsables de los
LS PUKP]PK\V JVUÄN\YH Z\ T\UKV H [YH]tZ KL SH procesos gestados, ha sido sustituida por el
mediación –en la vida cotidiana- de su propia rol que el estudiante tiene en esa dinámica de
conciencia o subjetividad y las otras conciencias interacción con los lineamientos del profesor, sus

?=,5*<,5;965(*065(3*65,0** 19
Análisis de la apropiación de las TIC en el aula

percepciones sobre la tecnología y el ámbito Institucional. Lo


anterior se expone en el cuadro siguiente:
Cuadro 1. Modelo de apropiación tecnológica

NIVEL DESCRIPCIÓN

Familiarización (VWDIDVHVHUH¿HUHDXQDSULPHUDH[SHULHQFLDFRQOD
WHFQRORJtDTXHHVWUDGXFLGRDOFRQRFLPLHQWRGHORVUHFXUVRV
WHFQROyJLFRVODFRPSXWDGRUDHOLQWHUQHWDOJXQRVPDWHULDOHV
GLGiFWLFRVHVSHFt¿FRVFRPRHO3LQWDUUyQORVFDxRQHVR
SUR\HFWRUHVORVSL]DUURQHVLQWHOLJHQWHVDVtFRPRHOFRQRFHU
SDTXHWHVGHVRIWZDUHEiVLFRV :RUG([FHO\3RZHU3RLQW

Utilización (VWDIDVHRFXUUHFXDQGRVHOHGDXQHVSDFLRGHDSOLFDFLyQ
DODWHFQRORJtDHQHODXODGHFODVHVLQSURIXQGL]DUHQ
HVWUDWHJLDVSHGDJyJLFDVTXHHQPDUTXHQVXDSOLFDFLyQ
(OPRGHORGH+RRSHU\5LHEHU  PHQFLRQDTXHHV
FXDQGRHOSURIHVRUODLQWURGXFHDODXODVLQHPEDUJRHQOD
LQYHVWLJDFLyQVHKDSODQWHDGRFRPRODSRVLELOLGDGGHVHU
LQWURGXFLGDLQFOXVRGHVGHHOiPELWR,QVWLWXFLRQDOFRPRSDUWH
GHODLQIUDHVWUXFWXUDWHFQROyJLFD

,QWHJUDFLyQ /DIDVHGHLQWHJUDFLyQHVHOSXQWRGHFDPELRVXVWDQFLDOHQWUH
ODVLPSOHSUHVHQFLDGHODV7,&HQODHQVHxDQ]DDSUHQGL]DMH
\VXSODQHDFLyQFRPRDJHQWHVTXHWLHQHQXQDIXQFLyQHQHO
SURFHVR6HJ~Q+RRSHU\5LHEHU  RFXUUHFXDQGRVHOH
FRQ¿HUHQFLHUWDVWDUHDV\UHVSRQVDELOLGDGHVDODWHFQRORJtD
GHQWURGHXQSURFHVRGHFRPXQLFDFLyQXQLGLUHFFLRQDOHV
GHFLUIXQGDPHQWDOPHQWHFRPRFDQDOGHHQYtRGHLQIRUPDFLyQ
HLQWHUFDPELRGHGDWRVRFRPRIXHQWHGHPDWHULDOHVGH
H[SRVLFLyQVLQTXHH[LVWDXQDLQWHUDFFLyQ

?=,5*<,5;965(*065(3*65,0** 20
Análisis de la apropiación de las TIC en el aula

5HRULHQWDFLyQ (QHVWDIDVHUHTXLHUHTXHODWHFQRORJtDVHUHSODQWHHHQ
VXVIXQFLRQHVGHQWURGHODXOD/DSULQFLSDOFDUDFWHUtVWLFD
GHpVWDHVTXHHOHPSOHRGHODV7,&VHKDFHHQIXQFLyQ
GHODSUHQGL]DMHGHOHVWXGLDQWH\ODFRQVWUXFFLyQGH
FRQRFLPLHQWRVDVtFRPRHOFDPELRGHOSDSHOGHOSURIHVRU
FRPRSULQFLSDOIXHQWHGHFRQWHQLGRV

(YROXFLyQ 3RU~OWLPRHODQiOLVLVGHODHYROXFLyQHQHOPRGHORGH
DSURSLDFLyQGH7,&WLHQHPXFKRTXpYHUFRQSURFHVRVGH
LQQRYDFLyQWHFQROyJLFDGHDXWRLQIRUPDFLyQFRQVWDQWH\
IRUPDFLyQLQWHJUDOGHXQVXMHWRDFWLYRHQODFRQVWUXFFLyQGHO
FRQRFLPLHQWR\XQGRFHQWHTXHVHDHOJXtDHQHVWHSURFHVR
GHLQWHUFDPELRGHE~VTXHGD\VHOHFFLyQGHLQIRUPDFLRQHV
(QWUHORVSULQFLSDOHVLQGLFDGRUHVTXHUHÀHMDUDQHVWD
WHQGHQFLDHVHOHPSOHRGHSODWDIRUPDVGHDSUHQGL]DMH
HQOtQHDXQDOWRQLYHOGHGHVWUH]DGHORVXVXDULRVSDUDOD
QDYHJDFLyQDVtFRPRODSHUFHSFLyQGHOSDSHOSUHGRPLQDQWH
GHODWHFQRORJtDHQVXIRUPDFLyQHVFRODU

Fuente: elaboración propia con base al modelo de Posterior a la recolección de datos y captura en
Hooper y Rieber (1995) el programa Statistical Package for the Social
Sciences (SPSS), se realizó el análisis estadístico
Metodología correspondiente. Para el análisis de la apropiación,
La presente investigación se realizó en la se construyeron indicadores en cada fase del
Unidad Académica de Ciencias Jurídicas y modelo, los cuales se estructuraron a través de
Sociales (UACJS), donde se procedió a aplicar escalas Likert, las que a su vez constituían en
un cuestionario que midiera el acceso, uso y conjunto una medida para determinar cada una de
apropiación que tenían los jóvenes universitarios las fases en tres niveles: alto, medio y bajo. Para
inscritos en el periodo 2009-III en esa facultad OHJLY LZ[H LZ[YH[PÄJHJP}U ZL HWSPJ} SH [tJUPJH KL
de la Universidad Autónoma de Tamaulipas. Del Estaninos con ayuda del SPSS. Una vez teniendo
total de los 4,367 alumnos, se determinó una los niveles de cada una de las fases de apropiación,
muestra probabilística de 353 estudiantes, que se correlacionaron con algunas otras variables que
representaran las seis carreras que se imparten en ZVU ZPNUPÄJH[P]HZ LU SH [LZPZ ZVZ[LUPKH! L_PZ[LU
la Unidad: Derecho, Ciencias de la Comunicación, ]HYPHISLZ JVU[L_[\HSLZ X\L PUÅ\`LU M\LY[LTLU[L
Psicología, Turismo, Idioma Inglés y Economía, en el nivel de apropiación: el acceso, el nivel
para lo cual se procedió a ponderar la muestra de socioeconómico, así como el uso no académico
acuerdo a la proporción de estudiantes de cada de las TIC.
una de las carreras.
?=,5*<,5;965(*065(3*65,0** 21
Análisis de la apropiación de las TIC en el aula

Resultados la separación de las dinámicas de apropiación y


La apropiación tecnológica en los estudiantes empleo tecnológico entre estudiantes y profesores.
de la UACJS se sitúa en niveles muy básicos de
incorporación de las TIC a las prácticas educativas .YmÄJV ! 5P]LSLZ KL HWYVWPHJP}U [LJUVS}NPJH LU
]LYNYmÄJV3VZUP]LSLZLZ[mUJHYHJ[LYPaHKVZWVY la UACJS
un buen número de jóvenes que están altamente
familiarizados con las tecnologías (88%), ya sea
porque tienen la posesión de un aparato propio,
o tienen acceso a través de los recursos que la
Universidad ofrece, cabe mencionar que fueron
analizados en este punto la familiarización con la
computadora, Internet, el Pintarrón, los cañones o
proyectores, así como el pizarrón inteligente.
Le sigue en el rango de utilización, un número
semejante de estudiantes que las emplean para
Fuente: elaboración propia con datos de la
sus tareas y actividades escolares (64%), en
encuesta Acceso, uso y apropiación de Internet en
este ámbito de respuestas estuvo contemplada
los estudiantes
la frecuencia de utilización de los recursos
tecnológicos descritos en la etapa anterior de
La reorientación está presente en un porcentaje
familiarización.
más bajo (17%), lo cual indica que ese cambio
Posteriormente, la integración de estos recursos
del empleo de las TIC como simples canales de
(21%), expresa que en menor medida se da el
comunicación a herramientas que permitan la
empleo de la tecnología dentro de alguna función
construcción del conocimiento es aún menor.
LZWLJxÄJH KLS WYVJLZV LK\JH[P]V H\UX\L ZLH
Se menciona en este punto que los niveles de
en una forma unidireccional o como canal de
apropiación son prácticas yuxtapuestas que no
difusión de información, muy pocos estudiantes
necesariamente requieren la completa dominación
señalaron que los profesores empleen un formato
de una para pasar a otra. En esta etapa se destacan
digital para dar a conocer sus planes clase, sus
algunos de los puntos más interesantes: los
TH[LYPHSLZYLJPIPYSHZ[HYLHZVLU]PHYJHSPÄJHJPVULZ
estudiantes siguen realizando prácticas de plagio
En este punto también cabe destacar que el
de información como cortar y pegar sin analizar
análisis efectuado a los estudiantes que utilizan
(61%), tienen una precaria estrategia de búsqueda
el Messenger y el correo electrónico para
de información válida en la red, puesto que no
comunicarse con sus profesores presenta una
emplean bases de datos, revistas especializadas
tendencia elevada (59.2%), no obstante, el uso
o buscadores especializados, sino únicamente los
de estos mismos recursos para contactar a sus
documentos que aparecen en sus buscadores
compañeros de clase y realizar trabajos escolares
convencionales (38.5%), y paradójicamente
e intercambio de información académica es
muchos de ellos perciben que Internet favorece
mucho más alto (91.6%). Esto muestra claramente

?=,5*<,5;965(*065(3*65,0** 22
Análisis de la apropiación de las TIC en el aula

sus procesos de aprendizaje (87%) y les permite cómo al cruzar los niveles de habilidades que los
aprender más y con menos esfuerzo (74.3%). jóvenes perciben tener de ellos mismos, va en
-PUHSTLU[LSHL]VS\JP}ULZ\UHL[HWHZPNUPÄJH[P]H decremento junto con los niveles de apropiación.
para un bajo porcentaje de los estudiantes (7%). ,Z[V YLÅLQH X\L ZP IPLU L_PZ[L \UH [LUKLUJPH H
En este proceso se debería poner especial análisis que los estudiantes tengan un nivel medio-alto
al hecho que, si bien la UACJS ha invertido en ` HS[V KL OHIPSPKHKLZ [LJUVS}NPJHZ UV ZPNUPÄJH
desarrollar una infraestructura tecnológica que necesariamente que esto mejore las prácticas
provea de red inalámbrica, pintarrones, cañones educativas cuando se incorporan las TIC al aula.
y computadoras para las aulas de clase, esto
no ha bastado para que se dé una evolución en .YmÄJH  7YPUJPWHSLZ \ZVZ KL SH 0U[LYUL[ KL SVZ
las prácticas educativas. Especialmente, la fase jóvenes
de orientación debería estar caracterizada por el
desarrollo de un sujeto activo en la construcción
del conocimiento a través de las interacciones en
red, mediados por la tecnología. Sin embargo, es
una meta aún por lograr.

.YmÄJH ! *VTWHYH[P]V LU[YL SHZ OHIPSPKHKLZ


tecnológicas y la apropiación

Fuente: elaboración propia con datos de la


encuesta Acceso, uso y apropiación de Internet en
los estudiantes
Fuente: elaboración propia con datos de la
encuesta Acceso, uso y apropiación de Internet en Es también interesante destacar, que los usos de
los estudiantes la tecnología están fuertemente condicionados
por una asociación hacia lo lúdico, lo social o
Si bien los niveles de apropiación hablan de un uso ZPTWSLTLU[L SV JVT\UPJH[P]V ,U SH NYmÄJH 
KLSHZ;0*WHYHÄULZHJHKtTPJVZSHZOHIPSPKHKLZ se exponen los resultados de un sondeo de las
tecnológicas de los estudiantes hacen mención a 5 principales actividades que los estudiantes
la destreza que presentan ellos para el uso de la realizaban en la Red, en las cuales se evidencia esta
computadora y el Internet sin ser exclusivamente tendencia. Sin embargo, estos resultados también
WHYHÄULZHJHKtTPJVZ,ULSNYmÄJVZLVIZLY]H pueden orientar las estrategias pedagógicas

?=,5*<,5;965(*065(3*65,0** 23
Análisis de la apropiación de las TIC en el aula

diseñadas para el uso de las TIC en las dinámicas Conclusiones


educativas, al conocer cuáles son los recursos de Los principales retos que presenta la educación
Internet sobre los que tienen un mayor dominio y en México, es elevar la calidad de sus programas
acceso los estudiantes. educativos y hacerlos competentes para formar
Otro aspecto que debe ser enfatizado, son las profesionales adecuados a las exigencias de la
variables contextuales que también condicionan Sociedad de la Información y el Conocimiento
fuertemente el nivel de apropiación de la tecnología. (SIC). En la búsqueda de esta meta, las TIC
Entre ellos destaca el hecho de pertenecer a la han surgido como un instrumento para dotar
zona metropolitana o residir en las zonas rurales de habilidades tecnológicas que inserten a
que circunscriben a Tampico, Madero y Altamira, los estudiantes en una lógica de continua
W\LZJVTVZLVIZLY]HLUSHNYmÄJHSVZHS\TUVZ autoformación y los instrumente para adaptarse
“foráneos” tienen mucho menor nivel de apropiación a las dinámicas del nuevo mercado de trabajo.
de las TIC que aquellos que declararon residir en la Sin embargo, la presión que se ha ejercido desde
zona urbana. Cabe destacar en este punto, que en el exterior para transformar a las Instituciones
la muestra del estudio por cada 3 alumnos locales de Educación Superior en un espacio de
hay 1 alumno foráneo. competencias tecnológicas, ha tergiversado el
papel que las TIC han adquirido en el aula: de ser
.YmÄJH+PMLYLUJPHZLUSVZUP]LSLZKLHWYVWPHJP}U TLKPVZZLOHUJVU]LY[PKVLUÄULZLUZxTPZTHZ
por lugar de residencia ,Z[LLZ[\KPVZPIPLUYLÅLQH\UHYLHSPKHKT\`SVJHS
evidencia esta tendencia a caer en el determinismo
tecnológico, donde la dotación de infraestructura
para garantizar el acceso se ha convertido en la
meta de las políticas públicas de incorporación
de TIC al aula, descuidando factores contextuales
importantes, como es el hecho de lograr un nivel
de apropiación de los recursos tecnológicos que
coadyuven en la gestación de nuevas dinámicas
de enseñanza-aprendizaje, donde la generación
de conocimiento y el aprovechamiento de los
recursos educativos que Internet ofrece sean
canalizados para el logro de una mayor calidad
Fuente: elaboración propia con datos de la educativa.
encuesta Acceso, uso y apropiación de Internet en 3VZYLZ\S[HKVZKLSHUmSPZPZOHUW\LZ[VKLTHUPÄLZ[V
los estudiantes algunos puntos que deben ser considerados
para mejorar la apropiación de la tecnología en
la educación, primeramente, el hecho de que
el uso de las TIC en el aula está condicionado
fuertemente por los usos sociales que se tienen

?=,5*<,5;965(*065(3*65,0** 24
Análisis de la apropiación de las TIC en el aula

de ésta, por lo que deben establecerse estrategias construir políticas públicas en materia de tecnología
que medien esta situación, logrando aplicar X\L PTWHJ[LU KL MVYTH TmZ LZWLJxÄJH H LSL]HY
adecuadamente las herramientas para lograr un el nivel de la educación y las competencias de
mayor aprendizaje. En segundo lugar, que las estudiantes y profesores en el actual escenario de
habilidades tecnológicas de los jóvenes si bien la Sociedad de la Información y el Conocimiento.
son elevadas, requieren también una orientación
para ser aplicadas al ámbito educativo y por parte Bibliografía
de los profesores, integrarlos a través de cursos o Asociación Nacioal de Universidades e Instituciones
programas de alfabetización digital que les provean de Educación Superior (ANUIES) (2001).
Plan Maestro de Educación Superior Abierta
las herramientas de trabajo en las TIC. Por último,
y a Distancia: Líneas estrategicas para su
y no por ello menos importante, merece atención desarrollo. Consultado el 3 de septiembre
el hecho de que la misma población estudiantil que de 2009. En línea: http://201.161.2.34/
H WYPVYP [PLUL JVTWSL[V HJJLZV LZ[m PUÅ\PKH WVY servicios/d_estrategicos/pdf/plan_
maestro_1.pdf.
otros factores que también condicionan su nivel
Barriga, F., Padilla, R., & Morán, H. (2009).
de habilidades tecnológicas y de apropiación de Enseñar con apoyo de TIC: Competencias
la tecnología, uno de estos factores más evidente, tecnológicas y formación docente. En F.
es el socioeconómico, pero también la condición Barriga Arceo, G. Hernández Rojas & M.
Rigo Lemini (Eds.), Aprender y enseñar con
de residencia de los mismos, ya que los alumnos
TIC en educación superior: Contribuciones
foráneos, que viven en su mayoría en las regiones desde el Socioconstructivismo. México:
rurales que rodean la zona conurbada tienen una UNAM.
menor apropiación de los recursos. Becerra, M. (2003). Sociedad de la Información:
proyecto, convergencia, divergencia.
Es necesario establecer diagnósticos que permitan
Buenos Aires: Editorial Norma.
conocer estos indicadores sobre los que se va Castells, M. (2000). La Era de la Información: la
a construir el modelo de aplicación de TIC a la Sociedad Red. Economía, Sociedad y
enseñanza, ya que se detectó que los profesores Cultura (Vol. I). México: Siglo XXI.
Castells, M. (2009). Comunicación y Poder. Madrid:
no están integrando la tecnología disponible
Alianza Editorial.
a sus prácticas –valdría atención indagar más Comisión Económica para América Latina y el
profundamente las causas-, mientras los jóvenes Caribe (CEPAL) (2005). Políticas Públicas
también hacen un uso no académico de los para el desarrollo de sociedades de
información en América Latina y el Caribe.
mismos. La población de estudiantes foráneos
Consultado el 18 de enero de 2010. En
que vienen a estudiar a la zona es alta, por lo línea: http://www.sociedadinformacion.
que también podría considerarse un programa unam.mx/repositorio/documentos/
de alfabetización tecnológica orientada a la praxis UneconomiccommissionforlatinA.pdf.
Crovi, D. (2004). Sociedad de la información
educativa para la población estudiantil.
y el conocimiento. Algunos deslindes
Todos estos lineamientos podrían constituir imprescindibles. En D. Crovi (Ed.), Sociedad
orientaciones clave para plantear mejores de la Información y el conocimiento: entre lo
escenarios de incorporación tecnológica en las falaz y lo posible (1a ed.). Buenos Aires: La
Crujía.
Instituciones de Educación Superior, y sobre todo,

?=,5*<,5;965(*065(3*65,0** 25
Análisis de la apropiación de las tic en el aula

Crovi, D. (2007). Comunicación Educativa y Organización para la Cooperación y el Desarrollo


Mediaciones Tecnológicas. Hacia nuevos Económico (OCDE) (2002). Perspectivas de
ambientes de aprendizaje. México: ILCE, las Tecnologías de la Información. Consultado
Instituto Latinoamericano de Comunicación el 27 de enero de 2009. En línea: http://
Educativa. www.oecd.org/dataoecd/63/60/1933354.
González-Linares, A. (2004). Uso de l@s pdf.
tecnologí@s de inform@ción y comunic@ Revista Iberoamericana de Ciencias, Tecnología,
ción en el @mbito educ@tivo: un estudio de Sociedad e Información (OEI) (2003). Visión
c@so. Unpublished Tesis de Licenciatura en Común de la Sociedad de la Información.
Psicología Social, Universidad Autónoma Consultado el 22 de febrero de 2009.
Metropolitana-Iztapalapa, México, D.F. En línea: http://www.oei.es/revistactsi/
González-Marín, S. (2009). Recursos electrónicos numero6/documentos01.htm.
de información en la UNAM: Diagnóstico de Ortega, J. A., & Chacón, A. (2007). Nuevas
uso entre estudiantes y profesores. México: Tecnologías para la Educación en la Era
UNAM/Dirección General de Bibliotecas. Digital. Madrid: Ediciones Pirámide.
Granados, J. (2008). Alfabetización tecnológica y Ortiz, G. (2007). Apropiación de la computadora
el acceso a las TIC en la dialéctiva inclusión/ y la red Internet en la vida cotidiana.
exclusión. El caso de la minoría gitana. Aproximaciones teóricas y empíricas
Revista de Educación, Mayo-agosto(346), para su estudio. Estudio de caso: los
427-451. jóvenes universitarios tecno-letrados.
Guitert, M., Romeu, T., & Pérez-Mateo, M. (2007). Unpublished Tesis de Maestría en Ciencias
Competencias, TIC y trabajo en equipo Antropológicas, Universidad Autónoma
en Entornos Virtuales. RU&SC Revista Metropolitana-Iztapalapa, México, D.F.
Universidad y Sociedad del Conocimiento, Rengifo, A. (2002). La sociedad de la información:
4(001), 1-13. un nuevo tipo de sociedad. Bogotá:
Hooper, S., & Rieber, L. (1995). Teaching with 7VU[PÄJPH<UP]LYZPKHK1H]LYPHUH
technology. En A. C. Ornstein (Ed.), Sánchez, M. C. (2008). Integrando las tecnologías
Teaching: Theory into Practice. (pp. 154- de la información y comunicaciones
170). Needham Heights, MA: Allyn and al proceso de enseñanza-aprendizaje.
Bacon. Reencuentro. Universidad Autónoma
Montes, J., & Ochoa, S. (2005). Evaluación de los Metropolitana-Xochimilco, marzo(051), 98-
niveles de apropiación de las Tecnologías 110.
de la Información y Comunicación en Secretaría de Educación Pública (SEP) (2007).
cursos universitarios. Un estudio cualitativo. Programa Nacional de Educación 2007-
Conferencia presentada en el Congreso 2012. Consultado el 2 de septiembre de
Cognición, aprendizaje y currículo. 2009. En línea: http://www.sep.gob.mx/
Consultado el 20 de septiembre de 2009, wb/sep1/sep1_Bol3081107.
En línea: http://www.colombiaaprende.edu. Sunkel, G. (2006). Las tecnologías de la información
co/html/mediateca/1607/articles-106516_ y la comunicación (TIC) en la educación
archivo.pdf. en América Latina. Una exploración de
Moreno, J. (2009). Diagnóstico de los usos e indicadores. Santiago de Chile: CEPAL.
incorporación de las TIC en un escenario <UP[LK 5H[PVUZ ,K\JH[PVUHS :JPLU[PÄJ HUK
universitario. En F. Barriga, G. Hernández Cultural Organization (UNESCO) (2005).
& M. Rigo (Eds.), Aprender y enseñar con Hacia las Sociedades del Conocimiento.
TIC en educación superior: Contribuciones Consultado el 19 de enero de 2010.
desde el Socioconstructivismo. México: En línea: http://unesdoc.unesco.org/
UNAM. images/0014/001419/141908s.pdf.

?=,5*<,5;965(*065(3*65,0** 26
Análisis de la apropiación de las tic en el aula

Winocur, R. (2006, julio-septiembre). Internet en


la vida cotidiana de los jóvenes. Revista
Mexicana de Sociología, 68, 563-570

SOBRE LOS AUTORES


María Consuelo Lemus Pool. Maestrante en
Ciencias Políticas y Sociales con orientación
a Comunicación por la Universidad Nacional
Autónoma de México. Licenciada en Ciencias
de la Comunicación. Línea de investigación
Educación e Innovaciones Tecnológicas.
Enrique Garza Mejía. Candidato a Doctor en
Comunicación y Periodismo por la Universidad
de Santiago de Compostela, España. Máster en
Educación. Actualmente es profesor de tiempo
completo e investigador de la Universidad
(\[}UVTHKL;HTH\SPWHZWLYÄS7964,7
Leticia Caloca Carrasco. Doctora en Investigación
Educativa por la Escuela Normal Superior de Cd.
Madero. Máster en Educación. Actualmente es
profesora de tiempo de completo e investigadora
KLSH<UP]LYZPKHK(\[}UVTHKL;HTH\SPWHZWLYÄS
PROMEP.

?=,5*<,5;965(*065(3*65,0** 27
La comunidad virtual de
“mis amigas Ana y Mía”
y la representación social
del culto al cuerpo
Dra. María Concepción Lara Mireles
Anahí Monserrat Hernández Rodríguez
Martha Fabiola Juárez Rodríguez
UNIVERSIDAD AUTÓNOMA DE SAN LUIS POTOSÍ

Resumen
La anorexia y la bulimia son trastornos de alimentación severos que llevan a quienes los padecen
  
a buscar la pérdida de peso para lograr una meta: la delgadez extrema.
Existen blogs que han sido creados por personas con este trastorno para formar una comunidad
de usuarios que compartan su deseo y búsqueda. Para lograrlo, en esas comunidades virtuales
se intercambian tips, se sugieren recetas y medicamentos que ayuden en la obtención de su ob-
jetivo y se tejen lazos comunicativos, afectivos y simbólicos.

Nos encontramos frente a una problemática social multidimensional que se ha exacerbado en


los últimos tiempos y es propiciada por las exigencias de la moda, el estereotipo de una belleza
basada en la cultura mercadológica de lo light, la incidencia de los MCS y las nuevas formas de
interacción discursiva de las TIC.

Nuestro objeto de estudio es el análisis de la identidad utópica de las chicas que visitan asidua-
mente el blog “Mis amigas Ana y Mía”. Ellas se autonombran princesas, es decir, personas bellas
y frágiles, superiores a los mortales comunes.

En este trabajo, trataremos de desentrañar el valor simbólico de la delgadez, estereotipo que se


ha convertido más allá de expresión estética, en sinónimo de éxito, seguridad, felicidad y acep-
[HJP}U,SLUMVX\LX\LJVUZPKLYHTVZUVZW\LKLH`\KHYH\UPÄJHYSHZKPTLUZPVULZPUKP]PK\HS`
colectiva, simbólica y social que presenta este fenómeno, es el de la representación social del
culto al cuerpo.
Asimismo, la articulación con el estudio de la textualidad electrónica del blog en cuestión, nos
WLYTP[PYmPU[LNYHYU\L]VZJ}KPNVZJVT\UPJH[P]VZX\LHÄHUaHULSJHYmJ[LYUVYTH[P]VKLSHZYL-
presentaciones sociales.

Palabras clave
Representaciones sociales, blogósfera, narrativa hipertextual, culto al cuerpo, trastornos alimen-
ticios.
La comunidad virtual de “mis amigas Ana
y la Mia” y la representación social
del culto al cuerpo

El fenómeno de la anorexia y la bulimia correspondería aumentar de acuerdo con


el proceso de crecimiento y considerando
La anorexia y la bulimia son consideradas que, una reducción de peso cercana a 15%
enfermedades de la conducta alimenticia de un es valorada como riesgo médico.
individuo, están ligadas a desórdenes sicológicos % Negativa a mantener el peso corporal por
como la baja autoestima. También se cree que encima del mínimo, según edad y estatura.
estos trastornos alimenticios son propiciados por % A estos criterios pueden agregarse los
la importancia que tiene la imagen corporal en las siguientes:
sociedades modernas. -­   Pérdida de peso auto inducido por
conductas compensatorias: vómitos,
La anorexia nerviosa se caracteriza por la laxantes, diuréticos y exceso de
autorrestricción en el consumo de alimentos, actividad física.
la práctica de ejercicio excesivo y el miedo -­   Retraso en el desarrollo puberal.
a engordar, mientras que la bulimia nerviosa
presenta episodios de “atracones”, seguidos de ,ULS4HU\HSZL[PWPÄJHUKVZMVYTHZKLHUVYL_PH!
una gran culpabilidad por las cantidades o tipos de % Tipo restrictivo: la pérdida de peso se
alimentos consumidos, este sentimiento genera obtiene haciendo dietas, ayunos o ejercicio
que el individuo busque maneras inadecuadas excesivo. No se recurre a “atracones” ni a
de expulsar la comida autoinduciéndose el purgas.
vómito y abusando de laxantes, como también % Tipo compulsivo-purgativo: se recurre
sometiéndose a periodos prolongados de ayuno. regularmente a medidas purgatorias como
inducción al vómito, uso de laxantes,
Según el Manual Diagnóstico y Estadístico de los diuréticos y enemas.
Desórdenes Mentales para los Trastornos de la
Alimentación. (DSM IV), los síntomas que presenta
cada enfermedad son los siguientes: Bulimia

Anorexia nerviosa % Episodios recurrentes de voracidad:


% Comer en corto período de tiempo gran
% Miedo intenso a engordar, que no disminuye cantidad de alimentos.
con la pérdida de peso. % Falta de control sobre la alimentación
% Alteración de la silueta corporal, exagerando durante el episodio.
su importancia en la autoevaluación y % Promedio de dos episodios de voracidad
negando los peligros que provoca la semanales durante tres meses.
disminución de peso. % (\[VL]HS\HJP}U ¸PUKLIPKHTLU[L¹ PUÅ\PKH
% Pérdida de por lo menos 25% del peso por la forma y el peso corporales.
original. En menores de 18 años de % Conducta compensatoria:
edad debe añadirse al peso inicial el que -­   Purgativa: vómitos auto inducidos,
?=,5*<,5;965(*065(3*65,0** 29
La comunidad virtual de “mis amigas Ana
y la Mia” y la representación social
del culto al cuerpo

laxantes, diuréticos. En el siglo XIX el discurso médico presentaba a la


-­   No purgativa: ayuno, ejercicios físicos mujer como un ser débil y enfermizo, la hipocondría
extenuantes. `SHOPZ[LYPH[HTIPtULZ[HIHUWYLZLU[LZLULZLWLYÄS
femenino. La anorexia se empezó a conocer como
Los desordenes alimenticios se presentan tanto anorexia histérica o anorexia nerviosa.
en hombres como en mujeres, pero el número de
mujeres es mayor al de los hombres. Dentro de En el caso de la bulimia primero se comenzó
la sociedad el sobrepeso masculino es aceptado, hablar de hipofagia (comer hasta no concentrarse
al contrario de lo femenino que mantiene una en otra cosa, asociada con la gula) acompañada
constante lucha con la lipofobia. con vómitos. Se creía que la bulimia era el extremo
de la anorexia. En 1979 Russell (citado en Moreno,
Siempre se asocia a las mujeres con estos 2005) la considera como un indicador crónico de
trastornos, se habla de baja autoestima, de presión la anorexia. Los pacientes con dicho padecimiento
social, de problemas familiares, sexuales, del ideal se caracterizaban por una mayor ansiedad y
de belleza. Y es aquí donde surge la primera depresión, inestabilidad e insatisfacción con su
pregunta ¿ideal de belleza? ésta desencadena aspecto físico.
otras tantas ¿de dónde surge está preocupación
de ser bella? ¿Dictado por quién? ¿La publicidad? Se entiende que estás enfermedades siempre
¿Los medios? han existido. Los antiguos griegos y los romanos
durante los festines orgiásticos vomitaban el
Posibles correlatos históricos alimento ingerido para poder seguir degustando
los manjares en la celebración. Sin embargo, dicha
Entre los siglos XII-XV se encuentran casos práctica no está ligada con el actual rechazo al
semejantes a la anorexia, mujeres religiosas que cuerpo y el propósito de alcanzar un peso corporal
practicaban el ayuno con frecuencia, al que le mínimo.
llamaban Holly Anorexia. (Moreno, 2005)).
La anorexia y la bulimia, como
Richard Morton (citado en Moreno, 2005) es enfermedades de nuestro tiempo
uno de los primeros que recoge datos sobre la
anorexia en su publicación de 1689: Phisiologica. Una chica aparentemente normal, sana, conforme
El autor describe los casos de algunas mujeres con su cuerpo, entra a una boutique, pregunta
` \U OVTIYL X\L Z\MYxHU \UH H[YVÄH ULY]PVZH V por la talla 13 de pantalón, la dependienta le dice
tuberculosis. Esta tuberculosis se caracterizaba que sólo hay de las tallas 0-7. Sale decepcionada
por falta de apetito, amenorrea, tos y carencia de consigo misma, ve posters en las tiendas,
ÄLIYL4VY[VUYLSHJPVUHIHLZ[LWYVISLTHMxZPJVJVU maniquíes, todas las modelos son tan delgadas.
las pasiones que dañaban a los nervios, dándole Llega a casa, va a su habitación, ve sus revistas,
un tono espiritual. modelos delgadísimas, enciende la TV y en la

?=,5*<,5;965(*065(3*65,0** 30
La comunidad virtual de “mis amigas Ana
y la Mia” y la representación social
del culto al cuerpo

pantalla aparecen reiteradamente productos para www.morirjovenmitoinmortal.bligoo.com se hace


bajar de peso, apaga el aparato y ahora centra la la semblanza de las causas de su padecimiento y
frustración en su computadora. Inocentemente muerte:
teclea en su buscador tips para bajar de peso,
aparece entre los primeros 10 resultados “Mis Karen Carpenter sufría de anorexia nerviosa
amigas Ana y Mía”. Un blog dirigido a quienes, desde 1975 a su muerte en 1983. En los
JVTVLSSHKLZLHJHTIPHYZ\ÄN\YH 1960s, seguía la dieta “Stillman”. Karen
tomaba 8 vasos de agua y comía alimentos
Hoy en día el fenómeno de la anorexia y la bulimia sin grasa, perdiendo así 12 kilogramos. Su
adquiere características alarmantes y una expansión corazón quedo dañado por la malnutrición
tal que bien podemos considerarlo como una de tantos años. Murió a temprana edad
enfermedad psico-somática de nuestro tiempo., de un paro cardíaco, a consecuencia de
ya que la delgadez extrema es un estereotipo del la Anorexia Nerviosa el 4 de febrero 1983.
discurso mediático contemporáneo. Dicen que su corazón se colapsó debido
a la sobrenutrición que le hicieron en el
3H WYPTLYH ÄN\YH LU JHW[HY SVZ YLÅLJ[VYLZ KLS hospital aunado a su continuo uso de
mundo mediático por su etérea silueta fue la Top- laxantes, diuréticos y medicamentos de
Model, Lesly Hornly, mejor conocida como Twiggy la tiroides que le ayudaban a acelerar su
(briznilla) en 1966. Ella comenzó a aparecer en metabolismo. (2010).
las portadas de las revistas Elle, Vogue, Harper’s
Bazaar, Look, Life. A sus 17 años, pesaba 40 kilos La anorexia y la bulimia en la blogosfera
y media 1.69. Su peso estaba asociado a la pésima
alimentación, al consumo de anfetaminas, aunado
Ahora bien, ¿qué pasa cuando el fenómeno de la
después al ritmo de vida de una Top-Model. Su
anorexia y la bulimia entran como temática central
volátil imagen atrapó a las adolescentes de todo
de varios blogs? ¿Cómo es que estos sitios se
el mundo, quienes empezaron a copiar su imagen:
convierten en “santuarios” desespacializados, en
cabello corto, rubio, rostro sin maquillaje, pestañas
lugares de culto de la delgadez extrema a donde las
largas y sólo brillo labial. La exagerada delgadez
comunidades de usuarios acuden para encontrar
de la modelo no pasó desapercibida para los
la fuerza que requiere el camino o despeñadero
padres de familia, que empezaron a temer que las
que han elegido?
jovencitas cayeran en la anorexia, y así fue.
Para contestar a esta pregunta compleja que conlleva
Una de las primeras muertes dentro del mundo muchos otros cuestionamientos, presentaremos
de la farándula, relacionadas con la anorexia en primer término algunas consideraciones en
nerviosa, enfermedad poco conocida en aquel torno a la discursividad electrónica, a la aplicación
entonces. fue la de Karen Carpenter, la cantante de la tecnología en los procesos de composición,
y baterista del dúo The Carpenters, que formó recepción y distribución del texto digital, cuyas
junto a su hermano Richard Carpenter. En el blog características permiten construir redes abiertas

?=,5*<,5;965(*065(3*65,0** 31
La comunidad virtual de “mis amigas Ana
y la Mia” y la representación social
del culto al cuerpo

de comunicación; esta presentación constituirá digital. Esta textualidad electrónica, entendida


el marco de referencia para el análisis de la como la comprensión, descripción, valoración
problemática estudiada. Pasaremos luego a dar y análisis del texto digital, surge a partir de la
cuenta del desarrollo de nuestro proyecto de convergencia tecnológica entre la informática, lo
investigación sobre el blog “Mis amigas Ana y audiovisual y la telemática.
Mía”, documentando la primera etapa, que fue
la recolección y sistematización de datos a través La lógica operativa incluyente, interactiva e
de la etnografía virtual; luego presentaremos la hipertextual del blog “favorece el descentramiento
segunda etapa interpretativa, o búsqueda de la y la democratización de los sistemas informáticos,
ZPNUPÄJHJP}U WYVM\UKH KL SHZ WYmJ[PJHZ L_[YLTHZ a través de la constitución de redes autogestivas,
que llevan a cabo los usuarios para construir su verdaderos sistemas abiertos y complejos de
identidad utópica de princesas y príncipes. intercambio comunicativo en sentido no sólo
horizontal o circular, sino reticular, donde todos los
La hipertextualidad digital puntos se tocan”. (Lara. 2004: 24-25).

Hace 13 años (1 de abril de 1997) que Dave Winer Amelia Fernández dice que “el fenómeno de los
publicó la primera entrada de “Scripting News”, que blogs es la llegada efectiva de la interactividad
es considerado el primer weblog de Internet. De a Internet”. (2007). De hecho, los bloggers,
entonces a la fecha los blogs han sufrido cambios nuevos actores de la comunicación, no son ya
ZPNUPÄJH[P]VZHTLKPKHX\LZLOHUWVZPJPVUHKV` los receptores de un medio masivo, sino los
ganado terreno particularmente en los ámbitos de protagonistas de un espacio virtual creado y
la política, la educación, la cultura.1 construido por ellos mismos para plasmar sus
ideas en la red informática, “exponiendo su otro
Los blogs son escenarios virtuales sociales, son “yo” cubierto o no por la sábana del anonimato
ágoras o plazas públicas, ya que su característica y el poder de la irregularidad, intercambiando
básica es la posibilidad de que otros usuarios cosmovisiones, sometiendo a la crítica de todo el
de la red participen no sólo como lectores, sino mundo sus ideas” (Lara, Zavala y Medina, 2007).
añadiendo comentarios a cada entrada, de
manera que se genere un debate alrededor de
determinados contenidos o bien se amplíe la El estudio de las prácticas comunicativas a
información. Por otro lado, las múltiples referencias través del ciberespacio no puede limitarse ni
o enlaces a otros blogs y a diferentes páginas web, agotarse desde una visión puramente tecnológica
que tanto el autor como los visitantes enlistan, o instrumental. Se requiere una perspectiva
sitúan al blog en el ámbito de la hipertextualidad mediacional, que considere la Red como un
1 Para tener una visión general sobre la historia de los complejo fenómeno socio-técnico-cultural, que
blogs, sus características técnicas, su tipología y la nomenclatura
que utilizan, remitimos a http://wikipedia.org/wiki/Blog.
como tal posibilita nuevas formas de interacción
grupal, y en el entramado social, contribuye a
conformar un nuevo entorno, el tecno-cultural.
?=,5*<,5;965(*065(3*65,0** 32
La comunidad virtual de “mis amigas Ana
y la Mia” y la representación social
del culto al cuerpo

Con base en estos postulados epistemológicos Etnografía virtual del blog “mis amigas
]HYPVZ H\[VYLZ LZ[mU YLKLÄUPLUKV H PU[LYUL[  UV Ana y Mía”
como una red de redes de computadoras, sino
como una red de redes humanas mediadas por El blog se encuentra en dominio de www.blogspot.
computadoras. Detrás de las redes digitales hay com. Los colores del blog predominantes son
seres humanos, pero no aislados y únicamente morados y negros. El slogan es: “Porque la comida
conectados a otros mediante las máquinas, sino es como el arte… sólo existe para mirarla...”
estructurados en redes de comunicación, lo que
hace que al conectarse lo estén haciendo no sólo En el home del blog se advierte que se trata de
como individuos sino también como integrantes de un blog Pro-Ana y Pro-Mía, se señala que no se
diversos agrupamientos humanos con sus propias responsabiliza por los comentarios que se emiten
identidades, con sus propios sistemas cognitivos y añade que si el contenido del blog molesta a
y valorales. (Castells, 1997 y 2003. Yus, 2001. alguien, que lo abandone, ya que no le interesa
Camacho, 2003 y Lara. 2004). En otras palabras, su opinión. También advierte que si la persona es
en la incorporeidad de las redes digitales tiene menor de 15 años se aleje, puesto que el blog no
cabida todo el peso de nuestra compleja realidad es para ella.
social multidimensional.
Después de esto viene la bienvenida a aquellas
Entramos así a la consideración de la producción WLYZVUHZX\LZLPKLU[PÄJHUJVTV¸(UHZ¹V¸4xHZ¹
social de sentido que se genera en un universo diciéndoles que en ese blog podrán intercambiar
relacional virtual como es el del blog, en el cual tips, dietas y hacer “carreras”.
circulan formas discursivas y de interacción Es a este punto que la blogger se presenta bajo el
ZPTI}SPJH X\L JVUÄN\YHU \UH ¸ZVJPHIPSPKHK 5PJRKL.VKKLZZ7YPUJLZZ`Q\Z[PÄJHX\LJYL}LS
virtual”, cobijada por la interconectividad y que blog porque en su país (el cual en primera instancia
contribuye a cambiar los modos predominantes no menciona) no hay muchas personas que
de producción social de sentido por la apropiación compartan, como ella lo denomina, ese “estilo de
cultural de formas distintas de representación, de vida”; espera encontrar amigos de Latinoamérica
expresión y de conocimiento. y otros países. Les recuerda a sus seguidores que
Aplicando este marco conceptual al blog: “Mis “nadie dijo nunca que fuera fácil ser una princesa”
amigas Ana y Mía”, tendremos que aceptar que nos
encontramos frente a una comunidad radicalizada A continuación la blogger presenta links de algunos
y excluyente, que comparte una identidad forjada blogs que visita como: Estoy poseída, Muriendo
en torno al fenómeno de la anorexia y la bulimia, por vivir, Sueños suicidas, entre otros.
considerados como los ideales únicos a alcanzar,
reduciendo así la multidimensionalidad de la vida Tiene 2923 seguidores2, pero está en continuo
humana a un sólo ámbito y a la exclusión de quien crecimiento.
no comparte sus metas. El blog tiene un contador de visitas que según lo
2 Dato obtenido el 10 de septiembre de 2010.

?=,5*<,5;965(*065(3*65,0** 33
La comunidad virtual de “mis amigas Ana
y la Mia” y la representación social
del culto al cuerpo

recuperado hasta el 10 de septiembre del 2010 pasa sin razón, no porque alguien lo desee.
tenía un total de visitas de 1, 319,417.
About Me: Muy parecida a la entrada de Im
En el mismo Home hay una sección a la que ella Back, cuenta de su vida, sus dietas, sus
denomina “Útiles”, en la cual se encuentra un “progresos”. Los post son desde el 21 de
“calculador de calorías quemadas”, un “calculador septiembre del 2007 hasta el 10 de junio del
de índice de masa corporal”, un escrito llamado 2009. Comenta acerca de sus cambios de
“léeme si tienes hambre”; es un texto que trata de ánimo, de su meta de llegar a 50 kg, de que
ayudar al usuario a no caer en la tentación de la tiene bulimia desde que tiene 13 años, que
comida, a menos que –ella dice– sea una cerda odia el color moreno de su piel y las estrías de
o un cerdito. Por ultimo aparece una tabla de su embarazo, que siempre que sale de paseo
calorías. toma mucha cerveza, de que puede ayunar
hasta 7 días, escribe un tipo de “chismógrafo”.
Después hay una sección de Entradas, en total Mide 1.65 m, le gusta vestir de negro, su sueño
40, que abarcan las temáticas o el menú que la es ser delgada y blanca, come una vez al día.
blogger oferta. Nos dimos a la tarea de englobarlas
` ZPZ[LTH[PaHYSHZ LU  JH[LNVYxHZ WHYH ÄULZ KL Brillante Weblog: Informa que su blog fue
análisis. nominado el 7 de junio del 2008, por la cantidad
de visitas recibidas.
% ¡*H[LNVYxH!+H[VZH\[VIPVNYmÄJVZ
En esta sección de entradas, la blogger escribe ¿Eres Wannabe? Léeme: Habla de las personas
sobre ella misma, su vida más allá de la red y que se meten a su blog y quieren compartir el
sus méritos virtuales. Las entradas son: mismo “estilo de vida” , de todo lo que sufren
I´m Back: En esta entrada pone a sus lectores como tener siempre frio, tener los dientes
al tanto de su vida, como el hecho de que está amarillos, mareos constantes, tener mal aliento
a punto de terminar su carrera en la universidad y padecer taquicardias entre otras cosas.
y el tiempo que le absorbe su hijo de tres
años. Tiene 22 años, es de Venezuela, tiene L-Carnitina: En esta entrada pregunta a sus
cálculos en la vesícula biliar, menciona que seguidores si tienen alguna experiencia con
pronto se casará, trata de hacer una comida este medicamento ya que ha empezado a
de 500 calorías al día, consume Sibutramina, consumirlo y quiere saber acerca de sus
siente taquicardia, fuma aproximadamente 20 resultados y efectos secundarios.
cigarros al día. La última actualización de esta
entrada es el 17 de marzo del 2010. Nuestra Comunidad: Una entrada para que
Advertencia: Se dirige a las personas que se sus seguidores dejen sus correos electrónicos
meten en su blog preguntándole como bajar de y puedan estar comunicados.
peso, a lo que ella responde simplemente: No % 2ª. Categoría: Tips para”matar” el hambre y
JVTHZ(ÄYTHHKLTmZX\LZLY(UHV4xHZ}SV para que no descubran tu secreto

?=,5*<,5;965(*065(3*65,0** 34
La comunidad virtual de “mis amigas Ana
y la Mia” y la representación social
del culto al cuerpo

En esta sección de entradas la Blogger ofrece al perro o al gato, tomar mucha agua para
a sus seguidores da tips que a ella le funcionan vomitar más fácil, vomitar después de comer
lo más rápido posible, tomar algo de menta
Ansiedad: En esta entrada describe la manera para refrescar la garganta después de vomitar,
en que ella combate la ansiedad como mascar si hay mucha gente en la casa y no se puede ir
mucho chicle sin azúcar, tomar mucha agua, al baño a vomitar tener un envase en el cuarto
alrededor de 6 litros, todo esto para evitar y poner música en volumen alto para vomitar y
comer. en la noche vaciar el envase en el excusado y
acostumbrar a la familia a que te gusta comer
Café con Leche: De cómo un vaso grande de en tu cuarto.
café con leche por la mañana evita que le dé
hambre en todo el día. % ¡ *H[LNVYxH! .HSLYxH MV[VNYmÄJH KL SVZ
“íconos” a seguir
Super Tip: Escribe acerca de sus dieta de 500 En esta sección la Blogger manipula las
calorías que consiste en tomar un jugo de limón aspiraciones de los usuarios a través de la
sin azúcar, 1 rebanada de jamón, 1 de queso, 1 imagen:
galleta integral y tomar mucha agua todo el día;
HSÄUHSKLSKxHLZJYPILLUZ\KPHYPVSVMLSPaX\LSH Antes y Después de las Famosas: Colocó fotos
hace comer tan poco. de la cantante Anahí, Lindsay Lohan, Hillary
Duff y Nicole Richie; de su pérdida de peso.
¿Tienes paciencia?: Sugiere que cuando te
den ganas de comer sólo tienes que esperar, Avatars: Colocó imágenes para que las usen
tener paciencia y cuando menos lo pienses el JVTV PKLU[PÄJHJP}U LU Z\Z TLZZLUNLYZ [HSLZ
hambre se habrá ido. como logos de princesas, labios cosidos con
hilo y muñecas delgadas.
Tips de Ana: Menciona tips como escribir
un diario, tomar antiácidos para calmar el Boys Thinspo: Colocó fotos de actores y
estomago, aprender a comer sin azúcar, modelos muy delgados.
dormir bien, comer mucho hielo, no purgarse
muy seguido, no decirle a nadie que se es Ana
o Mía, cada vez que bajen de peso premiarse Participantes de la carrera: En esta entrada
comprándose un accesorio o ropa, usar ropa vienen fotos de personas que quieren bajar de
apretada en casa para que se percaten de peso, en la mayoría de las fotos no se aprecia
lo gordas que son, comer desnuda frente al su rostro y vienen datos como nick, edad,
espejo y evitar salidas sociales para no ir a peso actual, peso meta y el peso que bajaron
comer. durante la “carrera”.
Tips de Mía: Menciona tips como masticar Progreso de Nicole Richie: Una entrada
bien la comida hasta que se disuelva y dársela dedicada a la evolución en el cuerpo de esta

?=,5*<,5;965(*065(3*65,0** 35
La comunidad virtual de “mis amigas Ana
y la Mia” y la representación social
del culto al cuerpo

artista desde su apariencia con unos “kilitos de


más” hasta la condición física de “estar en los Ejercicios: En esta entrada pone ejercicios
huesos”. físicos para diversas partes del cuerpo como
brazos, piernas, glúteos y abdomen.
Thinspo Inversa: Colocó fotos de personas
que tienen obesidad mórbida y advierte a sus Flacidez: Acerca de las causas y la prevención
seguidores que si siguen comiendo se pondrán KLSHÅHJPKLa
obesos.
¿Frío quema calorías?: Entrada acerca de que
Thinspiration: Fotos de actrices y modelos a las el frío hace que el cuerpo pierda calorías es un
que hay que admirar y tratar de ser como ellas. mito.

% 4ª. Categoría: Dietas, productos y prácticas Orlistat- Xenical: Entrada de cómo esta droga
para bajar de peso ayuda a la pérdida de peso, sin adicción ni
La información que la Blogger proporciona está rebote, todo esto con una dieta apropiada.
tomada de diversos sitios de Internet.
¿Por qué no ser Ana?: Información del
Anticonceptivos Orales: Información sobre los surgimiento, síntomas, preguntas para saber si
efectos secundarios de los anticonceptivos se padece el trastorno y las consecuencias.
orales, como puede ser el aumento de peso.
¿Por qué no ser Mía?: En esta entrada sólo
Ayuno: Información sobre los tipos de ayuno y informa de las consecuencias del padecimiento.
en qué consiste cada uno.
Productos Light: Acerca del consumo de estos
Celulitis: Entrada acerca de lo que es la celulitis productos que según la entrada sólo tienen 30%
y consejos para combatirla. menos de grasa que los productos normales y
en otros casos tienen el mismo porcentaje.
Dieta del Ayuno Parcial: Una dieta rigurosa de 7
KxHZ`Z\ZILULÄJPVZ Sibutramina: Información acerca de esta droga
anteriormente usada como antidepresivo y
Dietas: Diversas dietas basadas en líquidos, ahora como tratamiento para bajar de peso, ya
tomate, toronja, manzana, sopa, atún. La del que sirve para sentirse saciado, gastar calorías
Dr. Atkins, la de Montignac, la del ayuno de y perder peso.
jugo y caldo, la anti-fracaso, la del Buda, la del % 5ª. Categoría: Documentos de
semi-ayuno. entretenimiento

?=,5*<,5;965(*065(3*65,0** 36
La comunidad virtual de “mis amigas Ana
y la Mia” y la representación social
del culto al cuerpo

Escrito por un Hombre: Es un documento que más, se establece un diálogo entre usuarios sin
habla de los puntos de vista de los hombres hacerse ya necesaria la guía de la blogger. El blog
sobre las mujeres. Todo el texto gira alrededor funciona como una verdadera red, pues como ya
de la “verdadera” belleza de una mujer. dijimos tiene 1, 319,417 visitas, sigue captando
nuevos adeptos que se ocupan de intercambiarse
Horóscopo: Todas sus predicciones y información, de compartir sentimientos de
YLJVTLUKHJPVULZ ZL YLÄLYLU H SH WtYKPKH KL frustración, de soledad, de auto-denigración y
peso. de búsqueda de aliento para alcanzar las metas
propuestas.
Pecado Capital: El documento es acerca de la Base de datos del blog “mis amigas Ana y Mía”
gula. Después de haber analizado la comunidad
virtual de Ana y Mía decidimos hacer un conteo
Pesos según Ana: El documento es una tabla para conocer a los usuarios que visitan este
que contiene par+ametros extremos sobre la blog.
relación altura-peso. Ejemplo: si mides 1.60m La muestra está compuesta por 63 usuarios.
debes pesar 44 kg. Las categorías de nuestro registro están
divididas en cuatro:
Receta de Ana: Documento que simula una  Género
receta de cocina en donde se deben mezclar  Edad
sentimientos y actitudes como baja autoestima,  <IPJHJP}UNLVNYmÄJH
culpa, fuerza, rabia, lagrimas como una poción  Ocupación
mental que te debe acompañar en el camino Los resultados obtenidos los presentamos en
OHJPHSHW\YPÄJHJP}U SHZZPN\PLU[LZNYmÄJHZ!
GÉNERO  DE  LOS  USUARIOS
Versos: En esta entrada hay poemas, versos y
canciones centrados en la anorexia y la bulimia. 

0XMHU
La dinámica autogestiva del blog, más +RPEUH

allá de la blogger


El seguimiento del blog, nos lleva a constatar


que la presencia de la blogger no es continua.
De hecho, hay entradas a donde deja de acudir
por varios meses. Sin embargo, la semilla que Mujeres Hombres   Total  
ella ha sembrado, tiene ya vida propia, puesto 56 7 63
que sus seguidores, alimentan constantemente
con comments cada una de las entradas, es

?=,5*<,5;965(*065(3*65,0** 37
La comunidad virtual de “mis amigas Ana
y la Mia” y la representación social
del culto al cuerpo

OC UP AC IÓN  D E  L OS  U S UAR IOS 23   1


No  es pec ific a
21   4
2 %2 % 2 %
2%
A ux iliar  de  E nfermería

E s c ritora 20   4
E s tudiante  
29%
19   6
F otográfa
Médic o  Internis ta 18 9
59 %

Modelo  y  E s tudiante 17 4
2% V eterinaria
2%
16 1
15 1

No.  de   Total   63


Ocupación  
Usuarios
No   No.    de  
38 País
HVSHFL¿FD Usuarios
Auxiliar  de   Sin  país 20
1
enfermería Alemania   1
Escritora 1
Estudiante 19 Argentina 6
Fotógrafa 1 Chile 3
Médico  
1 Colombia   2
Internista
Modelo  y   España 14
1
Estudiante EEUU 1
Veterinaria   1
Total     63 Macedonia 1
México 13
Paraguay 1
E D AD  D E  L OS  U S UAR IOS
2%
2% No  es pec ifc a  
Uruguay 1
7% 32  años
26  años Total 63
15%
24  años
46% 23  años
21  años
19  años
18  años
UB IC AC IÓN  G E OG R ÁF IC A S in  P aís
10% 17  años 2% 2%
A lemania
16  años
21% A rgentina
7% 15  años 31%
2% 5% 2%
2% C hile
C olombia
2% E s paña

Edad NO.  de   Mac edonia

2% Méx ic o
(en  años) usuarios
No   22% 10%
P araguay
28 5% Uruguay
HVSHFL¿FD 3%

32   1
26   1
24     3 La construcción de la identidad utópica de las
princesas
?=,5*<,5;965(*065(3*65,0** 38
La comunidad virtual de “mis amigas Ana
y la Mia” y la representación social
del culto al cuerpo

En la segunda etapa de nuestra investigación A manera de comunidad mesiánica, los usuarios


[YH[HTVZ KL LUJVU[YHY SH ZPNUPÄJHJP}U X\L WHYH se sienten elegidos, diferentes a los demás, pues
la blogger y los usuarios tiene el intercambio de creen que Ana “la diosa que te escoge y te
mensajes sobre ese modo de vida que siguen y permite ser perfecta, te hace darte cuenta que la
KLÄLUKLUH[YH]tZKLSJ\HS]HUJVUZ[Y\`LUKV\UH comida sólo te destruye… ella está para ayudarte,
identidad grupal utópica. para hacerte una mejor persona, una que no tenga
necesidad de comer, eso te hará especial para
La temática central y obsesiva es la comida y su ella”. Por otro lado, Mía es la incondicional de
rechazo. En torno a ella se establece una lucha Ana. “Ella se convertirá en tu conciencia si decides
que sostienen los actores sociales involucrados. traicionar a Ana, hará que te arrodilles ante un
Las armas para vencerla no son sólo los paliativos excusado para arrojar toda la porquería que has
del hambre y los medicamentos, sino también la metido en tu estómago”.
construcción de personalidades complejas que se
aman y se odian, que se halagan y se autodenigran, El manejo de este discurso aberrante por parte
que reciben recompensas y se humillan y castigan. de la blogger y su aceptación por parte de los
Es la tensión entre la “princesa” y la “cerda”. usuarios lleva a la comunidad a una conciencia
colectiva que orienta su conducta: el recorrido de
Presidiendo la lucha de los usuarios están Ana y un camino ascético de privaciones en busca de la
4xH WLYZVUPÄJHJPVULZ KL SH HUVYL_PH ` SH I\SPTPH perfección de las princesas-diosas Ana y Mía, hasta
respectivamente. Para los usuarios, ellas tienen PKLU[PÄJHYZLJVULSSHZ+LOLJOVSVZTPLTIYVZKLS
vida propia, son perfectas y bellas, porque NY\WVZLH\[VKLÄULUJVTVWYPUJLZHZ`WYxUJPWLZ
son delgadas; es más, su preciosidad las hace Y, ¿qué pasa si alguno muere en el intento? Ellos
princesas y como tales son el ideal utópico a manejan un discurso de esperanza y trascendencia,
alcanzar. Además son “amigas” y por eso ayudan a ya que creen que cuando hayan pagado el precio
los adolescentes y jóvenes a persistir en su intento Z\ÄJPLU[LWHYHZLYKLSNHKVZ`T\LYHU¸SHZKPVZHZ
de alcanzar la delgadez extrema. los compensarán en la otra vida o en un nuevo
mundo con un cuerpo bello y delgado”.
Pero la metamorfosis no termina aquí, la comunidad
bloguera ha transformado a Ana y Mía en diosas, La representación social de culto al cuerpo y el
las ha convertido en íconos de veneración para blog “mis amigas Ana y Mía”
poder realmente gozar de sus favores, de un
apoyo sobrenatural que les acompañe y permita La teoría de las representaciones sociales
trascender por encima de los mortales comunes.
El ayuno, el hambre, las dietas se convierten en A la blogosfera llegamos con toda la carga
rituales, en prácticas de culto de una congregación de nuestro contexto social, por lo que nos
que se aísla cada vez más de la realidad, de las preguntamos: ¿Dónde se gesta la anorexia y la
reuniones sociales, de los amigos, de la familia, bulimia? ¿Cómo transita ese discurso cargado
para no caer en la tentación de la comida. de ideología y de apelaciones tiránicas desde

?=,5*<,5;965(*065(3*65,0** 39
La comunidad virtual de “mis amigas Ana
y la Mia” y la representación social
del culto al cuerpo

nuestra realidad física hasta el universo virtual, y De acuerdo con este postulado, las prácticas
cuáles son los lazos que unen ambos universos sociales obedecen a una determinada visión
y que son capaces de tejer la trama y el drama del mundo, a un pensamiento social que se
de los desórdenes alimenticios en adolescentes y ha ido construyendo comunitariamente en un
jóvenes? determinado contexto cultural, y que lleva a otorgar
Existe una teoría que procede de la psicología H KPJOHZ WYmJ[PJHZ \U KL[LYTPUHKV ZPNUPÄJHKV
social pero que se ubica en el paradigma de la compartido por el grupo de pertenencia como algo
complejidad y tiene un carácter transdisciplinario incuestionable, algo establecido. Por ejemplo, en
en cuanto que cruza preocupaciones de las los documentos legales del siglo 19, tales como
diferentes disciplinas sociales. Se trata de la teoría Escrituras Públicas de traslación de dominio de
de las Representaciones sociales cuyo máximo propiedades entre particulares, cuando aparecía
exponente es Serge Moscovici. Será para nosotros una mujer como propietaria o como compradora,
la guía, el marco conceptual complejo que nos en el rubro donde debía indicarse su ocupación,
permitirá responder a las preguntas formuladas. se decía: “Dedicada a las labores propias de su
sexo”. Y, ¿cuáles eran las labores propias del sexo
La teoría de las representaciones sociales pretende femenino para la sociedad del siglo XIX? Era el
estudiar el pensamiento social enfatizando la trabajo del hogar. Estamos ante una construcción
naturaleza social del pensamiento y la importancia o representación social del género femenino en esa
del pensamiento en la vida social (Rodríguez, época, que restringía el rol de la mujer al hogar, es
2003: 56). decir, al cuidado del marido y de los hijos. Y por
supuesto, todo mundo lo aceptaba.
Para Moscovici:
Las representaciones sociales integran entonces
Una representación social es comprendida un sistema de ideas, principios, valores que son
como un sistema de valores, ideas y el resultado de los procesos de comunicación
prácticas con una doble función: primero intersubjetiva de acuerdo con los cuales la gente
establecer un orden que permita a los piensa y organiza su vida cotidiana, a la base se
individuos orientarse entre ellos mismos encuentra el conocimiento del sentido común.
y manejar su mundo material y social; Dicho conocimiento es social porque se elabora
y segundo, permitir que tenga lugar la socialmente e incluye contenidos cognitivos,
comunicación entre los miembros de una afectivos y simbólicos. (Umaña, 2002).
comunidad, proveyéndoles un código para Las representaciones sociales hacen referencia al
UVTIYHY ` JSHZPÄJHY SVZ KP]LYZVZ HZWLJ[VZ JVUVJPTPLU[V KLS ZLU[PKV JVT‚U ` LU KLÄUP[P]H
de su mundo y de su historia individual y dice Araya Umaña:
grupal. (citado textualmente por Duveen
2001, 12 Constituyen sistemas cognitivos en los
que es posible reconocer la presencia
de estereotipos, opiniones, creencias,

?=,5*<,5;965(*065(3*65,0** 40
La comunidad virtual de “mis amigas Ana
y la Mia” y la representación social
del culto al cuerpo

valores y normas que suelen tener una


orientación actitudinal positiva o negativa. Los individuos que se conducen en forma habitual
Se constituyen, a su vez, como sistemas y natural por esta representación temen a la
KL J}KPNVZ ]HSVYLZ S}NPJHZ JSHZPÄJH[VYPHZ gordura, quieren ser esbeltos y para lograrlo llevan
principios interpretativos y orientaciones a cabo prácticas exageradas, dietas extenuantes,
KL SHZ WYmJ[PJHZ X\L KLÄULU SH SSHTHKH consumo de productos que prometen siluetas
conciencia colectiva, la cual se rige con frágiles.
fuerza normativa en tanto instituye los Factores que propician la representación social del
límites y las posibilidades de la forma en culto al cuerpo
que las mujeres y los hombres actúan en el
mundo.(2002: 11). % La belleza hoy
Ser delgada es ser perfecta. Si se considera que
La representación social del culto al esa delgadez es la que vemos en las pasarelas de
Londres, París y Milán, caemos en la cuenta de
cuerpo
que no es una delgadez sana, sino una belleza que
La construcción social del cuerpo que se gesta en
hoy está marcada en los huesos. Son siluetas que
nuestro tiempo posee el molde de la delgadez, una
carecen de curvas femeninas. Chicas andróginas,
ZPS\L[HLZILS[HMYmNPSWLYVLZHLKPÄJHJP}U[HTIPtU
JVUJHYHKLUP|HZPN\LUKLZÄSHUKVWVYSHZWHZHYLSHZ
contiene otras características como ser alta, rubia,
con atuendos más pesados que sus cuerpos. Las
de piel blanca. Las chicas se sueñan a sí mismas
jóvenes normales caen en esta desvirtualización
como super modelos, patrones que son impuestos
de la beldad, su vida gira alrededor de esa imagen
por los mass media, la industria de la moda, la
y si a esto se le suma el bombardeo que se da por
publicidad. El miedo a la gordura, al rechazo social,
parte de una sociedad centrada en la belleza física,
las pautas en los hábitos alimenticios marcadas
la presión por alcanzar dicho prototipo se vuelve
por la cultura de lo light son sembrados en el
extenuante.
imaginario cultural de las mujeres. La sociedad ha
creado a sus princesas, mujeres perfectas que al
% La moda, talla 0
adherirse al molde prefabricado, como por arte de
La moda orilla a las chicas que sueñan con
magia alcanzan la felicidad, la aceptación social.
las grandes pasarelas a adelgazar para poder
entrar al mundo de la alta costura, A pesar de
Son estos clichés, los estereotipos aceptados por
las prohibiciones en países como Alemania de
la mayoría, la práctica de lo Light que contribuyen
contratar a modelos que su peso sea menor al
a crear la representación social del culto al cuerpo
saludable, las modelos en París siguen luciendo
con su propio sistema de valores. El cuerpo pasa
esqueléticas.
de ser un ente biológico a ser una construcción
socio-cultural, se convierte en un símbolo de la
No sólo en el mundo de la moda surgen estas
sociedad que lo construye.
exigencias, las porristas o bailarinas profesionales
se ven sometidas a rigurosas dietas, además de

?=,5*<,5;965(*065(3*65,0** 41
La comunidad virtual de “mis amigas Ana
y la Mia” y la representación social
del culto al cuerpo

soportar los insultos de su entrenador “no quiero parezca en pocos días al de la chica del comercial.
viejas guangas”, “si estás gorda no te van a poder Suplementos alimenticios disueltos en agua que
cargar”, “las vacas no vuelan”. eliminarán la grasa, aparatos de gimnasia que
TVKLSHYmUSHÄN\YHOHZ[HOHJLYSHWHYLJLYX\LM\L
% la publicidad de lo light tallada en mármol y los más peligrosos fármacos
La delgadez es igual a belleza, que prometen bajar de 3 a 5 kilos en una semana.
la belleza es igual a felicidad. Además de plantas medicinales como el codo de
Por lo tanto una persona delgada es igual a una fraile, prohibido en varios estados de México, pero
persona feliz. recomendado entre las chicas que se dedican a la
(Silogismo de la cultura Light) animación deportiva en las preparatorias.

La publicidad se ha encargado de que este % la delgadez como sinónimo de felicidad


silogismo acompañe al individuo desde que tiene El adelgazar está ya preinscrito en la memoria de
conciencia sobre sí mismo y su corporeidad. la sociedad, tanto que es uno de los propósitos
Aprovechando esa situación la mercadotecnia que todos hacemos cada año nuevo al sonar las
ha diseñado un nuevo rubro: los productos light, 12 campanadas, para después pasar al comedor
que van desde el pan, los yogures, los refrescos, y degustar los 24 platillos que están servidos en
las golosinas, las barritas de avena, la leche, los la mesa.
quesos; para después pasar a la comida prebiótica,
orgánica. En países donde hay altos índices La excursión de quien no encaja en el
de problemas de sobrepeso y obesidad estos patrón establecido
anuncios proliferan. Más que abrir el panorama
a una vida sana, comerciales como: “¿talla 9 de ¿Cómo se siente una persona con problemas
pantalón? No te preocupes, con pan reducido en de peso ante una situación similar? Una persona
NYHZH`[YPNVYLJ\WLYHYmZ[\ÄN\YH¹HYYHZ[YHHSHZ que está peleada con su físico no es feliz, y no
chicas a entrar en un ritmo de vida insano. porque ella no se acepte sino porque los otros, esa
sociedad que nos condena así lo ha dictaminado y
% Los artilugios para alcanzar el peso ideal lo seguirá haciendo. La chica feliz que se presenta
A la mercadotecnia no le basta controlar la comida, en los mass media es delgada, tiene novio, viste a
la ropa y el manejo de las relaciones afectivas en la moda, es “bonita”. En cambio la “gordita” de la
torno a la delgadez. Ofrece además un universo historia es la eterna enamorada no correspondida,
de productos que queman la grasa desde cremas no tiene amigos y siempre es humillada por la
anunciadas por una chica que de verdad no las “bonita” o en el mejor de los casos tratada con
necesita, porque de tener 62 centímetros de benevolencia por la chica bella, con lo que
cintura pasa a los 59, otra de talla mediana a chica demuestra que además de ser bonita tiene buenos
NYHJPHZ H \U NLS 3VZ MHTVZVZ Ä[ULZ[LW HOVYH sentimientos.
tienen presentación en zapato casual, tennis y
sandalia para que con sólo caminar tu cuerpo se

?=,5*<,5;965(*065(3*65,0** 42
La comunidad virtual de “mis amigas Ana
y la Mia” y la representación social
del culto al cuerpo

Jodelet (2000: 21) menciona un estudio realizado


Lo anterior es todo un caldo de cultivo en el cual la en Madagascar para analizar las representaciones
YLWYLZLU[HJP}UKLSJ\S[VHSJ\LYWVZL]LYLÅLQHKH sociales. En él se evidenciaron cinco tipos de
en las prácticas simbólicas y afectivas. Las chicas YLSHJPVULZ X\L KLÄUxHU SH JVU]P]LUJPH JVU SVZ
no encajan en el imaginario colectivo de su otros:
sociedad; universo creado por los mass media, la % Los parientes (ancianos, respeto)
mercadotecnia y la moda. De esta tensión nace % la comunidad (expresa solidaridad),
la negación del cuerpo y la búsqueda por cubrir % los camaradas (amistad, cooperación),
las exigencias de belleza y perfección establecidas % la culpabilidad (responsabilidad)
por el nuevo sistema de símbolos que pretenden % el castigo (en función de las acciones del
construir a la mujer hoy. Esto de igual manera crea sujeto, ya sean positivas o negativas).
fronteras simbólicas que van excluyendo a las
que no encajan en el patrón establecido. Dichos Dentro de la comunidad virtual de “Mis amigas Ana
procesos de exclusión se dan desde temprana y Mía” encontramos la aplicación de cuatro tipos
edad, cuando las niñas comienzan a tomar sus de relaciones:
formas femeninas y esto las avergüenza, ellas Comunidad. Representada por las relaciones
buscan esconderse de la mirada. Sienten que si discursivo-comunicativas de apoyo entre sus
no son delgadas nunca serán aceptadas. usuarios.
Camaradas. Los usuarios y la blogger.
La imagen soñada: Ana y Mía. Correlación entre La culpabilidad o responsabilidad. Es la promesa
la representación social del culto al cuerpo y el que hacen a las deidades Ana y Mía para alcanzar
universo del blog la delgadez.
El castigo. En muchas ocasiones se presenta al
Los consejos que se dan dentro del blog “Mis incumplir las metas propuestas, bajo la mirada
amigas Ana y Mía”, el intercambio de dietas, los sancionadora de las Diosas Ana y Mía.
medicamentos que se recomiendan, el cómo
deben de vestir, usar su tiempo y producir sus A manera de conclusión
YLSHJPVULZ WLYZVUHSLZ ZVU LS YLÅLQV KLS ZPZ[LTH
valoral de la sociedad actual que rinde culto al A lo largo de la investigación ha quedado
cuerpo. El manejo de dicho sistema simbólico les comprobado que los usuarios del blog hacen
proporciona una identidad colectiva, les da sentido una lectura de la realidad desde la óptica de la
de pertenencia, como se menciona en el libro representación social del culto al cuerpo y que dicha
*\HUKV JVTLY LZ \U PUÄLYUV KL ,ZWPKPV -YLPYt! lectura adquiere para ellos la fuerza de un precepto,
“Las chicas copian frases, fotos, mandamientos hasta llegar al punto en el cual los padecimientos
similares (…).Homogeneizan criterios para darse se convierten en amigas, las practicantes en
más fuerza y ser conscientes de pertenecer a una princesas y se va más allá todavía al concederles
comunidad. (2002: 211) un grado de divinidad a las enfermedades, que
dejan de ser Anorexia Nerviosa y Bulimia para ser

?=,5*<,5;965(*065(3*65,0** 43
La comunidad virtual de “mis amigas Ana
y la Mia” y la representación social
del culto al cuerpo

Ana y Mía, deidades veneradas en el templo virtual. Camacho, K. (2003). Internet. ¿Cómo vamos
:L OHISH KL \UH W\YPÄJHJP}U KLS HSTH ` ZL PU]P[H cambiando? San José de Costa Rica: Fundación
al desprecio de lo corpóreo- La comunidad ha Acceso.
ritualizado y “sacralizado” sus prácticas, dándoles Castells, M. 1997). “Flujos, redes e identidades:
un valor simbólico y de trascendencia. una teoría crítica de la sociedad informacional”. En
Esto nos habla de la fuerza manipuladora del M. Castells et alii, Nuevas perspectivas críticas en
discurso social del culto al cuerpo y de hasta educación. Barcelona: Paidós. 13-53.
dónde se puede llegar cuando se asume
radicalmente, Nos plantea también la necesidad __________ (2003). La galaxia internet. Barcelona:
de seguir estudiando las prácticas comunicativas Debolsillo
en el ciberespacio, de entender su complejidad,
sus formas discursivas y de interacción simbólica, __________ (2005) La era de la información:
el alcance de la hipertextualidad porque en la Economía, sociedad y cultura. Vol. i. México: Siglo
incorporeidad de las redes digitales tiene cabida XXI
todo el peso de nuestra compleja realidad social
multidimensional. Duveen, G. (2001), “Introduction: the power
of ideas“, en Moscovici, Serge, “Social
Un mayor conocimiento de la articulación entre representations. Exploration in social psychology”,
mundo social y mundo virtual nos llevará a Nueva York, New York University Press.
entender mejor la dinámica de las interacciones
sociales, en orden a avanzar en nuestra tarea ,ZWPKPV -  *\HUKV JVTLY LZ \U PUÄLYUV
TVKPÄJHKVYH`[YHUZMVYTHKVYHKLJPLY[HZWYmJ[PJHZ Santaluria: Ediciones Generales, España.
y representaciones sociales creadoras de una
subcultura de la muerte. -LYUmUKLa ( ,U O[[W!^^^TVUVNYHÄHZJVT
trabajos901/blogs-blogosfera-ciberespacio-
Bibliografía comunicacion-canal/ Consultado el 5 de mayo de
2010.
Asociación de Psiquiatría Americana (DSM IV).
(2009). Manual Diagnóstico y Estadístico de los Jodelet, D. (2000) “Representaciones sociales:
Desórdenes Mentales para los Trastornos de la contribución a un saber socio cultural sin
Alimentación. (DSM IV) fronteras”, En Develando la cultura. Estudios en
Representaciones Sociales. pp. 7-27 México:
Araya Umaña, S. (2002). “Las representaciones UNAM.
sociales: ejes teóricos para su discusión”, en
Cuaderno de Ciencias Sociales, n. 127, octubre, Lara Mireles, M.C. (2004). Las tecnologías de
Costa Rica: FLACSO. información y comunicación (TIC) y la producción
de sentido en las interacciones sociales. Tesis
WYLZLU[HKHLUVWJP}UHSNYHKVJPLU[xÄJVKL+VJ[VY
?=,5*<,5;965(*065(3*65,0** en Ciencias de la Comunicación Social, por la 44
La comunidad virtual de “mis amigas Ana
y la Mia” y la representación social
del culto al cuerpo

Universidad de la Habana.
SOBRE LOS AUTORES
Lara Mireles,M.C., Zavala, U. y Medina, G.
Dra. María Concepción Lara Mireles. Dra. Cien-
(2007). “La estructura comunicativa del blog”. En
cias de la Comunicación Social, U. de la Habana.
Memoria en extenso electrónica del VI Congreso
Miembro del SNI nivel I, (2006-2008) y de AMIC.
Internacional de la Unión Latina de Economía
Directora de la Región México ante FELAFACS
Política de la Información, la Comunicación y la
(2007-2009). Actualmente Presidenta del CO-
Cultura, ULEPP-ICC. “Innovaciones, Tecnología,
NEICC (2009-2012) y Profesora Investigadora de
Comunicación y Cambio social”. México, D.F. 19-
la ECC de la UASLP.
20 de noviembre.
Anahí Monserrat Hernández Rodríguez. Estudiante
de la Licenciatura en Ciencias de la Comunicación
Moreno, A. (2005). La decontrucción literaria de los de la ECC de la UASLP. Participante del proyecto
trastornos de la alimentación y la cirugía estética de investigación: “Los blogs y su incidencia en
en las novelas de Margaret Atwood y Fay Weldon”. SHYLJVUÄN\YHJP}UKLSJHYmJ[LYHIPLY[VKLSJVUVJP-
Universidad de Oviedo miento en la sociedad actual”, que forma parte del
programa de Prácticas de Campo de la ECC.
Orihuela, J.L. (2006). La revolución de los blogs. Martha Fabiola Juárez Rodríguez. Estudiante de
Madrid: La esfera de los libros. S.L. la Licenciatura en Ciencias de la Comunicación
de la ECC de la UASLP. Participante del proyecto
Rodríguez, T. (2003), El debate de las de investigación: “Los blogs y su incidencia en
representaciones sociales en la sicología social,. SHYLJVUÄN\YHJP}UKLSJHYmJ[LYHIPLY[VKLSJVUVJP-
Relaciones, 24/93, pp. 51-80. miento en la sociedad actual”, que forma parte del
programa de Prácticas de Campo de la ECC.
Rojas Orduña,O. et al. (2005). Blogs. La
conversación en Internet que está revolucionando
medios, empresas y ciudadanos. Madrid: ESIC
Editorial.

Yus, F.(2001). “Ciberpragmática. Entre la


compensación y el desconcierto”. Disponible en el
ARCHIVO del Observatorio para la Cibersociedad.
En http://cibersociedad.rediris.es/archivo//
articuñp.php?art=42.
http://morirjovenmitoinmortal.bligoo.com/content/
view/254291/Karen-Carpenter-Su-muerte.html.
Consultado el 12 de septiembre.

?=,5*<,5;965(*065(3*65,0** 45
Consolidación y construcción
del periodismo digital
Dra. Lizy Navarro Zamora
UNIVERSIDAD AUTÓNOMA DE SAN LUIS POTOSÍ

Resumen
El impacto de las Nuevas Tecnologías de la Información y Comunicación ha provocado la
construcción del lenguaje para la información periodística que se presenta a través de las redes
KPNP[HSLZ,ZT\`PTWVY[HU[LJSHYPÄJHYX\L[YHZLSH|VKL LULSJ\HSZLPUZ[HS}LSWYPTLYTLKPV
LUSHYLK`H[LULTVZJVU[LUPKVZLZ[HISLJPKVZ\USLUN\HQL`J}KPNVZLZWLJxÄJVZ(ZxJVTVSH
televisión y la radio tienen un lenguaje propio, los medios digitales ya lo construyeron.
Los primeros
 periodistas llegaron a la red Internet sin preparación, es necesario que escuelas y
MHJ\S[HKLZPUJS\`HULUZ\LZWHJPVZTH[LYPHZLZWLJxÄJHZWHYHSHJVUZ[Y\JJP}UWLYPVKxZ[PJHJVU
características muy relevantes y que los medios analógicos no tienen, dos de ellas: la interactivad
y la hipertextualidad.

El usuario del siglo XXI encuentra en Internet un océano de información, pero las empresas
deberán de ofrecerle contenidos netamente periodísticos y no disfrazados. Además, estamos
en un momento en que los espacios han entendido que los usuarios exigen otros elementos
ZPNUPÄJH[P]VZJVTVLZLSJVU[HJ[VHSHZYLKLZZVJPHSLZX\L`HOHUZPKVPUJVYWVYHKHZHSVZTLKPVZ
y espacios periodísticos.

En esta ponencia desarrollaré el proceso de consolidación del periodismo digital con un lenguaje
y una redacción propia. Con una disparidad entre los medios digitales consolidados y aquellos
que intentan serlo, visto desde el emisor, los contenidos y el receptor.

Palabras Clave: Periodismo digital, ciberlenguaje, interactividad, hipertextualidad

Antecedentes Red. En el siglo XX, con el mayor desarrollo de los


En más de tres lustros los medios periodísticos medios de comunicación, la prensa escrita sufrió
han vivido las transformaciones en su diseño, en tres momentos de crisis e impacto en su desarrollo,
el contenido, en el negocio y en la existencia del TVKPÄJmUKVZL ` YLHKHW[mUKVZL H SVZ U\L]VZ
propio periodista, desde las incipientes páginas contextos. En los años treinta con el nacimiento
en 1994 hasta el aprovechamiento de las redes de la radio, en la década de los cincuenta con la
sociales para llegar al público de la Generación llegada de la televisión y en 1994 con el desarrollo
de la web.
Consolidación y construcción del periodismo digital

El primer paso de lo que se llama digitalización de acuerdo al paradigma de las Nuevas Tecnologías
de la prensa fue el uso de equipos electrónicos de la Información y Comunicación, con aquéllos
JVU WYVNYHTHZ WHYH Q\Z[PÄJHY SHZ SxULHZ X\L LYHU que se concretan a imitar lo que presenta el medio
compuestas por linotipia. Al principio de los impreso y periodistas que no han entendido que
setenta la mayoría de los periódicos de circulación están frente a un espacio distinto.
nacional contaban con videoterminales donde los En 1994, los medios de comunicación inician con
periodistas escribían sus textos. un esquema de contenidos reducido. Los primeros
Fue a mediados de los ochenta cuando la ejemplos que encontramos eran páginas que
informatización invade los periódicos de manera contaban con unas cuantas notas publicadas en la
más completa. Aparecieron los sistemas integrados red. No había otros servicios que los mismos que
de producción, los costos disminuyeron por el usuario podía localizar en el medio impreso y
consecuencia y se redujo la mano de obra en la en otros era una reducida selección de notas. Los
composición y montaje de las páginas. recursos que la nueva retórica permitía eran poco
Los antecedentes electrónicos de los medios de explotados. De hecho en aquel año los medios de
comunicación en línea se remontan a la década comunicación en línea eran muy parecidos a las
de los setenta con el desarrollo del videotexto y el síntesis que se mandan a las embajadas de los
teletexto; después se presentó el periódico por países, se escogían las notas más importantes, el
MH_LU*+9VTLUKPZX\L[LÅL_PISL`SHPUZLYJP}U resto no se presentaban.
en las primeras redes de información. Estos Poco a poco los medios fueron incorporando otros
antecedentes fueron los que construyeron lo que contenidos que les permitían una mayor interacción
en 1994 se instaló como un medio directamente con el usuario y sobre todo la explotación de los
en la red Internet. recursos en la red. Para ello también requirieron
El medio estadounidense San José Mercury News de más personal, cada contenido que agregaban
fue el primero que se instaló en ese año. Hoy los H Z\Z WmNPUHZ ZPNUPÄJHIH SH ULJLZPKHK KL TmZ
I\ZJHKVYLZ  L PU]LZ[PNHKVYLZ UV \UPÄJHTVZ LS apoyo. Los elementos principales que caracterizan
criterio de cuántos medios existen, las mismas la construcción del ciberperiodismo son los
condiciones y naturaleza de la red nos han dejado siguientes:
desarmados a los investigadores y a las instituciones
de regulación para tener una información precisa. LECTURA Y CONSULTA NO SECUENCIAL:
La no secuencialidad de la lectura se da a través
del uso del hipertexto, del hipermedia, la lectura
Elementos que caracterizan el ciberperiodismo por niveles y aún la contabilización de los minutos
El manejo de la información y cómo se presenta X\LHS\Z\HYPVSLSSL]HKLJVKPÄJHYJHKHPUMVYTHJP}U
es la parte medular del deber que tienen las La hipertextualidad y el recurso hipermedia son el
empresas periodísticas para cumplir con el enlace del medio con los procesos mentales y el
derecho a la información de los ciudadanos y de los WLYÄSKLS\Z\HYPV
ciberciudadanos. En este aspecto existe un rezago Los niveles de lectura permiten al consumidor
considerable entre quienes presentan contenidos de la información la posibilidad de seleccionar en

?=,5*<,5;965(*065(3*65,0** 47
Consolidación y construcción del periodismo digital

qué momento y en qué tiempo hacer la consulta a es el dominio de una informática básica y del
la información periodística. El elemento hipermedia idioma inglés. Las personas que no dominan esta
KHHSJVU[LUPKV\UHYLJVUÄN\YHJP}UKL[L_[V]PKLV lengua están muy alejadas de lograr informarse
y audio. Existen por tanto dos tipos de estructuras con imparcialidad y encontrarán en su propio
(Cuadro 1) en el discurso del ciberperiodismo. idioma una limitación.
MUNDIALIZACIÓN: Cuando inició Internet
Cuadro 1. Estructuras hipertextuales se habló mucho de la mundialización como la
característica clave y de gran riqueza de este
medio. Muy pocos, sólo unos cuantos lo han
logrado. Aisladamente los miles de medios que
en la red viajan tiene usuarios de diferentes partes
Los enlaces permiten viajar a varios caminos KLS T\UKV Z\ ISVX\L ZPNUPÄJH[P]V ZL LUJ\LU[YH
dependiendo del aspecto sociocultural de cada NLULYHSTLU[L LU LS mYLH NLVNYmÄJH H SH X\L
individuo, pero pocos son los medios que explotan pertenecen.
esta retórica, la gran mayoría presenta al usuario
La mundialización tiene como esencia
los contenidos en un solo nivel.
la organización de las cibercomunidades y la
comunicación más estrecha y directa entre los
Figura 1. La hipertextualidad del contenido
habitantes del mundo. La comunidad mundial se
periodístico.
torna local. Medios como el Washingtonpost.com,
,S 4\UKVLZ LU[YL V[YVZ OHU SVNYHKV JVUÄN\YHY
CONVERGENCIA MULTIMEDIA: El recurso
una comunidad de usuarios que se informan
multimedia en los primeros años era mínimo. En
periodísticamente en línea a través de ellos.
la actualidad algunos han logrado conformar un
INTERACTIVIDAD: En sus inicios la
nuevo lenguaje en el cual el texto, audio y video
interactividad se presentó como la máxima
convergen. Este año quienes contamos con líneas
potencialidad, de hecho es la gran riqueza de la red
YmWPKHZ KL JVUL_P}U ` JVU \U ZPZ[LTH KL ÄIYH
Internet con una real comunicación entre el emisor
óptica logramos apreciar este lenguaje. Pero la
y el receptor. Para lograr la interactividad deseada
disparidad tecnológica contribuye a la división entre
las empresas deben contratar personal que dé
los habitantes informados y los subinformados
respuesta a las dudas, comentarios e inquietudes
por cuestiones tecnológicas, económicas y de
de los usuarios.
conocimiento.
Al periodista le falta tiempo para completar
Tecnológicas porque no tienen acceso a la
el ciclo de la comunicación y pocas empresas
YLK KL ÄIYH }W[PJH ZPN\LU [YHIHQHUKV JVU JHISL
han invertido en contratar a trabajadores que
coaxial y carecen de equipos de cómputo de
desempeñen su labor en actividades que surgieron
punta. El aspecto económico limita el acceso al
como consecuencias de las Nuevas Tecnologías.
conocimiento y a la información periodística de
En los primeros medios la interactividad
los ciudadanos que carecen de recursos para
se dio a través de los foros de discusión y de
conectarse. En el conocimiento interviene lo que
encuestas. Hoy el punto máximo se presenta

?=,5*<,5;965(*065(3*65,0** 48
Consolidación y construcción del periodismo digital

cuando el medio de comunicación permite al tan completa que se encargue de reorganizar toda
usuario la reorganización y jerarquización de los la portada y los enlaces correspondientes. Para
mensajes periodísticos. estos medios es más accesible cambiar la portada
A través de la investigación realizada se cada 24 horas y sólo poner un recuadro.
comprobó que efectivamente la interactividad en En un tercer nivel tenemos los medios
la mayoría de los medios de comunicación en que actualizan su información cada día, son los
Internet es nula y tardada. Las respuestas de los más en el mundo. Los usuarios que se atreven a
correos electrónicos llegaban, si sucedía esto, dos JVUZ\S[HYSHZ JVYYLZWVUKLU H SH aVUH NLVNYmÄJH
semanas después de su envío. Para conocer esta y lo hacen para ahorrarse el pago del medio
interactividad se mandó un comentario a través del impreso. Su audiencia es reducida y la página es
cual comprobamos que no existe comunicación sólo una imagen porque hasta el momento no han
entre el periodista y el receptor. explotado los recursos de las nuevas tecnologías
Una de las razones de esta carencia es que para de la información. Las dos grandes razones de ello
tener interactividad en un medio se necesita es que la sala de redacción del medio en línea
de varios factores, entre ellos que el mismo está integrada por un mínimo de personas, debido
periodista lo entienda y lo sea. Esto ha traído como a que los empresarios no han querido invertir en
consecuencia la presencia de un círculo vicioso este nuevo medio porque aún no encuentran el
que no se ha transformado en virtuoso. negocio.
En la interactividad los medios permiten el PERSONALIZACIÓN: La personalización
comentario del usuario y lo ciertos es que muchos se presenta como el elemento central de las
periodistas han escuchado lo que verdaderamente riquezas del mensaje periodístico que se transmite
dicen de ellos y no lo que las empresas protectoras a través de la red. Son pocos los medios que han
quisieran encontrado las cibercomunidades como clientes
LA ACTUALIZACIÓN: Hasta el momento para vender un producto especializado. Los
la actualización de la información se presenta softwares para ello no han sido explotados, ni se
en tres posibilidades. La primera, que es la más ha encontrado la mercadotecnia, ni la estructura
importante y que cumple con el paradigma de del negocio necesaria para que se piense en un
las Nuevas Tecnologías de la Información, es la medio diseñado a la medida del usuario.
actualización de los contenidos informativos, no Además, la potencialidad de la
como una sección de Últimas Noticias, sino como personalización radica en la posibilidad de ofrecer
una reorganización de la portada o home page. al usuario el contexto de la información, lo que antes
En esta portada los medios de comunicación era privilegio del periodista. El usuario elige cómo
digitales reorganizan la información según los se informa, de qué se informa; la organización del
principios periodísticos de importancia, veracidad, medio se puede construir y reconstruir de acuerdo
temporalidad y cercanía. Otros medios presentan a los criterios del lector.
una columna de Últimas Noticias en un recuadro CONFIABILIDAD: En esta década son
donde se redactan encabezados de alrededor muy pocas las páginas que han logrado tener un
de 10 informaciones. Estas son páginas menos prestigio, desde su nacimiento en la Red. Sólo los
desarrolladas que no tienen una sala de redacción
?=,5*<,5;965(*065(3*65,0** 49
Consolidación y construcción del periodismo digital

medios de marca cuentan con la imagen para su La aparición de Internet y de las Nuevas Tecnologías
credibilidad (los que ya existían y eran respetados de la Información se ha presentado como una
por el ejercicio del periodismo). Quienes somos realidad que ha provocado la reubicación de las
amantes de la precisión en la información teorías periodísticas y de la comunicación. Estos
periodística los weblogs no han sustituido lo que cambios han iniciado en la vida práctica, en la
el periodismo serio y experto hace en todo esto situación real del quehacer periodístico para
y son los nombres de marca quienes obtienen la después construir el propio código de esta teoría,
JVUÄHUaHKLS\Z\HYPV al igual como sucedio con la aparición de la radio
y la televisión.
Las etapas de desarrollo de los medios son las “... los géneros periodísticos son instrumentos
siguientes: lingüísticos para la consecución de dos grandes
objetivos sociales de la información de actualidad:
Tercera etapa el relato –story- de los acontecimientos de interés
Los contenidos son preparadosex profeso colectivo, y el juicio valorativo –comment- que
para tener únicamente existencia en la web tales acontecimientos provocan en el periodista.”
(Martínez Albertos, Curso General)
Los géneros periodísticos son el resultado
Segunda etapa
de una lenta elaboración histórica (Cuadro 2) que
Los contenidos y servicios comienzan a ser
se encuentra íntimamente ligada a la evolución
originales y adaptados para la red
del mismo concepto de lo que se entiende por
periodismo.
3H JSHZPÄJHJP}U ImZPJH KL SVZ NtULYVZ
periodísticos tiene un principio deontológico
Primera etapa
que es LOS HECHOS SON SAGRADOS Y LOS
Webs con características eminentemente
COMENTARIOS SON LIBRES. Dichos géneros
textuales
han tenido una evolución que es paralela a la
transformación histórica de la humanidad.
:,9=0*06: ,?;9(:! 7VY LQLTWSV JVUÄN\YHY SHZ
noticias más importantes en la propia página, las
bases datos, la profundización en la información.
El servicio a blogs respaldados por la comunidad
periodística, pero más informales. Algunas otras
son las correcciones que el usuario puede hacer
de algún contenido.

Géneros y prácticas discursivas en el


ciberperiodismo

?=,5*<,5;965(*065(3*65,0** 50
Consolidación y construcción del periodismo digital

Cuadro 2: Evolución de los géneros periodísticos.

CLASIFICACIÓN DESIGNACIÓN PERIODO CARACTERÍSTICAS


Primera  Etapa 3HULRGLVPR,GHROyJLFR +DVWDHO¿QGHOD % 3HULRGLVPR
3ULPHUD*XHUUD GRFWULQDO\
0XQGLDO PRUDOL]DGRU
% ,GHDVSROtWLFDV\
UHOLJLRVDV
% 3RFDV
LQIRUPDFLRQHV
\PXFKRV
FRPHQWDULRV

Segunda  Etapa 3HULRGLVPR,QIRUPDWLYR $SDUHFHDOUHGHGRU 6HDSR\D


GHFRPR IXQGDPHQWDOPHQWHHQ
IHQyPHQR\FRH[LVWH ODQDUUDFLyQRUHODWRGH
FRQHOSHULRGLVPRGH KHFKRV
FRUWHLGHROyJLFR
$SDUWLUGH
ODSUHQVDGH
LQIRUPDFLyQVH
LPSRQHHQWRGRHO
PXQGRRFFLGHQWDO
Tercera  Etapa 3HULRGLVPRGH 'HVSXpVGHODxRGH 8WLOL]DDPERVJpQHURV
([SOLFDFLyQ  EiVLFRV
(OOHFWRUHQFXHQWUDORV
MXLFLRVGHYDORUVLWXDGRVGH
IRUPDLQPHGLDWDDOODGRGH
ODQDUUDFLyQREMHWLYDGHORV
KHFKRV
Cuarta  Etapa 3HULRGLVPRGLJLWDO &RQODDSDULFLyQ % 6HIXQGHQODV
GH,QWHUQHW\GH KLVWRULDV\ORV
OD&RQYHUJHQFLD FRPHQWDULRV
7HFQROyJLFD % /RVJpQHURV
SDUHFHQ
GHVDSDUHFHUHQVX
FODVL¿FDFLyQSXUD

Podemos hablar entonces también de tres áreas básicas de cambio en la redacción periodística:
Los géneros periodísticos, los títulos, la presentación. En el inicio se mantenía la clara división de los
géneros periodísticos entre el relato y los comentarios. Una razón lógica para ello es que el medio de

?=,5*<,5;965(*065(3*65,0** 51
Consolidación y construcción del periodismo digital

comunicación se presentaba con la misma hechos. Pero ésta, que pareciera una desventaja,
información que aparecían en el medio tradicional, es al contrario una ventaja para el medio. En los
sea radio, prensa o televisión. años 20 la radio le ganó la batalla de rapidez a la
Los medios on line recurren a los prensa, en los cincuenta la televisión superó a la
conceptos claves de la redacción periodística prensa y a la radio, en la actualidad Internet tiene
de selección, valoración, interpretación, opinión todas las ventajas de los medios analógicos.
y contextualización para comunicarla de manera
correcta al lector. A los estilos y a los géneros. Aunque durante el día se actualiza la información
y se reorganiza en lo que conocemos como home
Una de las tareas más importantes para page, es en la tarde-noche cuando los encargados
el periodista on line es la jerarquización de la de subir los trabajos actualizan la totalidad de las
información. Es necesario considerar que si páginas. Hay quienes “suben” la información y
Internet es una red abierta a la que accede todo SH YLVYNHUPaHU WYLZLU[HUKV SHZ TVKPÄJHJPVULZ
usuario que así lo desee de cualquier parte del en el diseño y ubicación de los elementos de la
mundo, el orden del contenido y la selección de pantalla cada 20 minutos, según se desarrollen los
estos mismos será con una visión global, pero acontecimientos en el ámbito económico, político,
periodística. Además, la difusión de las noticias social, etc. No tenemos una noticia más importante
será determinada por la interactividad que permite para todo el día, la ubicación y la aparición de ellas
el nuevo medio. cambia según se presenten las informaciones.

NOTICIA Es precisamente aquí (cuadro 3) donde el género


En el caso de la Noticia, el medio de comunicación en su redacción sufre ciertas variables. Una de las
no sólo se ha limitado a dar y presentar la líneas que tradicionalmente se siguen es la ya tan
información en una pirámide invertida, si no que famosa y no querida para los alumnos Pirámide
ha tendido a contextualizarla de una manera muy Invertida. En los medios de comunicación on
amplia. Los jefes de redacción de los medios de line, sobre todo en las noticias que actualizan la
comunicación on line saben que al usuario de la información no se aplica el principio de la pirámide
red, una vez que escoge la noticia, necesita saber invertida. Es a lo largo de una serie de párrafos, en
más de ella. Esto no quiere decir que la noticia promedio cuatro y por niveles de profundización,
se convierta en un reportaje. Es la misma noticia donde se dan a conocer los elementos más
en sus elementos básicos, acompañada de sus importantes y trascendentales de la información.
circunstancias explicativas. El lead presenta lo más importante, pero no se
da respuesta a las cinco preguntas básicas. En
En un medio de comunicación on line este género cuestión de redacción periodística los párrafos no
periodístico sufre las mismas limitantes de tiempo son equilibrados, es una o dos frases largas las
y análisis que tiene en la radio y en la televisión que los integran.
debido a que en estos medios la presentación de
la noticia debe ser de manera simultánea a los

?=,5*<,5;965(*065(3*65,0** 52
Consolidación y construcción del periodismo digital

enseñamos los géneros periodísticos según los


medios de comunicación, eso quiere decir que para
cada medio tenemos un lenguaje y una forma de
Cuadro 3. Evoluación de la pirámite. Evolución de presentar el género. Sin embargo, es aquí donde
la piramide invertida radica la diferencia, se conceptualiza el género
multimedio como una unidad redaccional donde
el audio, el video, la infografía, deben integrarse
perfectamente en el texto.

En un medio tradicional cerca del 90% de la


información que investigamos no se publica. Con
las posibilidades que ofrece Internet en cuanto a
la capacidad de transmisión ninguna información,
que el periodista desee publicar, se queda sin
difundir. Por supuesto que esto irá por niveles de
profundización que desee el usuario.
Además, al lograr la personalización de estos
Tal vez en la actualidad los medios de comunicación
nuevos medios, cada usuario seleccionará la
on line estén preparados para soportar la necesidad
información que quiere conocer. La capacidad
de información en casos de crisis y caos, ejemplo
de transmisión de datos por medio de las redes
de esto lo encontramos desde los atentados en
telemáticas permite que el usuario de este medio
Nueva York hasta los sufridos en Inglaterra y el
pueda profundizar en los temas que a él le interesan.
Medio Oriente.

GÉNEROS DE OPINIÓN
ENTREVISTA: Los usuarios realizan las entrevistas
Podemos hablar de que en este nuevo medio y que
en tiempo real, con ello el ciberciudadano cobra el
gracias a la interactividad, el lector se convierte en
papel de periodista porque es él quien pregunta.
un articulista o columnisa más. Los medios on line
También aparecen las entrevistas tradicionales,
demandan determinadas opiniones, por lo que el
sin embargo la diferencia es la construcción
usuario envía su información al servidor del diario,
hipermedia, hipertextual y la interactividad.
en donde suele estar instalado un programa para
que procese los comentarios.
CRÓNICA Y REPORTAJE
De hecho se habla precisamente del éxito de la red
En estos géneros podemos hablar de que la
por las amplias posibilidades que ofrece el medio
estructura y el fondo permanecen. La diferencia
para comunicarse con él. La retroalimentación es
radica en el recurso multimedia que tienen en cada
casi inmediata. Todo depende del servidor que se
una de las secciones. Se convierten en géneros
tenga para que la opinión, información o respuesta
multimedia. Si nos ubicamos en las Escuelas de
llegue a quien nosotros deseemos. Se presenta
Ciencias de la Comunicación reconocemos que
una bidirección donde el emisor y el receptor se
encuentran en el mismo plano.
?=,5*<,5;965(*065(3*65,0** 53
Consolidación y construcción del periodismo digital

el mismo medio de comunicación continua


Los canales se multiplican y los emisores y presentándola diferida.
receptores se confunden e intercambian sus Los géneros periodísticos se han vuelto
papeles. La característica clave de Internet, la géneros multimedia, no es recomendable que en
comunicación individual y en grupo: de uno la red los medios de comunicación on line sean
individualmente hacia uno, de uno hacia muchos una versión electrónica de los tradicionales. Son
y viceversa. Es posible conocer con bastante la integración de los tres medios masivos de
exactitud cuáles son los periodistas favoritos del comunicación, radio, televisión y prensa escrita,
lector. Por ejemplo la única posibilidad que tiene el con la ventaja de cada uno. Lo que hoy conocemos
periódico impreso para conocer la opinión de los como el periódico en línea se está convirtiendo
lectores son las cartas que se reciben y cuando en un medio de comunicación que reúne la
el medio de comunicación audiovisual necesita profundidad de la prensa escrita, la simultaneidad
conocer la opinión de los receptores se encarga de la radio y la imagen de la televisión.
una encuesta.
Es la convergencia del texto, la voz, la música, la
Con los temas de debate y las discusiones en PTHNLUÄQHLS]PKLVSVZYLJ\YZVZKLSHPUMVNYHMxH
grupo que se encuentran en la mayoría de los etc. Su presentación es más moderna y forma
periódicos on line, los lectores y los medios logran parte del paradigma de las Nuevas Tecnologías
una verdadera comunicación, de esta manera se de la Información. Es importante destacar que
termina esa relación unilateral, unidimensional y muchos medios de comunicación ya han aplicado
unidireccional. Nace el artículo y la columna del las riquezas que les ofrecen estos nuevos recursos.
público, que no se ubica en la radio, televisión y La prensa, en comparación a la radio y la televisión,
prensa, tradicionales. es el medio de comunicación que está en Internet
KL THULYH TmZ ZPNUPÄJH[P]H 9LJVYKLTVZ X\L
GÉNEROS EMERGENTES: para los medios audiovisuales la red ha sido
Tal vez los foros pueden ser considerados como simplemente una herramienta de promoción al
un nuevo género del periodismo on line, ya que servicio de las cadenas. Esta situación se debe
a través de una comunicación directa, el usuario a los problemas tecnológicos que ofrecen las
de Internet conduce la entrevista a un personaje conexiones, en la mayoría de los sitios el cable
famoso. En una pantalla el entrevistado lee desde coaxial limita la transmisión rápida del audio y del
cualquier parte del mundo las preguntas que le video.
plantean y las contesta. Por un lado desaparece la
intermediación del periodista y el entrevistado elige En los géneros periodísticos, sobre todo en la
a que cuestionamientos dar respuesta. noticia, crónica y reportaje se empiezan a presentar
Al hacerla en vivo, de manera simultánea, el los géneros hipermedia con imágenes animadas,
usuario toma el papel de periodista, pregunta lo audio, etc. De hecho la infografía es uno de los
que necesita, lo que desea. Posteriormente una elementos de mayor apoyo en la información
vez trasmitida la entrevista de manera simultánea, periodística. La inclusión de mapas, foros,

?=,5*<,5;965(*065(3*65,0** 54
Consolidación y construcción del periodismo digital

encuestas, etc. recurre al video, audio, omnimedia, alguna fotografía o infografía que puede ir en
NYmÄJV HUPTHKV MV[V NHSLYxH ` HUPTHJP}U ,U arracada. El tamaño de la tipografía suele ser
el audio y video con el streaming, el usuario no superior a las noticias impresas, entre 10 y 12
descarga el contenido y luego lo visualiza, sino que puntos. La tipografía va desde la times, la helvética,
lo va reproduciendo a medida que lo recibe, con la verdana o la arial.
el Real Media, el Real audio, el Windows Media
Pleayer, el MP3, MPEG, etc. Generalmente suelen ir alineados a la izquierda
con el objetivo de lograr mayor velocidad en la
Asimismo, el género periodístico será la punta del SLJ[\YH UV SSL]HU ZHUNYxH ` UV LZ[mU Q\Z[PÄJHKVZ
iceberg soportado por la investigación y análisis es conveniente no utilizar en exceso las negritas y
del periodista. Se necesita conectar al usuario a las las cursivas en el diseño ya que saturan la vista y
fuentes de información directas a través de enlaces confunden la valoración de los contenidos.
hipermedia, que sea éste el que profundice y el
que juzgue la veracidad de la información. Tanto en La redacción debe de ser hipertextual e hipermedia
informaciones ya publicadas por el medio, como a lo cual favorece la interacción amigable con la
las primeras fuentes. representación icónica de las estructuras de
información y de los comandos. Esto se traduce
Los blogs de los medios de comunicación también con la posibilidad del usuario de actualizarse e
se han convertido en espacios periodísticos incrementar la información en cualquier momento.
emergentes, repaldados por la marca del medio y
sin una rigurosidad periodística. Es decir, cuando El principio de multiplicidad y de encaje de escalas
se enlaza a un blog uno de los primeros referentes está representado en el periodismo digital por la
en el usuario es la informalidad y la cercanía a éste. conexión en red de las informaciones, de forma
que de cualquier asunto, el usuario sea capaz
Ejecicios: 1. Redacta una cibernoticia considerando de alcanzar otro punto. El acceso a los textos,
elementos esenciales como la hipertextualidad, la PTmNLULZÄQHZVLUTV]PTPLU[V`ZVUPKVZUVLZ
converencia multimedia, la interactividad, entre secuencial, como tampoco lo es el pensamiento
otros mencionados. humano.
2. Redacta un cibereportaje incluyento
también elementos como la hipertextualidad, la Es en su contexto sociocultural donde cada
converencia multimedia, la interactividad, entre persona, en razón de determinadas cuestiones
otros mencionados. (gustos, intereses, tiempo, etc.), decide cuál es
el camino único. Se pasa de la forma discursiva
Prácticas discursivas del ciberperiodismo secuencial a la información numérico-textual,
NYmÄJH`ZVUVYHX\LJVYYLZWVUKLTmZÄLSTLU[L
El estilo de los medios de comunicación on line es al sistema de pensamiento humano.
frases cortas y de estructura gramatical sencilla.
Son de una única columna, acompañados de

?=,5*<,5;965(*065(3*65,0** 55
Consolidación y construcción del periodismo digital

La información en Internet exige que los portal, generalmente en el medio se le da un poco


periodistas ofrezcan al lector un viaje narrativo en de mayor altura al titular. En un principio el medio
tres dimensiones desde el que pueda, en cualquier de comunicación manejaba titulares subrayados,
punto del discurso elegir su nueva ruta. pero esto provocó saturación en su diseño y en la
TITULARES actualidad son generalmente negros.
Son más simples. Aquí se exige una sintaxis
adecuada y de su estructura correcta depende una LAS INFOGRAFÍAS
fácil y rápida lectura. Como sabemos, el usuario Las infografías, esa reconstrucción virtual
de Internet, y de hecho el ciberciudadano, tiene de los acontecimientos surge como un género
la intención de tener una consulta más rápida. Se más. No tanto como complemento, sino como
ve limitado en la mayoría de las ocasiones por la un recurso que presenta un acontecimiento. En
calidad de las pantallas, pero aún así desea un Internet las posibilidades de desarrollo son muy
titular concreto de unas cuantas palabras y que lo amplias.
ubique en la información. En ocasiones el periodista no tiene la fotografía,
Hace unos años cuando inició la prensa en línea, la imagen o el audio, ante ello utilizan un recurso
algunos medios no entendían la característica de virtual fundamentado en las informaciones que ha
la mundialización y por tanto la posibilidad de que recogido, hablemos en este caso de las guerras,
no solamente los consultaran quienes viven en su KLZP[\HJPVULZLUJVUÅPJ[VKVUKLLUVJHZPVULZLZ
JVILY[\YH NLVNYmÄJH ZPUV \Z\HYPVZ HSLQHKVZ H imposible recuperar una imagen. Tal vez algunas de
veces por cuestiones físicas y culturales. las infografías más famosas que se hicieron fueron
The Times en sus inicios cometía este error. Por del 11 de Septiembre del 2001 en el atentado
ejemplo, si uno consultaba la sección World, se contra las Torres Gemelas.
pasaba directamente a encabezados y de ahí a
cada una de las unidades redaccionales. Donde RECURSOS ON LINE
se localizaba los encabezados el usuario no sabía Búsqueda de información, chat, foros de
a qué país o región del mundo se refería ese titular, debate, entre otros, las posibilidades del medio no
por lo cual en lugar de entrar a la información se se limitan a un contenido tradicional. Las páginas
pasaba directamente a otra página. ofrecen servicios de búsqueda de información
Generalmente el único elemento de la cabecera es general o especializada para que el usuario pueda
un titular que no va acompañada de antetítulos o encontrar la palabra, el tema, el artículo, el nombre
subtítulos. Esta situación se observa principalmente KL\UHTHULYHYmWPKH`LÄJPLU[L3HVYNHUPaHJP}U
en la home page, es decir, hay que ahorrar espacio de los contenidos se realiza en forma lógica y
en la primera pantalla. Lo que se hace entonces ÅL_PISL7LYTP[LSHWVZPIPSPKHKKLLUSHaHYZLHV[YHZ
es poner títulos de otras informaciones o servicios páginas en Internet, ya sea a otros medios de
relacionados con el tema. comunicación o a empresas comerciales. Ofrece
No existe un tamaño común de los titulares, cada conexiones con revistas, así como a otros servicios
medio ha escogido su propio estilo. Sin embargo, de la red.
comparando la página de un medio con la de un

?=,5*<,5;965(*065(3*65,0** 56
Consolidación y construcción del periodismo digital

Los medios brindan charlas o pláticas para Al abrir un periódico o revista, la atención de
los usuarios según los temas de interés del día, un lector se atrae inmediatamente a los elementos
entrevistas en vivo con los editores; hay foros de NYmÄJVZ LU SH WmNPUH LU S\NHY KL SVZ LSLTLU[VZ
debate donde se coincide con personas cuyos textuales. Una página bien diseñada convence y
temas de interés son similares; se platica y conoce atrae la atención del usuario. En Internet no sólo
a otras personas a través del chat. Todas estas engancha al usuario la calidad de información,
posibilidades que los medios tradicionales no tienen, también su presentación.
conforman el nuevo medio de comunicación. La página principal (home page) es la puerta
El incremento de la demanda no sólo es de entrada al servicio. Usualmente a través de ella
por la cantidad de noticias, también porque el se puede llegar a todas las otras páginas. Éstas se
reporte de ellas sea más rápido. La demanda de organizan en una estructura jerárquica muy similar
noticias en el mundo no es uniforme, depende al sistema de directorios y subdirectorios de un
de la penetración de las Nuevas Tecnologías de disco magnético. Sin embargo, no es necesario
la Información en cada país. Este medio presenta pasar por la portada para visitar los otros enlaces.
los servicios agregados, es decir las informaciones Los medios on line contienen muchos motivos
que permiten satisfacer la demanda del lector en visuales, utilizan diferentes tipos de letras, de
un tema determinado, acceso a los suplementos, tamaños, de colores, de recuadros, de marcos, de
noticias actuales, al minuto, asesoría laboral, subrayados, etc. A diferencia de los tradicionales
económica, educativa, clima, cotizaciones bolsa se pueden permitir el lujo de utilizar todo el color,
de valores, entre otros. audio y video que deseen ya que esto no elevará
su precio.
ORGANIZACIÓN DE LAS UNIDADES /H` \UH NYHU ÅL_PIPSPKHK KLS MVYTH[V 3VZ
textos, imágenes, sonidos y video se interrelacionan
REDACCIONALES
dando al usuario la máxima capacidad de
5V L_PZ[L SH JSHZPÄJHJP}U KL WmNPUHZ WHYLZ
navegación a través de los elementos como
o impares como en el periódico impreso, de
páginas malas o buenas. En la página nacional, teclas, botones, imágenes, íconos, mapas, entre
otros. Los hiperenlaces son punteros a otros
internacional, etc., las noticias más importantes
documentos o recursos en Internet para: a)
se colocarán en la primera parte de ésta, seguidas
obtener un nuevo documento, b) activación de un
por las de menor relevancia.
elemento multimedia, c) permitir el acceso a otros
No existe la noticia de ocho columnas. La
servicios de Internet. Los hiperenlaces textuales,
importancia de una noticia con respecto a otra
OPWLYLUSHJLZ NYmÄJVZ OPWLYLUSHJLZ H H\KPV
se observa en su colocación, si es en la primera,
hiperenlaces a videos, a juegos, en general.
segunda, tercer pantalla o según las que tenga el
Algunas páginas web están subdivididas
medio. Se valorizan más las fotografías respecto
en áreas rectangulares o ventanas, cada una
HS[L_[VLSNYHÄZTVMYLU[LHSHZWHSHIYHZLSJVSVY
de las cuales puede contener un documento de
frente al blanco y negro. La lectura hipermedia exige
hipertexto distinto e independiente de los demás.
que se destaque aquello que será una enlace.
Este recurso no es recomendable en la actualidad,

?=,5*<,5;965(*065(3*65,0** 57
Consolidación y construcción del periodismo digital

en los primeros años de los medios en la red se


dividían por frames, pero en estos momentos se
ha superado ese diseño.

REDACCIÓN PARA DISPOSITIVOS COMO


LOS MÓVILES: Es aquí donde se recupera el
nacimiento de la noticia. El cibermedio sobre todo
envía noticias en tan sólo una oración. La pantalla
Hoy el iPAD constituye la nueva generación de
del dispositivo móvil es muy pequeña y quien la
periodismo diital. Algunos de los elementos
construye es precisamente un ciberperiodista.
relevantes son los siguientes: la portabilidad, el
despliegue multimedia y no es gratuito. Todos los
Innovaciones en el ciberperiodismo
modelos de negocio pueden coexistir en el mismo
En España El Periódico de Catalunya emprendió
canal de distribución. Posibilidad de controlar más.
en marzo de 1994 un proyecto que consistió
El inconveniente que todavía existe es que en los
en desarrollar un chip, un sistema operativo y
móviles y en las nuevas tabletas todavía no se
\U LU[VYUV NYmÄJV X\L WLYTP[PLYH ]PZ\HSPaHY LS
navega tanto como en las computadoras. En la era
periódico en una tableta electrónica informativa
del acceso no se navega ni se busca tanto. Las
llamada NewsPad dentro del programa ESPRIT
WSH[HMVYTHZ [LJUVS}NPJHZ ` LS Å\QV ZVJPHS ZVU SVZ
(SPRINT). La Unión Europea subvencionó parte del
dos nuevos modos de acceder a los contenidos.
proyecto junto con algunas compañías europeas
Las plataformas móviles son el verdadero sustituto
como la británica Acorn Computer, la francesa
de la prensa, diarios y revistas. Sin la movilidad, el
:(*HYH[ \UH ÄYTH KL KLZHYYVSSV KL WYV`LJ[VZ
mercado de la información no es el mismo.
publicitarios; la griega Archimedes; y el Institut
Català de Tecnologia.
Redes sociales
NewsPad es un producto informativo multimedia
Las redes sociales y compartir los contenidos
difundido por medios digitales, que el lector recibe
periodísticos a través del correo son las innovaciones
en un visor portátil. Utilizando una pantalla de alta
que los espacios de primer nivel han desarrollado.
KLÄUPJP}U LZ[L WLYP}KPJV T\S[PTLKPH TVZ[YHIH
Una de las principales razones es que los usuarios
una gran calidad de vídeo en color, fotografías,
de Internet pertenecen a la Generación Red, de
PUMVNYHMxHÄQH`HUPTHKH`[L_[VZ3HZ\WLYÄJPLKL
tal manera que los cibermedios debe de entender
la pantalla era sensible al tacto, lo que permitía un
SHZ LZ[YH[LNPHZ KL PTWHJ[V LU SV X\L ZPNUPÄJH SH
manejo práctico.
Convergencia digital.

Las herramientas para compartir contenidos son


ligadas de sitios que ofrecen a los usuarios de
internet un método para almacenar, organizar,
buscar, administrar y compartir las páginas favoritas.

?=,5*<,5;965(*065(3*65,0** 58
Consolidación y construcción del periodismo digital

Los marcadores sociales son recursos de internet hablar de una verdadera comunicación en la que
que los usuarios consideran útiles. La mayoría de los L_PZ[L SH YL[YVHSPTLU[HJP}U ` LS Å\QV LZ LU HTIVZ
marcadores permiten a los usuarios categorizar los sentidos. El medio debe contar con personal
contenidos de su predilección mediante palabras dedicado exclusivamente a esa retroalimentación.
clave, todos estos iconos conducen a servicios * Hablamos de un nuevo medio, pero algunos
externos y ajenos. Por ejemplo: El Universal.com. han pensado en un medio personalizado: Daily
mx facilita la administración personal o comunitaria Me. Es seguro que este medio existirá porque
de las páginas favoritas del usuario. Las principales una de las ventajas de la red es darle al usuario lo
redes sociales son facebook, Twitter, entre otras. que él quiere. Aún así, es importante no perder de
Algunas formas es que el propio medio tenga su vista una verdad de la sociedad, aunque estemos
red social o que un usuario consulte una noticia en internetizados, seguiremos viviendo en un grupo,
la red social. donde no tendremos porque interesarnos de todos
los temas de manera profunda, pero sí saber lo
Conclusiones generales más importante que pasa en la comunidad, en el
país y en el mundo.
Los medios on line se han convertido en un nuevo * Parte de la información que viaja por Internet
medio. Es innegable esta verdad, pero tienen que no es periodismo, son simplemente datos. El
explotar los recursos que ofrece Internet. No es periodismo continuará conservando fundamentos
Z}SV[L_[VLPTHNLUÄQHHOVYHLZH\KPVLPTHNLU como informar, orientar y entretener de acuerdo
LUTV]PTPLU[V,ZLUKLÄUP[P]H\UJPILYTLKPV con los criterios de valoración, jerarquización,
* Este medio es más completo. Ofrece la interpretación y argumentación.
profundidad de la prensa escrita, la instantaneidad * Internet es información, pero así como en la
de la radio y la imagen en movimiento de la biblioteca hay mucha no toda esa información es
televisión. No habrá preferencias porque en el periodismo. La gente tendrá la necesidad de estar
mismo sitio podremos encontrar la convergencia orientada y de informarse de aquello que pasa en
digital de los tres medios. También pierde su la sociedad de la cual es parte. Y como viviremos
característica de periodicidad, porque se renueva en una Aldea Global debemos estar enterados de
conforme surgen las informaciones y no por todo.
periodos predeterminados desde las salas de * Internet no puede hacernos olvidar el deber
redacción. social del periodista, cumplir con el derecho a la
* Hay quienes piensan que si el periódico se actualiza información de los ciudadanos y la importancia de
de manera instantánea o conforme sucedan garantizar la veracidad de los hechos.
hechos importantes, se perderá la profundidad que *Las Facultades de Comunicación y Periodismo
caracteriza a la prensa. Sin embargo, estos son los KLILUWLYÄSHYSHWYLWHYHJP}UKLJPILYWLYPVKPZ[HZ`
retos de la prensa on line, la capacidad de ofrecer de quien elabora los contenidos en el medio digital.
la instantaneidad, pero sin perder la profundidad.
* El cibermedio ofrece la posibilidad de una
mayor interactividad usuario-emisor. Podemos

?=,5*<,5;965(*065(3*65,0** 59
Consolidación y construcción del periodismo digital

SOBRE LOS AUTORES


Bibliografía
Armañanzas, Emy; Díaz Noci, Javier y Meso, Koldo Dra. Lizy Navarro Zamora. Escuela de Ciencias de
(1996). El periodismo electrónico. Barcelona: la Comunicación, Universidad Autónoma de San
Editorial Ariel, 1996. 3\PZ 7V[VZx 4PLTIYV KLS :50 KL *VUHJ`[ 7LYÄS
Cebrián, Juan Luis (1998). La red. Madrid: Ed. Promep. Publicación de dos libros: Los periódicos
Taurus, Madrid,1998. on line y Comunicación Mexicana en Internet
Diaz, Javier y Meso Ayerdi, Koldo: Medios de
comunicación en Internet. Madrid: Ed. Anaya,
1997.
Esebbag, Benchimol (1998). Internet. España: Ed.
Anaya Multimedia, 1998.
Islas, Octavi (2002). Explorando el ciberespacio
iberoamericano. México: Ed. CECSA.
Martínez Albertos, José Luis, Curso General
de Redacción Periodística. España: Ed.
Paraninfo, 1993.
Muñoz, Pedro (1997). Un futuro interconectado y
digital. Madrid: Ed. Ericsson S. A.
Navarro Zamora, Lizy (2002). Los periódicoson
line. México: Ed. U.A.S.L.P.
Navarro, L. (2005). Comunicación mexicana en
internet. México: Fundación Manuel Buendía.
Rojo, P. (2006): La empresa periodística multimedia:
creación y difusión digital de contenidos
interactivos. Madrid: Visión Net.
Sahagún Felipe: De Gutemberg a Internet.
España: Ed. Estudios Internacionales de la
Complutense, 1998.

* Este es el resultado de las investigaciones


YLHSPaHKHZLU[VYVHSWLYPVKPZTVKPNP[HS`ÄUHUJPHKV
por El Fondo de Apoyo a la Investigación de la
Universidad Autónoma de San Luis Potosí, México.

?=,5*<,5;965(*065(3*65,0** 60
Economía alternativa
y redes sociales en línea.
El caso TRUEQMX
Dra. Cecilia Sabido
UNIVERSIDAD PANAMERICANA

Resumen:
Los sistemas de economía alternativa surgen por todo el mundo a partir de las crisis de los años
ochenta. LETSystem de Michael Linton, los dólares-hora de Ithaca y los bancos del tiempo en
España, son ejemplos de redes locales de ayuda y medios de economía humanista.
Las propuestas, que en sí mismas son ya innovadoras, necesitan adaptarse a los recursos tec-
nológicos y sociales disponibles. Por ello tienen un campo abierto y un área de oportunidad
  
de crecimiento en las redes sociales online. Los esquemas de servicio y la revaloración de los
talentos, del tiempo y los recursos reciclables adquieren mayor versatilidad cuando se integran
a la llamada web 2.0: salvan los límites espacio-temporales y multiplican sus posibilidades. Ese
es el caso de TrueQmx (www.trueqmx.com), una red social de economía alternativa en línea que
funciona en México desde enero de 2010.

Palabras clave:
Economía alternativa, redes sociales, trueque, moneda virtual, interacción social

1.   Introducción mismo del intercambio. Entre muchas otras


ventajas frente al sistema monetario real, los ecos
TrueQmx (Truequemex) es una red social en línea no generan intereses y devuelven valor a ciertas
de intercambio de servicios y bienes reciclables. realidades del mundo social que quedan fuera del
Funciona como un sistema de economía alternativa sistema de comercio estándar. Desempleados,
inspirado en la Doctrina Social y en el proyecto de discapacitados, jubilados, amas de casa, jóvenes
Michael Linton llamado LetSystem. En lugar de estudiantes que aún no cuentan con experiencia
utilizar dinero real para el intercambio, se crea una laboral, tienen cabida en este espacio.
\UPKHKLZWLJxÄJHKLU[YVKLSZPZ[LTHLULZ[LJHZV
llamados “puntos eco” o “ecos”. Los participantes La plataforma de TrueQmx se encuentra en la
dentro del sistema integran una comunidad que red de habilidades y servicios que los miembros
intercambia sus servicios, bienes y habilidades. están dispuestos a ofrecer y las necesidades
emergentes que expresan e intercambian. Por
Los puntos eco sirven como una moneda, esta razón, su fortaleza reside en las redes sociales
ayudan a formalizar el valor de los servicios con y se transforma en una comunidad que comparte
una expresión abstracta y facilitan el concepto ]HSVYLZ JVTV YLJPWYVJPKHK JVUÄHUaH LZWxYP[\ KL
servicio y justicia.
Economía alternativa y redes sociales en línea.

Consideramos que TrueQmx es una red social en en los bienes y servicios que pueden adquirirse
dos sentidos: uno humanitario y el otro tecnológico. con él. La moneda simplemente es el principio y
Es una red humanitaria por la interrelación de ÄUKLSPU[LYJHTIPV`LZ\UHYLHSPKHKUVUH[\YHSZ\
individuos que integran una comunidad a través valor se determina por una convención (Moreno,
de nodos de interacción social solidaria. Y es una 1988).
red tecnológica porque sus principales medios
de acción son los servicios de red social online. La moneda, a lo largo de los años, se ha convertido
TrueQmx se presenta al público como una red social en la expresión metálica (o material, al menos) de
online que integra diversas herramientas de la web cada civilización. En la civilización romana, por
2.0, como un portal de internet y tiene presencia ejemplo, la moneda se utilizó con frecuencia como
en medios como facebook, twitter, blogger, y otras una vía de propaganda, de modo que además
redes como Mujeres Construyendo. del valor relativo al peso del metal, se empleaba
como un medio de difusión de los ideales que
2.   El trueque, la moneda y los tiempos el emperador quería que compartieran todos los
críticos: un poco de historia romanos. Ideales como la paz, la concordia, la
prosperidad, se transmitían de mano en mano
Aristóteles explicó en la Política (I-9, 1257a – 1257b durante las épocas más felices del imperio. (Rodà
10) cómo surgen entre los hombres los primeros de Llanzà, I. 2007).
intercambios de bienes y servicios, y el modo en
que la complejidad social fue transformando las El comportamiento social del comercio y la
transacciones hasta dar lugar al surgimiento de moneda en el transcurso de la historia arroja datos
SHTVULKH,ULSMVUKVKLZ\YLÅL_P}ULSÄS}ZVMV interesantes, por ejemplo, los romanos jugaron
griego destacaba que era necesario considerar T\JOV JVU LS KPULYV! NLULYHYVU PUÅHJPVULZ `
en todos los bienes dos valores, el de uso y el KL]HS\HJPVULZ X\L KLYP]HYVU ÄUHSTLU[L K\YHU[L
de cambio.(I-9, 1257a-2) Cada cosa tiene un la crisis política del siglo III en la paralización
]HSVY YLHS X\L JVUZPZ[L LU LS \ZV LZWLJxÄJV X\L del comercio: las cecas (casas de moneda) se
puede hacerse de él: los zapatos para caminar, detuvieron –o peor aún, se multiplicaron- y el
los lápices para escribir, etcétera. Sin embargo, comercio terminó por volver al sistema básico: al
absolutamente todas las cosas adquieren un comercio local, y al trueque. (Rostovtzeff, 1926).
valor añadido, el valor de cambio. Para agilizar los
intercambios, al tiempo que las sociedades crecen En tiempo de Carlomagno se procuró controlar
y sus necesidades aumentan, se crea un objeto el valor de cambio del imperio entre los feudos:
especial que represente el valor de cambio de PU[LU[} WVULY \UH TVULKH ‚UPJH ` ÄQHY WYLJPVZ
todas las cosas: la moneda (I-9, 1257a-7). Llama la atención en esta época que utilizara
valores nominales, como el “sous” o sueldo,
Aristóteles recuerda en su texto que la riqueza, en independiente del valor de las monedas circulantes.
sentido estricto, no consiste en la acumulación de (Nadie tenía sueldos, pero se sabía que un caballo
dinero, que sólo representa el valor de cambio, sino equivalía en sueldos a dos yeguas). Este sistema

?=,5*<,5;965(*065(3*65,0** 62
Economía alternativa y redes sociales en línea.

facilitó dar valores equivalentes, a pesar de la falta 3.   (U[LJLKLU[LZJVUJYL[VZÄJ[PJPVZ`


de metálico, de modo que aún en los trueques reales
internos quedaba establecido el valor de un ;Y\L8T_ Z\YNP} H WHY[PY KL \UH YLÅL_P}U HJLYJH
objeto. Además, las pocas monedas circulantes de la presente crisis económica. Nos dábamos
se relacionaron con el sueldo por su material y su cuenta de que la riqueza existe y que algo ajeno a
peso. Esto derivó en la creación, a la larga, de las ella la paralizaba. Muchos recursos y habilidades
letras de cambio y el papel moneda. (Duby, G., simplemente no son “comerciales” de modo
1976). VÄJPHSWLYVUVWVYLSSVJHYLJLUKL]HSVYYLHS7VY
ejemplo, quien tiene habilidad para conversar con
En un resumen sumamente lato podemos ver cómo ancianos, tiempo libre para ayudar con trámites,
la historia del dinero es la historia de la abstracción explicar materias, dar consejos, realizar labores
de los valores de cambio. El dinero existe para manuales, etcétera. La intención que tuvimos fue
agilizar las transacciones. Las crisis suelen coincidir “revalorar” los bienes y las habilidades y crear un
con los vicios que estas abstracciones conllevan: espacio donde se pudieran intercambiar de modo
cuando escaseó el metal o se devaluó, cuando LÄJPLU[L]LYZm[PS`KPUmTPJV
se emitió más papel moneda que su respaldo
metálico, cuando se especuló con la posibilidad Cuando pretendíamos explicar nuestra iniciativa,
de generar riqueza, independientemente de que las referencias que mayor eco hicieron en nuestros
esta efectivamente se produjera (Weatherford, J. PU[LYSVJ\[VYLZ M\LYVU ÄJ[PJPHZ TmZ X\L YLHSLZ!
1998). En momentos como estos, es necesario la cinta de Mimi Leder, “Pay it Forward” (2000)1
revisar prioridades y procedimientos y buscar la y la serie “Los Simuladores” (2008). En ambas
salud del sistema. producciones visuales se presenta la idea de crear
redes de ayuda o cadenas de favores donde la
Son numerosos los ejemplos que muestran la “deuda” es un compromiso personal de servicio y
necesidad de repensar la economía y buscar no de dinero.
alternativas. Entre ellas, con frecuencia aparece el
trueque, no sólo por la falta de dinero circulante, Otro ejemplo que daba resultado fue el de los
sino por el innegable valor social que desde siempre puntos que se acumulan por jugar juegos de
ha conllevado. Diversos autores coinciden en que, video: alcanzar objetivos, generar sistemas de
si el trueque no se ha extinguido, es porque “sirve recompensa a partir de actividades que, en
para establecer lazos de amistad y alianzas con esencia, no te cuestan nada inicialmente, pero te
V[YVZ NY\WVZ V IPLU WHYH HÄHUaHY SHZ YLSHJPVULZ permiten crecer en oportunidades, experiencia y
sociales existentes en el interior del propio grupo”. elementos de interacción.
(Grau y Chalaux, 1984)
Estos ejemplos son relevantes porque nos
muestran dos elementos indispensables para

1 También conocida en español como “Cadena de


favores”.

?=,5*<,5;965(*065(3*65,0** 63
Economía alternativa y redes sociales en línea.

comprometerse con un proyecto como éste: [VKVZSVZmTIP[VZÄJ[PJPVZ`LZKPNUVKLVIZLY]HYLS


en primer lugar, el hecho de que la práctica del hecho de que en las redes sociales y la interacción
trueque no es ajena a la sociedad actual: se virtual se generen procesos semejantes.
considera creativa y pertinente. En segundo lugar,
se trata de actividades y procesos que realizamos Aun cuando lo que se experimente se ocurra en
cotidianamente en sistemas cerrados, como el un ámbito no lúdico, como una colaboración o
familiar o el amical, y en ejercicios lúdicos. (Reintjes, una junta a distancia, una discusión en un foro,
C., 2010). SH JVUÄYTHJP}U KL \U N\Z[V LU MHJLIVVR V LS
seguimiento de un acontecimiento en twitter, la
El aspecto lúdico tiene una contribución actividad virtual comunitaria tiene herramientas
ZPNUPÄJH[P]HLULSmTIP[VKLSH^LI+LZKLZ\ WHYHMVY[HSLJLYSHaVZZVJPHSLZSSLUVZKLZPNUPÄJHKV
creación, internet no duró mucho tiempo como (Alonso-Fernández, F., 2003)
una herramienta exclusivamente de trabajo: el
ocio tomó forma y contribuyó en gran medida a Por estas razones, al planear TrueQmx como una
SH PU[LNYHJP}U KL SHZ YLKLZ ZVJPHSLZ 4VKPÄJH ` red social online de ayuda mutua tenemos la
compromete la participación del usuario, porque el aspiración de convocar la conducta comprometida,
ambiente lúdico genera pertenencia, competencia vivencial y comunitaria de las asociaciones virtuales.
y compromiso personal. Contamos con la inevitable correspondencia nodal
de crecimiento que da la participación, cuando
Haciendo a un lado las evidentes críticas al la red es la oportunidad de ampliar vínculos de
ámbito lúdico en los servicios de red social, se HTPZ[HKZVSPKHYPKHK`JVUÄHUaH(ZxJVTV;Y\L8T_
debe considerar que la psicología del usuario valora las habilidades y recursos de sus miembros,
genera dinámicas de aprendizaje y socialización también considera parte de su riqueza toda la red
a través del juego. Además, el tiempo adquiere propia de relaciones de cada participante, porque
otro valor cuando se invierte en estas actividades: la vincula con el sistema y enriquece sus opciones.
deja de vivirse de modo lineal –una mera
secuencia de acontecimientos- para expandirse 4.   TRUEQMX como economía
psicológicamente hacia varios puntos de alternativa
conciencia. Es decir, en lugar de dejar un simple
pasar el tiempo, la inversión lúdica transforma el Iniciamos una investigación para saber si existían
tiempo en “vivencia”. proyectos similares y encontramos diversos
sistemas de economía alternativa por todo el
Esa vivencia acumula experiencia y genera el mundo. Con frecuencia pensamos que el trueque
deseo de repetirla. Instaura un punto de referencia es cosa del pasado. Sin embargo, descubrimos
en la experiencia vital, que, además, se enriquece sistemas actuales que aplican trueque directo e
por empatía con las vivencias de otros individuos indirecto en economías locales, sobre todo rurales,
que sienten lo mismo que uno, o han participado principalmente en países que llamaríamos “de
de la misma actividad. Este fenómeno ocurre en primer mundo”.
?=,5*<,5;965(*065(3*65,0** 64
Economía alternativa y redes sociales en línea.

El primero que llamó nuestra atención fue el sistema local, los miembros de la comunidad ofrecen
llamado “LETSystem”, creado en Canadá por servicios que el ayuntamiento no está en posición
Michael Linton durante los años 80. A partir de sus de resolver y mejoran la vida de la sociedad
YLÅL_PVULZZLOHUKLZHYYVSSHKVJVT\UPKHKLZWVY entera. En última instancia, un sistema como éste
todo el mundo que contribuyen a un proyecto hoy agiliza la participación que es indispensable en el
más amplio llamado “Open Money”. En la página mejoramiento de la calidad de vida de cualquier
web de ambos proyectos hay herramientas para sociedad. (Subirana, P., 1998)
aplicar LETSystem en comunidades concretas,
jugar con las posibilidades de la economía En el mejor de los casos, la economía alternativa
alternativa e intercambiar experiencias que mejoren podría sustituir el dinero formal, pero en el sentido
los proyectos mismos. (http://www.openmoney. más práctico, convive con él adecuadamente. Los
org) puntos, las horas, la moneda virtual no sustituyen
el dinero: lo reubican. Se solucionan muchas
LETSystem o “Local Exchange Trading System” necesidades con recursos alternativos y se deja el
es una propuesta alternativa de organización dinero para lo urgente o importante. Señala Pere
económica aplicable en cualquier comunidad. :\IPYHUHX\LLSKPULYVVÄJPHSLZULJLZHYPVJ\HUKV
Consiste en una red económica autorregulada, más nos alejamos del ámbito familiar o local.
que permite a sus miembros generar y administrar Sistemas como LETS complementan el sistema
una moneda virtual completamente legal e TVUL[HYPV VÄJPHS UV SV Z\Z[P[\`LU 4mZ H‚U SH
independiente del sistema federal monetario. Las existencia de sistemas alternativos de intercambio
herramientas de LETS permiten a las comunidades PU]P[H H \UH YLÅL_P}U TmZ JVTWYVTL[PKH ZVIYL
el intercambio de bienes y servicios en tiempo de los vicios de la economía contemporánea que
crisis. Subirana esboza adecuadamente en su ensayo
sobre Redes de Ayuda Mutua (1998):
LETS funciona como una cuenta bancaria: un
miembro de la comunidad ofrece algún producto % ,SKPULYVVÄJPHSZLJYLHLUNY\WVZKLWVKLY
o servicio y gana, quien recibe el servicio queda controlado por agentes externos, mientras
en deuda y deberá compensarla con sus propias el dinero virtual se crea a medida que el
ofertas. El sistema mantiene el balance porque usuario lo necesita.
algunos miembros tienen crédito a favor, que % ,S KPULYV VÄJPHS ZL KPS\`L V ZL KPZ[YPI\`L
corresponde a la deuda de otros. en instrumentos como los impuestos y
el consumo, mientras el dinero virtual se
Hay casos de comunidades que llegan a un queda como riqueza de la comunidad y se
acuerdo con el ayuntamiento local. Tal es el reinvierte en el grupo.
caso de “La Troca”, comunidad LETS pionera en % ,S KPULYV VÄJPHS ZL JVUJLU[YH LU WVJHZ
España, fundada por Pere Subirana en Vilafranca manos, provoca escasez de dinero a
del Penedés, Cataluña. Partiendo del principio de disposición de las personas y genera una
que LETS fortalece el desarrollo de la economía brecha entre ricos y pobres, mientras

?=,5*<,5;965(*065(3*65,0** 65
Economía alternativa y redes sociales en línea.

el dinero virtual es solo una medida de pueden ser “retirados” para gastarse en cualquier
intercambio, de modo que es inagotable momento en cualquiera de los servicios que
y además genera igualdad en todos los ofrezcan los demás usuarios. Normalmente, se
usuarios sin importar su estrato económico utiliza la hora como criterio unitario. A diferencia
típico. de LETS, los bancos del tiempo se dedican
% ,SKPULYVVÄJPHSZLHJ\T\SHZLJVTWYHZL LZWLJxÄJHTLU[L HS PU[LYJHTIPV KL ZLY]PJPVZ :\
vende y es “caro”. La moneda virtual no versatilidad consiste en que en ocasiones no es el
tiene caso acumularla, es en realidad una dinero lo que falta, sino el tiempo para cumplir con
medida de la riqueza que ha sido creada y VIQL[P]VZLZWLJxÄJVZ,U,ZWH|HSVZ )HUJVZ KLS
está al alcance de todo el mundo. Tiempo están en auge debido a la crisis mundial. La
% ,SKPULYVVÄJPHSLZ[mZ\QL[VHSVZTLJHUPZTVZ bibliografía al respecto es abundante y constante:
de interés que en los sistemas de moneda tan sólo en este año se han publicado con gran
virtual no pueden (o al menos no deben) éxito: “Vivir sin Empleo”, de Julio Gisbert y “Vivir
generarse, ni para quien presta el servicio ni sin Dinero” de la alemana Heidemarie Schwermer.
para quien contrae la deuda de reciprocidad.
% ,S KPULYV VÄJPHS LU Z\TH UV YLWYLZLU[H La propuesta de TrueQmx en este caso resultaba
la riqueza real. Se ha convertido en una innovadora por al menos dos razones, la primera:
abstracción especulativa que no tiene no hay comunidades mexicanas vinculadas aún a
respaldo, ni en oro ni en bienes y genera los sistemas de economía alternativa. La segunda,
crisis (como la originada por los fraudes que la propuesta de TrueQmx desde el principio
de las compañías aseguradoras en 2009), surgió como una comunidad virtual abierta y
TPLU[YHZ SH TVULKH ]PY[\HS LZ LS YLÅLQV KL con presencia online, no meramente local como
la riqueza concreta: bienes que se han ocurría en la mayoría de los proyectos originales
intercambiado y servicios que se realizado de economía alternativa.
efectivamente.
5.   TRUEQMX como red social en línea
Otro sistema de economía alternativa es la
comunidad creada en Ithaca, Nueva York. Fue Indudablemente, los proyectos que iniciaron entre
creada en 1991 por Paul Glover. Durante un los años 80 y el 2000 se han visto enormemente
periodo de crisis económica, este hombre impulsó ILULÄJPHKVZ WVY LS Z\YNPTPLU[V KL 0U[LYUL[ ` LS
el intercambio de horas de servicio entre los desarrollo de las tecnologías de comunicación:
miembros de la comunidad. En el caso de Ithaca, la creación de blogs, portales, la posibilidad de
se imprimen billetes que avalan las transacciones compartir información gratuita, de colaboración en
de “Horas”. línea, aplicaciones móviles, etcétera, han facilitado
la administración de los bancos del tiempo y las
Modelos semejantes han dado lugar a los llamados monedas virtuales.
“bancos del tiempo”. En estas comunidades, los
créditos de tiempo se depositan en un banco,

?=,5*<,5;965(*065(3*65,0** 66
Economía alternativa y redes sociales en línea.

Además, se han creado círculos asociados de Como proyecto en fase beta se encuentra Kroonos,
comunidades semejantes por todo el mundo. (http://www.kroonos.com) que se anuncia como el
Crecen y se complementan de modo exponencial. “primer banco del tiempo global en Internet”. Es
En un solo año de trabajo, hemos visto crecer la lista \UHYLKZVJPHSX\LPU[LNYH[VKVZSVZILULÄJPVZKL
de posibilidades y el modo de proceder de cada la Web 2.0. Para poder entrar a este sistema es
una. Las redes sociales no se forman únicamente necesaria una invitación, que se puede conseguir
por la concurrencia con el medio: ante todo se en el foro o en el grupo de Facebook, pero ha
implica la coincidencia de valores e ideologías que tenido problemas en últimas fechas.
se descubren y se comparten. Las comunidades
de economía alternativa se han encontrado de /H`WmNPUHZX\LWYVWVULUPU[LYJHTIPVZLZWLJxÄJVZ!
este modo y es cosa de tiempo saber si se ha de conocimientos (http://prestaquenadatecuesta.
crear un medio tan potente como twitter, facebook org), de libros (http://www.bookcrossing-spain.
o google para hacer coincidir estos esfuerzos o si, com), objetos reciclados (http://www.nolotires.
como ha venido sucediendo, todas las iniciativas com/), aprendizaje de idiomas, (http://www.loquo.
van migrando e interactuando en los medios de la JVT LS MHTVZV ¸JV\JOZ\YÄUN¹ \UH LZWLJPL KL
web. alojamiento, donde ofreces el sofá de tu casa
por una hora o para pasar la noche- (http://www.
,_PZ[LU OLYYHTPLU[HZ KLÄUPKHZ JVTV *`JSVZ JV\JOZ\YÄUNVYN  PUJS\ZV YL[LQPKV KL WYLUKHZ!
(http://project.cyclos.org/) un programa (http://www.rekn.it/), por mencionar algunos de
de e-banking especialmente dedicado a un larguísimo etcétera. En torno a las experiencias
economía alternativa, desarrollado en común vividas en cada intercambio, las páginas de estos
por programadores brasileños y uruguayos en sitios van abriendo herramientas de interacción
2003. Hoy día, Cyclos presta servicios a muchas que van desde testimoniales hasta foros. Crean,
JVT\UPKHKLZ KL TPJYVÄUHUaHZ IHUJVZ KLS JVTVJ\HSX\PLYV[YHWLYZVUHVLTWYLZH\UWLYÄS
tiempo, LETS y proyectos semejantes por todo el en facebook o twitter y fortalecen sus vínculos de
mundo. Los países registrados que más participan pertenencia en los ámbitos más representativos
con esta herramienta son Alemania, Australia, de la web 2.0. El intercambio se convierte, en la
España, Holanda, entre otros. Su aplicación mayor parte de los casos, en el primer paso de la
requiere recursos informáticos poderosos y una creación de una comunidad sólida.
programación dedicada, pero está en constante
evolución y ya integra SMS y herramientas móviles 6.   Los retos de TRUEQMX
para realizar anuncios y formalizar intercambios.
Es ideal para comunidades grandes y bien Lograr el lanzamiento de la fase beta de TrueQmx
establecidas. Desde luego, es una paquetería que ha supuesto diversos retos. Como concepto,
opera bajo un sistema de Open Source o código establecer una red social en el sentido humanitario
abierto. de la palabra radica, sobre todo, en la falta de
claridad en el concepto de economía alternativa.
Una vez salvado el escollo, la idea tiene muy
?=,5*<,5;965(*065(3*65,0** 67
Economía alternativa y redes sociales en línea.

elevada aceptación. En un contexto como México, ÄUHUJPHYLU\UHL[HWHPUPJPHS+\YHU[LSHMHZLIL[H


que es el nodo inicial de la red (opera también en hemos tenido la oportunidad de poner a prueba el
Miami y Los Ángeles), destaca la preocupación por proyecto en carne propia, y hemos contado con
la seguridad de los usuarios. Hasta el momento, proveedores que han estado dispuestos a colaborar
la única solución viable ha sido el monitoreo en la creación y el mantenimiento del servicio.
constante del procedimiento en las transacciones. No obstante, por momento hemos migrado a un
ambiente más sencillo, con la intención de facilitar
Como empresa, ha sido difícil encontrar un el acceso y la interacción de los usuarios.
LZ[H[\[V SLNHS HWYVWPHKV KLÄUPY SVZ SxTP[LZ ` SH
responsabilidad de TrueQmx en los intercambios. Durante los primeros seis meses de funcionamiento,
Ha sido necesario replantear la estructura TrueQmx ha vinculado a más de 500 usuarios, tiene
operativa conforme se multiplican las posibilidades una centena de miembros activos, ha realizado
y el interés de los miembros en participar más de 30 tipos de intercambio efectivos, además
directamente, como ayuda base. Como negocio, de servicios publicitarios y comunitarios. La página
TrueQmx ha resuelto su sustentabilidad con tiene un promedio de 2,500 visitas mensuales
espacios comerciales y patrocinadores: al usuario y cuenta con 16 empresas patrocinadoras. En
se le ofrece como incentivo algún descuento o general, ha movido un valor monetario virtual
trato preferencial en las empresas patrocinadoras. aproximado de 7,500 ecos y ha generado un
(Durante la negociación de un patrocinio, surgió aproximado de 11,500 ecos en total.
también la posibilidad de iniciar un programa piloto
dentro de una gran empresa, para estimular el TrueQmx necesita mantenerse a la vanguardia en
trueque y los intercambios entre sus trabajadores. la tecnología y una infraestructura sólida. Para ello
Buscaban una manera de mejorar su calidad de es indispensable tener servicios informáticos de
]PKH KL TVKVZ TmZ LÄJHJLZ ` K\YHKLYVZ X\L LS primer nivel y la atención constante del sistema y
solo aumento de sueldo). los usuarios. También requiere medios para atender
las necesidades de los miembros de la comunidad,
3H KPÄJ\S[HK KL LZ[HISLJLY \UH YLK ZVJPHS LU LS garantizar la seguridad de la información y de los
sentido tecnológico requiere la programación de usuarios durante los procesos de intercambio. Para
un portal dinámico, la incorporación de espacios poder dar un servicio competitivo es necesario
de interrelación entre usuarios interesados en integrar un equipo profesional de trabajo de tiempo
conocer el proyecto tanto como en los usuarios completo que responda oportunamente a todas
ya activos. Hace falta que los usuarios se integren las instancias de actividad social y económica que
a la dinámica virtual y que participen con cierta vincula.
regularidad.
Como conclusión: la misión de TrueQmx es
Intentamos integrar Cyclos, pero es una herramienta crear cadenas de valor integrales, que ofrezcan
muy poderosa para involucrarla en la fase beta del la posibilidad de solucionar un problema a
proyecto y consume recursos que no se pueden cambio de ofrecer un servicio proporcional. Su

?=,5*<,5;965(*065(3*65,0** 68
Economía alternativa y redes sociales en línea.

visión es generar una forma real de economía 1200. Madrid, España, Siglo XXI
alternativa, crear el funcionamiento de redes
solidarias integrando una perspectiva humanística Estallo, J. A., (2001) Usos y abusos de Internet,
con la versatilidad de los servicios y sistemas Anuario de Psicologia, Barcelona, España,
tecnológicos de punta. TrueQmx promueve la Facultad de Psicología, (n. 32-2, 2001) pp. 95-108
YLJPWYVJPKHKSHJVUÄHUaH`SHYLZWVUZHIPSPKHK`LS
aprovechamiento de recursos, en un ámbito social Glover, P., (2000) A History of Ithaca HOURs,
de economía creativa. recuperado el 13 de septiembre de 2010 en
http://www.lightlink.com/hours/ithacahours/
TrueQmx es un proyecto que involucra al hombre archive/0001.html
en un sentido integral, nos da la oportunidad de
operar de un modo distinto y así poder tener Grau Figueras, M., y Chalaux de Subirà, Agustí.,
una mejor calidad de vida, menos estrés, mejor (1984) Moneda telemática y estrategia de
administración de nuestros recursos y talentos. mercado, Barcelona, España, Centro de Estudios
Busca llegar a lo más profundo del hombre, su Joan Bardina
esencia, el darle sentido a su vida, recreando su
universo, compartiendo y reutilizado los recursos Lang, P., (1994). LETS Work: Rebuilding the Local
que están a su alcance. Pone al hombre por Economy. Oxford, Inglaterra, Grover Books.
encima de los bienes materiales. El ser por encima
del tener. Linton, M., y Yacub, E., (s.f) Open Money,
recuperado el 13 de septiembre de 2010 en http://
subsol.c3.hu/subsol_2/contributors0/lintontext.
Bibliografía html

Alonso Montes, A., (24 de marzo de 2002) Pobre Moreno, A., (1988) La otra política de Aristóteles:
por vocación. Heidemarie Schwermer, Crónica, el cultura de masas y divulgación del arquetipo viril,
Mundo, España. Recuperado el recuperado el 13 Barcelona, España, Icaria
de septiembre de 2010 en http://www.elmundo.
es/cronica/2002/336/1017050504.html Reintjes, C., (s.f) Economía Solidaria, recuperado
el 13 de septiembre de 2010 en http://www.
Alonso-Fernández, F., (2003) Las nuevas economiasolidaria.org/carta_solidaria.
adicciones, Madrid, España, TEA Ediciones.
Rodà de Llanzà, I. (2007), Mensaje y propaganda
Aristóteles, (1988), Política, Madrid, España, LU LS T\UKV YVTHUV *\YZVZ 4VUVNYmÄJVZ
Gredos. sobre el Patrimonio Histórico, Reinosa, España,
Universidad de Cantabria, pp. 17-35
Duby, G., (1976), Guerreros y campesinos.
Desarrollo inicial de la economía europea. 500- Rostovtzeff, M., (1973) Historia Social y Económica

?=,5*<,5;965(*065(3*65,0** 69
Economía alternativa y redes sociales en línea.

del Imperio Romano, Madrid, España, Espasa


Calpe.
Subirana, P., (1998) Redes de ayuda mutua y
apoyo local, Conferencia, Barcelona, España.

Subirana P., (1999), Ecología para vivir mejor.


Respuestas sostenibles a los retos personales y
sociales. Barcelona, España, Icaria.

Weatherford, J., (1998) La historia del dinero,


Santiango, Chile, Andrés Bello.

SOBRE EL AUTOR
Cecilia Sabido. Doctora en Filosofía por la
Universidad de Navarra. Se ha especializado
en Estética, Filosofía Antigua y Ética Social.
Actualmente imparte materias de humanidades
en el Instituto Tecnológico Autónomo de México
y la Universidad Panamericana. Pertenece a
GIRO, Grupo de Investigación de Redes Sociales
Online, donde investiga sobre la relación de las
redes sociales con la antropología y la literatura.
Es socia fundadora del proyecto TrueQmx, red
social de economía alternativa. correo electrónico:
csabido@up.edu.mx

?=,5*<,5;965(*065(3*65,0** 70
El papel del sonido en el diseño
de los medios interactivos
audiovisuales.
Aspectos retóricos en la construcción
del diseño auditivo.
Miguel Rafael Amador León
UNIVERSIDAD POPULAR AUTÓNOMA
DEL ESTADO DE PUEBLA (UPAEP)

Resumen
 
Este trabajo propone la revisión del papel del sonido en el diseño de medios educativos, audio-
visuales interactivos, puesto que, con una amplia revisión teórica, se encontró que no se le ha
dado mayor importancia. El estudio inicia con un análisis de lo que es el sonido, para entender
sus características básicas; como también conocer, cuál es su participación en las “nuevas” tec-
nologías educativas.

La meta es la construcción de una “imagen sonora”, con estímulos adecuados: voz, música,
efecto de sonido y silencio. Entender los procesos cognitivos en la escucha humana ayudará a la
utilización correcta del sonido. En ese sentido, el presente trabajo incluye recomendaciones para
\UKPZL|VZVUVYVLMLJ[P]VPUJS\`LUKVLZWLJPÄJHJPVULZWHYHPUJS\PYH\KPVLUTLKPVZPU[LYHJ[P]VZ
además de un acercamiento a la propuesta de utilizar la retórica de Aristóteles en este campo del
KPZL|VKLTLKPVZPU[LYHJ[P]VZH\KPV]PZ\HSLZJVUÄULZLK\JH[P]VZ

Actualmente en nuestra sociedad de información se deben concebir interactivos audiovisuales


educativos con un diseño sonoro bien planeado, con elementos de un lenguaje de la “audiovi-
sión”, en donde el sonido y la imagen convivan, creando un lenguaje de síntesis, en donde los
ZPNUPÄJHKVZ ZVU WYVK\J[V KL \UH HKLJ\HKH PU[LYHJJP}U KL SVZ LSLTLU[VZ L_WYLZP]VZ X\L ZL
THUPÄLZ[HULULSOLJOVX\LZLWYVK\JLLULSYLJLW[VY\UHL_WLYPLUJPH\UPÄJHKH

Palabras clave
Diseño, Sonido, Audiovisuales, Retórica, Audio
El papel del sonido en el diseño
de los medios interactivos audiovisuales.

1.   Introducción red tecnológica porque sus principales medios


de acción son los servicios de red social online.
TrueQmx (Truequemex) es una red social en línea TrueQmx se presenta al público como una red social
de intercambio de servicios y bienes reciclables. online que integra diversas herramientas de la web
Funciona como un sistema de economía alternativa 2.0, como un portal de internet y tiene presencia
inspirado en la Doctrina Social y en el proyecto de en medios como facebook, twitter, blogger, y otras
Michael Linton llamado LetSystem. En lugar de redes como Mujeres Construyendo.
utilizar dinero real para el intercambio, se crea una
\UPKHKLZWLJxÄJHKLU[YVKLSZPZ[LTHLULZ[LJHZV 2.   El trueque, la moneda y los tiempos
llamados “puntos eco” o “ecos”. Los participantes críticos: un poco de historia
dentro del sistema integran una comunidad que
intercambia sus servicios, bienes y habilidades. Aristóteles explicó en la Política (I-9, 1257a – 1257b
10) cómo surgen entre los hombres los primeros
Los puntos eco sirven como una moneda,
intercambios de bienes y servicios, y el modo en
ayudan a formalizar el valor de los servicios con
que la complejidad social fue transformando las
una expresión abstracta y facilitan el concepto
transacciones hasta dar lugar al surgimiento de
mismo del intercambio. Entre muchas otras
SHTVULKH,ULSMVUKVKLZ\YLÅL_P}ULSÄS}ZVMV
ventajas frente al sistema monetario real, los ecos
griego destacaba que era necesario considerar
no generan intereses y devuelven valor a ciertas
en todos los bienes dos valores, el de uso y el
realidades del mundo social que quedan fuera del
de cambio.(I-9, 1257a-2) Cada cosa tiene un
sistema de comercio estándar. Desempleados,
]HSVY YLHS X\L JVUZPZ[L LU LS \ZV LZWLJxÄJV X\L
discapacitados, jubilados, amas de casa, jóvenes
puede hacerse de él: los zapatos para caminar,
estudiantes que aún no cuentan con experiencia
los lápices para escribir, etcétera. Sin embargo,
laboral, tienen cabida en este espacio.
absolutamente todas las cosas adquieren un
La plataforma de TrueQmx se encuentra en la valor añadido, el valor de cambio. Para agilizar los
red de habilidades y servicios que los miembros intercambios, al tiempo que las sociedades crecen
están dispuestos a ofrecer y las necesidades y sus necesidades aumentan, se crea un objeto
emergentes que expresan e intercambian. Por especial que represente el valor de cambio de
esta razón, su fortaleza reside en las redes sociales todas las cosas: la moneda (I-9, 1257a-7).
y se transforma en una comunidad que comparte
]HSVYLZ JVTV YLJPWYVJPKHK JVUÄHUaH LZWxYP[\ KL Aristóteles recuerda en su texto que la riqueza, en
servicio y justicia. sentido estricto, no consiste en la acumulación de
dinero, que sólo representa el valor de cambio, sino
Consideramos que TrueQmx es una red social en en los bienes y servicios que pueden adquirirse
dos sentidos: uno humanitario y el otro tecnológico. con él. La moneda simplemente es el principio y
Es una red humanitaria por la interrelación de ÄUKLSPU[LYJHTIPV`LZ\UHYLHSPKHKUVUH[\YHSZ\
individuos que integran una comunidad a través valor se determina por una convención (Moreno,
de nodos de interacción social solidaria. Y es una 1988).

?=,5*<,5;965(*065(3*65,0** 72
El papel del sonido en el diseño
de los medios interactivos audiovisuales.

La moneda, a lo largo de los años, se ha convertido peso. Esto derivó en la creación, a la larga, de las
en la expresión metálica (o material, al menos) de letras de cambio y el papel moneda. (Duby, G.,
cada civilización. En la civilización romana, por 1976).
ejemplo, la moneda se utilizó con frecuencia como
una vía de propaganda, de modo que además En un resumen sumamente lato podemos ver cómo
del valor relativo al peso del metal, se empleaba la historia del dinero es la historia de la abstracción
como un medio de difusión de los ideales que de los valores de cambio. El dinero existe para
el emperador quería que compartieran todos los agilizar las transacciones. Las crisis suelen coincidir
romanos. Ideales como la paz, la concordia, la con los vicios que estas abstracciones conllevan:
prosperidad, se transmitían de mano en mano cuando escaseó el metal o se devaluó, cuando
durante las épocas más felices del imperio. (Rodà se emitió más papel moneda que su respaldo
de Llanzà, I. 2007). metálico, cuando se especuló con la posibilidad
de generar riqueza, independientemente de que
El comportamiento social del comercio y la esta efectivamente se produjera (Weatherford, J.
moneda en el transcurso de la historia arroja datos 1998). En momentos como estos, es necesario
interesantes, por ejemplo, los romanos jugaron revisar prioridades y procedimientos y buscar la
T\JOV JVU LS KPULYV! NLULYHYVU PUÅHJPVULZ ` salud del sistema.
KL]HS\HJPVULZ X\L KLYP]HYVU ÄUHSTLU[L K\YHU[L
la crisis política del siglo III en la paralización Son numerosos los ejemplos que muestran la
del comercio: las cecas (casas de moneda) se necesidad de repensar la economía y buscar
detuvieron –o peor aún, se multiplicaron- y el alternativas. Entre ellas, con frecuencia aparece el
comercio terminó por volver al sistema básico: al trueque, no sólo por la falta de dinero circulante,
comercio local, y al trueque. (Rostovtzeff, 1926). sino por el innegable valor social que desde siempre
ha conllevado. Diversos autores coinciden en que,
En tiempo de Carlomagno se procuró controlar si el trueque no se ha extinguido, es porque “sirve
el valor de cambio del imperio entre los feudos: para establecer lazos de amistad y alianzas con
PU[LU[} WVULY \UH TVULKH ‚UPJH ` ÄQHY WYLJPVZ V[YVZ NY\WVZ V IPLU WHYH HÄHUaHY SHZ YLSHJPVULZ
Llama la atención en esta época que utilizara sociales existentes en el interior del propio grupo”.
valores nominales, como el “sous” o sueldo, (Grau y Chalaux, 1984)
independiente del valor de las monedas circulantes.
(Nadie tenía sueldos, pero se sabía que un caballo 3.   (U[LJLKLU[LZJVUJYL[VZÄJ[PJPVZ`
equivalía en sueldos a dos yeguas). Este sistema reales
facilitó dar valores equivalentes, a pesar de la falta
de metálico, de modo que aún en los trueques ;Y\L8T_ Z\YNP} H WHY[PY KL \UH YLÅL_P}U HJLYJH
internos quedaba establecido el valor de un de la presente crisis económica. Nos dábamos
objeto. Además, las pocas monedas circulantes cuenta de que la riqueza existe y que algo ajeno a
se relacionaron con el sueldo por su material y su ella la paralizaba. Muchos recursos y habilidades

?=,5*<,5;965(*065(3*65,0** 73
El papel del sonido en el diseño
de los medios interactivos audiovisuales.

simplemente no son “comerciales” de modo cotidianamente en sistemas cerrados, como el


VÄJPHSWLYVUVWVYLSSVJHYLJLUKL]HSVYYLHS7VY familiar o el amical, y en ejercicios lúdicos. (Reintjes,
ejemplo, quien tiene habilidad para conversar con C., 2010).
ancianos, tiempo libre para ayudar con trámites,
explicar materias, dar consejos, realizar labores El aspecto lúdico tiene una contribución
manuales, etcétera. La intención que tuvimos fue ZPNUPÄJH[P]HLULSmTIP[VKLSH^LI+LZKLZ\
“revalorar” los bienes y las habilidades y crear un creación, internet no duró mucho tiempo como
espacio donde se pudieran intercambiar de modo una herramienta exclusivamente de trabajo: el
LÄJPLU[L]LYZm[PS`KPUmTPJV ocio tomó forma y contribuyó en gran medida a
SH PU[LNYHJP}U KL SHZ YLKLZ ZVJPHSLZ 4VKPÄJH `
Cuando pretendíamos explicar nuestra iniciativa, compromete la participación del usuario, porque el
las referencias que mayor eco hicieron en nuestros ambiente lúdico genera pertenencia, competencia
PU[LYSVJ\[VYLZ M\LYVU ÄJ[PJPHZ TmZ X\L YLHSLZ! y compromiso personal.
la cinta de Mimi Leder, “Pay it Forward” (2000)1
y la serie “Los Simuladores” (2008). En ambas Haciendo a un lado las evidentes críticas al
producciones visuales se presenta la idea de crear ámbito lúdico en los servicios de red social, se
redes de ayuda o cadenas de favores donde la debe considerar que la psicología del usuario
“deuda” es un compromiso personal de servicio y genera dinámicas de aprendizaje y socialización
no de dinero. a través del juego. Además, el tiempo adquiere
otro valor cuando se invierte en estas actividades:
Otro ejemplo que daba resultado fue el de los deja de vivirse de modo lineal –una mera
puntos que se acumulan por jugar juegos de secuencia de acontecimientos- para expandirse
video: alcanzar objetivos, generar sistemas de psicológicamente hacia varios puntos de
recompensa a partir de actividades que, en conciencia. Es decir, en lugar de dejar un simple
esencia, no te cuestan nada inicialmente, pero te pasar el tiempo, la inversión lúdica transforma el
permiten crecer en oportunidades, experiencia y tiempo en “vivencia”.
elementos de interacción.
Esa vivencia acumula experiencia y genera el
Estos ejemplos son relevantes porque nos deseo de repetirla. Instaura un punto de referencia
muestran dos elementos indispensables para en la experiencia vital, que, además, se enriquece
comprometerse con un proyecto como éste: por empatía con las vivencias de otros individuos
en primer lugar, el hecho de que la práctica del que sienten lo mismo que uno, o han participado
trueque no es ajena a la sociedad actual: se de la misma actividad. Este fenómeno ocurre en
considera creativa y pertinente. En segundo lugar, [VKVZSVZmTIP[VZÄJ[PJPVZ`LZKPNUVKLVIZLY]HYLS
se trata de actividades y procesos que realizamos hecho de que en las redes sociales y la interacción
virtual se generen procesos semejantes.
1 También conocida en español como “Cadena de
favores”.

?=,5*<,5;965(*065(3*65,0** 74
El papel del sonido en el diseño
de los medios interactivos audiovisuales.

Aun cuando lo que se experimente se ocurra en El primero que llamó nuestra atención fue el
un ámbito no lúdico, como una colaboración o sistema llamado “LETSystem”, creado en Canadá
una junta a distancia, una discusión en un foro, por Michael Linton durante los años 80. A partir de
SH JVUÄYTHJP}U KL \U N\Z[V LU MHJLIVVR V LS Z\ZYLÅL_PVULZZLOHUKLZHYYVSSHKVJVT\UPKHKLZ
seguimiento de un acontecimiento en twitter, la por todo el mundo que contribuyen a un proyecto
actividad virtual comunitaria tiene herramientas hoy más amplio llamado “Open Money”. En la
WHYHMVY[HSLJLYSHaVZZVJPHSLZSSLUVZKLZPNUPÄJHKV página web de ambos proyectos hay herramientas
(Alonso-Fernández, F., 2003) para aplicar LETSystem en comunidades
concretas, jugar con las posibilidades de la
Por estas razones, al planear TrueQmx como una economía alternativa e intercambiar experiencias
red social online de ayuda mutua tenemos la que mejoren los proyectos mismos. (http://www.
aspiración de convocar la conducta comprometida, openmoney.org)
vivencial y comunitaria de las asociaciones virtuales.
Contamos con la inevitable correspondencia LETSystem o “Local Exchange Trading System”
nodal de crecimiento que da la participación, es una propuesta alternativa de organización
cuando la red es la oportunidad de ampliar económica aplicable en cualquier comunidad.
]xUJ\SVZ KL HTPZ[HK ZVSPKHYPKHK ` JVUÄHUaH (Zx Consiste en una red económica autorregulada,
como TrueQmx valora las habilidades y recursos que permite a sus miembros generar y administrar
de sus miembros, también considera parte de su una moneda virtual completamente legal e
riqueza toda la red propia de relaciones de cada independiente del sistema federal monetario. Las
participante, porque la vincula con el sistema y herramientas de LETS permiten a las comunidades
enriquece sus opciones. el intercambio de bienes y servicios en tiempo de
crisis.
4.   TRUEQMX como economía
LETS funciona como una cuenta bancaria: un
alternativa
miembro de la comunidad ofrece algún producto
o servicio y gana, quien recibe el servicio queda
Iniciamos una investigación para saber si existían
en deuda y deberá compensarla con sus propias
proyectos similares y encontramos diversos
ofertas. El sistema mantiene el balance porque
sistemas de economía alternativa por todo el
algunos miembros tienen crédito a favor, que
mundo. Con frecuencia pensamos que el trueque
corresponde a la deuda de otros.
es cosa del pasado. Sin embargo, descubrimos
sistemas actuales que aplican trueque directo
Hay casos de comunidades que llegan a un
e indirecto en economías locales, sobre todo
acuerdo con el ayuntamiento local. Tal es el
rurales, principalmente en países que llamaríamos
caso de “La Troca”, comunidad LETS pionera en
“de primer mundo”.
España, fundada por Pere Subirana en Vilafranca
del Penedés, Cataluña. Partiendo del principio de
que LETS fortalece el desarrollo de la economía

?=,5*<,5;965(*065(3*65,0** 75
El papel del sonido en el diseño
de los medios interactivos audiovisuales.

local, los miembros de la comunidad ofrecen el dinero virtual es solo una medida de
servicios que el ayuntamiento no está en posición intercambio, de modo que es inagotable
de resolver y mejoran la vida de la sociedad y además genera igualdad en todos los
entera. En última instancia, un sistema como éste usuarios sin importar su estrato económico
agiliza la participación que es indispensable en el típico.
mejoramiento de la calidad de vida de cualquier % ,SKPULYVVÄJPHSZLHJ\T\SHZLJVTWYHZL
sociedad. (Subirana, P., 1998) vende y es “caro”. La moneda virtual no
tiene caso acumularla, es en realidad una
En el mejor de los casos, la economía alternativa medida de la riqueza que ha sido creada y
podría sustituir el dinero formal, pero en el sentido está al alcance de todo el mundo.
más práctico, convive con él adecuadamente. Los % ,SKPULYVVÄJPHSLZ[mZ\QL[VHSVZTLJHUPZTVZ
puntos, las horas, la moneda virtual no sustituyen de interés que en los sistemas de moneda
el dinero: lo reubican. Se solucionan muchas virtual no pueden (o al menos no deben)
necesidades con recursos alternativos y se deja el generarse, ni para quien presta el servicio ni
dinero para lo urgente o importante. Señala Pere para quien contrae la deuda de reciprocidad.
:\IPYHUHX\LLSKPULYVVÄJPHSLZULJLZHYPVJ\HUKV % ,S KPULYV VÄJPHS LU Z\TH UV YLWYLZLU[H
más nos alejamos del ámbito familiar o local. la riqueza real. Se ha convertido en una
Sistemas como LETS complementan el sistema abstracción especulativa que no tiene
TVUL[HYPV VÄJPHS UV SV Z\Z[P[\`LU 4mZ H‚U SH respaldo, ni en oro ni en bienes y genera
existencia de sistemas alternativos de intercambio crisis (como la originada por los fraudes
PU]P[H H \UH YLÅL_P}U TmZ JVTWYVTL[PKH ZVIYL de las compañías aseguradoras en 2009),
los vicios de la economía contemporánea que TPLU[YHZ SH TVULKH ]PY[\HS LZ LS YLÅLQV KL
Subirana esboza adecuadamente en su ensayo la riqueza concreta: bienes que se han
sobre Redes de Ayuda Mutua (1998): intercambiado y servicios que se realizado
efectivamente.
% ,SKPULYVVÄJPHSZLJYLHLUNY\WVZKLWVKLY
controlado por agentes externos, mientras Otro sistema de economía alternativa es la
el dinero virtual se crea a medida que el comunidad creada en Ithaca, Nueva York. Fue
usuario lo necesita. creada en 1991 por Paul Glover. Durante un
% ,S KPULYV VÄJPHS ZL KPS\`L V ZL KPZ[YPI\`L periodo de crisis económica, este hombre impulsó
en instrumentos como los impuestos y el intercambio de horas de servicio entre los
el consumo, mientras el dinero virtual se miembros de la comunidad. En el caso de Ithaca,
queda como riqueza de la comunidad y se se imprimen billetes que avalan las transacciones
reinvierte en el grupo. de “Horas”.
% ,S KPULYV VÄJPHS ZL JVUJLU[YH LU WVJHZ
manos, provoca escasez de dinero a Modelos semejantes han dado lugar a los llamados
disposición de las personas y genera una “bancos del tiempo”. En estas comunidades, los
brecha entre ricos y pobres, mientras créditos de tiempo se depositan en un banco,

?=,5*<,5;965(*065(3*65,0** 76
El papel del sonido en el diseño
de los medios interactivos audiovisuales.

pueden ser “retirados” para gastarse en cualquier Además, se han creado círculos asociados de
momento en cualquiera de los servicios que comunidades semejantes por todo el mundo.
ofrezcan los demás usuarios. Normalmente, se Crecen y se complementan de modo exponencial.
utiliza la hora como criterio unitario. A diferencia En un solo año de trabajo, hemos visto crecer la lista
de LETS, los bancos del tiempo se dedican de posibilidades y el modo de proceder de cada
LZWLJxÄJHTLU[L HS PU[LYJHTIPV KL ZLY]PJPVZ :\ una. Las redes sociales no se forman únicamente
versatilidad consiste en que en ocasiones no es el por la concurrencia con el medio: ante todo se
dinero lo que falta, sino el tiempo para cumplir con implica la coincidencia de valores e ideologías que
VIQL[P]VZ LZWLJxÄJVZ ,U ,ZWH|H SVZ )HUJVZ KLS se descubren y se comparten. Las comunidades
Tiempo están en auge debido a la crisis mundial. La de economía alternativa se han encontrado de
bibliografía al respecto es abundante y constante: este modo y es cosa de tiempo saber si se ha de
tan sólo en este año se han publicado con gran crear un medio tan potente como twitter, facebook
éxito: “Vivir sin Empleo”, de Julio Gisbert y “Vivir sin o google para hacer coincidir estos esfuerzos o si,
Dinero” de la alemana Heidemarie Schwermer. como ha venido sucediendo, todas las iniciativas
van migrando e interactuando en los medios de la
La propuesta de TrueQmx en este caso resultaba web.
innovadora por al menos dos razones, la primera:
no hay comunidades mexicanas vinculadas aún a ,_PZ[LU OLYYHTPLU[HZ KLÄUPKHZ JVTV *`JSVZ
los sistemas de economía alternativa. La segunda, (http://project.cyclos.org/) un programa
que la propuesta de TrueQmx desde el principio de e-banking especialmente dedicado a
surgió como una comunidad virtual abierta y economía alternativa, desarrollado en común
con presencia online, no meramente local como por programadores brasileños y uruguayos en
ocurría en la mayoría de los proyectos originales 2003. Hoy día, Cyclos presta servicios a muchas
de economía alternativa. JVT\UPKHKLZ KL TPJYVÄUHUaHZ IHUJVZ KLS
tiempo, LETS y proyectos semejantes por todo el
5.   TRUEQMX como red social en línea mundo. Los países registrados que más participan
con esta herramienta son Alemania, Australia,
Indudablemente, los proyectos que iniciaron entre España, Holanda, entre otros. Su aplicación
los años 80 y el 2000 se han visto enormemente requiere recursos informáticos poderosos y una
ILULÄJPHKVZ WVY LS Z\YNPTPLU[V KL 0U[LYUL[ ` LS programación dedicada, pero está en constante
desarrollo de las tecnologías de comunicación: evolución y ya integra SMS y herramientas móviles
la creación de blogs, portales, la posibilidad de para realizar anuncios y formalizar intercambios.
compartir información gratuita, de colaboración en Es ideal para comunidades grandes y bien
línea, aplicaciones móviles, etcétera, han facilitado establecidas. Desde luego, es una paquetería que
la administración de los bancos del tiempo y las opera bajo un sistema de Open Source o código
monedas virtuales. abierto.

?=,5*<,5;965(*065(3*65,0** 77
El papel del sonido en el diseño
de los medios interactivos audiovisuales.

Como proyecto en fase beta se encuentra Kroonos, elevada aceptación. En un contexto como México,
(http://www.kroonos.com) que se anuncia como el que es el nodo inicial de la red (opera también en
“primer banco del tiempo global en Internet”. Es Miami y Los Ángeles), destaca la preocupación por
\UHYLKZVJPHSX\LPU[LNYH[VKVZSVZILULÄJPVZKL la seguridad de los usuarios. Hasta el momento,
la Web 2.0. Para poder entrar a este sistema es la única solución viable ha sido el monitoreo
necesaria una invitación, que se puede conseguir constante del procedimiento en las transacciones.
en el foro o en el grupo de Facebook, pero ha
tenido problemas en últimas fechas. Como empresa, ha sido difícil encontrar un
LZ[H[\[V SLNHS HWYVWPHKV KLÄUPY SVZ SxTP[LZ ` SH
/H`WmNPUHZX\LWYVWVULUPU[LYJHTIPVZLZWLJxÄJVZ! responsabilidad de TrueQmx en los intercambios.
conocimientos (http://prestaquenadatecuesta. Ha sido necesario replantear la estructura
org), de libros (http://www.bookcrossing-spain. operativa conforme se multiplican las posibilidades
com), objetos reciclados (http://www.nolotires. y el interés de los miembros en participar
com/), aprendizaje de idiomas, (http://www.loquo. directamente, como ayuda base. Como negocio,
JVT LS MHTVZV ¸JV\JOZ\YÄUN¹ \UH LZWLJPL KL TrueQmx ha resuelto su sustentabilidad con
alojamiento, donde ofreces el sofá de tu casa espacios comerciales y patrocinadores: al usuario
por una hora o para pasar la noche- (http://www. se le ofrece como incentivo algún descuento o
JV\JOZ\YÄUNVYN  PUJS\ZV YL[LQPKV KL WYLUKHZ! trato preferencial en las empresas patrocinadoras.
(http://www.rekn.it/), por mencionar algunos de (Durante la negociación de un patrocinio, surgió
un larguísimo etcétera. En torno a las experiencias también la posibilidad de iniciar un programa piloto
vividas en cada intercambio, las páginas de estos dentro de una gran empresa, para estimular el
sitios van abriendo herramientas de interacción trueque y los intercambios entre sus trabajadores.
que van desde testimoniales hasta foros. Crean, Buscaban una manera de mejorar su calidad de
JVTVJ\HSX\PLYV[YHWLYZVUHVLTWYLZH\UWLYÄS ]PKH KL TVKVZ TmZ LÄJHJLZ ` K\YHKLYVZ X\L LS
en facebook o twitter y fortalecen sus vínculos de solo aumento de sueldo).
pertenencia en los ámbitos más representativos
de la web 2.0. El intercambio se convierte, en la 3H KPÄJ\S[HK KL LZ[HISLJLY \UH YLK ZVJPHS LU LS
mayor parte de los casos, en el primer paso de la sentido tecnológico requiere la programación de
creación de una comunidad sólida. un portal dinámico, la incorporación de espacios
de interrelación entre usuarios interesados en
6.   Los retos de TRUEQMX conocer el proyecto tanto como en los usuarios
ya activos. Hace falta que los usuarios se integren
Lograr el lanzamiento de la fase beta de TrueQmx a la dinámica virtual y que participen con cierta
ha supuesto diversos retos. Como concepto, regularidad.
establecer una red social en el sentido humanitario
de la palabra radica, sobre todo, en la falta de Intentamos integrar Cyclos, pero es una herramienta
claridad en el concepto de economía alternativa. muy poderosa para involucrarla en la fase beta del
Una vez salvado el escollo, la idea tiene muy proyecto y consume recursos que no se pueden

?=,5*<,5;965(*065(3*65,0** 78
El papel del sonido en el diseño
de los medios interactivos audiovisuales.

ÄUHUJPHYLU\UHL[HWHPUPJPHS+\YHU[LSHMHZLIL[H una forma real de economía alternativa, crear el


hemos tenido la oportunidad de poner a prueba el funcionamiento de redes solidarias integrando
proyecto en carne propia, y hemos contado con una perspectiva humanística con la versatilidad
proveedores que han estado dispuestos a colaborar de los servicios y sistemas tecnológicos de punta.
en la creación y el mantenimiento del servicio. ;Y\L8T_WYVT\L]LSHYLJPWYVJPKHKSHJVUÄHUaH`SH
No obstante, por momento hemos migrado a un responsabilidad y el aprovechamiento de recursos,
ambiente más sencillo, con la intención de facilitar en un ámbito social de economía creativa.
el acceso y la interacción de los usuarios.
TrueQmx es un proyecto que involucra al hombre
Durante los primeros seis meses de funcionamiento, en un sentido integral, nos da la oportunidad de
TrueQmx ha vinculado a más de 500 usuarios, tiene operar de un modo distinto y así poder tener
una centena de miembros activos, ha realizado una mejor calidad de vida, menos estrés, mejor
más de 30 tipos de intercambio efectivos, además administración de nuestros recursos y talentos.
de servicios publicitarios y comunitarios. La página Busca llegar a lo más profundo del hombre, su
tiene un promedio de 2,500 visitas mensuales esencia, el darle sentido a su vida, recreando su
y cuenta con 16 empresas patrocinadoras. En universo, compartiendo y reutilizado los recursos
general, ha movido un valor monetario virtual que están a su alcance. Pone al hombre por
aproximado de 7,500 ecos y ha generado un encima de los bienes materiales. El ser por encima
aproximado de 11,500 ecos en total. del tener.

TrueQmx necesita mantenerse a la vanguardia en


la tecnología y una infraestructura sólida. Para ello Bibliografía
es indispensable tener servicios informáticos de
primer nivel y la atención constante del sistema y Alonso Montes, A., (24 de marzo de 2002) Pobre
los usuarios. También requiere medios para atender por vocación. Heidemarie Schwermer, Crónica, el
las necesidades de los miembros de la comunidad, Mundo, España. Recuperado el recuperado el 13
garantizar la seguridad de la información y de los de septiembre de 2010 en http://www.elmundo.
usuarios durante los procesos de intercambio. Para es/cronica/2002/336/1017050504.html
poder dar un servicio competitivo es necesario
integrar un equipo profesional de trabajo de tiempo Alonso-Fernández, F., (2003) Las nuevas
completo que responda oportunamente a todas adicciones, Madrid, España, TEA Ediciones.
las instancias de actividad social y económica que
vincula. Aristóteles, (1988), Política, Madrid, España,
Gredos.
Como conclusión: la misión de TrueQmx es crear
cadenas de valor integrales, que ofrezcan la Duby, G., (1976), Guerreros y campesinos.
posibilidad de solucionar un problema a cambio de Desarrollo inicial de la economía europea. 500-
ofrecer un servicio proporcional. Su visión es generar 1200. Madrid, España, Siglo XXI

?=,5*<,5;965(*065(3*65,0** 79
El papel del sonido en el diseño
de los medios interactivos audiovisuales.

Estallo, J. A., (2001) Usos y abusos de Internet, Subirana, P., (1998) Redes de ayuda mutua y
Anuario de Psicologia, Barcelona, España, apoyo local, Conferencia, Barcelona, España.
Facultad de Psicología, (n. 32-2, 2001) pp. 95-108
Subirana P., (1999), Ecología para vivir mejor.
Glover, P., (2000) A History of Ithaca HOURs, Respuestas sostenibles a los retos personales y
recuperado el 13 de septiembre de 2010 en sociales. Barcelona, España, Icaria.
http://www.lightlink.com/hours/ithacahours/
archive/0001.html Weatherford, J., (1998) La historia del dinero,
Santiango, Chile, Andrés Bello.
Grau Figueras, M., y Chalaux de Subirà, Agustí.,
(1984) Moneda telemática y estrategia de
SOBRE EL AUTOR
mercado, Barcelona, España, Centro de Estudios Miguel Rafael Amador León. Licenciado en Cien-
Joan Bardina cias de la Comunicación. Maestro en Diseño de
Información
Lang, P., (1994). LETS Work: Rebuilding the Local
Economy. Oxford, Inglaterra, Grover Books.

Linton, M., y Yacub, E., (s.f) Open Money,


recuperado el 13 de septiembre de 2010 en http://
subsol.c3.hu/subsol_2/contributors0/lintontext.
html

Moreno, A., (1988) La otra política de Aristóteles:


cultura de masas y divulgación del arquetipo viril,
Barcelona, España, Icaria

Reintjes, C., (s.f) Economía Solidaria, recuperado


el 13 de septiembre de 2010 en http://www.
economiasolidaria.org/carta_solidaria.

Rodà de Llanzà, I. (2007), Mensaje y propaganda


LU LS T\UKV YVTHUV *\YZVZ 4VUVNYmÄJVZ
sobre el Patrimonio Histórico, Reinosa, España,
Universidad de Cantabria, pp. 17-35

Rostovtzeff, M., (1973) Historia Social y Económica


del Imperio Romano, Madrid, España, Espasa
Calpe.
?=,5*<,5;965(*065(3*65,0** 80
Enrédate.
Tecnologías Comunitarias:
Experiencia de la comunidad rural Lequeitio,
municipio de Francisco I. Madero, Coahuila
Mayra Viridiana Olivares Gómez
M.C. José Alfredo Morales Pérez
Dra. Blanca Chong López
FACULTAD DE CIENCIAS POLÍTICAS Y SOCIALES
UNIVERSIDAD AUTÓNOMA DE COAHUILA. UNIDAD TORREÓN

  
Antecedentes. Bilbao y a solicitud de las autoridades educativas
del lugar, de nueva cuenta se llevó a cabo el
Enrédate. Tecnologías Comunitarias ha sido desde proyecto Enrédate, Tecnologías Comunitarias en
poco tiempo atrás, además de un proyecto de la primaria del ejido Tejaban de la Rosita, también
investigación acción participativa, un ejercicio pertenecientes al municipio de Viesca, Coahuila.
metodológico en la réplica de una iniciativa
comunitaria desarrollada durante el 2007 por En el 2010 se volvió a ejecutar el proyecto en
los integrantes de la Universidad de Colima, en la comunidad rural de Lequeitio, perteneciente
núcleos rurales marginados de ese propio estado. al municipio de Francisco I. Madero, Coahuila.
Cabe aclarar que el trabajo que se realiza en
Las experiencias logradas se compartieron con las comunidades, es parte del conjunto de
integrantes de otros cuerpos académicos de las actividades de la red sobre Cultura, Comunicación,
universidades de Coahuila y de Nuevo León, eso Tecnologías y Desarrollo que han conformado las
motivó el interés por echar andar un proyecto universidades de Colima, Autónoma de Coahuila
de estas características en la Región lagunera y y la Autónoma de Nuevo León.
se concretaron acciones durante el 2008 para
trabajar con la réplica de ese modelo en los ejidos El propósito del proyecto es el de promover el
de Boquilla de las Perlas y Tejaban de la Rosita, en empoderamiento y desarrollo sostenible de las
el 2009, trabajó nuevamente este proyecto en los comunidades rurales marginadas, a través del uso
núcleos rurales de Venustiano Carranza, Villa de de metodologías participativas (IAP), encaminadas
Enrédate. Tecnologías Comunitarias

a la apropiación creativa de las Tecnologías trabajadas con el proyecto Enrédate, tecnologías


de Información y Comunicación, a través de la Comunitarias, se ha evidenciado el escaso o nulo
investigación acción participativa (Zermeño: 2007) acceso a las computadoras con o sin servicio de
Internet. Los gobiernos estatales-para el caso de
Con la IAP, se ha trabajado en grupos denominados Coahuila- han emprendido programas para dotar
“Semilla”, compuestos por niñas y niños de a las escuelas y comunidades rurales marginadas,
educación básica, preferentemente de V y VI año, de infraestructura tecnológica pero esta ha sido
quienes con asesorías y apoyo de tutores (alumnos PUZ\ÄJPLU[L ` ZPU WYV`LJ[VZ H SHYNV WSHaV X\L ZL
de las licenciaturas de Sociología y Ciencias de sustenten en experiencias o en iniciativas de leyes
SH *VT\UPJHJP}U YLHSPaHU WYV`LJ[VZ LZWLJxÄJVZ educativas.
procurando que a su vez se desarrollen una serie
de competencias instrumentales, además de 6[YVZ HJHKtTPJVZ HÄYTHU KL SH L_PZ[LUJPH KL
LQLYJPJPVZJYx[PJVYLÅL_P]VZWHYHX\LHWHY[PYKLSH una brecha digital que tiene tres dimensiones:
KPZJ\ZP}U NY\WHS ZL SVNYLU PKLU[PÄJHY WYVISLTHZ la tecnológica, que provee la infraestructura
sociales en la comunidad en la que se vive, a necesaria para la incorporación a la sociedad de
ÄU KL WYVWVULY ZVS\JPVULZ \[PSPaHUKV LU [VKV la información y el conocimiento; de conocimiento
este proceso, las Tecnologías de Información y , referida a las habilidades y saberes que deben
Comunicación (TIC). poseer los individuos para que sean capaces de
apropiarse de las herramientas tecnológicas y
Analfabetismo Tecnológico y Desigualdad H WHY[PY KL LSSV TVKPÄJHY Z\Z WYmJ[PJHZ J\S[\YHSLZ
Social. cotidianas, la otra dimensión, la que está compuesta
por la participación, que da cuenta de los recursos
Sobre el fenómeno de la desigualdad social se ha que aporta la convergencia tecnológica y puedan
escrito de manera amplia y profunda, las diferentes ser empleados de tal forma que los individuos y
ciencias sociales han hecho desde su aparato las naciones tengan las mismas oportunidades
crítico énfasis en un sinnúmero de factores que la para manifestarse, participar e intervenir en las
generan y de los efectos que ella trae. En esta nueva decisiones globales de la sociedad (Crovi:2002).
era se ha dado particular atención en el uso de las
TIC, que son también parte de esa desigualdad En este marco hemos hecho lo posible por sustentar
social y que han provocado una distancia o brecha parte de nuestras actividades de interpretación
cultural pues no todos los sectores sociales tienen y desarrollo del proyecto, buscando no aislar las
acceso a las TIC. dimensiones, considerarlas y procurando atender
necesidades para que en lo referente a la brecha
Para algunos estudiosos, se ha generado un nuevo digital, la hagamos más estrecha en la medida de
[PWVKLHUHSMHIL[PZTVKLÄUPKVJVTVSHPUJHWHJPKHK nuestros alcances y limitaciones de una práctica
para acceder al conocimiento que se desarrolla a universitaria en comunidades rurales.
partir del uso de esas nuevas tecnología (Área,
2002). En el caso de las comunidades rurales

?=,5*<,5;965(*065(3*65,0** 82
Enrédate. Tecnologías Comunitarias

La experiencia en la comunidad rural lequeitio, JHZVKLU\LZ[YV]LOxJ\SVVÄJPHSKLSH<UP]LYZPKHK


municipio de Francisco I. Madero, Coahuila. no estuviera dispuesto para las fechas en que
El proyecto se desarrolló del 15 de mayo al 07 de agendaríamos nuestras actividades.
julio de 2010, después de haber realizado varios
recorridos en otras comunidades y descartado Participación y compromisos
posibilidades, en razón de que no contaban con comunitarios.
SVZZ\ÄJPLU[LZHS\TUVZLUSVZNYHKVZKL=`=0KL
WYPTHYPH X\L M\L LS JHZV KLS LQPKV LS WHJxÄJV KLS Se acordó con al directora del plantel de convocar
municipio de Torreón Coahuila y la otra, de nombre a una reunión con los padres de los alumnos de V
Mieleras tres, que colindaba entre los límites de los y VI año, para explicarles el contexto general del
municipios de Viesca y Torreón, también ambos proyecto, lo gratuito del mismo pero el compromiso
del estado de Coahuila, porque la infraestructura que se debería de asumir por parte de todos los
mínima requerida- luz eléctrica- para la operación involucrados y participantes, pues las niñas y niños
KLSWYV`LJ[VUV[LUxHSHZ\ÄJPLU[LJHWHJPKHKWHYH no deberían de faltar a las sesiones de trabajo que
SHL[HWHÄUHSKLSTPZTV demandaba la planeación de las actividades.

Al visitar el ejido Lequeitio por los integrantes del En asamblea se acepta participar con 20 niños,
cuerpo académico “Sociedad, Comunicación y de manera responsable, conjuntamente con la
Cultura” y a propuesta de una extutora, participante dirección de la escuela, se nos deja un margen de
en Enrédate 2009 y que habita cercana a ese tiempo para que las autoridades universitarias nos
lugar, nos dimos cuenta de que la escuela primaria aprueben el monto económico requerido por el
tenía una sala con más de diez computadoras de proyecto y de las etapas en las que administraríamos
YLN\SHYJHSPKHK`JVU]VS[HQLZ\ÄJPLU[LWHYHVWLYHY SVZ YLJ\YZVZ ÄUHUJPLYVZ *HIL HJSHYHY X\L SH
simultáneamente esos equipos, sin riesgo de universidad autónoma de Coahuila, lanzó una
interrupciones debido a la baja de voltaje eléctrico. convocatoria meses atrás, para participar con
proyectos de investigación denominados “grupos
La actitud de la directora y del personal que semilla”, el dictamen nos favoreció y sólo había que
colaboraba con ella, también nos hizo saber que esperar a que nos liberaran los recursos, eso se
estaban interesados porque el proyecto se echara les explicó a la asamblea de padres y autoridades
andar en ese lugar. Previo intercambio de ideas, escolares de la localidad rural de Lequeitio,
observando las condiciones generales del ejido, municipio de Francisco I. Madero, Coahuila.
concluimos que había condiciones mínimas para la
ejecución de nuestro proyecto, pues el núcleo rural El arte de Enredarte y la operación del
contaba con una población idónea para trabajar proyecto.
ahí.
Aprobado nuestro proyecto que fue avalado por los
El acceso al ejido no era problema pues había una responsables de los diferentes cuerpos académicos
línea de camiones que nos podía transportar en que participan en la red de universidades,

?=,5*<,5;965(*065(3*65,0** 83
Enrédate. Tecnologías Comunitarias

empezamos a trabajar en reuniones y talleres de niños de diferentes temáticas: medio ambiente,


capacitación con los estudiantes universitarios derechos de las niñas y los niños, cultura local y
involucrados en el mismo, estos fueron invitados narrativa, simultáneamente se les habilitaba en el
` ZLSLJJPVUHKVZ LU M\UJP}U KL Z\ WLYÄS 3H manejo de los distintos instrumentos tecnológicos
capacitación se denominó: “El arte de enredarte: y se desarrollaban las actividades planeada en
taller para la gestión de investigación comunitaria” un día previo a la sesión de trabajo en la escuela
con una duración de 20 horas y como parte del primaria del lugar.
proyecto enrédate hacia un modelo de inclusión
digital para el trabajo académico y comunitario. La Cada reunión de planeación adquiría una dinámica
coordinación general descansó en la Dra. Ana Isabel muy particular, además de rendir un informe
Zermeño Flores, de la Universidad de Colima, que cada tutora, se exponían e intercambiaban las
forma parte de la Corporación Universitaria para experiencias de esa jornada sabatina, que iniciaba
el Desarrollo de Internet, A.C. (CUDI) así como en en punto de las 9.00 y terminaba a las 13:00 horas,
la Dra. Blanca Chong López, por la universidad con un lapo de descanso de quince minutos. Por
Autónoma de Coahuila y responsable del cuerpo cada sábado se asignaba una responsable de
académico “Sociedad, Comunicación y Cultura”. coordinar de manera interna las actividades, con
la ayuda y asesoría de un profesor integrado al
Nuevas experiencias: Una plataforma de proyecto. Se elaboraba un plan de trabajo con
trabajo, para Enredarte. sus respectivos tiempos, objetivos, requerimientos
` JSHYPÄJHIHU LS [PWV KL OHIPSPKHKLZ X\L ZL
En las anteriores réplicas del proyecto Enrédate, impulsarían en esa visita al grupo de niños. Cuando
desarrolladas durante el 2008 y 2009, se trabajó la coordinadora general del proyecto requería de
bajo un esquema de Coordinación General, entre un informe más estructurado, nos lo indicaba a
los representantes de las Cuerpos Académicos. través del sitio electrónico –plataforma- para que
En el 2010, se diseñó y puso en marcha una ahí se hiciera el llenado de reporte o evaluación
plataforma http://enredate.ucol.mx mediante la mediante un instrumento.
cual sirviera como espacio de orientación, guía
y coordinación de todas nuestras actividades de En el arte de enredarte No todo fue miel
operación, recopilación de información y de las sobre hojuelas
tareas por desarrollar, dentro de la nueva versión-
réplica Enrédate 2010. El proyecto demandaba concreción de actividades
LUWYVK\J[VZLZWLJxÄJVZLZKLJPYSHMVYT\SHJP}U
Sesiones de trabajo para Enredarse con de subproyectos por parte de los equipos de
Tecnologías Comunitarias. trabajo. Cada grupo de niñas y niños, con el apoyo
de sus tutoras, decidieron abordar temáticas de su
En las primeras sesiones sabatinas – de un interés, prevalecieron las del medio ambiente y los
total de nueve- a las que se denominaron de derechos de las niñas y los niños. En la ejecución
sensibilización, se trabajaron con las niñas y de las tareas se utilizaron diversos equipos como

?=,5*<,5;965(*065(3*65,0** 84
Enrédate. Tecnologías Comunitarias

la videograbadora, grabadora digital de voz, estas El gran salto: El uso y familiarización de la


fueron las más solicitadas, aunque en el ejercicio plataforma del proyecto.
de las sesiones sabatinas se les enseño a usar,
LS LZJmULY SH JmTHYH MV[VNYmÄJH KL ]PKLV ` SH :PNUPÄJ} \UH U\L]H WYmJ[PJH ` HJ[P[\K WHYH SH
grabadora de voz. mayoría involucrada en el proyecto pues no
teníamos antecedentes de trabajo mediante el uso
El que un grupo e niña y niños deban elaborar un de una plataforma ni mucho menos hacerla parte
plan y ejecutarlo, es algo difícil pero no imposible, de nuestra rutina, tanto para las tutoras como para
pues en su formación escolar no hay antecedentes los profesores integrantes del cuerpo académico.
o experiencias de campo que hayan sido realizado En esta parte del proyecto- uso de la plataforma-
con la ayuda de su profesor. Las tutoras tuvieron los niños la fueron conociendo y familiarizando
KPÄJ\S[HKWHYHX\LSV[\[VYHKVZZLJLU[YHYHULUSH mediante sesiones de Internet, con el apoyo de
interpretación y realización de las tareas. las alumnas tutoras. Se observó que una pequeña
parte 10% de la población de niños participantes
Los elementos motivadores no estuvieron en el proyecto ya tenían nociones de entrar a
H\ZLU[LZWLYVHSN\UVZUVLYHUSVZZ\ÄJPLU[LTLU[L Internet, el resto fue habilitado en las sesiones de
adecuados para que llegaran y se fueran dispuestos trabajo.
a continuar con el proyecto y agregarle más detalles
novedosos o atractivos para su equipo de trabajo.
Condiciones favorables comunitarias y el
El acompañamiento de las tutoras para el diseño y café Internet en el proyecto.
LQLJ\JP}UKLSVZWYV`LJ[VZM\LZPNUPÄJH[P]VH\UX\L
la exigencia de los profesores-coordinadores- no A comparación de las réplicas realizadas durante
permitía que alguna tutora y sus tutorados, se los años de 2008 y 2009 en las demás comunidades
fueran rezagando. Las reuniones donde se rendían Y\YHSLZ THYNPUHKHZ LS ÄUHUJPHTPLU[V V[VYNHKV
informes, avances y exposición de tareas fueron de por la Universidad Autónoma de Coahuila, para
gran ayuda pues la colaboración de todos facilitaba la adquisición de cinco computadoras Laptop,
la realización de cierta actividad, por más difícil que mismo número de videograbadoras y cámaras
fuera, por ejemplo, cuando había incompatibilidad MV[VNYmÄJHZ KPNP[HSLZ HKLTmZ KL [LULY IHQV
de temperamentos entre algunos niños y niñas U\LZ[YV YLZN\HYKV Z\ÄJPLU[LZ NYHIHKVYHZ KL
en los equipos, se cambiaban de grupos donde voz digitales y disponer en todo momento de
O\IPLYH HÄUPKHK LU[YL SVZ V[YVZ PU[LNYHU[LZ V LS un cañón para proyectar diapositivas y videos
auxilio entre las tutoras para establecer límites en fueron condiciones favorables para la realización
el manejo del equipo, pues la mayoría quería traer del proyecto Enrédate, Tecnologías Comunitarias
VJHYNHYZPLTWYLSHJmTHYHKL]PKLVVMV[VNYmÄJH y ni que decir de tener a nuestra disposición el
o estar siempre usando la computadora (laptop). [YHUZWVY[LVÄJPHSKLSH<UP]LYZPKHK`LSHWV`VKL
una beca económica de $50.00 por sesión para
cada tutora.

?=,5*<,5;965(*065(3*65,0** 85
Enrédate. Tecnologías Comunitarias

El café Internet que se encontraba en la La participación comunitaria es indispensable


comunidad rural de Lequeitio y que operaba con incorporarla desde el inicio de toda actividad pues
seis equipos, fue sin ligar a dudas de gran ayuda desde el inicio se apropiará del proyecto, le dará
para todos los trabajos que había que realizar para seguimiento y apoyo para que culmine de acuerdo
la plataforma, La disposición de colaborar por a los objetivos planteados. Incorporar a los padres
parte del encargado- negociando el previo pago nos posibilitará aumentar la capacidad de previsión
del tiempo usado por computadora- posibilitó el y ejecución de las tareas, mejorar nuestros métodos
cumplimiento de la etapa complementaria del de enseñanza y hasta crear nuevas expectativas
proyecto, pues las niñas y niños pudieron, previa con apoyo de proyectos de este tipo, buscando
enseñanza, localizar y bajar imágenes de Internet complementar acciones con las tecnologías de la
para elaborar e ilustrar sus dispositivas. información y comunicación, que la comunidad
haya emprendido y dirigidas hacia el mejoramiento
de las condiciones generales de vida.
Conclusiones.

Con toda razón Delia Crovi ha mencionado sobre Bibliografía.


la importancia de las dimensiones tecnológica, de
conocimientos y de participación, pero existen otras Área, M. (2020) Igualdad de oportunidades y
que merecen nuestra atención pues el desarrollo nueva tecnología. Un modelo educativo para la
sostenible de comunidades demanda enfoques alfabetización tecnológica. Revista EDUCAR, núm.
más holísticos tanto en el diseño de estrategias 29 Universidad autónoma de Barcelona.
como de metodologías de trabajo comunitario.
Crovi, D. (2002). “sociedad de la información y el
,S LQLYJPJPV [\[VYPHS LZ ZPNUPÄJH[P]V ` [HTIPtU LZ conocimiento. Entre el optimismo y la esperanza”
necesario considerar las variables que intervienen revista mexicana de Ciencias Políticas y Sociales,
en los procesos educativos, tanto en el ámbito año XLV, núm. 185.
urbano, como en lo rural, pues el proceso de
aprendizaje de los niños en el medio campesino, Zarzar, CH, (2010) Antología. Relación Maestro-
implican otras mediaciones socioculturales que Alumno en la Pedagogía centrada en el Estudiante.
WYVT\L]LUVMYLUHULSHWYLUKPaHQLZPNUPÄJH[P]VX\L Instituto de Estudios Superiores Dídaxis. México
en teoría es un modelo alternativo que el alumno
inicie y desarrolle un aprendizaje autónomo, capaz Zermeño F. (2007) Una experiencia de intervención
de aprender a aprender (Zarzar : 2010) y esto comunitaria para el empoderamiento social a través
lo debemos de considerar en los enfoques que de la apropiación de las tecnologías de información
demos a todo proyecto. y comunicación, inexperiencias de desarrollo
rural, dos visiones de vinculación universitaria:
Colima y Iowa, González S. R. y Barrón P. M.A.
Universidad de Colima, Iowa State Univresity, Red
de Investigación Urbana. México
?=,5*<,5;965(*065(3*65,0** 86
Enrédate. Tecnologías Comunitarias

SOBRE LOS AUTORES


Mayra Viridiana Olivares Gómez. Alumna del no-
veno semestre de la Licenciatura en Ciencias de
la Comunicación. Facultad de Ciencias Políticas y
Sociales. Unidad Torreón.

M.C. José Alfredo Morales Pérez. Prof. Investiga-


dor de la Facultad de Ciencias Políticas y Sociales,
de la Universidad Autónoma de Coahuila, Unidad
Torreón.

Dra. Blanca Chong López. Responsable del Cuer-


po Académico: “Sociedad, Comunicación y Cultu-
ra”, de la Facultad de Ciencias Políticas y Sociales
de la Universidad Autónoma de Coahuila, unidad
Torreón y Coordinadora del Proyecto Enrédate,
tecnologías Comunitarias, en la FCPYS.

?=,5*<,5;965(*065(3*65,0** 87
Experiencia comunitaria
de gestación y aplicación de un
proyecto formativo por
competencias a través del uso
y apropiación de las TIC´s
Dra. Juana María Alanís Ramírez
Carlos Iván Serrano García, Mariel Coronado Fuentes
Universidad Autónoma de Coahuila

 
Introducción.  profesional, mejorando los hábitos de auto
Fusiónate con las tecnologías, es un proyecto enseñanza y demostrará la importancia de
YLJPtUÄUHSPaHKVIHQVSHTL[VKVSVNxHKL7YV`LJ[V fusionar la tecnología con el aprendizaje diario,
Formativo por Competencias (Dra. Alanís, 2009), exhortándolos desde pequeños a crear una
de la Facultad de Ciencias de la Comunicación conciencia activa en pro de la calidad de la
de la U A de C, llevado a cabo por alumnos de la información y la comunicación. Permitiendo la
institución bajo la metodología establecida, a través PU[LYHJJP}U ` LS KPmSVNV X\L WLYTP[H SH YLÅL_P}U
KL[HSSLYLZMVYTH[P]VZNLULYHUKVL]PKLUJPHZÄUHSLZ de sus problemas sociales, así ir desarrollando la
KL HWYLUKPaHQL ZPNUPÄJH[P]V KLS \ZV KL SHZ ;00*Z mirada crítica de los retos en la vida en materia
Experiencia que se comparte a los participantes de formación, enseñanza y ejercicio profesional,
tanto de los alumno y de los instructores- JVU SH ÄUHSPKHK X\L L_WYLZLU ` JVTWHY[HU Z\Z
talleristas, que a su vez formaron promotores ideas, hallazgos, cuestionamientos, opiniones,
y gestores sobre el uso y apropiación de las críticas y propuestas encaminadas al desarrollo
TIICs a nivel primaria y ahora a nivel preparatoria, de su comunidad de un proyecto formativo por
cuyo objetivo es promover el empoderamiento y competencias equitativo y democrático desde la
el desarrollo sostenible de comunidades rurales comunicación.
marginadas, a través del uso de metodologías
formativas por competencias encaminadas a la Los inicios
apropiación creativa de las nuevas tecnologías de
información y comunicación con sentido ético. “Fusiónate con las tecnologías comunitarias”,
proyecto que surge como un proyecto formativo
Se ayudo a los alumnos a visualizar la tecnología por competencias de educación no formal en
como factor de crecimiento para el mundo
Experiencia comunitaria de gestación y aplicación de un
proyecto formativo por competencias a través del
uso y apropiación de las TICs

el uso y apropiación de las TIICs a través de la en la búsqueda del desarrollo sostenible de las
experiencia de trabajar con comunidades rurales y comunidades rurales marginadas, a través del
formar estudiantes como gestores y/o promotores uso de metodologías participativas formativas
funcionales a través de la experiencia de trabajar por competencias encaminadas a la apropiación
con una comunidad rural, como talleristas creativa de las TIICs.
asesorados por profesionistas.
Experiencia que como alumnos, ha sido parte ya Proyecto formativo por competencias
de nuestra formación extracurricular no solo a nivel
KL KPZJPWSPUH JPLU[xÄJH ZPUV X\L UVZ OH WLYTP[PKV ¿Por qué elegir un Proyecto Formativo?
desarrollar una nueva experiencia aplicada a
una comunidad como parte de una universidad 7VY SH ULJLZPKHK KL JSHYPÄJHY ` \UPÄJHY JYP[LYPVZ
académica y socialmente comprometida con objetivos, fundamentos, acciones, metodologías
comunidades marginadas no siendo la excepción y bases teóricas importantes para impulsar por
desde el terreno de conocimiento y acceso a las competencias.
TIICs, lo que de alguna manera propicia lograr cada
vez más una democratización de la información. ¿Qué es la educación basada en competencias?
Es por ello que adentrar a las comunidades rurales
o semi-rurales a la tecnología puede ayudar a :L KLÄUL JVTV \U TVKLSV KL MVYTHJP}U
mejorar sus métodos de comunicación, así como basado en el enfoque constructivista, que tiene
en la disminución de los problemas sociales que como propósito central formar personas con
presenten, y ayuda de manera efectiva a crear una conocimientos, habilidades y destrezas relevantes
visión más grande del mundo laboral a largo plazo, y pertinentes al contexto real, de acuerdo a las
contribuyendo con ello a formar mejores personas características de cada persona.
tanto en “el ser como en el saber hacer”. Experiencia
X\L OH ZPNUPÄJHKV [HTIPtU \U JYLJPTPLU[V UV ¿Para Qué y para Quienes, incide el
solamente académico sino de formación solidaria Proyecto Formativo por Competencias?
para con nuestro entorno.
Para proponer una valiosa instancia
Nuestra misión como alumnos. de comunión entre la formación,
capacitación, organización de investigación y
iZ[LWYV`LJ[V[PLULSHÄUHSPKHKKLHWVY[HYU\LZ[YH desarrollo aplicado a los universitarios-tutorados
experiencia como alumnos, aplicada a los estudios UAdeC. Y, promover así el desarrollo comunitario
de tecnologías de la información, educación y del uso de las tecnologías a los estudiantes de
comunicación en niños y jóvenes, orientándolos Derramadero y comunidad en general.
H SH LK\JHJP}U  `  ZPNUPÄJHUJPH KL SH  ]PUJ\SHJP}U
entre diferentes campos del conocimiento. Con
ello se busca promover el empoderamiento de
los niños por éstas áreas y a la vez se ayudará

?=,5*<,5;965(*065(3*65,0** 89
Experiencia comunitaria de gestación y aplicación de un
proyecto formativo por competencias a través del
uso y apropiación de las TICs

Basado en competencias promoción su desarrollo,


c)   Formar recursos humanos desde una
En la educación basada por competencias que perspectiva proactiva y ética (investigadores,
se utilizó para la realización de éste proyecto, se gestores sociales y usuarios de las TIC),
planearon, registraron y evaluaron una multitud de d)   Fomentar el trabajo en red, generar
aspectos que se relacionaron al mismo tiempo sistemas de información, así como
para construir una serie de pasos y actividades e)   Producir y difundir información relevante
participativas en cada taller, de forma individual y sobre las TIIC y el desarrollo comunitario.
colectiva.
Competencia general a través de talleres
En éste proceso la retroalimentación de información MVYTH[P]VZKLHWYLUKPaHQLZPNUPÄJH[P]V
entre tutores (alumnos de la universidad) y niños
(alumnos del proyecto) es de suma importancia ‡ Desarrollar capacidades de auto-
para comprender todos los aspectos relacionados aprendizaje del uso y apropiación de las
con el aprendizaje de los participantes y la TIIC tomando como base situaciones
creación de las evidencias, de ésta forma puede reales de su entorno con sentido ético.
comprobarse la viabilidad del proyecto, dado que ‡ Interactuar grupalmente, con respeto a la
JVUÄYTH X\L SVZ UP|VZ LU[PLUKLU SH PUMVYTHJP}U diversidad y sentido ético.
que se les otorga y la asimilan convirtiéndola en
aprendizajes.
Competencias particulares:

‹(UHSPaHY SHZ WYVISLTm[PJHZ KLS LU[VYUV  KLZKL


perspectivas sistémicas y con sentido crítico.
‹*VT\UPJHY SHZ PKLHZ JVU Å\PKLa ` WYLJPZP}U
teniendo en cuenta las intenciones y propósitos
DE INFORMAR Y COMUNICAR para promover el
empoderamiento del uso y apropiación de las TIIC.
‹<ZHY SHZ [LJUVSVNxHZ JVU ZLU[PKV t[PJV `
en función de optimizar proceso cognitivos.
Enfoques de talleres por competencias ‹4HULQHY PUMVYTHJP}U ZVIYL  SH UH[\YHSLaH KL SH
comunicación tomando como base situaciones
Objetivos generales de los talleres formativos por reales del entorno.
competencias: Evaluación por competencias

a)   Generar conocimiento básico sobre las Es el proceso mediante el cual se recopilan las
TIIC, evidencias necesarias para determinar el grado de
b)   Co-participar con las comunidades en la desarrollo de las competencias en una persona,
empleando criterios acordados y buscando
?=,5*<,5;965(*065(3*65,0** 90
Experiencia comunitaria de gestación y aplicación de un
proyecto formativo por competencias a través del
uso y apropiación de las TICs

retroalimentarla de tal forma que esto posibilite


mejorar su formación e idoneidad.
La cantidad de espacio y tiempo invertido en
cada actividad deberá ser apto para facilitar el
grado de aprendizaje, además de utilizar mensajes
de contenido creativo en los que el producto
comunicativo sea de interés para el receptor.

TOBÓN, S. (2006).

&ULWHULRV (YLGHQFLDV

*VTWVULU[LZKLSHZTH[YPJLZKLL]HS\HJP}ULUSVZWYVK\J[VZÄUHSLZ

Componente Descripción
 &RPSHWHQFLD (VODFRPSHWHQFLDDHYDOXDU

&ULWHULRV 6RQORVFULWHULRVTXHVHWHQGUiQHQFXHQWD
HQHOSURFHVR

(YLGHQFLDV 6RQODVSUXHEDVDWHQHUHQFXHQWD
1LYHOHVGHDSUHQGL]DMH 'DQFXHQWDGHQLYHOHVGHDSUHQGL]DMHSRU
FULWHULR
3XQWRVRSRUFHQWDMH ,QGLFDQODFXDQWL¿FDFLyQGHFDGDFULWHULR\
GHFDGDQLYHOGHORJURRLQGLFDGRU

?=,5*<,5;965(*065(3*65,0** 91
Experiencia comunitaria de gestación y aplicación de un
proyecto formativo por competencias a través del
uso y apropiación de las TICs

EJEMPLO  DE  DESCRIPCIÓN  DE  UNA  


COMPETENCIA:  A  lograr  a  través  del  Taller  
Trabajo  en  equipo

352%/(0$6'(/&217(;72
 'L¿FXOWDGSDUDUHDOL]DUDFWLYLGDGHVFRRSHUDWLYDV\FRPSHWLWLYDVSDUDHVWDEOHFHU
PHWDVFRPXQHV
 'L¿FXOWDGHQORVSURIHVLRQDOHVSDUDDVXPLUUHVSRQVDELOLGDGHVHQHOWUDEDMRHQ
HTXLSR\FXPSOLUFRQORVSODQHVGHDFFLyQ

&203(7(1&,$6 &ULWHULRV (YLGHQFLDV


'HVFULSFLyQ ,QWHJUDUORVWUHVVDEHUHVGH
FRQXQYHUERGH FDGDFRPSHWHQFLDVHUFRQRFHU
GHVHPSHxRXQ \KDFHU
REMHWRXQSDUDTXp
\XQDFRQGLFLyQGH
UHIHUHQFLD 

?=,5*<,5;965(*065(3*65,0** 92
Experiencia comunitaria de gestación y aplicación de un
proyecto formativo por competencias a través del
uso y apropiación de las TICs

 &RQFHSWXDOL]DTXpHV 1.  Registro  de  un  equipo  


7UDEDMDUHQHTXLSR HOWUDEDMRHQHTXLSR conformado  y  funcionando.
SDUDDOFDQ]DUXQD VXVFDUDFWHUtVWLFDV\ 2.  Acta  del  establecimiento  de  
GHWHUPLQDGDPHWD UHVSRQVDELOLGDGHV un  plan  de  acción  en  equipo.
FRQREMHWLYRVELHQ WHQLHQGRHQFXHQWDORV 3.  Mapa  mental  argumentado  
GH¿QLGRVDFRUGH UHWRVGHOFRQWH[WR sobre  trabajo  en  equipo.
FRQXQGHWHUPLQDGR 3DUWLFLSDHQODUHDOL]DFLyQ 4.  Registro  sobre  el  abordaje  
SUR\HFWRRDFWLYLGDGGHDFWLYLGDGHVFRQMXQWDVHQ GHXQFRQÀLFWR\ODPDQHUD
HQFRQWH[WRV XQGHWHUPLQDGRHTXLSRFRQ como  se  superó.
GLVFLSOLQDULRV DFHSWDFLyQGHODVGLIHUHQFLDV\
PXOWLGLVFLSOLQDULRV FRPXQLFDFLyQDVHUWLYDDFRUGH
LQWHUGLVFLSOLQDULRV\ FRQXQRVREMHWLYRV
WUDQVGLVFLSOLQDULRV &RQWULEX\HDTXHHOHTXLSR
WHQJDXQDYLVLyQFRPSDUWLGD\
XQFODURSURJUDPDGHWUDEDMR
SDUWLFLSDQGRHQHODQiOLVLV
\UHVROXFLyQFUHDWLYDGHORV
FRQÀLFWRV
7LHQHVHQWLGRGHUHWRSDUDTXH
HOHTXLSRDOFDQFHPHWDVFDGD
YH]PiVHOHYDGDVDFRUGHFRQOD
YLVLyQFRPSDUWLGDGHOHTXLSR

Niveles  de  dominio  de  la  competencia  de  trabajo  en  equipo
1LYHO &DUDFWHUtVWLFDV (MHPSOR
,,1,&,$/ $OJXQRVORJURVHQOD 7UDEDMRVHVSRUiGLFRVHQHTXLSR
FRPSHWHQFLD &XDQGRWUDEDMDHQHTXLSRVLJXHEiVLFDPHQWH
'HVHPSHxRPX\EiVLFR LQVWUXFFLRQHV
%DMDDXWRQRPtD
,,%È6,&2 'HVHPSHxRPHGLDQRR 3DUWLFLSDHQWUDEDMRVHQHTXLSR
PtQLPR &XPSOHODVUHVSRQVDELOLGDGHV
$VLVWHQFLD 7LHQHXQWUDWRFRUGLDOFRQORVGHPiV
3DUWLFLSDFLyQFRQ
HOHPHQWRVWpFQLFRV

?=,5*<,5;965(*065(3*65,0** 93
Experiencia comunitaria de gestación y aplicación de un
proyecto formativo por competencias a través del
uso y apropiación de las TICs

,,, $XWRQRPtDHQHO +DFHFRQWULEXFLRQHVDOWUDEDMRHQHTXLSR


$87Ï1202 GHVHPSHxR (YDO~DHOWUDEDMRHQHTXLSRFRQDXWRQRPtD
*HVWLyQGHSURFHVRV 3URSRQHPHMRUDVHQHOWUDEDMRHQHTXLSR
$UJXPHQWDFLyQFLHQWt¿FD
'LUHFFLyQGHSUR\HFWRV
(675$7e $SOLFDFLyQGH /LGHUDSURFHVRVGHDEDMRHQHTXLSR
*,&2 HVWUDWHJLDVGHFDPELR %XVFDTXHORVSUREOHPDVIRUWDOH]FDQHO
'LUHFFLyQ HTXLSR
$OWDÀH[LELOLGDG 3URSRQHLQQRYDFLRQHVHQODIRUPDGHRULHQWDU
&UHDWLYLGDGH HOWUDEDMRHQHTXLSR
,QQRYDFLyQ
$OWRJUDGRGHDXWRQRPtD

El alumnado y el cuerpo de maestros participantes Etapas de implementación de un PF


(proyecto formativo)
El proyecto formativo fue dirigido por profesores
pero realizado en conjunto con alumnos de la 1. Formación del equipo.
Universidad Autónoma de Coahuila, en la siguiente
NYmÄJHZLT\LZ[YHLSNYHKVKLWHY[PJPWHJP}UKLSVZ 7HY[PJPWHJP}U JVTWYVTL[PKH WLYV UV PUKLÄUPKH
estudiantes en la planeación y ejecución de PF. sobre la importancia de trabajar en perspectiva
de Proyectos Formativos comunitarios de manera
TOBÓN, S. (2006). sustentable.
Quiénes: Cuerpo Académico de la Fac. Css.
Comunicación. U A de C. (C.A.) Secretaría Técnica
¿Cómo implementar éste proyecto en una (ST) Equipo de Intervención (EI)
comunidad?

Además del proceso de planeación y construcción 2. Incubación institucional.


del mismo y de la capacitación de los tutores,
existen más puntos a tomar en cuenta para su Realizar una visita a la comunidad. Plantear
realización, como lo son: perspectiva como participación comunitaria.
Concientizar y garantizar el apoyo interinstitucional
por parte de los representantes del equipo de
Investigación e intervención
Quiénes: (. (D) Director, (CP) Coordinadores
de proyecto) (S. T.) Secretaria Técnica) - A Grupos
de la Comunidad (Docentes, Directivos y Alumnos,
padres de familia, etc.).

?=,5*<,5;965(*065(3*65,0** 94
Experiencia comunitaria de gestación y aplicación de un
proyecto formativo por competencias a través del
uso y apropiación de las TICs

3. Capacitación de talleristas a tutores. de formar cuadros.

Sensibilización y capacitación en la: 7. Auto evaluación de la experiencia académica


‡ Pre-producción; formativa desde la investigación y desarrollo,
‡ En la producción y, como propuesta para la ccontextualización de la
‡ Pos-producción. experiencia académica.
Quiénes: A Equipo de Tutores responsables (E:T)
por parte de los talleristas (IT). 1.   Diagnóstico de aprendizajes previos y el
ahora.
4. Implementación del proyecto formativo. (P. F.) 2.   Encuadre de su aplicación y posibles
aplicaciones o desarrollos.
Nuestro proyecto se centra en la organización de 3.   Facilitación del trabajo en equipo.
talleres formativos en los cuáles se reproducen 4.   Diseño del proyecto y saberes.
las condiciones y procesos que los alumnos 5.   Nuevas ejecución y abordaje de saberes,
necesitarán para la implementación de una radio entornos, etc.
comunitaria en su etapas de producción, Así, 6.   Valoración del Proyectos Formativos desde
WLYÄSHTVZ KLZKL SHZ KPMLYLU[LZ JVTWL[LUJPHZ las TIIC
(evidencias-productos) hasta los hábitos de 7.   Valoración de las competencias entre otras.
organización acordes al desarrollo comunitario de
manera ética y responsable. 8. Difusión y divulgación de los resultados.

5. Análisis y seguimiento Se presentan los proyectos a la comunidad para


retroalimentar y buscar su participación para otras
Proyecto que cobra sentido en el momento de su etapas, y se divulgará como experiencia comunitaria
aplicación. Consiste en la revisión e interpretación LUNLULYHS`HUP]LSKP]\SNHJP}UJPLU[xÄJHWHYHZ\
cuantitativa y cualitativa de los resultados de réplica. Las estrategias de proyecto formativo
la sistematización de la experiencia como serán a través de ponencias, artículos y páginas
investigación acción-participativa comunitaria y Web.
retroalimentación de la propuesta metodológicas.
Nuestro proyecto
6. Evaluación
Proyecto: “Fusiónate: Tecnologías Comunitarias”
Por ello, esta evaluación tiene seguimiento proyecto formativo por competencias.
formativo, no sólo se queda como evaluación, si
no que se toman medidas de proceso en mejora Lugar de realización: Derramadero, ejido de Saltillo,
continua como necesidad para su funcionamiento Coahuila.
e implementación. Se trata de una reingeniería Escuela primaria: Doña Josefa Ortiz de Domínguez.
parcial para su réplica. Abarca desde la importancia Público participante: 35 niños.
?=,5*<,5;965(*065(3*65,0** 95
Experiencia comunitaria de gestación y aplicación de un
proyecto formativo por competencias a través del
uso y apropiación de las TICs

Grado de escolaridad: 4to y 5to de primaria.


Fecha de realización: agosto de 2009 – junio de
2010.

Estudio/diagnostico sobre el acceso a las TIICS.

Se realizaron encuestas para determinar el grado de


incidencia y acceso que se reconoce por parte de
los niños de la primaria “Josefa Ortiz de Domínguez”
como grupo objetivo con los que se trabajo en el 3H LUJ\LZ[H YLÄLYL X\L SH TH`VYxH KL SVZ UP|VZ
Proyecto Formativo Por Competencias “Fusiónate: cuenta con televisión, radio y celular en casa.
Tecnologías Comunitarias” en la comunidad rural Es importante conocer cuáles son los MMC que
de Derramadero, Saltillo Coahuila. Los datos \[PSPaHU SVZ WHKYLZ KHKV X\L LSSVZ ZVU \U YLÅLQV
arrojados fueron los siguientes: de lo que hace el niño también. Observamos un
gran caso de incidencia de este tipo, cabe hacer la
Objetivo: Aplicar un pre diagnóstico sobre el uso observación de que en esta comunidad semi-rural
y apropiación a la comunidad del publico objetivo, la mayoría de las casas tiene señal de televisión
previo a la implementación del proyecto. Con la cerrada como sky, dish, etc, ya que no se cuenta
ÄUHSPKHK KL VI[LULY PUMVYTHJP}U ZVIYL X\t [HU[H con señal abierta; y en radio solamente reciben
competencia se tenía sobre las TIICs. señal de amplitud modulada y en frecuencia
modulada solamente la estación del gobierno del
Metodología: estado.
Muestra: Grupos que asistieron a los talleres
formativos por competencias.
Cuota: 35 niños de 5to y 6to de primaria.
Técnica: Encuesta estructurada voluntaria a grupo
objetivo.
Fecha de aplicación del instrumento: Septiembre
2009.
Diseño e instrumentación: Dra. Juana María
Alanís Ramírez. Catedrática Investigadora. Carlos
Iván Serrano García, Mariel Coronado Fuentes, La mayoría de las madres de familia gusta de hacer
estudiantes de 5° semestre de la Fac. Css. de la otras actividades relacionadas al hogar, como la
Comunicación, UA de C. cocinar y la limpieza, y después escuchar la radio
Analista: Oscar Morín. Alumno de 7º semestre de y la televisión, debido a que se cuenta con poca
la FCC. programación de radio y no todos tienen acceso
a la televisión.

?=,5*<,5;965(*065(3*65,0** 96
Experiencia comunitaria de gestación y aplicación de un
proyecto formativo por competencias a través del
uso y apropiación de las TICs

Desde la percepción de sus hijos dicen que a la En radio se escuchan más las noticias, seguido
mayoría de los padres de familia les interesa leer el de los programas con corte musical, dejando por
periódico, seguido de realizar otras actividades, y último a diversos programas gubernamentales. Ya
utilizan la televisión y el radio solo para descansar. que se cuenta con poca recepción solo reciben
señal de amplitud modulada y en frecuencia
La pregunta cuatro está dividida en 5 partes: modulada solamente la estación del gobierno del
prensa, radio y televisión. estado.
4.- ¿Qué tipo de programas utiliza, ve, escucha, lee
en estos medios de comunicación que se tienen
en su casa?

En prensa, las noticias con mayor incidencia son de Las novelas, caricaturas y noticieros son la
ámbito deportivo, siguiendo otro tipo de noticias, y programación más vista en la comunidad, dejando
después locales y espectáculos. Mas sin embargo por último los programas culturales y musicales.
en la comunidad se recibe solo periódicos de corte
amarillista, donde se da poca información cultural
y política, y se da más sobre publicidad, accidentes 5.- ¿A qué compañía pertenece el teléfono celular?
y problemas sociales. Los datos nos dicen que un 72% de los celulares
son de la compañía Telcel, seguido de un 28% por
Movistar, ya que son las únicas compañías que
tienen cobertura en el territorio.

?=,5*<,5;965(*065(3*65,0** 97
Experiencia comunitaria de gestación y aplicación de un
proyecto formativo por competencias a través del
uso y apropiación de las TICs

La mayoría de los encuestados han asistido a Según los datos obtenidos la mayoría sabe utilizar
\UH ZHSH JPULTH[VNYmÄJH WLYV ZL THUPMLZ[} X\L la computadora y principalmente la usan para
asisten muy poco, dado que en su comunidad educación y ocio, y pese a que los resultados
no hay cine, y tienen que salir a Saltillo, siendo la de la encuesta dicen que si saben, nos dimos
ciudad más próxima. cuenta que realmente la mayoría no cuenta con
el acceso a ella y por lo tanto no se contaba con
conocimientos de su uso, cabe hacer mencionar
que tienen muy poca infraestructura en cuanto a
las TIICs, pues se contaba con 2 computadoras
en la primaria y solamente usándola con la
enciclopedia. Después de los primeros talleres se
donaron 5 computadoras a la escuela primaria por
parte de la UA de C.

Las películas preferidas son las caricaturas,


seguidas de las películas de terror, terminando con
las de comedia y acción.

La encuesta nos revela que la mayoría de las


personas no saben usar el internet, y la minoría
lo utilizan como factor de entretenimiento. Muy
pocos se adentran a la búsqueda de información.
@WHYHLSSVYLÄtYHZLSHWYLN\U[H


?=,5*<,5;965(*065(3*65,0** 98
Experiencia comunitaria de gestación y aplicación de un
proyecto formativo por competencias a través del
uso y apropiación de las TICs

El director de la preparatoria EMSAD de Talleres aplicados durante el periodo.


Derramadero, en una entrevista comento que Todos los talleres se impartieron en su forma
gracias a estos proyectos los niños de la primaria es práctica y teórica, de manera individual y colectiva,
la primera vez que tienen acceso a la computadora. dedicando la mayor parte del tiempo a la práctica
evidenciada del uso de las TIICs.

Taller 1: Tecnologías de la información

yParte teórica.
 Se destacó la importancia de los medios de
comunicación, así como sus antecedentes
históricos y sus principales usos y
Manifestaron que la mayoría de los encuestados características.
\[PSPaHU SH JmTHYH MV[VNYmÄJH WHYH SHZ ÄLZ[HZ LU  La sesión estuvo apoyada por cartelones
familia. Más sin embargo, algunos han manifestado que demostraban visualmente cada medio
X\L [PLULU LU Z\ JHZH JmTHYH MV[VNYmÄJH [YHxKH de comunicación a través de la historia.
por un pariente directo que se ha ido a trabajar a  Hubo participación y una sección de
Estados Unidos, pero no saben usarla. La mayoría WYLN\U[HZ WHYH HÄYTHY SVZ JVUVJPTPLU[VZ
de las familias cuentan con teléfono celular en la adquiridos durante la actividad.
comunidad y es utilizado en su mayoría de las
veces para tomar fotos sustituyendo la cámara. yParte práctica:
 En la segunda mitad de la sesión
programada se presentaron los medios de
comunicación más usados en la actualidad
en físico y se dio una introducción de cada
uno a los niños.
 Se le explicó a los niños el correcto
funcionamiento de cada medio, sus partes
y su funcionamiento.
 Seguida a ésta explicación de comenzó
La mayoría nos comentó que no sabe utilizar la la actividad de enseñanza en la que los
cámara de video, y los que saben hacer buen uso niños comenzaron a practicar con estos
KL LSSH SH \[PSPaHU WHYH NYHIHY ÄLZ[HZ MHTPSPHYLZ instrumentos, a memorizar su forma y
Manifestando en menor medida que cuentan con tomar sus primeras fotografías y audio.
la cámara de video, mas sin embargo no saben
hacer uso de ella, ya que es el mismo caso de la Evidencia: con las primeras fotografías y audios
JmTHYHMV[VNYmÄJH se realizo un video corto para explicarlos

?=,5*<,5;965(*065(3*65,0** 99
Experiencia comunitaria de gestación y aplicación de un
proyecto formativo por competencias a través del
uso y apropiación de las TICs

el proceso de video: capturar la imagen, Los participantes aprendieron a redactar un


concentrar audio, vaciar a la computadora y guión y una entrevista
editar ambos.
yParte práctica:
1.   *mTHYHMV[VNYmÄJH  Ángulos para fotografía y video.
2.   Grabadora digital de voz  Realización de una entrevista a un personaje
3.   Computadora de la localidad.
4.   Televisión, radio, celular, periódico.
Evidencia: guión de un personaje de la comunidad
Programas y grabación de la entrevista con videocámara.
1.   Movie Maker (programa de video) Ejemplo de un fragmento de guión hecho en clase.
2.   Internet
Ejemplo de Guión hecho en clase.
Taller 2: Icono-escritura.
‡ “Escenografía: Se desarrolla en el ejido
derramadero.
yParte teórica. ‡ José Ángel tiene 55 años. Él se dedica a
 Los niños analizaron diferentes situaciones la artesanía y talabartería. Él usa material
de su comunidad a través de dinámicas como el hilo de cáñamo, hilo de ixtle y
lúdicas. material de cuero. También el ha seguido
la tradición para que estas artesanías no
yParte práctica. desaparezcan.” - Everardo (niño participante
 Perfeccionaron el uso de la grabadora de del curso).
voz digital y entrevistaron a personas de Taller 4: Equidad y transversalidad de género.
la comunidad siendo personajes como
el señor de la tiendita de la esquina, el yParte teórica.
comisario ejidal, el sacerdote o ministro del Durante el curso, los niños y las niñas
culto, las personas de mayor edad, sobre aprendieron sobre la importancia de la
qué jugaban ellas y ellos cuando eran niños. equidad de género, así como los derechos
a que son merecedores.
Evidencia: entrevista sobre la vida de personajes
del pueblo y la opinión de la importancia del uso y yParte práctica:
apropiación de las TIICs. Con la ayuda de grabadoras digitales de
]VaJmTHYHMV[VNYmÄJH`JmTHYHKL]PKLV
Taller 3: Cultura local, regional y tradiciones los niños realizaron entrevistas a distintos
personajes de la localidad.
yParte teórica: Ellos preguntaron acerca de profesiones,
 Se desarrollaron habilidades de redacción. actividades normales, derechos de hombres

?=,5*<,5;965(*065(3*65,0** 100
Experiencia comunitaria de gestación y aplicación de un
proyecto formativo por competencias a través del
uso y apropiación de las TICs

y mujeres a través de la localidad y más. Como PRODUCTO FINAL INTEGRADOR los


Evidencia: video de los derechos e importancia de alumnos y alumnas evidenciaron su aprendizaje a
la equidad de género. través de:
Programa radiofónico transmitido a través del
Taller 5: Ética y medio ambiente. WYVNYHTH VÄJPHS KL SH <( KL * ¸:HILY :LY¹ X\L
conduce la Dra. Alanís, que se transmite a través
yParte teórica: de la estación “Radio Gente” a nivel estatal del
Actualmente las temáticas ecologistas van Gobierno del Estado, producido por ellos mismos
de la mano con nuestro objetivo, pues es el en colaboración con los alumnos de la preparatoria
medio de comunicación quien se encarga EMSAD Derramadero, con el Titulo “Reporteros Por
de distribuir toda la información que se tiene Un Día”, así mismo se les entrevisto en la misma
acerca del tema. estación sobre su experiencia de su experiencia
de haber sido formados en un proyecto como
yParte práctica: el presente. Bajo criterios de su aprendizaje se
Aprendieron a actuar éticamente al tomar TVU[} \UH L_WVZPJP}U MV[VNYmÄJH ZVIYL [LTHZ
una fotografía, actuar con formalidad y ambientales se produjo un video sobre género
seriedad al realizar una entrevista utilizando que ellos mismos armaron en el programa movie
la grabadora, cámara de video así como la maker.
JmTHYHMV[VNYmÄJH
Evidencia: Reportaje sobre los problemas El compromiso con nuestros niños.
ambientales de su comunidad.
Al comienzo del proyecto, los estudiantes/tutores
Taller 6: Internet, Gestión de la Información como promotores y gestores del uso y apropiación
de las TIICs a través de este proyecto recibimos
Parte teórica: una asesoría por parte de la directora del proyecto
ySe les dio a conocer las principales técnicas Dra. Juana Alanís que consistía en una explicación
y funciones de la búsqueda de información. del proyecto formativo por competencias, así como
yComprendieron la dimensión del buen uso la completa información de los talleres registrados
que se tenga de la internet y la computadora. y las actividades que conllevaba a realizar, para
después ir a la capacitación directa por parte de
Parte práctica: los instructores/talleristas como responsable de
yEn este taller se les enseñó a trabajar en los mismos según su área de especialidad.
Navegadores de la web (internet), sobre Desde el inicio estuvimos muy entusiasmados por
cómo buscar información, referenciarla, y participar en éste gran proyecto, pues enseñar y
manejar programas. acercar al niño a las tecnologías se ha vuelto una
acción solidaria, inteligente y de fácil apoyo hacia las
Evidencias: Ensayo sobre su comunidad (ubicación comunidades rurales y a favor de la democratización
NLVNYmÄJH`HJ[P]PKHKLZLJVU}TPJHZJVU[L_[V` de la información y al empoderamiento que ello
fotos.
?=,5*<,5;965(*065(3*65,0** 101
Experiencia comunitaria de gestación y aplicación de un
proyecto formativo por competencias a través del
uso y apropiación de las TICs

WVKYxH ZPNUPÄJHY H [YH]tZ KL JVUVJLY SVZ \ZVZ ` por alentar a sus hijos a saber más como
de la misma apropiación de las TIICs que a su estudiantes.
comunidad ellos podrían desarrollar.
Conocer el funcionamiento de las TIIC’s es una Desarrollo de competencias
información ávida y útil para cualquier estudiante en
la vida cotidiana y sin importar el nivel de educación Jóvenes y niños aprendieron jugando y mientras
HSJ\HSZLWLY[LULaJHJYLLTVZÄLSTLU[LX\LH‚U LZV WHZHIH JHZP ZPU KHYZL J\LU[H YLÅL_PVUHYVU
siendo estudiantes podemos ser participes de ZVIYL WYVISLTHZ LZWLJxÄJVZ KL Z\ LU[VYUV
la educación no formal, compartiendo nuestros ofrecieron soluciones y desarrollaron competencias
conocimientos y colaborando de ésta forma a las en diferentes aspectos y en diferentes niveles.
comunidades rurales o semi-rurales. Desde el diseño de las dinámicas de trabajo se
buscó impactar en el desarrollo de las siguientes
Derramadero, ejido de Saltillo Coahuila, se competencias y otras se reforzaron sin preverlo:
encuentra actualmente en desarrollo industrial. ‡ Capacidad de análisis y síntesis.
Los niños y la comunidad en general mantienen ‡ *HWHJPKHKKLVYNHUPaHY`WSHUPÄJHY
poco acceso a los mmc. Por lo que acercarlos ‡ Conocimientos generales básicos.
al uso y conocimiento de las TIICs representa ‡ Comunicación oral y escrita en la
un camino hacia nuevos retos y formas de propia lengua
entendimiento y expresión sobre sus problemas ‡ Habilidades básicas en el manejo de
sociales. ordenadores
‡ Resolución de problemas
Desde el inicio estuvimos comprometidos con ‡ Toma de decisiones
la niñez saltillense, apreciamos sus emociones y ‡ Capacidad crítica y autocrítica
sus ganas de aprender cada día más, puesto que ‡ Trabajo en equipo
para participar en el proyecto, ellos debían asistir ‡ Habilidades interpersonales
un día más a la escuela, para lo que también ‡ Comunicarse con expertos de otras
tanto sus padres como sus maestros, directivos áreas
y asociaciones y grupos de la comunidad se ‡ Apreciación de la diversidad y
sumaron a este esfuerzo. multiculturalita
‡ Compromiso ético
Cada día pudimos apreciar y entender el contexto ‡ Aplicar conocimientos en la práctica
cultural de la comunidad, observamos a padres ‡ Capacidad de aprender
caminando apresuradamente cada sábado por la ‡ Capacidad para adaptarse a nuevas
mañana para llegar a tiempo. situaciones
Estuvimos conmovidos, pues al platicar con ‡ Capacidad para generar nuevas
los padres de familia, éstos nos expresaban ideas
el gusto porque sus hijos adquirieran mayores ‡ Liderazgo
conocimientos, y nos agradecían profundamente ‡ Conocimiento de otras culturas y
costumbres
?=,5*<,5;965(*065(3*65,0** 102
Experiencia comunitaria de gestación y aplicación de un
proyecto formativo por competencias a través del
uso y apropiación de las TICs

‡ Habilidad para trabajar de forma lo que a la par debería demandar una atención
autónoma o una nueva mirada desde el sector educativo
‡ Diseño y gestión de proyectos como polo industrial de desarrollo y demanda de
‡ Iniciativa y espíritu emprendedor profesionistas con miras a disminuir los problemas
‡ Preocupación por la calidad sociales, económicos y políticos de la región, no
‡ Motivación al logro solamente de equipamiento de desarrollo urbano
sino también, sociocultural. Cabe hacer mención
A manera de conclusión. que también la UA de C a través de esta facultad,
trabaja otro proyecto en esa misma comunidad en
Los niños se apropiaron de los medios de la preparatoria EMSAD-DERRAMADERO titulado
comunicación e incluso aprendieron algunos “Radio Internet Comunitaria”.
programas básicos de edición y video. La iniciativa
fue factor importante de aprendizaje, además del 9LMLYLUJPHZIPISPVNYmÄJHZ
uso de un lenguaje apto que recibieron de nosotros.
La educación recibida fue individual y colectiva, pues ALARCÓN, R., M. A. ÁVILA, A. DELGADO et al.
se dio especial importancia a cada niño para que (2004). “Ciudadanía, participación y desarrollo
ZLZPU[PLYHUPKLU[PÄJHKVZJVU[LU[VZ`HWYLUKPLYHU comunitario” en Encina, Pino, Sierra y Rosa,
a manejar correctamente el equipo. Estamos muy Participación, comunicación y desarrollo
contentos con esto, ya que los niños demostraron comunitario, España, Diputación de Sevilla,
L]PKLUJPHZ ZPNUPÄJH[P]HZ KL HWYLUKPaHQL ` LZ[V
ayudó en su autoestima, pues al ver su producto ALCOCER,(1990).Investigaciónacciónparticipativa.
ÄUHS ` ZHILYZL JVUVJLKVYLZ ZL TVZ[YHIHU T\` EnGalindoCáceres,J.Técnicas de investigación en
felices e interesados cada día. sociedad cultura y comunicación..México:
PEARSON-AddisonWesleyLongman
,Z \UH NYHU NYH[PÄJHJP}U LS LUZL|HYSL H SVZ UP|VZ
como funcionan los medios y mostrarles formas ALGUACILI GÓMEZ, J. (2002).”Ciudad,
mayores de aprovechamiento y apropiamiento que ciudadanía y democracia urbana” en Documento
les sirvan para su formación. Con el conocimiento Social, N° 119, abril-junio.
que los niños cuentan ahora sobre las herramientas
del las tecnologías vistas en cada uno de los talleres DE BONO, E. (1997). El pensamiento práctico,
aplicados, es más fácil ampliar la visión que tienen ciudad de México, Paidós.
sobre el mundo y sobre todo alentarlos a seguir CASTRO, J. A. (2003). “Participación y desarrollo
estudiando cada día más. local en el proceso El Reparto” en Encina, Ávila,
Fernández y Rosa (coords). Praxis Participativas
La escuela primaria en la que se aplico este desde el Medio Rural, España, CIMAS.
proyecto está ubicada en una zona semi-rural
que se ha visto impactada por el creciente ENCINA, J. Y J. C. MEJIAS. (1997).”Nacionalismo
desarrollo industrial aledaño a su comunidad, y cultura populares: una lucha por el tiempo y el
?=,5*<,5;965(*065(3*65,0** 103
Experiencia comunitaria de gestación y aplicación de un
proyecto formativo por competencias a través del
uso y apropiación de las TICs

espacio”, en Colaborativo de Estudios Marxistas SOBRE LOS AUTORES


(coords), Nacionalismo-interaccionismo: una Dra. Juana María Alanís Ramírez. Catedrática In-
visión dialéctica, Sevilla[Bogotá, Ed. Muñoz Moya. vestigadora.
Carlos Iván Serrano García y Mariel Coronado
GARCÍA FRAILE, J.A., TOBÓN, S., et al. (2008). Fuentes. Estudiantes de 5° semestre de la Fac.
“Un nuevo modelo de formación para el siglo Css. de la Comunicación, UA de C.
XXI. La enseñanza basada en competencias”.
Barcelona: Davinci.

GALINDO CÁCERES, J. Técnicas de Investigación


en sociedad cultura y comunicación, ciudad de
México, Addison Wesley Longman, 1999.

LEMOS, N. (1996). 1964-1995 Juventud Rural,


modernidad y democracia en América Latina-
Santiago de Chile, Comisión Económica para
América Latina y el Caribe (CEPAL).
LÓPEZ DE CEBALLOS, P. (2000). Un método
para la Investigación Acción Participativa, España,
Editorial Popular.

ROSA, M. Y J. ENCINA. (2004). “Democracias


participativas desde las praxis locales”.
Democracias Participativas e Intervención Social
Comunitaria desde Andalucía, España.

TOBÓN, S. (2006). “Formación basada en


competencias”. Bogotá: Ecoe.

TOBÓN, S. (2008). “Gestión curricular y ciclos


propedéuticos por competencias”. Bogotá:

?=,5*<,5;965(*065(3*65,0** 104
Internet como herramienta
educativa: Del usuario funcional
al usuario intelectual
Irma Villalpando Hernández
UNIVERSIDAD PANAMERICANA

Resumen:
Internet es uno de los soportes de información más importantes del mundo actual, como lo
fueron la inscripción en piedra, el papiro o el papel. No obstante, es necesario que los diversos
HNLU[LZZVJPHSLZLZWLJPHSTLU[LSHLZJ\LSHSLYLHZPNULUM\UJPVULZ`ÄULZLK\JH[P]VZVYPLU[HKVZ
al desarrollo de habilidades intelectuales para construir conocimiento.
Transformar la información en conocimiento implica convertir al usuario tradicional de Internet en
  
un gestor crítico; esto le exigiría efectuar verdaderos ejercicios de comprensión lectora, análisis
KLJVU[LUPKVKPZJLYUPTPLU[VKLKH[VZ`ZVIYL[VKVSHJVUZ[Y\JJP}UKLZPNUPÄJHKVWLYZVUHSH
partir de los múltiples y abrumadores resultados de búsqueda que realice en la red. Se pretende
entonces, aprovechar el recurso desde dos aristas: como mecanismo de distribución informativa
y como posibilidad de aprendizaje y generación de conocimiento.

3VZWYVISLTHZKLS\ZVKL0U[LYUL[WHYHÄULZLK\JH[P]VZVZJPSHULUSHZLSLJJP}USHJVKPÄJHJP}U
SHJSHZPÄJHJP}USHPU[LYWYL[HJP}ULSHUmSPZPZ`SHZxU[LZPZKLSHPUMVYTHJP}UTPZTVZX\LWYV]VJHU
la transformación del usuario funcional en usuario intelectual. Sin duda alguna, un tema de edu-
cación conferido primordialmente a la escuela formal.

0U[LYUL[[PLUL\UHTWSPVWV[LUJPHSLU[LTHZLK\JH[P]VZ"`WVY[HU[VJVUÄULZKLHWYLUKPaHQLUV
obstante, esto se presenta al menos bajo tres problemáticas: garantizar la conectividad en las
escuelas, instruir al profesorado en el manejo instrumental del recurso y que la escuela y con-
cretamente el profesor, funja como mediador entre la enormes cantidades de información y el
KLZHYYVSSVKLOHIPSPKHKLZPU[LSLJ[\HSLZZ\WLYPVYLZWVYWHY[LKLSVZHS\TUVZ [LZPZKLSHWYLZLU[L
WVULUJPH "ZPLSSVM\LYHWVZPISL[YHUZP[HYxHTVZKLSH:VJPLKHKKLSH0UMVYTHJP}UHSH:VJPLKHK
del Conocimiento.

Palabras Clave: Internet, educación, escuela, sociedad, alumno.

El informe Delors (1996) sobre educación para igualdad de oportunidades, constituir un medio
el siglo XXI expone que los sistemas educativos de socialización o nuevas herramientas para
deben proporcionar el uso de las tecnologías en JVTWYLUKLYLST\UKV"LUKLÄUP[P]HWYVWVYJPVUHY
el espacio escolar desde diferentes perspectivas: las bases de una ciudadanía adaptada a la
propiciar el conocimiento continuo, fomentar la Sociedad de la Información. En este sentido, es
Internet como herramienta educativa

dable pensar que la escuela no puede atrasarse ni racional en lo que respecta a la información, basa
en materia de comunicación ni en los instrumentos su argumentación en la necesidad de obtener
de aprendizaje que son habituales al entorno todos los datos que se necesiten en un periodo
actual; tampoco puede quedar desligada del corto de tiempo. El criterio del bajo esfuerzo, de
compromiso social, mismo que toma de bandera la facilidad con la que se accede a la información,
la muy conocida frase “preparar para la vida”. es un bien primario; sin embargo acceder así a la
En este sentido, parece que en general las información no favorece los procesos de distinción
escuelas no han integrado pedagógicamente y jerarquización en torno a los datos recabados.
el uso de las Tecnologías de la Información y la Esta necesidad de instalar un tiempo entre la
Comunicación–en adelante TIC- , y la mayoría I‚ZX\LKH ` SH YLÅL_P}U ZVIYL SVZ YLZ\S[HKVZ KL
de los docentes que las usan suelen hacerlo de la misma para la construcción de conocimiento,
THULYH [tJUPJH ` Z\WLYÄJPHS JVTV PUZ[Y\TLU[V es importante en todos los niveles del sistema
de trabajo o como fuente informativa), esto educativo, sobre todo, teniendo en cuenta que
WYV]VJHKVWVYSHMHS[HKL\UHZLYPHYLÅL_P}UZVIYL es preciso contar con un marco disciplinario que
el planteamiento didáctico. Debido a esto, más allá entienda el mapa de relaciones de los datos, su
de una cierta alfabetización digital, las TIC no han abordaje epistemológico y metodológico en cada
Z\W\LZ[V JHTIPVZ ZPNUPÄJH[P]VZ LU SVZ WYVJLZVZ campo de conocimiento.
de enseñanza/aprendizaje, ni una mejora en la Por otra parte, la imagen de accesibilidad que se
calidad de los aprendizajes de los estudiantes. pone a disposición del público a través de los sitios
Consideramos que las TIC y en concreto Internet, web crearía la ilusión de una democratización del
puede ser un valioso recurso para la construcción conocimiento; sin embargo, en el mejor de los
del aprendizaje dentro del entorno escolar, siempre casos, se trata de una accesibilidad “fría” donde
`J\HUKVL_PZ[HUTLKPHJPVULZKVJLU[LZYLÅL_P]HZ la falta de mediación oculta la imposibilidad de
que impulsen el tránsito del usuario funcional al construir relaciones cognitivas verdaderas.
usuario intelectual. Los problemas auténticos con el uso de Internet
Se propone el uso de Internet como una WHYH ÄULZ LK\JH[P]VZ VZJPSHU LU SH ZLSLJJP}U SH
herramienta muy valiosa para la generación de JVKPÄJHJP}U SH JSHZPÄJHJP}U SH PU[LYWYL[HJP}U LS
aprendizajes en los alumnos y el desarrollo de análisis y la síntesis de la información (Lion, 2006)
OHIPSPKHKLZ PU[LSLJ[\HSLZ 3VZ ÄULZ ZL LUMVJHU que derivan en la transformación de los datos en
hacia la construcción de aprendizajes, y los medios JVUVJPTPLU[ViZ[VZYLÄLYLUH\UWYVJLZVX\LSSL]H
a la creación de dispositivos que transmitan [PLTWV`YLÅL_P}UWVYWHY[LKLSVZLZ[\KPHU[LZ"HZx
LÄJPLU[LTLU[L LS PUZ\TV KL JVUVJPTPLU[V! SH SH]HYPHISL[PLTWVZLHÄYTHJVTVYLSH[P]HW\LZSVZ
información. WLYPVKVZKLYLÅL_P}UKPÄLYLUKLSVZKLYLJVSLJJP}U
Sería redundante y trivial argumentar sobre la gran de datos.
utilidad del uso de Internet en particular o de las Estas problemáticas nos ubican en la necesidad
TIC en general, argumentando que su pertinencia de seguir pensando la incorporación de Internet
obedece al ahorro de tiempo y a que obtenemos a los procesos de aprendizaje de los alumnos y
información con rapidez. Este discurso, de base

?=,5*<,5;965(*065(3*65,0** 106
Internet como herramienta educativa

reconocemos que el acceso a la educación ha sido Por otra parte, recordemos que los procesos
un pilar en las propuestas del liberalismo clásico escolares exigen pensar la triada contenido-
y del neoliberalismo (Gimeno, 2007). Hoy, nos profesor-educando en interdependencia y
enfrentamos con la necesidad de ocuparnos por dinamismo de roles y funciones; es decir, los
ofrecer algo más que el acceso a la información: contenidos son la información que está lista
el sentido pedagógico de Internet, su integración WHYH ZLY \[PSPaHKH HZPTPSHKH ` YLÅL_PVUHKH WVY LS
con los contenidos, los modos en que favorece estudiante, quien depende en un primer momento,
procesos de construcción de conocimiento, ya de la guía del profesor, quien ya no cumple con
que el verdadero problema del usuario de Internet el rol de autoridad suprema y dueña absoluta
está en la construcción de categorías que le del conocimiento, sino como mediador entre los
WLYTP[HU ZLSLJJPVUHY JSHZPÄJHY L PU[LYWYL[HY SH contenidos y los alumnos.
enorme información a que tiene acceso. De este modo, las actividades educativas del
La valoración en torno a la pertinencia de los profesor y las de aprendizaje de los alumnos,
datos recabados en un campo disciplinar implica WLYTP[LU LS SPIYL Å\QV KL SVZ JVU[LUPKVZ :PU
una comprensión genuina acerca de un área de embargo cabe señalar que ni información es
conocimientos. Asimismo, en tanto el conocimiento sinónimo de conocimiento ni la recepción o el
sea frágil, las búsquedas y recopilación informativa acceso a la información garantiza el aprendizaje. De
Z}SV ZLYmU Z\WLYÄJPHSLZ ,U LZ[L ZLU[PKV ` hecho, la información que se transmite por medio
recurriendo a la metáfora del diluvio informativo, se de imágenes, texto o sonidos, no es de ninguna
trataría del “naufragio cognitivo” (Cabero, 2007), manera la misma, no se aprende de la misma
en tanto los alumnos se pierden en la construcción forma y mucho menos se asimila de igual manera
del conocimiento. Los procesos de lectura y la información en las escuelas tradicionales, donde
asignación de sentido se trivializan y obstaculizan el conocimiento es dictado por los profesores
la reconstrucción crítica de los propios procesos de ayudados por una tiza, que por medio de los
I‚ZX\LKH ZLSLJJP}U JSHZPÄJHJP}U ` [YHUZMLYLUJPH recursos multimedia y digitales proporcionados por
de la información. las TIC. Éstas exigen al individuo nuevos recursos
La transformación de los datos encontrados en semióticos, pues la información se presenta
conocimiento requiere de mediaciones no sólo multisensorialmente: sonidos, imágenes, textos,
de índole cognitiva, sino también comunicacional. colores y dimensiones virtuales interactúan en
Como mencionamos, estas revisiones implican tecnologías que llegan a cada vez más miembros
la exploración de los recorridos de búsqueda, de de la Sociedad de la Información. Las tecnologías
los mismos buscadores y metabuscadores, de la y el usuario interactúan activamente por medio
información que se escoge y de la que se descarta, de una conexión a la red en tiempo real; el sujeto
de la integración en las tareas académicas, de la accede a un hipertexto o a la llamada carretera de
participación de los docentes y de los procesos la información; el problema es que no cuenta con
de interacción con otros alumnos, entre otras estrategias de estudio que le permitan aprovechar,
cuestiones. comprender y utilizar óptimamente los contenidos.
Por ello es pertinente crear didácticas diferenciadas,

?=,5*<,5;965(*065(3*65,0** 107
Internet como herramienta educativa

es decir diseños o estrategias metodológicas que convierta en información.


contemplen la lógica de mediación simbólica que Desde esta arista, entendemos que el conocimiento
exigen las TIC y en concreto Internet. constructivista es de carácter personal e
En sentido estrictamente didáctico, orientado intransferible, es un sustantivo que comporta
hacia la apropiación educativa de Internet, resulta posesión y que es el resultado de la interacción
necesario abonar en torno a tres factores que del sujeto con el medio, sea éste a partir de libros,
median la interacción del proceso enseñanza- exposiciones o sistemas digitales.
aprendizaje: el conocimiento que habrá de A detalle, y para avanzar en las diferencias: sobre
construirse, el rol activo del alumno, y las funciones la diada información-conocimiento, diremos que la
de guía y orientador por parte del maestro. Para el primera es vista como objeto y no como proceso,
primer elemento, y en pleno sentido al tema central prescinde del sujeto que la genera y de quien la
de la presente ponencia, es pertinente describir recibe. Desde esta perspectiva, la información
las diferencias entre información y conocimiento es un conjunto de elementos relaciones con
así como las condicionantes que garantizan el alguna forma de materialidad asociada al tiempo
tránsito de un estado a otro. Más adelante, se (González, 2007). Esta construcción conceptual de
trazarán algunas vertientes relativas a la función SHPUMVYTHJP}ULZSHX\LKHYmZLU[PKVHSHYLÅL_P}U
cognitivamente activa de parte del alumno, que abordaremos en la lógica de intervención que
WHYH ÄUHSTLU[L HZWPYHY H \U U\L]V YVS KVJLU[L sigue el alumno con el empleo de Internet.
que deberá centrar su actividad en el diseño de Carina Lion (2006) en su texto Imaginar con
situaciones o, quizá, en ambientes de aprendizaje tecnologías alude a las diferencias entre información
orientados preponderantemente al desarrollo de y conocimiento, y argumenta que la información
habilidades intelectuales por parte de los alumnos. es discreta, lineal; en cambio: “[…] el conocimiento
está dispuesto en redes conceptuales con
De la información al conocimiento JVUL_PVULZZPNUPÄJH[P]HZLU[YLUVKVZKLZLU[PKV`
Es comúnmente aceptado que la información ZPNUPÄJHJP}U¹
es un conjunto de datos asociados a un campo De lo anterior, podemos considerar que la
determinado y se reconoce por su carácter información es solamente un insumo o base
transmisible; es decir, susceptible de transferir en para que los estudiantes piensen, comprendan,
paquete. Si observamos dicha información desde relacionen y generen conocimiento.
ángulos diversos, si hacemos reacomodo de sus Por otra parte, ante el diluvio informativo, la
datos y le damos un nuevo orden (auto estructura), educación actual debe promover en el alumno su
JVOLYLU[L`SVZ\ÄJPLU[LTLU[LJVUZPZ[LU[LS}NPJH capacidad para distinguir la información valiosa
y original (creatividad), podemos decir que estamos ` ZPNUPÄJH[P]H KL SH PYYLSL]HU[L ;HS KPZ[PUJP}U
aprendiendo; que estamos generando nuestro implica medir cualitativamente las informaciones
propio conocimiento. Así pues, el constructivismo y sopesarlas de acuerdo a un marco referencial
entiende que la generación de conocimiento es una previo que deberá construir el alumno. Sería algo
actividad interna del sujeto, y que éste, al momento que en palabras de Ausubel (2000), obligaría a que
de comunicarlo, o de transferirlo, seguramente lo las ideas previas colisionen con las nuevas para

?=,5*<,5;965(*065(3*65,0** 108
Internet como herramienta educativa

llegar a una resolución de aprendizaje. Sin embargo, conocimiento, se requiere una serie de actividades
para hacer contrastar ideas previas con nuevas cognoscitivas que se resguarde en la memoria y
o esquemas anteriores con nuevos –siguiendo a WVZPIPSP[LLSKLZHYYVSSVKLHJ[P]PKHKLZKLYLÅL_P}U`
Piaget– requerimos breve espacio detenernos al toma de decisiones por parte del alumno.
papel de la memoria, como una función cognitiva El acto de conocer, esencialmente humano,
que posibilitará posteriores habilidades en la requiere del manejo de información; ésta nos
generación del conocimiento. permite evocar, anticipar y construir situaciones,
,S JVUJLW[V KPNmTVZSV HZx  ¸[YHKPJPVUHS¹ KL objetos y experiencias de manera virtual sin que
la memoria nos remite a la construcción de un estén presentes empíricamente y, por su valor
espacio mental donde se conserva fragmentos o simbólico, podemos compartirla y no la perdemos.
pedazos de información. Este modelo responde a Con la información, interactuamos con los objetos
una concepción de memoria como tabla archivo o de la realidad con base en abstracciones e
base de datos; acceder a datos almacenados en inferencias que nos permitan igualmente desarrollar
la memoria implica el recuerdo literal y organizado y mejorar nuestra forma de coordinar acciones con
de la información. Las ciencias cognitivas actuales, otros. A esta capacidad para coordinar acciones le
buscan proponer una nueva forma de comprender llamamos comunicación. No hay conocimiento sin
la memoria tomando en cuenta conceptos información, aunque puede haber información sin
matemáticos, como sistemas de ecuaciones y, de conocimiento.
manera complementaria, modelos biológicos en Una sociedad que integra las TIC a su cultura no
términos de redes que simulan el comportamiento solamente es aquella que navega en Internet para
de redes neuronales. De esta manera, una red bajar o compartir música, o en la que sus jóvenes
neuronal va reteniendo información a lo largo son expertos en videojuegos. Tampoco tiene que
de un proceso de distinciones, selecciones, ver con la cantidad de artilugios o dispositivos
comparaciones y decisiones dentro de los tecnológicos (gadgets) que se use en nuestra
elementos de la propia red. Esto es, la memoria vida cotidiana, ni con la cantidad de personas con
literal no funciona para la explicación del trabajo en las que se mantenga una relación virtual en los
Internet, se aspira más a una memoria que ponga chats, en el correo electrónico o en nuestro propio
en diálogo construcciones anteriores dinámicas y blog. Ni mucho menos, “saber computación”,
ÅL_PISLZ`SHU\L]HPUMVYTHJP}UX\LZLSLWYLZLU[H que en la mayoría de los casos suele entenderse
Valga la digresión, solamente para establecer como la habilidad para usar un paquete de
que a partir de esta memoria de construcción ZVM[^HYLJVTVLS4PJYVZVM[6MÄJL,Z\UHMHSHJPH
comprensiva el educando discernirá la información mundialmente impuesta, contra la que hay que
que usará para su aprendizaje1. Esto es, para luchar abiertamente desde los países pobres o
que la información sea útil para la generación de periféricos en el sistema-mundo, sostener que a
más computadoras, mayor educación.
1  (VWD PHPRULD FRPSUHQVLYD VHJXUDPHQWH KDFH
DOXVLyQDODJHQHUDFLyQGHHVTXHPDVFRQFHSWXDOHVGHFRUWH Estamos vinculados en la Sociedad del
SLDJHWLDQR GRQGH ORV QLYHOHV GH FRPSUHQVLyQ GHO PXQGR Conocimiento, no cuando llevamos computadoras
HVWDEDQGDGRVSRUHVWUXFWXUDVRPDUFRVUHIHUHQFLDOHVTXH
SRVLELOLWDQODLQWHOLJLELOLGDGFRQHOHQWRUQR a la escuela o cuando los niños reciben clases

?=,5*<,5;965(*065(3*65,0** 109
Internet como herramienta educativa

con la pizarra digital, ni siquiera al integrar el uso pertinentes a la consulta realizada.


de software o de simuladores a la enseñanza En su tesis doctoral, Marta Fuentes (2009) propone
de contenidos; estamos en la Sociedad del tres fases para que el alumno transite en Internet
Conocimiento al proponernos desarrollar en KL I‚ZX\LKHZ Z\WLYÅ\HZ KL SH PUMVYTHJP}U
los alumnos habilidades cognitivas y marcos a estrategias que posibiliten aprendizajes
interpretativos para que puedan organizar la JVU[L_[\HSLZ`ZPNUPÄJH[P]VZ
información y mantener, en todo momento, una FASE 1: Análisis de la consulta
TPYHKHYLÅL_P]H`JYx[PJHKLZ\LU[VYUV El aprendiz debe decidir sobre el sentido y la
De lo anterior, podemos concluir que toda tecnología naturaleza de la búsqueda y tener claro cuál es la
de la información y la comunicación deberá ser ÄUHSPKHKKLSHTPZTH+PJOHPUKHNHJP}UPTWSPJH[YLZ
una tecnología de conocimiento. Si no avizoramos UP]LSLZKLJVTWYLUZP}U!3HKLÄUPJP}UKLS[}WPJVH
como objetivo de Internet la generación de elegir (búsqueda literal), la argumentación del tema
conocimiento, entonces estamos ante tecnologías (por qué y para qué se realizará) y, por último, la
que mediatizan, que reproducen, que enajenan; valoración de las posibles rutas de la búsqueda,
son, pues, tecnologías del desconocimiento. su contrastación y la elección más idónea (meta
Esta generación de conocimiento produce saber, cognición).
`JVUtSZLW\LKLTVKPÄJHYYLVYPLU[HYJVYYLNPY` -(:,!7SHUPÄJHJP}UKLSHI‚ZX\LKH
transformar cualquier acto; a eso se le llama poder. Cuando el alumno elige utilizar Internet, tiene dos
“Todo saber genera poder y todo poder genera caminos de uso: el incidental, llamado también
saber”, nos dijo Foucault (1976) desde la zapping, que es cuando de manera casi azarosa va
historiografía. “Todo conocer es hacer y todo hacer encontrando y guardando diversas informaciones;
es conocer” nos dice desde la biología Maturana contrariamente se encuentra el buscador activo,
(1998) y “Sólo podemos conocer actuando sobre que tiene patrones selectivos de la información
los objetos”, nos planteaba desde la piscogénesis, y marcos referenciales que le permiten elegir y
Piaget (1976). proponer sus propias rutas de indagación.
FASE 3: Autorregulación de la búsqueda
Rol del alumno Esta fase es de decisión, pues el alumno debe elegir
,S \ZV KL 0U[LYUL[JVUÄULZKLHWYLUKPaHQLL_PNL SVZ KVJ\TLU[VZ X\L KLÄUP[P]HTLU[L LTWSLHYm L
que el alumno sea, siguiendo a Juan I. Pozo PUPJPHYm SH PKLU[PÄJHJP}U KL PUMVYTHJP}U JVUJYL[H
(2002), un aprendiz estratégico, el cual se concibe con la que trabajará.
como aquél que toma decisiones conscientes Aquí, se esbozó alguna orientación hacia prácticas
e intencionales en función de unos objetivos autorreguladas de búsqueda de información
de aprendizaje y de condiciones contextuales dando relevancia a las decisiones estratégicas
variables. Actuar estratégicamente en calidad que tendrían que seguir los alumnos, enfatizando
de buscador de información supone, pues, que la función de estos últimos, no se reduce
interpretar adecuadamente las claves del contexto simplemente en la búsqueda de conocimientos
KLI‚ZX\LKHJVULSÄUKLHKVW[HYSHZKLJPZPVULZ prácticos para usar Internet; más allá de eso, y a
que puedan contribuir a seleccionar los datos más manera de Gilster en su libro Digital Literacy (1997),

?=,5*<,5;965(*065(3*65,0** 110
Internet como herramienta educativa

lo que se requiere del alumno del siglo XXI es que Por una parte, la inserción de las TIC a la educación
“domine ideas y no teclados”. no se presenta de manera automática simplemente
con el manejo del instrumento; esto es, solamente
El rol del profesor que el profesor maneje adecuadamente los
La formación del profesorado, es sin duda, un buen recursos digitales, sino que a su vez construya una
camino para lograr transformaciones en la práctica nueva cultura de aprendizaje, una construcción
educativa, sabemos que las nuevas tecnologías no que implique su propia transformación. Un cambio
representan en sí mejoras a la educación, pero que de rol que lo aleje de ser un mero medio transmisor
la transformación de los maestros sí (Area, 2001). y lo acerque más a ser un diseñador de estrategias
Para analizar el papel del docente frente a la de aprendizaje, guía en la realización de proyectos
inserción de las TIC como medios de enseñanza- y mediador en debates y discusiones que generen
aprendizaje, existen diversas líneas de investigación. aprendizajes colaborativos.
Una de ellas lo observa como usuario de medios De acuerdo a J. I. Pozo (2006), para cambiar la
y nuevas tecnologías; es decir, se evalúan sus educación es necesario revisar las concepciones
competencias técnicas con los recursos digitales que tienen los profesores de aprendizaje, las cuales
y lo observa como el eje en el diseño de la acción se construyen como herencia cultural, legado
didáctica. Esta vertiente enfatiza la formación implícito de formas de ser, de estar y de pensar.
profesional del docente en medios distinguiendo Estas herencias que nos sitúan como sujetos
su conocimiento formal y práctico con el uso de histórico-sociales, actúan sobre nosotros de
tecnologías (Cabero, 2007). manera implícita.
Esta perspectiva no es el planteamiento esencial Las creencias constituyen la base de nuestra
de la presente argumentación. No es el docente vida, el terreno sobre el que acontece. Porque
\[PSPaHUKVSHZ;0*KLTHULYHLÄJPLU[LSVX\LOHYm\UH ellas nos ponen delante lo que para nosotros es
YLÅL_P]H`JVUZ[Y\J[P]HPU[LY]LUJP}UKLSHZTPZTHZ la realidad misma. Toda nuestra conducta, incluso
dentro de la educación formal. Nos distanciamos la intelectual, depende de cuál sea el sistema
de la perspectiva de la Tecnología Educativa que de nuestras creencias auténticas. En ellas nos
observa en sí misma a los medios tecnológicos movemos, vivimos y somos. Por lo mismo, no
solamente como recursos didácticos. Se pretende, solemos tener conciencia expresa de ellas, no
WVY LS JVU[YHYPV X\L LS KVJLU[L YLÅL_PVUL ZVIYL las pensamos, sino que actúan latentes, como
las diferentes opciones que tiene para lograr la implicaciones de cuanto expresamente hacemos
participación activa auto-estructurante del alumno. o pensamos (Ortega, 1999).
En este sentido, la importancia del profesor es En este sentido, tendríamos que plantear en
fundamental sólo en la medida en que propicia en un primer momento la posibilidad de explicitar
Z\HS\TUVJVUÅPJ[VZJVNUP[P]VZ SV SH[LU[L" LS WYVMLZVYHKV YLX\PLYL \UH YLÅL_P}U
Se proponen algunas pistas que debe seguir el profunda de sus concepciones de enseñanza y
maestro para lograr en los alumnos acciones auto- KL HWYLUKPaHQL KLILYm PKLU[PÄJHYZL JVTV Z\QL[V
estructurantes respecto a la realidad simbólica producto de un complejo entramado de creencias
circundante. `]HSVYLZJ\S[\YHSLZX\LSVPUÅ\`LU`SVKL[LYTPUHU

?=,5*<,5;965(*065(3*65,0** 111
Internet como herramienta educativa

En la medida que reconozca el legado histórico que solamente su intervención estratégica, pedagógica
sin testamento le ha sido conferido (Pozo, 2006), y teleológica hacia el conocimiento conducirá
podrá decidir si continúa con tal reproducción una verdadera transición del alumno funcional al
o decide reconocerse como sujeto activo de alumno intelectual.
cambio, con capacidad de aprender y desaprender
constantemente. Hablamos, entonces, de una Bibliografía
segunda herencia que él tendrá que construir si así
Area M. (2001), Educar en la sociedad de la
SVKLZLH\UHOLYLUJPHX\LHWHY[PYKLSHYLÅL_P}U
información. Bilbao, Descleé de Brouwer.
propiciará una nueva cultura del aprendizaje.
(KLTmZ KL SH PUÅ\LUJPH OPZ[}YPJVJ\S[\YHS JVTV Ausubel, David. (2000), The acquisition and
factor determinante de las concepciones que retention of knowledge: A cognitive view, E.U.
University New York.
tiene el profesorado, podemos atisbar también
PU]LZ[PNHJPVULZ X\L YLÅL_PVUHU LU [VYUV HS [LTH Cabero, A. (2007). Nuevas Tecnologías aplicadas a
de la cultura social del gremio dentro de las la educación. Madrid, McGrawHill.
instituciones escolares.
Delors, Jacques. (1996). La educación encierra
7HYH ÄUHSPaHY YLJ\YYPYLTVZ H \UV KL SVZ H\[VYLZ
un tesoro. Informe a la UNESCO de la Comisión
más reconocidos dentro de la investigación actual Internacional para la Educación del siglo XXI.
de la formación del profesorado, el sociólogo Andy París,UNESCO.
Hargreaves (1996) quien ha realizado valiosos
González, J. (2007). Cibercultura e iniciación a la
aportes para comprender la cultura laboral de los
investigación.México,Conaculta.
KVJLU[LZLUU\LZ[YHtWVJH5\LZ[YVH\[VYPKLU[PÄJH
la problematización que sufre el profesor actual y Hargreaves, Andy.(1996) Profesorado, Cultura y
lo hace a través de diversos cuestionamientos que Postmodernidad. Madrid,Morata
sin duda alguna tienen relevancia y vigencia para
Maturana H. y Varela, F. (1998), El árbol del
el tema de análisis. conocimiento. Raíces biológicas del conocimiento
“¿Cuál es el sentido de la escuela actual? ¿Qué humano. Londres, Universidad de Boston.
papel ha de jugar en la Sociedad del conocimiento?
Ortega y Gasset, (1999).El tema de nuestro tiempo.
¿Qué conocimiento es importante? ¿Cómo
Madrid, Revista de Occidente.
incorporar los problemas sociales dominantes?
¿Seguimos siendo profesores o vamos a ser Pozo, J. I. (2002). Aprendizaje estratégico. Madrid.
entrenadores?” (Hargraves, 1996). Santillana.
El profesor de nuestro siglo sin duda se enfrenta
Pozo, J. I. et al., (2006) Nuevas formas de pensar
a retos y demandas de mayor complejidad que la enseñanza y el aprendizaje. Las concepciones
en tiempos anteriores, contradictorias entre sí, y de profesores y alumnos. Barcelona, crítica y
que conllevan una fuerte dosis de incertidumbre fundamentos, Barcelona.
y riesgos en la toma de decisiones. Será él quien
Fuentes, M. (2009) “Naufragar en Internet.
tenga la posibilidad de transformar las prácticas Estrategias de búsqueda de información en redes
de cultura escolar y sistemas de aprendizaje, telemáticas”. Disponible en: http://www.uoc.edu/
web/esp/art/uoc/0109037/fuentes.html.
?=,5*<,5;965(*065(3*65,0** 112
3HWVSx[PJHVÄJPHSKLPUJS\ZP}U
digital para los pueblos indígenas
Un estudio de caso: Los Matlatzincas
Jaime Enrique Cornelio Chaparro
Angélica Berenice Hernández Chávez
UNIVERSIDAD AUTÓNOMA DEL ESTADO DE MÉXICO

Resumen
El vertiginoso progreso de las Tecnologías de Información y Comunicación (TIC) en el contexto
  
de lo que hoy conocemos como Sociedad de la Información, ha representado la gran apuesta
para promover el desarrollo equitativo y justo entre países, regiones y sectores sociales, mediante
el acceso generalizado y uso apropiado de estas tecnologías. En América Latina como en otros
países del mundo se han venido implementando estrategias nacionales para acercar las nuevas
tecnologías a sectores de la población que poco o nulo acceso han tenido a ellas, donde se des-
tacan los programas para la instalación de Centros Comunitarios Digitales (CCD) principalmente
en zonas rurales y apartadas.
En nuestro país, a través del Sistema Nacional e-México se han instalado más de 10 mil (CCD) a
lo largo y ancho del territorio nacional, en zonas tanto urbanas como rurales para que la pobla-
ción de una manera incluyente y cercana, tenga acceso a la tecnología y a la conectividad. En
2005, a tres años de haber iniciado el programa, se habían instalado ya mil trescientos CCD en
comunidades pertenecientes a varios grupos lingüísticos del país, administrados por la Comisión
Nacional para el Desarrollo de los Pueblos Indígenas (CDI).
No obstante la amplia cobertura del proyecto, no hay registros de seguimiento que permitan
conocer cuáles han sido hasta ahora los resultados de la implantación de estos centros, ya que
TmZHSSmKLSHZJPMYHZVÄJPHSLZSVX\LPU[LYLZHZHILYLZOHZ[HX\tW\U[VOHUJVU[YPI\PKVHSKLZH-
rrollo comunitario; si han tenido algún impacto en las pautas culturales y sociales de los diversos
grupos lingüísticos, si se ha dado la articulación entre el aprendizaje individual y las instancias
colectivas de capacitación que son propias de las formas comunitarias para la transmisión de
conocimientos, etcétera.
De lo anterior se desprende la necesidad de realizar estudios intra-comunitarios que permitan
aportar elementos para el establecimiento de políticas y programas encaminados a promover un
mayor aprovechamiento para el desarrollo de las comunidades indígenas donde se han instala-
dos los Centros Comunitarios Digitales.
El objetivo de este trabajo es conocer las formas de uso y apropiación de los miembros de la
comunidad indígena matlatzinca, donde fue instalado un Centro Comunitario de Acceso, dentro
del programa Sistema Nacional e-México.

Palabras clave: Indígenas, Uso y apropiación, Internet


3H7VSx[PJH6ÄJPHSKL0UJS\ZP}U
Digital para los Pueblos Indígenas.

Introducción En 2003 se continuó con la primera fase de la


Cumbre Mundial de la Sociedad de la Información
El acelerado desarrollo de las Tecnologías
(CMSI), en Ginebra, Suiza, donde la Organización
de Información y Comunicación (TIC), ha llevado a
de las Naciones Unidas, en conjunto con la
los distintos países del mundo al establecimiento
Unión Internacional de Telecomunicaciones (UIT),
de políticas, leyes y reglamentos encaminados a
convocaron a los distintos países miembros para
reducir lo que se ha denominado “Brecha Digital”.
que juntos formularan estrategias para disminuir
En este contexto, en septiembre del 2000 se llevó
la brecha digital, considerando que los países no
a cabo la Cumbre del Milenio, convocada por
desarrollados contaban con menos presupuesto
la Organización de las Naciones Unidas (ONU),
que los desarrollados.
donde se estableció como uno de los objetivos
La segunda fase se efectuó en el mes de noviembre
prioritarios (además de objetivos orientados a
de 2005, en Túnez, donde se establecieron como
tomar las medidas necesarias en la lucha contra
objetivos prioritarios para la eliminación de la
la pobreza, el analfabetismo, el hambre, la falta de
brecha digital:
educación, la desigualdad entre los géneros, la
mortalidad infantil y materna, la enfermedad y la
% Reconocer que el internet se ha
degradación del medio ambiente, entre otros), el de
convertido en un recurso mundial
fomentar una asociación mundial para el desarrollo
disponible y necesario para la sociedad
mediante la cooperación con el sectores privado,
y su desarrollo; por lo cual es necesario
WHYH KHY HJJLZV H SVZ ILULÄJPVZ KL SHZ U\L]HZ
crear políticas para su gobernanza.
tecnologías, especialmente las de la información y
% Digitalizar el patrimonio cultural e
las comunicaciones.1
OPZ[}YPJV WHYH LS ILULÄJPV KL SHZ
generaciones futuras.
Un año después, en 2001, se creó el “Programa
% Acentúar la importancia a la protección
Información para Todos” (UNESCO), con la
del patrimonio indígena y legado
ÄUHSPKHK KL ZLY \UH WSH[HMVYTH WHYH LS KLIH[L
cultural, dentro del desarrollo de la
de políticas y acciones para promover el fácil
sociedad de la información.
acceso a las nuevas tecnologías de información
y comunicación, así como abrir el debate de las
Sobre este último punto, se estableció el
consecuencias de la utilización de las mismas,
compromiso de incluir dentro de las nuevas
reconociendo el acceso libre y universal a las TIC’s
tecnologías el uso de las lenguas indígenas, para
como un valor fundamental en el desarrollo de las
facilitar la inclusión de los pueblos dentro de la
naciones”. 2
sociedad de la información. 3

1 &XPEUHGHO0LOHQLR'LVSRQLEOHHQ
KWWSZZZXQRUJVSDQLVKPLOOHQQLXPJRDOVJOR
EDOVKWPO
2   3URJUDPD GH ,QIRUPDFLyQ SDUD 7RGRV 2UJD 3 (OFRPSURPLVRGH7~QH]&XPEUH0XQGLDOVREUH
QL]DFLyQ GH ODV 1DFLRQHV 8QLGDV SDUD OD (GXFDFLyQ OD OD6RFLHGDGGHOD,QIRUPDFLyQ
&LHQFLD\OD&XOWXUD

?=,5*<,5;965(*065(3*65,0** 114
3H7VSx[PJH6ÄJPHSKL0UJS\ZP}U
Digital para los Pueblos Indígenas.

El caso de América latina JVTWSLTLU[HYPV H SH THZPÄJHJP}U KLS


acceso, que es necesario promover
(…) Los programas de acceso público,
Para responder a las exigencias de la impulsados por la sociedad civil, el
Sociedad de la Información, durante los últimos sector privado o el Estado, constituyen
10 años en distintos países de América Latina han una alternativa viable y pertinente para
se han venido tomando acciones por parte del hacer frente a los desafíos.” (Celedón y
Razeto, 2009: 79-80)
Estado, el sector privado y la sociedad civil para la
instalación de cibercafés, infocentros o telecentros.
No obstante, un estudio realizado por la CEPAL en El número de telecentros en los países de la región
2009, señala que: han aumentado rápidamente y sus aportes no se
Para la mayoría de la población es difícil
acceder a estas tecnologías, sobre todo reducen a generar condiciones físicas de acceso,
si presentan algún grado de exclusión sino también, a propiciar espacios de capacitación
social, ya sea por los bajos ingresos para el uso de estas tecnologías y desarrollo de
LJVU}TPJVZLSHPZSHTPLU[VNLVNYmÄJVKL la población. No obstante, la conclusión a la que
las zonas rurales; o porque pertenecen
a sectores tradicionalmente marginados se llegó a través de este estudio, indica que este
como grupos étnicos, discapacitados tipo de iniciativas surgen en su mayoría de forma
y adultos mayores. (Celedón y Razeto, aislada, sin formar parte de una política pública
2009: 79) que cuente con el apoyo de los gobiernos para su
implementación y sostenibilidad.
Señala además, que el factor cultural es un
elemento que incide en la actitud hacia la tecnología,
Sistema nacional e-México
ya que el idioma y las tendencias culturales son de
suma importancia para la incorporación de estas
En nuestro país, se estableció el sistema
herramientas en la vida cotidiana.
L4t_PJV JVTV WVSx[PJH VÄJPHS WHYH KPZTPU\PY SH
brecha digital. Dicho programa tuvo su fase inicial
Finalmente, otro factor que condiciona el uso
en el periodo de noviembre de 2000 hasta abril
efectivo de las TIC’s tiene que ver con la existencia
de 2001. Siendo su lanzamiento el 16 de Julio
de contenido y aplicaciones de utilidad para la
de 2002, quedando a cargo de la Secretaría de
población. De nada sirve lograr condiciones de
Comunicaciones y Transportes del gobierno
conectividad si la gente no percibe qué hacer
Federal. Se estableció como:
con las TIC’s además de aplicaciones de correo Política Pública, que integra y articula
electrónico y de navegación en Internet. los intereses de los distintos niveles
de gobierno, de diversas entidades y
Como fue señalado po María Angélica Celedón y dependencias públicas, de los operadores
de redes de telecomunicaciones, de las
Alicia Razeto cámaras y asociaciones vinculadas a
El desarrollo de herramientas de las Tecnologías de la Información y las
gobierno-e, comercio-e, educación-e, Comunicaciones (TIC’s), así como de
salud-e, se constituye en un factor KP]LYZHZ PUZ[P[\JPVULZ H ÄU KL HTWSPHY

?=,5*<,5;965(*065(3*65,0** 115
3H7VSx[PJH6ÄJPHSKL0UJS\ZP}U
Digital para los Pueblos Indígenas.

la cobertura de servicios básicos como 6.   Integrar a través del sistema e-México a


educación , salud, economía, gobierno y los diversos grupos lingüísticos y étnicos
ciencia, tecnología e industria, así como
de México; a mexicanos en el extranjero
de otros servicios a la comunidad (…)
diseñado por el Gobierno de México y a personas con discapacidad.
para conducir y propiciar la transición 7.   Garantizar mecanismos jurídicos,
de México hacia la sociedad de la la regulación y aspectos tarifarios,
información y el conocimiento, diseñando
adecuados para el desempeño del
los servicios digitales para el ciudadano
del siglo XXI. (Margáin, 2003: 4) sistema e-México, en condiciones de
certidumbre, transparencia y seguridad
Además, se plantea como una opción para generar para garantizar el derecho a la intimidad
alternativas de sistemas tecnológicos de contenido y la informática de los usuarios, así
social, que ofrezcan oportunidades y herramientas como valores éticos y sociales de los
WVYTLKPVKLSHZU\L]HZ[LJUVSVNxHZJVUSHÄUHSPKHK mexicanos.
de mejorar la calidad de vida de los mexicanos, 8.   Coordinación con los diferentes grupos
llevando Internet gratuito a todo el país. participantes (públicos y privados)
en el desarrollo de la administración;
Los principales objetivos que busca este Programa operación mantenimiento, control y
son los siguientes: ÄUHUJPHTPLU[VKLtZ[LZPZ[LTH
9.   Despliegue del programa e-México,
1.   Acelerar la penetración de servicios NHYHU[PaHUKVM\LU[LZKLÄUHUJPHTPLU[V
de Telecomunicaciones e informática, internacionales y nacionales, para que el
JVUSHÄUHSPKHKKLX\LLZ[tULU[VKVLS programa sea rentable.
territorio nacional y al alcance de toda la
población. El 6 de junio de 2003, fue inaugurada la Primera Red
2.   Renovación Tecnológica y demanda de Satelital e-México, cubriendo tres mil doscientas
servicios. localidades del país, incluidas las Cabeceras
3.   Brindar nuevas opciones de acceso a la Municipales, para dar servicio a más del 60% de la
educación y capacitación; que estimulen WVISHJP}UJVTVZLVIZLY]HLULSZPN\PLU[LNYmÄJV!
el aprendizaje y que la educación sea
accesible para cualquier persona.
4.   Facilitar el acceso a los profesionales de
la salud del país. El acceso a servicios
y contenidos de salud a distancia, que
permita mejorar el nivel del bienestar de
la población.
5.   Promover la competitividad de las
pequeñas y medianas empresas, tanto 3XQWRVGH6HUYLFLR
dentro, como fuera del país. GHO6LVWHPD
1DFLRQDOH0p[LFR 

?=,5*<,5;965(*065(3*65,0** 116
3H7VSx[PJH6ÄJPHSKL0UJS\ZP}U
Digital para los Pueblos Indígenas.

Cobertura de los Centros Comunitarios Digitales rurales que permita el comercio entre
(CCDs), del Sistema Nacional e-México comunidades, municipios y estados.
% e-Economía: Promoverá el desarrollo y
El programa e-México cuenta con la participación competitividad de las Pequeñas y Medianas
de la iniciativa privada a través de empresas empresas (Pymes) a través de eliminar
como: Axtel, Alestra, Unefon, Pegaso, Iusacell, cadenas de intermediarios, facilitar el
Telcel, Avantel, Bestel, Telmex; así como el Centro acceso a los mercados no sólo nacionales,
Nacional de Desarrollo Municipal y el sistema de sino de exportación. Integración de cadenas
Información de desarrollo Municipal, ambos de productivas. Fortalecer la comunicación
la Secretaría de Gobernación y Funcionarios del entre negocios clientes y proveedores.
sector de Comunicaciones y transportes. % e-Gobierno: Garantiza el libre acceso de los
ciudadanos a servicios públicos (tramites en
El Programa está organizado en tres ejes rectores línea, información pública, estatal, federal y
para su desarrollo: municipal).

1.   Conectividad: para incrementar las 3.   Sistemas: Portal de portales, para ofrecer –a


infraestructuras y cobertura de servicio través de una sola cara- A) a la mayoría de
telefónico en los hogares mexicanos. Así los ciudadanos, en función de sus propias
como crear una red de Centros Comunitarios necesidades. B) NAP (Punto Neutral de
Digitales (CCDs) que provean conectividad a Acceso a Red) para optimizar a los contenidos
poblaciones y familias que no cuenten con KL L4t_PJV ZPU ULJLZPKHK KL X\L LS [YmÄJV
infraestructura de telecomunicaciones. entre operadores de México salga del País. C)
Data center (Centro de Cómputo de Gobierno)
2.   *VU[LUPKVZ!*VUSHÄUHSPKHKKLSSL]HYHJHIV para concentrar los sistemas que van a operar
los objetivos mencionados, se crearon los a e-México.
siguientes proyectos:
% e-Educación: Impulsa innovadores sistemas De los ejes señalados, sobresale la instalación de
con el uso de las nuevas tecnologías de Centros Comunitarios Digitales (CCDs), puesto
comunicación y de información que por medio de ellos se pretende llegar a los
% e-Salud: Facilitará el acceso a servicios ciudadanos de todos los estados y de todas las
y contenidos de la salud a distancia LKHKLZJVUSHÄUHSPKHKKLH\TLU[HYLSU‚TLYVKL
que permita mejorar el nivel de vida de alfabetizados digitalmente y sin costo alguno.
la población, a través de telemedicina,
educación a distancia, expediente clínico A partir del 9 de febrero de 2009 la Coordinación
digital. del Sistema Nacional e-México se convierte en
% e-Comercio: Enfocado a las comunidades Coordinación de la Sociedad de la Información y el
indígenas. Para artesanos, talleres, Conocimiento (CSIC). Con este cambio se pretende
maquiladoras instaladas en comunidades dar un nuevo impulso a los motores de desarrollo

?=,5*<,5;965(*065(3*65,0** 117
3H7VSx[PJH6ÄJPHSKL0UJS\ZP}U
Digital para los Pueblos Indígenas.

y progreso, que son parte de las características de sobre la mejora de las leyes y reglamentos que
la Sociedad de la Información y el Conocimiento faciliten el desarrollo acelerado de Internet,
H UP]LS NSVIHS 7HYH LSSV ZL YLKLÄUPLYVU HSN\UVZ incorporando los factores de educación, salud,
HZWLJ[VZ LU[YL LSSVZ SH KLÄUPJP}U KLS WYVNYHTH economía y gobierno, así como fomentar el
en sí, pues ahora la Coordinación de la Sociedad desarrollo de la investigación e innovación para dar
de la Información y el Conocimiento es la continuidad a las estrategias y propuestas iniciales
responsable de proponer y conducir las políticas del Sistema Nacional e-México, sobre todo en lo
para el desarrollo, implementación y coordinación que respecta a la propagación y difusión de los
del Sistema Nacional e-México, formulando y CCD’s.
proponiendo estrategias, programas y sinergias
en el desarrollo de proyectos particularmente en Centros comunitarios digitales
materia de Conectividad, Contenidos y Sistemas.
Los Centros Comunitarios Digitales (CCDs)
Promoviendo y coordinando estudios, son espacios públicos con acceso a internet
investigaciones y acciones que coadyuven al NYH[\P[VJ\`HÄUHSPKHKLZX\LZLHWYV]LJOLUtZ[HZ
desarrollo y adopción de las tecnologías de la herramientas como medida de aprendizaje. Se
Información y las Comunicaciones, contribuyendo encuentran ubicados principalmente en escuelas,
al mejoramiento del uso y aprovechamiento de bibliotecas, centros de salud, sitios de correo y
estas tecnologías entre las dependencias de la VÄJPUHZKLNVIPLYUVWLYVZVIYL[VKVLUHX\LSSHZ
Administración Pública Federal, y entre ésta y los zonas que son consideradas de alta marginación.
gobiernos de las entidades federativas y de los No obstante, como señala Sandoval (2006), no
municipios, así como con la población en general.4 L_PZ[L \U JYP[LYPV KLÄUPKV WHYH KL[LYTPUHY KVUKL
construir los Centros Comunitarios Digitales, pues
De esta manera, la Coordinación tendrá la labor en algunas de las comunidades de alta marginación,
de incluir a dependencias y entidades para formar UV J\LU[HU JVU \UH PUMYHLZ[Y\J[\YH Z\ÄJPLU[L L
parte de esta Sociedad de la Información y el incluso se tienen que adaptar espacios o reducir el
Conocimiento, lo cual implica la conectividad, espacio de las bibliotecas de los municipios para
sistemas y contenidos, y su vigilancia. Así mismo, instalar los equipos.
promover el acceso universal a los servicios
digitales a través del apropiamiento de nuevas 3HÄSVZVMxHKLS*LU[YV*VT\UP[HYPV+PNP[HSJVUZPZ[L
tecnologías para que la población, sobre todo la en que éste es apadrinado por una dependencia
más vulnerable, tenga acceso a una mejor calidad o institución gubernamental, que es la que
de vida para así incrementar su desarrollo social y proporciona tanto el mobiliario como el equipo
humano. de cómputo. Por su parte, el Sistema Nacional
Un punto muy importante es el trabajo a realizar e-México proporciona todo lo relacionado con la
conectividad satelital para proveer los diversos
4   Coordinación de la Sociedad de la Información y el Co-
nocimiento (CSIC), de la Secretaría de Comunicaciones y Trans- servicios digitales. De esta manera, los CCDs
portes. http://www.sct.gob.mx/coordinacion-de-la-sociedad-de-
la-informacion-y-el-conocimiento/browse/3/ pueden estar a cargo de instituciones como: la
?=,5*<,5;965(*065(3*65,0** 118
3H7VSx[PJH6ÄJPHSKL0UJS\ZP}U
Digital para los Pueblos Indígenas.

Comisión Nacional para el Desarrollo de los Pueblos Indígenas (CDI), la Dirección General de Bachilleratos
(DGB), al Instituto Nacional para el Federalismo y el Desarrollo Municipal (INAFED), el Instituto Nacional de
Educación para Adultos (INEA), la Secretaría de Comunicaciones y Transportes en conjunto con el Instituto
Mexicano del Transporte (SCT-IMT), Secretaría de Desarrollo Social (SEDESOL), Servicio Postal Mexicano
(SEPOMEX), Secretaría de Salud (SSA), en conjunto con el programa Oportunidades y Telecomunicaciones
de México (TELECOM).

La siguiente tabla muestra el número de Centros Comunitarios Digitales, por institución a nivel nacional:

INSTITUCIÓN   NÚMERO  DE  CCD  


ADMINISTRADOS
6HFUHWDUtDGH(GXFDFLyQ3~EOLFD  (SEP) 
,QVWLWXWR1DFLRQDOGH(GXFDFLyQSDUD$GXOWRV  (INEA) 
6HFUHWDUtDGH'HVDUUROOR6RFLDO(SEDESOL) 
6HFUHWDUtDGH6DOXG(SSA) 

'LUHFFLyQ*HQHUDOGH%LEOLRWHFDV(DGB) 
6HFUHWDUtDGH6DOXG2SRUWXQLGDGHV 
,QVWLWXWR1DFLRQDOSDUDHO)HGHUDOLVPR\HO'HVDUUROOR
0XQLFLSDO(INAFED) 
&HQWURVGHOD6HFUHWDUtDGH&RPXQLFDFLRQHV\
7UDQVSRUWHV(SCT) 
&RPLVLyQ1DFLRQDOSDUDHO'HVDUUROORGHORV3XHEORV
,QGtJHQDV(CDI) 
7HOHFRPXQLFDFLRQHVGH0p[LFR  (TELECOM) 
6HUYLFLR3RVWDO0H[LFDQR(SEPOMEX) 
6HFUHWDUtDGH&RPXQLFDFLRQHV\7UDQVSRUWHV,QVWLWXWR
0H[LFDQRGHO7UDQVSRUWH(SCT-­IMT) 
Total 
Fuente: Programa e-México. “Ubica tu centro comunitario digital”.

CCD’S en el Estado de México

De los 7,450 CCDs señalados en el cuadro anterior, 337 pertenecen al Estado de México; 160
están ubicados en 32 municipios considerados de alta marginación, entre ellos 12 municipios donde
se encuentran ubicadas las comunidades indígenas. En todos los casos, los CCDs están a cargo de la
Secretaría de Desarrollo Social. 5
5 'DWRVSURSRUFLRQDGRVSRU6DQGUD0RUDOHV-HIDGHGHORV&HQWURV&RPXQLWDULRVGH$FFHVR &&$ HQHO(VWDGR
GH0p[LFR

?=,5*<,5;965(*065(3*65,0** 119
3H7VSx[PJH6ÄJPHSKL0UJS\ZP}U
Digital para los Pueblos Indígenas.

En las comunidades indígenas, los CCDs se El matlatzinca es uno de los pueblos indígenas del
ubican en pequeños espacios acondicionados país que mayor desintegración ha sufrido desde la
época de la Conquista hasta la actualidad. De haber
para su funcionamiento y en las bibliotecas de las
sido un grupo que ocupaba un amplio territorio
cabeceras municipales, dónde han sido aceptados en la época prehispánica, el correspondiente a
como una ayuda para las actividades escolares y en los actuales estados de Michoacán, Guerrero y
los cuales la Comisión Nacional para el Desarrollo México, se ha reducido a esta sola comunidad.
de los Pueblos Indígenas (CDI) pretende rescatar la En la época prehispánica, este grupo
lengua originaria. lingüístico ocupaba un extenso territorio
y en consecuencia su población era
ZPNUPÄJH[P]HTLU[L TmZ LSL]HKH X\L SH
nahua, mazahua u otomí. Sin embargo,
en la actualidad el fenómeno se ha
invertido, siendo estos tres grupos
quienes cuentan con una población
numerosa […] (Quezada, 1996: 10).

La base económica de la comunidad es la


agricultura, pero se cuenta además con la
explotación de una mina de arena. Asimismo, el
aprovechamiento del agua del río ha facilitado la
instalación de criaderos de truchas y, de manera
más reciente, se han aprovechado los recursos
forestales en la creación de talleres familiares de
Municipios con zonas indígenas carpintería.
Fuente: Base de datos de los Centros Comunitarios
de Acceso en el Estado de México 2009. La propiedad de la tierra, a decir de Korsbaek y
González, presenta un cuadro bastante complejo,
lo que da lugar a la monopolización y concentración
Los Matlatzincas de este recurso.
Existen todas las combinaciones posibles
El pueblo indígena Matlatzinca está de tenencia de la tierra (y algunas neta-
localizado en la comunidad de San Francisco mente imposibles): aparte de los campe-
sinos que tienen tierras bajo un solo régi-
Oxtotilpan, municipio de Temascaltepec, en el men, hay comuneros que son también eji-
Estado de México. Según el Censo General datarios, hay ejidatarios que tienen propie-
de Población y Vivienda 2000 (INEGI, 2000), la dad privada, hay pequeños propietarios
comunidad de San Francisco Oxtotilpan tiene que son comuneros. Hemos encontrado
campesinos que no son ni comuneros ni
alrededor de 2,000 habitantes, que son hablantes ejidatarios ni propietarios privados, y que
de la lengua indígena matlatzinca. 6 sin embargo tienen tierra […] (Korsbaek-
González, 1999: 295).

6 El Censo General de Población y Vivienda 2000 de INEGI,


?=,5*<,5;965(*065(3*65,0** reportó 651 hablantes de esta lengua en la comunidad. 120
3H7VSx[PJH6ÄJPHSKL0UJS\ZP}U
Digital para los Pueblos Indígenas.

Sin embargo, la tierra es escasa en comparación % Un secretario de recaudación. Es el


con el número de habitantes, lo que ha obligado encargado de la recolecta mensual
a un alto porcentaje de la población a emigrar en KL \UH JHU[PKHK LZWLJxÄJH WVY JHKH
busca de trabajo hacia otras regiones como la persona para sufragar gastos por el
zona conurbada del Distrito Federal. desempeño de actividades políticas de
las autoridades.
En cuanto al sistema de autoridad, se divide en % El representante supremo del pueblo
civiles y religiosas. Las primeras están constituidas indígena matlatzinca, quien vincula
de la siguiente manera: a la población total con los sectores
institucionalizados del Estado, como el
% Tres delegados a los cuales les Consejo Estatal de Desarrollo Integral
corresponde, ya sea la parte norte, el de los Pueblos Indígenas del Estado
centro o la parte sur de la comunidad. de México (CEDIPIEM) y la Comisión
% En cada una de las siete colonias se tiene Nacional para el Desarrollo de los
a un jefe de seguridad, un jefe de ronda Pueblos Indígenas (CDI).
y un policía.
% Un comisario ejidal, encargado de la Por lo que toca a las autoridades religiosas, éstas
distribución de las tierras ejidales, que se conforman por el sistema de cargos. Los prin-
cuenta con un secretario y un suplente. cipales cargos están divididos en dos grupos: los
% Un representante de bienes comunales mayordomos y los mbexoques7 conformados por
que cuenta también con su secretario y seis miembros respectivamente, más la pareja más
suplente, para administrar el uso correcto PTWVY[HU[LX\LJVUMVYTHULSºÄZJHS»`LSºÄZJHSP[V»
de las tierras comunales.
% Un presidente de aguas con sus Según la antropóloga Maricela Gallegos Devéze, su
respectivos secretario y suplente, que concepción del mundo y de la vida, sigue basada
en gran parte en sus creencias antiguas.
se auxilia en el cumplimiento de sus
Tienen una concepción animista de la
funciones por siete jueces de agua,
naturaleza, o sea que consideran que
uno por cada colonia, quienes vigilan y tanto las personas como los animales y
autorizan los usos de agua de riego de las plantas tienen alma, a ello se debe su
los cinco canales existentes, así como actitud reverencial hacia la naturaleza y a
todo lo que hay en ella […] (Gallegos, 1998:
de la construcción de nuevos canales
101).
para su mejor distribución.
% Un vigilante de explote, que autoriza
cuántas y cuáles son las zonas de Finalmente, es importante señalar que la dinámica
monte a limpiar, cuántos carros de arena por la que atraviesa esta comunidad, al igual que
por día saldrán de la población. A este otras comunidades indígenas del estado de México,
personaje se encuentran supeditados
7 Campaneros o criados.
los presidentes de tierras ejidales y
comunales.
?=,5*<,5;965(*065(3*65,0** 121
3H7VSx[PJH6ÄJPHSKL0UJS\ZP}U
Digital para los Pueblos Indígenas.

está marcada por la tensión constante entre lo rural las TIC. Muestra además cómo las prácticas de los
y urbano, es decir, en una constante interacción usuarios marcan una separación, una diferencia
social, económica y cultural entre diversos grupos con el programa que la tecnocracia y las industrias
sociales, determinada por la inserción al mercado J\S[\YHSLZI\ZJHUPTWVULYSLZ:LPUZPZ[LÄUHSTLU[L
de trabajo externo (principalmente el DF, Toluca y sobre el carácter fundamentalmente imprevisible
Valle de Bravo) y que va transformando el mundo de los usuarios que no cesan de transformar y de
comunitario al incorporar aspiraciones, prácticas y desviar los servicios y las tecnologías que les son
representaciones más cercanas al medio urbano, ofrecidos.
al tiempo que otras prácticas y representaciones
tradicionales se transforman o pierden vigencia. En cuanto a la noción de apropiación, se remonta
a las preocupaciones de los investigadores
Marco conceptual francocanadienses que deseaban desarrollar una
sociopolítica de los usos que llamara la atención
La noción de uso apareció en la sociología ZVIYL SH KPTLUZP}U JVUÅPJ[P]H KL SH HWYVWPHJP}U
de los medios con la corriente funcionalista de de las tecnologías en el seno de las relaciones
SVZ <ZVZ ` NYH[PÄJHJPVULZ LU SVZ H|VZ  `  de producción y de reproducción de la economía
No obstante de que se le acusa por reducir la capitalista. No obstante, la noción de apropiación
atracción por las tecnologías a mecanismos permite describir el proceso de interiorización
de compensación sociológica, estos primeros progresiva de competencias técnicas y cognitivas
trabajos abrieron el camino para un análisis del uso entre los individuos y los grupos que manejan
que se emancipa de un determinismo unilateral de cotidianamente estas tecnologías.
la técnica sobre la sociedad (Ambrosi, Peugeot y
Pimienta (2005). Por lo que toca a los estudios que abordan la
problemática entre las TIC y los grupos indígenas,
De manera más reciente los trabajos de Michel Monasterios (2001-2003), Del Álamo (2004)
KL*LY[LH\OHU[LUPKV\UHNYHUPUÅ\LUJPHLUSVZ y Correa (2005), destacan experiencias que
estudios de usos en Francia o en la corriente describen cómo las poblaciones indígenas de la
británica de los cultural Studies. Lo que ha permitido región latinoamericana están haciendo uso de las
ampliar la visión más allá de la relación individual nuevas tecnologías para solventar algunos de los
de las personas con las interfaces tecnológicas. La problemas más acuciantes que les afectan.
base o el sustento de su propuesta nace a partir En este sentido, podemos decir que
de reconocer la capacidad de los individuos para la los pueblos indígenas latinoamericanos
autonomía y la libertad. En este sentido, el abordaje están luchando por tener su propio
consiste en detectar los mecanismos por los cuales territorio en el ciberespacio y gozar del
uso de las nuevas tecnologías. Los logros
SVZPUKP]PK\VZZL]\LS]LUZ\QL[VZX\LTHUPÄLZ[HU en este sentido todavía parecen ser
formas de autonomía en un conjunto muy amplio pequeños (sobretodo si los comparamos
de prácticas de la vida cotidiana, el consumo, la con los avances de las grandes industrias
lectura, la vivienda, o en este caso, el manejo de dedicadas a las tecnologías de la

?=,5*<,5;965(*065(3*65,0** 122
3H7VSx[PJH6ÄJPHSKL0UJS\ZP}U
Digital para los Pueblos Indígenas.

información) aunque podríamos hablar La conciencia adquirida en torno a la naturaleza


de un avance indígena en materia de democrática e interactiva de la Internet ha llevado
nuevas tecnologías durante los últimos
a las organizaciones indígenas hacia una nueva
años. (Del Álamo, 2004: 3)
dinámica en el ejercido de su derecho para
comunicar el conocimiento de su proceso histórico,
Efectivamente, desde hace algún tiempo diversas cultural y social.
organizaciones indígenas están haciendo uso
de algunos de los recursos de Internet (Correo Por otra parte, al margen de la existencia de
electrónico y páginas en Internet), como manera páginas ligadas a movimientos de reivindicación,
KL PU[LUZPÄJHY Z\Z YLSHJPVULZ KL WYVTVJP}U KL se ha producido un uso de la TIC por parte de los
difundir y recibir información. Es fácil observar en el diferentes grupos lingüísticos para satisfacer otro
contenido de los diferentes portales los mensajes tipo de necesidades.
que dan prioridad al rescate de la identidad,
difusión de las prácticas culturales y cosmovisión,
Gómez Mont (2002), ha señalado que con el paso
así como la intención de generar conciencia sobre
del tiempo las comunidades indígenas han sabido
los derechos indígenas.
HWYVWPHYZL SLU[H WLYV LÄJHaTLU[L KL TLKPVZ
de comunicación como la radio, el teléfono, el
En este sentido, Sandoval y Mota (2007) destacan vídeo y ahora el Internet. Logrando familiarizarse
aspectos relacionados con los derechos indígenas y utilizar estos instrumentos en función de sus
y su inserción en la Sociedad de la Información. necesidades.
Consideran relevante su inclusión a partir de sus
Es evidente una creciente participación de
derechos colectivos; de los convenios, acuerdos y las comunidades indígenas en iniciativas
tratados establecidos. que competen a los viejos y nuevos
medios de información y comunicación,
Los indígenas han venido planteando
aunada a una falta de documentación
en diferentes eventos internacionales
escrita sobre los procesos de apropiación
la necesidad de poseer su propio
y creatividad tecnológica. La fotografía,
territorio en el ciberespacio mediante
el cine, las radios comunitarias, el vídeo,
el uso de las nuevas tecnologías,
LS MH_ LS [LStMVUV JLS\SHY ` ÄUHSTLU[L
mismas que les ayudaría a potencializar
internet forman parte de su cotidiano. La
acciones democráticas tanto al interior
llegada de estos medios ha sido en gran
de sus pueblos como con el resto de
medida silenciosa y desconocida para
la sociedad. Luchan por ser parte de la
la mayoría de la población mexicana,
sociedad de la información con base
sin embargo, para las comunidades
en sus derechos colectivos y a partir
estos medios han sido un motor para
de la búsqueda de la justicia social
conservar su memoria histórica, impulsar
con democracia a partir de criterios de
la producción y venta de sus productos
autonomía étnica. (Sandoval y Mota,
y fortalecer sus relaciones sociales a
2007: 23)
nivel regional, nacional e internacional.
(Gómez, 2002: 3)

?=,5*<,5;965(*065(3*65,0** 123
3H7VSx[PJH6ÄJPHSKL0UJS\ZP}U
Digital para los Pueblos Indígenas.

No obstante, señala, en la mayoría de los casos las Para ello, se han utilizado dos conceptos
;0*JVUÄULZLK\JH[P]VZSSLNHUHSHZJVT\UPKHKLZ desarrollados por Serge Proulx en su obra La
no por consenso comunitario sino por decreto Révolution Internet en question (2004):
estatal. 1. El modelo mental. Como la representación
En este caso observamos dos subjetiva que un usuario se hace en forma más o
direcciones que se contraponen: a) en
menos consciente del objeto técnico que intenta
WYPTLYS\NHY\UKPJ[HTLUVÄJPHSX\LOHJL
llegar infraestructura y computadoras a apropiarse. En este sentido, la representación
las comunidades sin antes consultar su subjetiva está en función del conocimiento que una
parecer; y b) una demanda de parte de persona tiene de Internet y de sus posibilidades,
las comunidades para que la introducción
así como de la disposición que algunas personas
de las TIC se haga de acuerdo a
procesos de consulta y aceptación en han desarrollado frente al universo de los objetos
las asambleas. (Gómez, 2006: 15) técnicos, lo cual podría denominarse “cultura
técnica” (Proulx, 2004).

En efecto, dos visiones distintas en la forma 2. El proceso de apropiación de Internet. Que podría
de concebir la tecnología para integrarla a la diná- ZLYKLÄUPKVWVY[YLZJVUKPJPVULZ!
mica comunitaria. Es por ello que nos propusimos % La accesibilidad al equipo y a las
realizar un estudio que nos permitiera conocer el infraestructuras,
sentido y la utilidad que atribuyen al Internet los % Comprender el manejo de los equipos, así
miembros de la comunidad indígena matlatzinca, como las reglas y protocolos de navegación
donde se instaló en el año 2005 un CCD den- y de comunicación en el ciberespacio.
tro del programa Sistema Nacional e-México. En % La producción de contenidos que podrán
consecuencia, el estudio diseñado consiste en ser publicados en la red.
una investigación de tipo cualitativo, que, concre-
tamente, nos aporta información mediante obser- En una primera etapa de observación se estableció
vaciones y entrevistas. Lo que se expone a conti- una muestra constituida principalmente por
nuación son algunos resultados preliminares de jóvenes en un rango de edad entre 15 y 18 años,
esta investigación en curso. debido a que son ellos quienes acuden con mayor
regularidad al CCD de la comunidad.
Metodología Las preguntas estuvieron orientadas, entre otros
aspectos, a conocer las formas como perciben y
Para alcanzar el objetivo propuesto, se se han relacionado con esta tecnología.
aplicó un modelo de “análisis comprensivo”
(Raymond y Campenhoudt, 1999) que consiste Así mismo, para determinar el nivel de apropiación
LUHZVJPHY\UZPNUPÄJHU[L!LSUP]LSKLHWYVWPHJP}U de Internet se procedió a evaluar el interés y la
KL0U[LYUL[H\UZPNUPÄJHKV!LSZLU[PKV`SH\[PSPKHK habilidad de estos jóvenes en las diversas tareas
atribuidos a éste. de interactividad. Lo cual se determino de la
siguiente manera:

?=,5*<,5;965(*065(3*65,0** 124
3H7VSx[PJH6ÄJPHSKL0UJS\ZP}U
Digital para los Pueblos Indígenas.

digitales desde la puesta en marcha del


Desde un bajo nivel de apropiación como la simple CCD en la comunidad, además de recibir
posibilidad e interés en extraer información puesta algunos conocimientos sobre el uso de las
a disposición en un determinado sitio Web, hasta computadoras en el espacio escolar.
un alto nivel de apropiación para la producción y
publicación de contenidos originales y la animación Al no contar con una computadora en sus
de un sitio Web. casas, asisten al CCD una o dos veces por
semana para realizar sus tareas escolares; lo
Este nivel de apropiación está ligado a su “cultura que hace de este grupo el más representativo,
técnica”, es decir a su disposición y a sus pues está constituido por el 65% de los jóvenes
JVTWL[LUJPHZ WHYH PKLU[PÄJHY ` JVTWYLUKLY SVZ entrevistados.
elementos de interacción hombre-máquina. De
HJ\LYKV JVU LZ[V ZL JSHZPÄJ} H SVZ \Z\HYPVZ KLS 3.   TERCER CASO: Usuarios que poseen un
CCD de la comunidad de San Francisco Oxtotilpan escaso conocimiento de la interfase virtual
de la siguiente manera: y material. Su primer contacto con los
dispositivos digitales ha sido desde la puesta
1.   PRIMER CASO: Hablamos de usuarios en marcha del CCD en la comunidad.
que poseen un considerado conocimiento
de la interfase virtual y material; están Ellos tampoco cuentan con una computadora
familiarizados con los dispositivos digitales, en sus casas, asisten de forma esporádica y de
especialmente las computadoras desde manera grupal, pues comparten la computadora
hace varios años, esto se debe a que han entre dos o tres personas, y únicamente asisten al
nacido o vivido fuera de la comunidad CCD para hacer trabajos escolares.
(en zonas urbanas del estado de México
o en las zonas conurbadas del DF) y han Este caso abarca sólo el 25% de los entrevistados,
regresado para reintegrase a la comunidad, ya que muchos de estos jóvenes estudiantes viven
trayendo consigo estos conocimientos. LU JVT\UPKHKLZ ]LJPUHZ WVY SV X\L ZL KPÄJ\S[H
asistir con mayor frecuencia al CCD.
Estos jóvenes cuentan con una computadora
en sus casas o asisten al CCD de manera Conclusiones
regular. Este grupo este constituido por un
número reducido de usuarios, ya que hablamos ,U [tYTPUVZ NLULYHSLZ ZL W\LKL HÄYTHY
de un 10% de la muestra. que para los habitantes de la comunidad indígena
matlatzinca esta tecnología no representa un
2.   SEGUNDO CASO: Son usuarios que elemento que podría contribuir al desarrollo y
poseen un mediano conocimiento de la mejoramiento de sus condiciones de vida ni
interfase virtual y material. Han tenido al aumento de sus ingresos económicos. Tal
su primer contacto con los dispositivos percepción está claramente asociada a las muy

?=,5*<,5;965(*065(3*65,0** 125
3H7VSx[PJH6ÄJPHSKL0UJS\ZP}U
Digital para los Pueblos Indígenas.

marcadas diferencias en el capital cultural entre mación se realiza al azar y a través una navegación
dos generaciones, una sin estudios y otra con intuitiva pues los usuarios no poseen criterios sóli-
estudios. Es por ello que tanto para las autoridades dos para seleccionar la información:
civiles y religiosas, como para la población adulta
Pues busco una por una [...] y
en general, el funcionamiento del CCD se percibe
ya de todas éstas leo y la que más o
como una necesidad proyectada hacia los jóvenes menos se acerque o la que sea más es-
en la medida que siguen siendo depositarios de las WLJPÄJH6THY+VTxUN\La/LYUmUKLa
aspiraciones de progreso y movilidad social. edad : 16 años. Entrevista realizada el
14 de mayo de 2008, en el CCD)

El espacio escolar es el lugar donde se refuerza y


Voy leyendo todo allí a ver que hay y
legitima la necesidad para uso de las, ya que desde abro uno por uno hasta que aparezca
la puesta en marcha del CCD los maestros del la tarea. (Ariel Pérez de la Cruz, edad
nivel secundaria y de preparatoria comenzaron a 18 años. Entrevista realizada el 12 de
mayo de 2008, en el CCD)
solicitar a sus alumnos tareas que requieren el uso
de esta tecnología. Particularmente la elaboración
7VYV[YHWHY[LZLWVKYxHHÄYTHYX\LLS0U[LYUL[LZ
de trabajos escritos y a partir de la búsqueda
un agente externo que ha encontrado un lugar al
de información en Internet. Esta situación ha
interior de la comunidad matlatzinca sin provocar
llevado a los padres de familia a realizar grandes
cambios importantes en sus valores culturales.
esfuerzos para obtener los recursos económicos
que les permitan la compra de una computadora
El otro día hice un experimento con dos
como condición necesaria para aumentar la
semillas, una con estiércol y la otra con
competitividad de sus hijos en el espacio escolar.
abono; sembré dos matitas, una sin
lama y la otra con lama; y estoy viendo
Si bien, no se puede negar la importancia
que la que tiene lama del estiércol de
del CCD como fuente de socialización, iniciación
los animales que tenemos aquí, va más
y aprendizaje del manejo de la computadora y del
rápido que la que tiene puro abono.
Internet entre los jóvenes matlatzincas, se puede
(Fidel Méndez Domínguez, edad: 17
HÄYTHYX\LtZ[VZWVZLLU\UIHQVUP]LSKLHWYVWPH-
años. Entrevista realizada el 12 de mayo
ción, debido a que la principal actividad consiste
de 2008, en el CCD)
en la extracción de información para realizar traba-
Lo anterior nos da una idea sobre la forma en
jos escolares. La primera fuente de información es
que los matlatzincas adquieren los conocimientos
la enciclopedia Encarta. El uso de este programa
que les son útiles en su vida cotidiana. Los temas
se debe a su fácil manejo; los usuarios no tienen la
de interés que se añaden de acuerdo a sus
necesidad de seleccionar la información ya que la
necesidades actuales provienen de la forma que
enciclopedia les proporciona una sola respuesta.
tradicionalmente han utilizado como herramienta
de información y comunicación: la oralidad. A
La segunda fuente de información es el mo-
partir principalmente del consejo de ancianos
tor de búsqueda Google. La extracción de la infor-
(“tatas”), autoridades civiles, religiosas y los propios
?=,5*<,5;965(*065(3*65,0** 126
3H7VSx[PJH6ÄJPHSKL0UJS\ZP}U
Digital para los Pueblos Indígenas.

miembros de las familias, quienes transmiten los de los centros digitales, integrándolos
mensajes como medio de socialización de ideas, a sus propias formas y medios de
comunicación, y se incorporarán a las
empleando la lengua materna.
estructuras sociales y formas propias
de organización convirtiéndose en
Por lo que habría que preguntarse hasta qué espacios comunitarios de encuentro
punto los CCD pueden contribuir a potenciar estos y comunicación que promuevan
iniciativas locales para el mejoramiento
conocimientos, o bien, a proporcionar elementos
de las condiciones de vida de las
para la construcción de nuevos saberes que se comunidades (2003: 16).
inserten en función de sus propias necesidades.
Finalmente, es importante señalar las limi-
Por lo que es necesario que las instituciones
taciones derivadas de las políticas en el uso y
encargadas del diseño, implantación y supervisión
manejo de estas herramientas tecnológicas, que
KLLZ[VZJLU[YVZÅL_PIPSPJLUZ\WVZ[\YHOHJPHSHZ
impiden a los usuarios alcanzar mayores niveles de
normas que rigen el uso y operación de los CCD,
apropiación e integrarlas a la dinámica comunitaria
y atiendan las recomendaciones emanadas de la
en función de sus intereses económicos, políticos,
declaración de principios de la Cumbre Mundial
sociales y culturales8.
sobre la Sociedad de la Información (CMSI, 2005),
De acuerdo al Manual de Implantación de Centros
donde se establecen diversas recomendaciones
Comunitarios Digitales del Sistema Nacional
para el desarrollo de las telecomunicaciones
e-México (2002) la participación de la comunidad
LU JVT\UPKHKLZ PUKxNLUHZ X\L ZL YLÄLYLU H
es principalmente como usuarios del centro, sin
aspectos de tecnología, capacitación, desarrollo
que se prevean en este manual mecanismos que
de contenidos, administración de los servicios,
permitan la participación de la comunidad en la
industria, tele aplicaciones y marco regulatorio.
administración y operación del centro, de acuerdo
,ZWLJxÄJHTLU[LLUTH[LYPHKLJHWHJP[HJP}UZL|HSH
con los objetivos de la Resolución 134 de la XV
la importancia de una capacitación que busque
Reunión del Comité Consultivo Permanente de la
que las comunidades puedan administrar y operar
Comisión Interamericana de Telecomunicaciones
éstos medios.
(CCP1). No obstante, como lo han señalado
De esta manera, el Sistema Nacional e-México
Hernández y Calcagno:
podría jugar un papel trascendental, pero sólo en
En la medida en que los proyectos de
la medida en que, junto con las comunidades
telecentros y las TIC sean reconocidos
por su contribución y utilidad para las indígenas, planee, organice, proponga e implante
estrategias y proyectos de desarrollo servicios que los apoyen a conocer, consultar
local, las comunidades entrarán en y en su caso, participar en el desarrollo de los
un proceso de apropiación tanto de
recursos de información idóneos que rescaten
las herramientas tecnológicas, como
8 Como resultado de un ejercicio de planeación participa- su historia, su cultura, su forma de vida, sus
[P]HZLKPZL|}\UISVNJVUÄULZPUMVYTH[P]VZ`KLWYVTVJP}UKLSH inquietudes, su cosmología, entre otros aspectos;
cultura matlatzinca. Se instaló como página de inicio en los equipos
de cómputo y permaneció así durante algunos días, pero ante la lo que permitirá que no sólo se satisfagan sus
negativa del personal de supervisión del CCD fue cambiada por el
WVY[HSVÄJPHSKPZL|HKVWVY:PZ[LTH5HJPVUHSL4t_PJV3HKPYLJJP}U necesidades de información, sino que además se
del blog es: http://matlatzinca.blogspot.com/ sigan perpetuando sus características, identidad e
?=,5*<,5;965(*065(3*65,0** historia. Para que mediante la apropiación de esta 127
3H7VSx[PJH6ÄJPHSKL0UJS\ZP}U
Digital para los Pueblos Indígenas.

tecnología, las nuevas generaciones se desarrollen ante la construcción de los usos sociales. El caso
dentro de la sociedad del conocimiento en de las comunidades indígenas mexicanas”
http://www.er.uqam.ca/nobel/gricis/actes/panam/
igualdad de condiciones y sin menoscabo de sus
Gomez.pdf Consultado el 8 de mayo del 2009.
tradiciones, costumbres, cultura y organización
social. ---- (2006) “Redes de conocimiento, apropiación
tecnológica y diversidad cultural: balances y
perspectivas desde los usos de las TIC en los
pueblos indígenas de México”
Fuentes consultadas http://www.sociedadconocimiento.unam.mx/
Conferencia_VEdef.pd . Consultado el 8 de
Ambrosi, Alain; Peugeot, Valérie y Pimienta, Daniel mayo del 2009.
(2005), Palabras en Juego: Enfoques Multiculturales
sobre las Sociedades de la Información. C & F Hernández, Isabel y Calcagno, Silvia (2003), Los
Éditions, Caen-France. Pueblos Indígenas y la Sociedad de la Información
en América Latina y el Caribe. Un Marco para la
Base de datos de los CCA´S en el Estado de Acción. CEPAL, Santiago de Chile.
México 2009.
Hernández Rosano, David. Responsable del CCA,
de la comunidad Matlatzinca de San Francisco
Celedón, María y Razeto, Alicia (2009). La Oxtotilpan, en el municipio de Temascaltepec,
transformación de puntos deacceso en nodos estado de México. (Entrevista)
de conocimiento: análisis de diez experiencias
de telecentros comunitarios en América Latina,
Chile: Comisión Económica para América Latina INEGI (2000), Censo General de Población y
y el Caribe (CEPAL) – Colección Documentos de Vivienda, INEGI, México.
proyectos. Korsbaek, Leif y Felipe González (1999), “Trabajo
y Comunidad. Reproducción social, económica
Correa, Norma y (2005), “Praxis Indígena. Etno- y cultural de la población indígena del Estado
apropiación discursiva y tecnológica” de México”, en Revista Convergencia, Núm. 19,
http://www.hemi.nyu.edu/cuaderno/praxis/ UAEM, México.
documents/ashaninka.pdf. Consultado el 17 de
mayo del 2009. Margáin y Compeán, Julio César (2003). El Sistema
Del Álamo, Oscar (2004) “¿Son las nuevas Nacional e-México: un sistema de participación
tecnologías de la información herramientas válidas digital hacia la sociedad de la información y el
para consolidar y potenciar los procesos de conocimiento, México: Coordinación General
desarrollo humano?” del Sistema Nacional e-México Secretaría de
http://www.ciudadpolitica.com/modules/news/ Comunicaciones y Transportes.
article.php?storyid=331&keywords=Oscar+del+%
C1lamo. Consultado el 14 de abril del 2009. Monasterios, Gloria (2001)” Aproximaciones al
movimiento indígena en Internet”
Gallegos, Maricela (1998), “La Danza entre los h t t p : / / w w w. m a p u c h e . i n f o / m a p u i n t /
matlatzincas del Estado de México”, en Danzas monasterios010906.pdf . Consultado el 6 de abril
tradicionales ¿Actualidad u obsolescencia?, del 2009.
Eduardo Andrés Sandoval Forero y Marcelino
Castillo (coordinadores), UAEM, México. Morales, Sandra Jefa de los CCA en el Estado de
México. Dentro del programa Microrregiones de
Gómez Mont, Carmen (2002) “El Desafío de internet SEDESOL. (Entrevista)
?=,5*<,5;965(*065(3*65,0** 128
3H7VSx[PJH6ÄJPHSKL0UJS\ZP}U
Digital para los Pueblos Indígenas.

Sandoval, Eduardo y Mota, Laura (2007) “Indígenas


Naciones Unidas – Centro de Información México, y democracia en las tecnologías de información y
Cuba y República Dominicana (CINU) (2000). Comunicación (TICs)”
Asamblea y Cumbre del Milenio. http://www.cinu. http://www.ocyt.org.co/esocite/Ponencias_
org.mx/ninos/html/odm.htm. Consultado el 17 de ESOCITEPDF/1MEX059.pdf. Consultado e17 de
mayo de 2010. mayo del 2009.

Organización de las Naciones Unidas. 2005. Sandoval, Rodrigo (2006). “Explorando la Brecha
Cumbre Mundial sobre la Sociedad de la Digital en México: Diagnóstico del Proyecto
Información. “Compromiso de Túnez”. http://www. L4t_PJV¹ 9L]PZ[H ,ZWHJPVZ 7‚ISPJVZ

itu.int/wsis/docs2/tunis/off/7-es.pdf. Consultado Facultad de Ciencias Políticas y Administración
el 6 de agosto de 2010. Pública, UAEM.

Organización de las Naciones Unidas (ONU) 2010. Secretaría de Comunicaciones y Transportes


Podemos erradicar la pobreza 2015: Objetivos de (2010). Comunicados de Prensa. Disponible
Desarrollo del Milenio. en: http://www.sct.gob.mx/despliega-noticias/
http://www.un.org/spanish/millenniumgoals/ article/comunicado-de-prensa-no-055-mantiene-
global.shtml. Consultado el 17 de mayo de 2010. mexico-ruta-hacia-la-consolidacion-de-agenda-
digital/. Consultado el 11 de mayo de 2010.
Organización de las Naciones Unidas para la
Educación, la Ciencia y la Cultura (UNESCO). Vázquez Rojas, Gonzalo (1995), “Matlatzincas”,
2010. Programa de Información para Todos. http:// Sínt. Zazil Sandoval. México: INI - SEDESOL. 22
portal.unesco.org/geography/es/ev.phpURL_ p.: il. (Pueblos Indígenas de México).
ID=6881&URL_DO=DO_TOPIC&URL_
SECTION=201.html. Consultado el 6 de agosto
de 2010. SOBRE LOS AUTORES
Jaime Enrique Cornelio Chaparro. Lic. En Ciencias
Programa e-México. Ubica tu centro comunitario
de la Comunicación, Maestría en Comunicación,
digital.
O[[W!LTL_PJVNVIT_PUKL_WOW&VW[PVU$JVTFÅ Doctorado en Ciencias Sociales.
exicontent&view=items&cid=3673%3Acentros- Angélica Berenice Hernández Chávez . Pasante en
comunitarios-digitales&id=9485%3Acentros- la Licenciatura de Comunicación, de la Faculta de
comunitarios-digitales-e mexico&lang=es.
Ciencias Políticas y Sociales, UAEM
Consultado el 10 de julio de 2010.

Proulx, Serge (2004), La Révolution Internet en


question. Editions Québec Amérique, Montréal.

Quezada, Noemí (1996), Los matlazincas, UNAM,


México.

Quivy, Raymond y Campenhoudt, Luc (1999)


Manual de investigación en ciencias sociales.
Limusa, México

?=,5*<,5;965(*065(3*65,0** 129
Los museos de migración en
línea, una forma diferente de
democratizar el acceso y
preservación del patrimonio
cultural
Ma. Alejandra Rocha Silva
UNIVERSIDAD DE COLIMA

Resumen:

  
Los museos son espacios en los cuales se preserva parte de nuestra historia, en el caso de los
que son de migración adquieren otro sentido, pues son la historia o de los que se fueron o de
los que llegaron a formar esa comunidad. Los migrantes siempre han sido un grupo socialmente
marginado, por lo que una forma de poner más a su alcance los museos es digitalizar el conteni-
do y ponerlos en la web, con ello es relativamente más fácil el acceso (en tiempo, desplazamiento
y costo). La investigación se realizó sobre los museos de migración en línea pertenecientes a la
Red de Museos de Migración de la Unesco (23 en total). Encontrando que todos ellos existían fí-
sicamente, y como elementos en común es que cumplen con las normas del diseño web -una pá-
gina de inicio, contacto, menú principal-. Una mayoría pueden ser consultados en inglés. Como
Museos que son tienen Exposiciones y Muestras, Actividades y Eventos, Educación, Publicacio-
ULZ0UMVYTHJP}U7YLUZH`5V[PJPHZ/VYHYPVZL[J(SN\UVZ[PLULU0U]LZ[PNHJP}U`SVTHUPÄLZ[HU
a través de otras opciones como proyectos, bases de datos e investigación. Sólo cuatro tienen
YLJVYYPKVZ]PY[\HSLZ[PLULUYLNPZ[YVZKLTPNYHU[LZ`IHZLZKLKH[VZ[PLULU-HJLIVVRWVY
lo que la propuesta integra todas las partes de los museos de migración en línea, se une a las
tendencias de la virtualidad y las redes sociales, pero además ofrece la posibilidad de obtener
información de los migrantes y retroalimentar proyectos de investigación, además de visualizar
los trayectos en un mapa.

Palabras clave: migración, museo, on line, cultura y democracia.

Introducción en general de valor cultural, convenientemente


Los museos son lugares cuyo objetivo es la colocados para que sean examinados”1. Esta serie
conservación y divulgación del patrimonio histórico. de objetos son avalados por una institución de
Según la Real Academia de la Lengua Española prestigio. También están los llamados “museos de
son un “Lugar en que se guardan colecciones sitio”. En donde, como su nombre lo dice, el valor
KL VIQL[VZ HY[xZ[PJVZ JPLU[xÄJVZ V KL V[YV [PWV ` 1 Encontrado en http://buscon.rae.es/draeI/
SrvltConsulta?TIPO_BUS=3&LEMA=Museo.
Los museos de migración en línea un forma diferente
de democratizar el acceso y preservación del patrimonio cultural.

histórico está ya en el mismo lugar, por ejemplo la web “WebMuseum” de Surshone, Timpledon y
una pirámide, un castillo, etc. Los museos son Marseken (2010).
lugares que tienen horarios preestablecidos como
cualquier establecimiento público que ofrezca un Las nuevas tecnologías nos dan la oportunidad
servicio. También tienen un costo. Todo lo anterior de recuperar las historias y ponerlas en línea para
hace que sean accesibles sólo a un bajo porcentaje que puedan ser “completadas” por los familiares
de la población, por lo que estos establecimientos sobrevivientes desde dónde quiera que estos se
se están incorporando a la Era Digital, a través de encuentren. Esto es uno de los objetivos que se
dispositivos móviles que pueden ser usados dentro persigue cumplir con el modelo de museo virtual.
de los mismos espacios y al digitalizarse y ponerse
en línea como una forma de acceso sin horarios y Un museo virtual es una colección organizada de
sin costo para cualquiera que tenga acceso a la artefactos electrónicos y recursos informativos.
red. Dicha colección incluye pinturas, dibujos,
MV[VNYHMxHZ KPHNYHTHZ NYmÄJVZ NYHIHJPVULZ
Los museos de migración cumplen con otro segmentos de vídeo, artículos, transcripción de
cometido, el de enseñar a las nuevas generaciones entrevistas, bases de datos y cualquier otro tipo de
el origen de sus antecesores o como parte de registro que pueda ser almacenado en el servidor
programas de inclusión o tolerancia ante las del museo (MAVUT, 2007).
diferencias en sociedades multiculturales.
Jamie McKenzie (1997) en su artículo “Building a
Por todo lo anterior se realizó una investigación con Virtual Museum Community”, distingue dos tipos
el objetivo analizar los museos de migración para de museos virtuales:
descubrir qué tenían en común y con ello hacer un % Learning Museums: sitio web que ofrece
diseño de museo que llevará al desarrollo de un recursos de aprendizaje en línea que invitan
prototipo. a ser visitados repetidamente facilitan la
exploración y la investigación.
% Marketing Museums: sitio web que busca
Estado del arte
la promoción de los museos físicos para
incrementar el número de visitantes a sus
El museo se está reinventado autores como
instalaciones. Generalmente, los sitios de
Anderson (1997) y Marstine (2006) abordan el
estos museos cuentan con una tienda en
[LTHWLYVTmZLZWLJxÄJHTLU[LX\LLZ[LJHTIPV
línea para vender sus productos.
es a través del uso de la tecnología, Parry (2007)
JVU ¸9LJVKPUN [OL 4\ZL\T¹ LZWLJxÄJHTLU[L
Los museos no sólo se están incorporando a las
sobre el tema digital encontramos a dos obras:
nuevas tendencias, sino que parecen estar siendo
“The digital museum. A think guide” de Din y Hecht
más conscientes de su objetivo primario, el dar a
(2007) y “Digital Technologies and the museum
conocer un patrimonio cultural a un mayor público.
experience” de Tallon y Walker (2008) acerca de

?=,5*<,5;965(*065(3*65,0** 131
Los museos de migración en línea un forma diferente
de democratizar el acceso y preservación del patrimonio cultural.

Dentro de los museos, el interés del proyecto está que “la noción connota formas de percepción y
centrado en los de migración. La sociedad es acción relativas a las tecnologías de información
multicultural, unos se han ido y otros han llegado y comunicación…Desde cierta perspectiva se
y con esas “idas y venidas” se van entretejiendo está hablando de una cultura de las máquinas
los valores, las costumbres, las formas de ser y de información contemporáneas, hace alusión a
de pensar. El territorio adquiere otro sentido, ya paquetes de informática, a dominio de la web o
no es un espacio en el que vivimos y compartimos HZ\U[VZHÄULZ+LZKLV[YHWLYZWLJ[P]HLZ[HYxHTVZ
una forma de vida. Ahora es una referencia. Y partiendo de la concepción cibernética, y de
como parte de esa referencia surgen los museos la llamada cibernética de segundo orden en
de migración, los que dan cuenta de es ir y particular. De esta segunda opción la cibercultura
venir de diferentes grupos sociales, etnias. De es una apuesta de la organización de la cultura en
diferentes periodos de la historia y por diferentes general. No se trata de la relación de la informática
circunstancias. En este sentido el museo es parte JVUSH]PKHZVJPHSZPUVKLSHJVUÄN\YHJP}UKL\UH
del que se va pero también del que se queda y de perspectiva que incluya a las nuevas tecnologías, a
ahí la importancia de que se encuentre en Internet. las viejas, y a todo el espacio social dentro de una
nueva cosmovisión que organice todos los vínculos
La democratización de la información a través de posibles entre los diversos componentes sociales
Internet es un tema que ha sido y sigue siendo y todas sus opciones de conexión. En este sentido
controversial en el 2010. Están los dos extremos la cibercultura no es una matriz ya constituida, es
o lo que es lo mismo, Los Apocalípticos y Los un proyecto de construcción, un plan de trabajo en
Integrados. En un extremo tenemos la postura de construcción” (111-112).
que Internet hace que cualquier expresarse y de Más adelante Edgar Gómez (2007) hace un
igual manera obtener información a través de esta recuento del término desde dónde viene y hacia
plataforma tecnológica. Y en el otro lado, tenemos dónde va.
a los que cuestionan a esa democratización Sin pretender ser extremista, si hay datos sobre los
partiendo de que el acceso a la red no es para X\L[LULTVZX\LYLÅL_PVUHY:PIPLULZJPLY[VX\L
todos, por el costo que representa, así como por el Internet aun no es para todo, la tendencia es que
cuestiones tecnológicos que no permiten que se cada vez más personas lo tengan. Las instituciones
tenga en todos los sitios. públicas han tenido que hacer programas que
El Internet está aquí y es parte de la vida cotidiana permitan un mayor acceso de las personas
de millones de usuarios en el mundo entero. A excluidas, con la llamada alfabetización digital
la tecnología no se le puede cuestionar, no es ni (Gutiérrez, 2003), en el sentido de la capacitación
buena, ni mala, es el uso que le demos lo que en la computadora e Internet, así como con lugares
se pone en la palestra. El Internet ha cambiado en los que el acceso es gratuito a la red e incluso
nuestra forma de ver y de relacionarnos con el acceso a computadoras de manera gratuita. Por
mundo. otra parte el desarrollo tecnológico que no para y
La cibercultura es una parte sustancial de todo que hace que se pueda tener acceso desde un
este constructo. Jesús Galindo (2006) dice teléfono celular, la banda ancha, el satélite, etc.

?=,5*<,5;965(*065(3*65,0** 132
Los museos de migración en línea un forma diferente
de democratizar el acceso y preservación del patrimonio cultural.

La idea principal de este proyecto es que los mismos Migración de la Unesco y que estuvieran en
migrantes sean quienes cuenten su historia con línea en la fecha del análisis.
base en las posibilidades que nos ofrece la red.
3.   :LSLJJPVUHY`KLÄUPY\UH\UPKHKKLHUmSPZPZ!
Que los migrantes se conviertan en prosumidores,
Página Web
es decir productores y consumidores de esa
información, porque es su historia y nadie mejor 4.   Construcción de las categorías del
que ellos la conoce. Si los migrantes cuentan contenido que se analizarán.3
directamente su historia y se registra estaremos en
1.   Estructura
la posibilidad de reconstruir nuestra historia, como
parte de nuestro patrimonio cultural. 1.   Página Web
2.   Museos

Metodología utilizada 3.   Museos en línea

5.   ,Z[HISLJLYLSZPZ[LTHKLJ\HU[PÄJHJP}U
,S LZ[\KPV PKLU[PÄJ} SHZ LZ[YH[LNPHZ \[PSPaHKHZ WVY
museos virtuales e interactivos, a través de la Se diseñó una base de datos en Excel en el
apropiación del análisis de contenido, ya que es que se pusieron los datos de todos los museos
una técnica de investigación destinada a formular, según las categorías establecidas y luego se
a partir de ciertos datos, inferencias reproducibles obtuvieron las frecuencias y correlaciones.
y válidas que puedan aplicarse a su contexto
6.   Análisis de la información recopilada
(Krippendorff, 1997:292). En este proyecto el
objetivo es la descripción del contenido de la Con base en las frecuencias (se consideró a
comunicación vía pantalla averiguando qué se partir de la repetición de uno de los elementos)
dice, cómo se dice y a quién se dice. y las correlaciones se establecieron los
parámetros del diseño del prototipo.
Berelson (1942) comentaba cómo el Análisis de
Contenido es “una técnica de investigación para la 7.   Conclusiones
descripción objetiva, sistemática y cuantitativa del
Con base en las conclusiones se diseño el
contenido de la comunicación”.
Museo Virtual Interactivo de Migración y se
Para lo cual se hizo el siguiente proceso desarrolló el prototipo.

1.   +LÄUPYHSHWVISHJP}UKLSHT\LZ[YH!4\ZLVZ El prototipo está en línea


de Migración
Resultados
2.   Muestra: Todos los museos que
perteneciera a la Red de Museos de La muestra se determinó a través de la
información de la UNESCO sobre las instituciones
2 Krippendorff, Klaus (1997). Metodología de
análisis de contenido. Teoría y práctica. Barcelona: 3 De Jakob Nielsen: http://www.useit.com, http://www.
Paidós comunicación. nngroup.com/; Nielsen, J. y Mack. R.L. (1994). Usability Inspection
Methods. John Wiley & Sons, Inc. EE.UU.http://www.ainda.info/
http://www.nosolousabilidad.com
?=,5*<,5;965(*065(3*65,0** http://www.boxesandarrows.com/ 133
Los museos de migración en línea un forma diferente
de democratizar el acceso y preservación del patrimonio cultural.

de migración que se encuentran en línea http:// Aunque Jesús Galindo (2006) dice que “el mundo
w w w. m i g r a t i o n m u s e u m s . o r g / w e b / i n d e x . KL0U[LYUL[ZLOHJVUÄN\YHKVLUSHMVYTHJ\S[\YHS
php?page=museo-de-la-inmigracion. Además de del idioma inglés y su matriz lingüística-ideológica”
uno que no se encontraba en esta red, pero se (114). En el Museo Interactivo de Migración
incorporó por ser latinoamericano y dentro de la conlleva otra situación y es que los migrantes
red no se encontraba ninguno. El de Argentina. mexicanos, en su mayoría se encuentran en Los
Estados Unidos, de lengua inglesa y los hijos de
8.   Tabla 1. Red de Museos de Migración de la
muchos de estos son bilingües o incluso no hablan
UNESCO
el español por lo que ponerlo en inglés no sólo es
DIRECCIÓN NOMBRE  DEL  MUSEO

PAÍS IDIOMA
MUSEO  

FÍSICO
MUSEO  
VIRTUAL  Y/O  EN  
LÍNEA
una tendencia, sino una necesidad.
KWWSZZZPLQLQWHULRUJRYDUPLJU (OKRWHO$UJHQWLQD 1R HVWi en
DFLRQHVPXVHRPXVHRBEDVHBGDWR

El 17%, que fue el más alto porcentaje, tiene la


VKWP $UJHQWLQD (VSDxRO OtQHD 1RHVWiHQOtQHD
KWWSZZZDUFKLYRGHLQGLDQRVHVS )XQGDFLyQ $UFKLYR GH ,QGLDQRV 0XVHR GH (VSDxD (VSDxRO  GH RFWXEUH 1RGLFHODIHFKD
RUWDGDBLQWURKWP
KWWSZZZKLVWRU\VDJRYDXPLJU OD(PLJUDFLyQ (VSDxD
+LVWRU\7UXVWRI6RXWK$XVWUDOLD GH

DWLRQPLJUDWLRQKWP $XVWUDOLD ,QJOpV 
KWWSZZZEDE\ORQMHZU\RUJLO
KWWSZZZDOWUHLWDOLHRUJ
WKH%DE\ORQLDQ-HZU\+HULWDJH&HQWHU ,VUDHO
Altreitalie A :HE 6LWH IRU VWXG\ RI italian ,WDOLD
+HEUHR,QJOqV
,WDOLDQR,QJOpV3
6L
RUWXJXpV(VSDx &HQWUR
1RGLFHODIHFKD
GH 1RGLFHODIHFKD
opción FACEBOOK. Una de las tendencias del uso
PLJUDWLRQV
KWWSZZZKLVWRLUHLPPLJUDWLRQIU &LWp QDFLRQDOH GH OKLVWRULH GH OCPLJUDFLRQ 'RFXPHQWDFLyQ

&LXGDG QDFLRQDO GH la KLVWRULD GH la
PLJUDFLyQ Francia )UiQFHV 
de Internet son las redes sociales. Son lo de hoy y
KWWSZZZFREKKHULWDJHFRP &REK 7KH 4XHHQVWRZQ 6WRU\ /D KLVWRULD ,UODQGD ,QJOpV 6L  1RGLFHODIHFKD
KWWSZZZGRPLWGH GH4XHHQVWRZQ  ,5/$1'$
'20,7
Alemania ,QJOHV$OHPDQ
&HQWUR GH
'RFXPHQWDFLyQ 6LQIHFKD por eso ya están incorporadas en algunos museos.
KWWSZZZQSVJRYDUFKLYHVWOLVHU 0XVHRGHOD,VOD(OOLV (VWDGRV GHVGH
 GH
YKWP
KWWSZZZGDKEUHPHUKDYHQGH &HQWUR GH (PLJUDFLyQ Alemana GH
KWWSZZZLPPLVH %UHPHUKDYHQ
,QVWLWXWR GH 0LJUDFLyQ &HQWUR GH
8QLGRV
Alemania
,QJOpV
,QJOpV$OHPDQ
VHSWLHPEUHGH 6LQIHFKD
si
6XHFR,QJOpV( ,QVWLWXWR FUHDGR
6LQIHFKD Seguramente que esta tendencia irá en aumento.
Es una forma de interactuar con el público.
LQYHVWLJDFLyQ \ GRFXPHQWDFLyQ VREUH VSDxRO,WDOLDQR
LQPLJUDQWHVUHIXJLDGRV\UDFLVPR 6XHFLD Aleman HQ 6LQIHFKD
KWWSZZZLPPLJUDQWPXVHHWGN 0XVHRGHOD,QPLJUDFLyQ'DQpV Dinamarca 'DQpV,QJOpV si 6LQIHFKD
KWWSPXVHXPYLFWRULDFRPDXLP 0XVHRGH,QPLJUDFLyQ si
PLJUDWLRQPXVHXP $XVWUDOLD ,QJOpV 6LQIHFKD
KWWSZZZPLJUDWLRQLQVWLWXWHILLQG ,QVWLWXWRGH0LJUDFLyQ ,QJOpV)LQOiQGHV si
H[BHSKS
KWWSZZZNRVPRSROLVQO .RVPRSROLV
)LQODQGLD
+RODQGD
3DVYHQVND
,QJOpV+RODQGHV 1RTXHGDFODUR
6LQIHFKD
1RWLHQHQ El Museo:
KWWSZZZPHPRULDOGRLPLJUDQWHR 1R HVWi en
UJEU 0HPRULDOGR,PLJUDQWH %UDVLO 3RUWXJXHV OtQHD 1RHVWiHQOtQHD
KWWSZZZPKLFQHW 0XVHR GH KLVWRULD GH la LQPLJUDFLyQ GH (VSDxRO&DWOiQ si

KWWSZZZPNFERWN\UNDVH
KWWSZZZHPLJUD]LRQHLW
&DWDOXQ\D
0iQJNXOWXUHOOWFHWUXP
0XVHR 5HJLRQDO GH la (PLJUDFLyQ 3LHWUR
(VSDxD
6XHFLD
,QJOpV
6XHFR si
,WDOLDQR)UDQFpV si
6LQIHFKD
6LQIHFKD Exposiciones y muestras 57%, Educación 52.2%,
Museo 52%, Prensa/Noticia 35%, Publicaciones
&RQWL ,WDOLD ,QJOpV 6LQIHFKD
KWWSZZZVPYNVHVPYNMVSSROR 6WDWHQV0XVVHUI|U9lUGVNXOWX si
SRO\MVS"G  6XHFLD 6XHFR,QJOpV 6LQIHFKD

30%, Historia 36.1%, Biblioteca 26%, Información


Frecuencias 26%, Servicios 22%. El resto de las opciones
quedó por debajo del 10%.
Estructura de la página:
Museo de Migración:
Página Web
Investigación 39%, Historia de migrantes 26.09,
El 100% tienen página de inicio y contacto. El 95.7
Proyecto 26%, Bases de datos 22%, Recorrido
son museos que existen físicamente, sólo uno –
Virtual 17%, esta opción aparece en museos
Kosmopolis- no queda claro si tiene ubicación
que no son de migración, como en los Museos
física.
del Vaticano, el Museo de Louvre, en Francia; el
El 52.2% tienen una opción de inglés como una Museo del Prado en España. Lo cual nos indica
alternativa de lectura para las que están en otros que es otra tendencia.
idiomas. Además de que 6 sólo están en inglés,
El resto de las opciones quedó por debajo del
que son el 26% por lo que tenemos que en total
10%.
hay un 78.2% de los museos que están en ese
idioma, como única lengua o como una opción, por
lo que el inglés es EL IDIOMA para estar en línea.

?=,5*<,5;965(*065(3*65,0** 134
Los museos de migración en línea un forma diferente
de democratizar el acceso y preservación del patrimonio cultural.

Relaciones o correlaciones especialmente en el continente americano y que


tiene comunidades de emigrantes dentro de casi
12 de las 23 instituciones que tiene la opción de
todos los países.
“Educación” que representa más de la mitad de
los museos de migración con esta opción.

Cuadro Correlaciones de Educación. Sin embargo, también tenemos la visión de la


inmigración en museos como los de Holanda,
EDUCACIÓN FRECUENCIA TOTAL
Argentina, Australia, Canadá o Estados Unidos,
Actividades  
y  Eventos 9 11 que son países que se han formado con
Museo 8 12 inmigrantes. En estos museos la perspectiva es
Exposicione de la inmigración, es decir de los que llegaron. El
s y
7 13
objetivo de la educación es mostrar a las nuevas
Muestras
Investigació generaciones quiénes son, hablando culturalmente.
n 6 9 Por lo que en estos casos se puede observar que
Proyecto 5 5 se pueden realizar búsquedas de los apellidos a
Biblioteca 5 6
4 4
través de bases de datos, que provienen de los
Historia
Historias de desembarcos, principalmente, para saber de
Migrantes 4 4 dónde vino ese apellido y en qué fecha llegaron los
Bases de primeros.
Datos 3 5
Recorrido   Interface
Virtual 2 4
La interface se encontró que en los museos de
Y dentro de este encontramos las correlaciones migración aparecen imágenes de migrantes en
que se encuentran en la tabla. `LSYLZ[VLZ[HIHYLSHJPVUHKHJVULSLKPÄJPVLU
El apartado de lo educativo que se encontró en las donde se albergaba el museo real 5 de las 23.
páginas analizadas tiene que ver con programas Los colores y el diseño eran variables, por lo que
que existen en el museo real, el que existe queda claro que la tendencia es mostrar rostros
físicamente. Estos programas están dirigidos a de la emigración y hacer una referencia al espacio
niños y jóvenes, como parte de la enseñanza de físico
la tolerancia a los que son diferentes, tanto en el
sentido cultural, como étnico o social, pero también
como una parte fundamental de la enseñanza de
Conclusiones
la historia de un pueblo, que puede ser el que
ha llegado o los que se han ido. Ejemplo de lo Con base en estas conclusiones es que se elaboró
anterior lo tenemos en los museos de migración la propuesta de considerando que el Museo Virtual
LZWH|VSLZX\LZLYLÄLYLUHSVZX\LZL]HU,ZWH|H Interactivo de Migración no tiene una ubicación
fue una cultura que conquistó muchos territorios, físico por lo que se descartan el apartado en el que
se da información sobre la ubicación y los servicios
?=,5*<,5;965(*065(3*65,0** 135
Los museos de migración en línea un forma diferente
de democratizar el acceso y preservación del patrimonio cultural.

que presta, pero en donde si se consideraron Este grupo de la población que tradicionalmente
las demás opciones que aparecen, de manera se iban a Estados Unidos y que constituye el
representativa en los museos analizados. mayor porcentaje de mexicanos que viven en el
extranjero, es un grupo que no ha tenido acceso
a la educación, con un bajo ingreso salarial por lo
que si bien podrá mejorar su situación económica
esto no implica que haga lo propio en lo educativo,
por lo que “su relación” con Internet es nula o baja.
:PULTIHYNVLSWLYÄSKLSX\LLTPNYHOHJHTIPHKV
ahora se están yendo mexicanos del área urbana,
con estudios y que ya están capacitados en el uso
de una computadora e Internet. E igualmente las
nuevas generaciones, son una generación digital.
La tendencia es que el acceso y el uso de la red irá
en aumento y es por lo mismo que se apuesta en
Los objetivos del museo son registrar y divulgar
este sentido.
las historias de los que se han ido y los que han
llegado, cómo llegaron y por qué llegaron y de igual Unos de los objetivos principales del MVIM es
manera de los que se fueron. De esta manera se el educativo, pero desde una perspectiva de
WYL[LUKL PY KVJ\TLU[HUKV SVZ Å\QVZ TPNYH[VYPVZ e-Educación. Habrá programas dirigidos a niños
Con ello podemos tener conciencia de quiénes y jóvenes que sean hijos de los colimenses que
somos como sociedad. ¿De dónde venimos? ¿A se han ido al extranjero, así como para los viven
dónde se fueron? en Colima como una herramienta de apoyo a su
educación en los valores, especialmente en el de
Estar “on line” o “en línea” implica el trabajo de todo
la tolerancia.
un equipo para poner los contenidos en el lenguaje
adecuado. Los usuarios de la página serán: Los programas serán diseñados y elaborados por
un grupo de especialistas en educación, migración
1.   Público en general.
y tecnología que lleve a poner los contenidos de la
2.   Migrantes manera más transparente posible en dos lenguas:
español e inglés.
3.   Investigadores
Después de la elaboración la administración será
4.   Estudiantes
tanto a nivel técnico como educativo, por lo que
Por lo que el lenguaje y los contenidos tienen que habrá un responsable del programa y asesores
estar pensados en estos receptores pero también que acompañen a los estudiantes en línea en el
en el que les es propio a la plataforma tecnológica. logro de los objetivos.

En este punto es necesario acotar que los migrantes La interface se encontró que en los museos de
mexicanos, no usuarios “comunes” de Internet. migración estaba relacionada con los rostros de
?=,5*<,5;965(*065(3*65,0** 136
Los museos de migración en línea un forma diferente
de democratizar el acceso y preservación del patrimonio cultural.

SVZTPNYHU[LZ`LSLKPÄJPVLUKVUKLZLHSILYNHIHLS El usuario podrá acceder a la información


museo real. Los colores y el diseño eran variables, sin registrase, como una forma de facilitar el
por lo que queda claro que la tendencia es hacer acceso, pero si quiere compartir su información,
referencia a los rostros de la migración y a un entonces tendrá que hacerlo, como una forma
LZWHJPVMxZPJVZPNUPÄJH[P]VWHYHSVZTPNYHU[LZ,ULS de organización de los datos, ya que al hacerlo
caso del Museo Virtual Interactivo de Migración no está realizando el llenado de una base de datos.
existe una ubicación física, el diseño de la interfaz, Cualquiera que quiera contar su historia puede
así como del recorrido virtual hace referencia a un hacerlo, no hay límites más que los propios de
espacio físico que les es común a los colimenses, acceso a la red de los que se habló al inicio de
la llamada casa colimota o colimense. Una casa este trabajo.
que tiene un patio central y alrededor corredores
Sin embargo, por cuestiones de seguridad,
con techo de teja. Un espacio abierto, lleno de luz
el acceso a las bases de datos para obtener
y de vegetación. Los rostros aparecerán en las
la información será sólo para investigadores
historias y en la galería.
registrados y con clave.
Imagen No. 1. Fachada de una Casa Colimense.
Así mismo, los proyectos, resultados o
publicaciones que se pongan en línea deberán ser
aprobados por el responsable del Museo Virtual
Interactivo de Migración.

Referencias

1.   Collison, George, Elbaum, Bonnie, Haavind,


Sarah, y Tinker, Robert. (2000). Facilitatin
online learning. USA: Atwood Publishing.
2.   Galindo Cáceres, Jesús. (2006).
Fotografía de Ma. Alejandra Rocha Silva. Cibercultura. Un mundo emergente y una
nueva Mirada. México: Conaculta/Instituto
Mexiquense de Cultura.
La interfaz se ha diseñado siguiendo los estándares 3.   Gómez Cruz, Edgar. (2007). Las metáforas
internacionales pero además de regirse bajo dos de Internet. Barcelona: UOC.
premisas fundamentales: 4.   Gutiérrez Martín, Alfonso.(2003).
Alfabetización digital algo más que ratones
1)   La cultura colimense. y teclas. España:Gedisa.
2)   Transparencia. 5.   Din, Herminia y Hecht, Phyllis (Ed) (2007).
The digital museum. A think guide.
U.S.A:American Association of Museums.
?=,5*<,5;965(*065(3*65,0** 137
Los museos de migración en línea un forma diferente
de democratizar el acceso y preservación del patrimonio cultural.

6.   McKenzie, Jamie. (March 16-19, 1997). SOBRE EL AUTOR


“Building a Virtual Museum Community”. Ma. Alejandra Rocha Silva. Doctora en Tecnología
This paper will be presented at the Educativa por la Universidad de Salamanca en Es-
Museums & The Web Conference. Los paña. Profesora e Investigadora de la Universidad
Angeles, California : Sponsored By the de Colima. Línea de Investigación Estudios sobre
Getty Information Institute. las Nuevas Tecnologías de la Comunicación.
7. Marstine, Janet (Ed). (2010). New Museum.

Theory and Practice. Australia:Blackwell


Publishing
8.   MCcORMACK, Colin y Jones, David.
Building a Web-Based education system
(1998). U.S.A/Canada:Wiley Computer
Publishing.
9.   MAVUT (2007). Encontrado en la red en
http://mavut.utalca.cl/educa_2.html
10.  Anderson, Gail (Ed) (1997) . Reinventing the
museum. EEUU:Altamira.
11.  Moore, Michael G. y Kearsley, Greg.(1996)
Distance education. USA:Wadsworth
Publishg Company.
12.  Pallot, Rena M. y Pratt, Keih.( 1999). Building
learning communities in cyberspace. San
Francisco: Jossey_Bass Publisher.
13.  Parry Ross (2007). Recoding the museum
digital heritage and the technologies of
change.EEUU/Canada: Routledge
14.  Rosenberg; Marc J.(2001) e-Learnig.
USA:Mc. GrawHill
15.  Surshone, Lambert M. Timpledon,
Miriam T. Marseken, Susan F. (Ed) (2010).
WebMuseum. U.S.A/UK/Germany:
Betascrip publish.
16.  Tallon, Loïc and Walker, Kevin (Ed.)(2008).
Digital technologies and the museum
experience.U.S.A: Altamira,

?=,5*<,5;965(*065(3*65,0** 138
Brecha digital en México:
Hacia una propuesta de
políticas públicas
Dra. Alma Rosa Alva de la Selva
FACULTAD DE CIENCIAS POLÍTICAS Y SOCIALES, UNAM

Resumen
En el marco del desarrollo de la Sociedad de la Información y el Conocimiento, en México se
ha ido abriendo paso un fenómeno: la brecha digital. Es ésta la “nueva desigualdad”, asociada
a otras exclusiones anteriores, presente tanto en los países desarrollados como en los países en
desarrollo y que constituye un problema complejo generado por factores económicos, sociales,
J\S[\YHSLZ ` LK\JH[P]VZ 3H KLUVTPUHKH IYLJOH KPNP[HS LZ HZx SH ¸U\L]H KLZPN\HSKHK¹ JVUÄN\-

  
rada en los tiempos del neoliberalismo para los marginados del orden actual. Se trata de una
construcción histórica mediada por relaciones de poder, un problema generado y sostenido por
estructuras de larga duración.
Como parte de los trabajos de una investigación en curso sobre el tema, la ponencia aborda la
problemática de la “brecha digital” en México en términos generales y desde la perspectiva de
la desigualdad. Si bien en América Latina –la región que adolece de mayores desigualdades,
H\UX\LUVZLHSHTmZWVIYLKLST\UKVSHIYLJOHKPNP[HSZLOHJVUÄN\YHKVJVTVLSMHJ[VYKL
inequidad más reciente para los latinoamericanos, en México el problema ha ido tomando cuerpo
y se presenta en varias dimensiones.
En la ponencia se plantea que, a pesar de las recurrentes hipótesis de que la desigualdad y por
tanto la brecha digital constituyen una situación inherente a las sociedades latinoamericanas, y
por tanto no podrán erradicarse, o bien que éstas permanecerán atrapadas en los mecanismos
que generan y reproducen aquélla, es posible intervenir en el proceso para lograr atenuar o frenar
su avance. Ello puede lograrse en la ruta de la llamada “inclusión digital” y a partir del instrumento
de las políticas públicas.

Palabras clave
Sociedad de la Información, Brecha Digital, Inclusión Digital, Desigualdad Social, Políticas Públi-
cas.

  El Siglo XX es el escenario del despliegue humanas (Miége:2002), con las Tecnologías de


de la llamada Sociedad de la Información y el la Información y la Comunicación (TIC) como el
Conocimiento (SIC), una organización donde la principal instrumento.
información, que constituye no sólo una fuerza A lo largo de la primera década del nuevo
productiva importante, sino también un recurso milenio, en medio de un discurso global que
para la generación de valor, se ha convertido se difunde actualmente con el apoyo de los
en un paradigma que cruza las actividades organismos internacionales y de los grandes
Brecha digital en Mèxico

consorcios de telecomunicaciones (discurso que existencia de un pequeño grupo de millonarios.


plantea la tesis del progreso universal y el arribo La brecha digital es uno de esos “nuevos rostros”
de la democracia gracias a la intervención de las de la inequidad, trasladado a la organización social
TIC), las realidades estructurales han generado un que se construye de otras brechas, económicas y
panorama muy contrario al de ese escenario ideal. sociales
En los tiempos de la Sociedad de la Información
y el Conocimiento (de aquí en adelante, SIC), la Ante las recurrentes hipótesis de que
desigualdad no ha sido desterrada…. Por el la desigualdad es un problema “inherente” a
contrario, el fenómeno que originó una de las más nuestras sociedades latinoamericanas, y por tanto
caras promesas de la nueva organización social ha no podremos erradicarla, o bien que estamos
continuado su avance: la brecha digital. atrapados en los mecanismos que generan y
La brecha digital -entendida aún en medida reproducen las desigualdades, cabe oponer
importante en términos del acceso o no a las una visión diferente útil para buscar soluciones
TIC, y en ese sentido, dividiendo al mundo en al problema, una visión que partiendo de un
JVULJ[HKVZ`KLZJVULJ[HKVZKLÄUPJP}UWVYJPLY[V enfoque dialéctico se concentre en los procesos
`H PUZ\ÄJPLU[L LZ \UV KL SVZ MLU}TLUVZ KL SH que generan la inequidad y en los que pueden
desigualdad social en el Siglo XXI más complejos. disminuirla.
Asociada a otras exclusiones anteriores, la brecha Partir de esa perspectiva propuesta por
es un problema presente tanto en los países Reygadas para abordar el tema de la brecha digital
desarrollados como en los llamados “emergentes”. permite ver que ésta, si bien es un problema arduo
En la América Latina de hoy –la región que adolece y complejo, no es inexorable y perpetuo. Por el
de mayores inequidades, aunque no sea la más contrario, se trata de una construcción histórica
WVIYL KLS T\UKV SH IYLJOH KPNP[HS ZL JVUÄN\YH generada y sostenida por estructuras económicas,
como el más reciente factor de desigualdad. sociales y políticas de larga duración. Las nuevas
“redes de la desigualdad” no se autoreproducen
* Este trabajo forma parte de una investigación en HS PUÄUP[V ZPUV X\L ZVU JVUÄN\YHJPVULZ X\L ZL
J\YZVX\LI\ZJHPKLU[PÄJHY`HUHSPaHYSVZMHJ[VYLZ transforman, así sea lentamente, bajo el impulso
estructurales de la brecha digital en México, con el de los procesos sociales.
ÄU KL VMYLJLY LSLTLU[VZ WHYH \U KPHNU}Z[PJV KLS Desde tal visión, en lugar de sólo asumir,
fenómeno y contribuir a la formulación de políticas por principio de cuentas, que la desigualdad –en
públicas de inclusión digital para la sociedad el caso que nos ocupa, la brecha digital- es un
mexicana. HZ\U[V PYYL]LYZPISL LZ PTWVY[HU[L PKLU[PÄJHY LU
X\t JVUZPZ[L J}TV ZL THUPÄLZ[H LU U\LZ[YV
,ULZ[LZLU[PKVLZWVZPISLHÄYTHYJVUWHSHIYHZ país, cuáles son sus dimensiones y muchos otros
de Luis Reygadas, que en Latinoamérica se están puntos más, pues hacerlo constituye un paso
haciendo cada vez más visibles los “nuevos fundamental para el análisis del problema y la
rostros” de la desigualdad (Reygadas:2008): búsqueda de alternativas.
el desempleo, la precarización del trabajo, la

?=,5*<,5;965(*065(3*65,0** 140
Brecha digital en Mèxico

Es así como aparece en el tema de la No obstante que la problemática de la


brecha una ruta que puede conducir a otro rumbo: IYLJOH ZL OHJxH L]PKLU[L LU 4t_PJV KLZKL ÄULZ
la inclusión digital. Esta puede entenderse como de los noventa, y que de frente a la situación
“el conjunto de políticas públicas relacionadas económico-social existente era previsible su
con la construcción, administración, expansión, profundización, sería hasta el 2001 cuando se
oferta de contenidos, así como el desarrollo de formuló una estrategia gubernamental para
capacidades locales en las redes digitales públicas” enfrentar el problema: el Sistema Nacional
(Robinson:2005). e-México.
A partir del enfoque arriba planteado, Presentado con resonancia como el proyecto
este trabajo sostiene que, aun en medio de la que insertaría al país en la órbita de la SIC y por
complejidad del problema, es posible insertarse en tanto al progreso, el Sistema Nacional e-México,
el proceso para buscar reorientar la ruta que se ha considerado como el proyecto detonador para
seguido hasta ahora, y de una forma concertada el desarrollo del país, tenía como objetivo central
con los sectores involucrados, buscar aproximarse el de abatir la brecha digital, entendiendo a ésta
hacia un modelo de organización social y productiva implícitamente como un problema de acceso a las
de mayor equidad, con la inclusión digital como TIC. Sin embargo, a las fallas de origen del proyecto
objetivo. ZL Z\THYVU PUZ\ÄJPLUJPHZ HS PTWSLTLU[HYSV LU[YL
La ruta alterna para atenuar y/o frenar las más graves el de la progresiva desatención
el avance de la brecha digital en México puede de los Centros Comunitarios Digitales (CCDs),
construirse con el respaldo de las políticas públicas, elementos cruciales para el éxito del proyecto.
las cuales no obstante sus importantes elementos Sin que nunca se hayan dado a conocer
críticos, se presentan como una herramienta útil sus resultados o posibles avances, el Sistema
para hacer más alcanzables las propuestas y e-México, la estrategia del gobierno para enfrentar
soluciones a complicados problemas como el la brecha digital, dejó de de ser del interés del
que aquí se estudia, relacionado estrechamente gobierno entrante, en el 2006, que lo dejó caer
con el desarrollo de una organización social más en el estancamiento. Incluso, en el Plan Nacional
equitativa para el futuro del país. de Desarrollo 2006-2012, si bien se señala como
meta llevar a Internet a más del 60 por ciento de
LA BRECHA DIGITAL EN MEXICO la población, ese plan de gobierno no se remite
al proyecto mencionado. Tampoco presentó uno
/LTVZ HÄYTHKV X\L LU 4t_PJV SH ¸U\L]H nuevo.
desigualdad” se amplía, en un fenómeno posible de Sería en el 2007 cuando de alguna manera
apreciar aun a partir de las escasas y a veces poco se retomó el tema y se planteó un cambio a nivel de
HJ[\HSPaHKHZVJVUÄHISLZLZ[HKxZ[PJHZKPZWVUPISLZ la estrategia de conectividad del Sistema, de tipo
Antes de presentar algunas de ellas que permiten satelital, para pasar a otra donde la banda ancha es
estimar la magnitud de la brecha digital en nuestro el elemento protagónico para alcanzar el “acceso
país, conviene hacer mención con brevedad de universal.” A partir de lo anterior, la administración
algunos antecedentes sobre el tema. de gobierno comenzó a impulsar desde ese año

?=,5*<,5;965(*065(3*65,0** 141
Brecha digital en Mèxico

lo que llamó el “modelo alternativo para el acceso pues a veces las estadísticas disponibles no se
universal”, el denominado Redes Estatales de encuentran actualizadas o discrepan entre sí)
Educación, Salud y Gobierno (REESG), con el YLÅLQHUZ\THNUP[\K`]LY[PLU[LZ
que se busca establecer conectividad mediante Por ejemplo, el más reciente estudio de
tecnologías inalámbricas. la Asociación Mexicana de Internet, AMIPCI
No obstante que si bien en el plano de (www,amipci.org.mx) (cuya fuente de información
la infraestructura hay propuestas para mejorar empleada es la consultora Select) establece la
el funcionamiento del alicaído e-México, no penetración de Internet en México en 29.7%, uno
puede decirse lo mismo en lo relativo a otros de los porcentajes más bajos entre los países
aspectos sustantivos de la problemática de la SIC latinoamericanos. Por su parte, el “Estudio 2010
involucrados directamente con el asunto de la de hábitos y percepciones de los mexicanos sobre
brecha digital. Internet y diversas tecnologías asociadas”, del
Así, puede decirse que la actual World Internet Projet (www.worldinternetprojet.net)
administración de gobierno no ha considerado la , establece el número de usuarios de Internet en
construcción de la SIC en el país y la problemática México en 30 millones 239 mil. Así pues, más de
de la brecha digital como asuntos prioritarios. Ni 70 millones de habitantes no tienen acceso a la
siquiera el Plan Nacional de Desarrollo 2006-2012 red.
hace mención de dichos temas. El estudio de AMIPCI estima el total de
La situación arriba descrita a rasgos computadoras en México en 18.2 millones, de
muy generales se ha convertido en un factor de las cuales sólo 11.3 contaban con los recursos
importancia para el ahondamiento de la brecha necesarios para ingresar a la red. Por otra parte,
KPNP[HSLULSWHxZ(WHY[PY`HZLHKLSHPUZ\ÄJPLUJPH YLZ\S[HUZPNUPÄJH[P]HZSHZLZ[HKxZ[PJHZX\LHWVY[HSH
o incluso inacción estatal en la materia, cabe Encuesta Nacional sobre Disponibilidad y Uso de
destacar que ello ocurre, además, en medio del las Tecnologías de la Información en los Hogares
apoyo de una política regulatoria favorable a los 2009 generadas por el INEGI, pero que sería largo
proyectos de expansión de los consorcios de exponer aquí (www.inegi.gob.mx),
telecomunicaciones, que continúan impulsando
los patrones para la incorporación de las TIC y los | En cuanto a lo que podría llamarse “la
usos de las mismas con criterios de rentabilidad, y brecha generacional”, puede decirse a partir del
con escasos contrapesos por parte de la autoridad estudio ya citado, que la mayor penetración de la
gubernamental. red se encuentra en el grupo de edad de 12 a 19
¿Cuáles son las expresiones de la brecha años, en una clara ruta de decrecimiento hasta
digital en nuestro país? Habiendo dejado claro los 64. Por lo que toca a la brecha de género, de
que el fenómeno no se reduce a la cuestión del acuerdo con el estudio de AMIPCI antes citado, en
acceso sino que asume otras dimensiones – la república el 56% de los usuarios son hombres
destacadamente entre ellas, como lo ha señalado y el 44% mujeres. Existen otros estudios, como
la UNESCO, la “brecha cognitiva”- algunas el de WIP-México que en este renglón establecen
pocas cifras (con la relatividad que ello implica, una diferencia más amplia (58% hombres, con
44% de mujeres).
?=,5*<,5;965(*065(3*65,0** 142
Brecha digital en Mèxico

Se aprecia que la problemática de la brecha interesados en la problemática referida, con los


digital en nuestro país es compleja, de múltiples espacios de participación adecuados a su alcance
facetas y afecta a millones de mexicanos. para intervenir en el proceso de búsqueda de la
solución de un asunto y contribuir a los acuerdos
HACIA POLITICAS PÚBLICAS PARA LA necesarios para ello.
Ahora bien, no obstante el alentador
INCLUSIÓN DIGITAL
panorama para proyectos o temas que para llegar a
De continuar la situación antes descrita, en
sus objetivos requieren del concurso de la sociedad
el futuro de México la llamada SIC se presentará
y que, a pesar de su complejidad, apoyándose
como un espacio de participación sólo para unos
en la formulación e implementación de políticas
cuantos, con la profundización de la brecha digital
públicas pueden despejar su camino, es necesario
y la pérdida de una oportunidad valiosa para
subrayar que este trabajo, lejos de caer en el
impulsar el desarrollo de la sociedad mexicana.
sobredimensionamiento de tales herramientas , en
Es posible aún, reitera este trabajo,
visiones utópicas o hasta en convertir a aquéllas en
intervenir en el proceso, buscando reorientarlo de
una “panacea”, apela a su pertinente aplicación.
forma concertada con los sectores involucrados y
Ello porque de lo que se trata es de formular y
con las políticas públicas como útil herramienta,
desarrollar políticas que sean susceptibles de
entendidas éstas como “un curso de acción (…)
fundamento legal, de apoyo político, de viabilidad
que es efectivamente desarrollado, intencional
administrativa y de racionalidad económica”
o reactivamente por los varios actores
(Aguilar Villanueva:1992:36).
gubernamentales, por los otros poderes estatales,
Tal sería justamente el reto a asumir por
por la multitud de diferentes actores políticos,
los diferentes actores involucrados de frente al
grupos económicos y organizaciones sociales,
ahondamiento de la brecha digital en el país y lo que
JVUZ\ZPU[LYHJJPVULZJVVWLYH[P]HZVJVUÅPJ[P]HZ¹
ello conlleva para construir un país mayormente
(Aguilar Villanueva:1992:33).
equitativo y distinto al que estamos viviendo.
Dado que las políticas públicas necesitan
contar con el consenso social para considerarse
como tales, requieren ser expuestas, argumentadas
y debatidas. Así pues, para avanzar en el tema del BIBLIOGRAFIA
desarrollo de la SIC y en México y del freno a la
brecha digital, es preciso impulsar acciones que AGUILAR VILLANUEVA, LUIS, El estudio de las
hagan posible la formación del consenso, con una políticas públicas, México, Porrúa, 1992.
discusión abierta que se traduzca después en la
formulación e implementación de las políticas. KAUFMAN, ESTHER (Coord.), Políticas públicas y
Es importante hacer notar que en dicha tecnologías. Líneas de acción para América Latina,
dinámica la presencia de la sociedad, en tanto Buenos Aires, La Crujía, 2007.
actor involucrado, resulta fundamental y supone
la presencia de ciudadanos informados e GARCIA CANCLINI, NESTOR, “Diferentes,
desiguales o desconectados”, Barcelona, Gedisa,
2006.
?=,5*<,5;965(*065(3*65,0** 143
Brecha Digital en México

MIEGE, BERNARD, “La Societé de L Information: SOBRE EL AUTOR


Toujours Aussi Inconcevable”, en Revúee Dra. Alma Rosa Alva de la Selva. Profesora e in-
Européenne des Sciences Sociales, No. 123, vestigadora en el Centro de Estudios de la Co-
París, 2002. municación de la Facultad de Ciencias Políticas
y Sociales de la UNAM. Investigadora Nacional
MOSCO, VINCENT, The political economy of (Sistema Nacional de Investigadores, SNI, CONA-
Communication: Rethinking and renewal, London, CYT). Miembro del Consejo Consultivo del Canal
Sage Publications Ltd, 1995. del Congreso.

REYGADAS, LUIS, “La apropiación. Destejiendo


las redes de la desigualdad”, México, UAM/
Antrophos, 2008.

ROBINSON, SCOTT, “¿Brecha o inclusión digital?”


, México, UAM Iztapalapa, 2005,

REFERENCIAS ELECTRONICAS

INSTITUTO NACIONAL DE ESTADISTICA ,


GEOGRAFIA E INFORMATICA
www.inegi.gob.mx

ASOCIACION MEXICANA DE INTERNET


www.amipci.org.mx

WORLD INTERNET PROJET


www.worldinternetprojet.net

?=,5*<,5;965(*065(3*65,0** 144
Productos culturales digitales:
Estrategias formales e informales
de distribución en México

Dr. Gabriel Pérez Salazar


UNIVERSIDAD AUTÓNOMA DE COAHUILA
Resumen:
Entendidos desde la perspectiva de Adorno y Horkheimer, los productos culturales han atrave-
sado en los últimos años por diversos procesos de digitalización y convergencia tecnológica.
En este trabajo se presentan los resultados de una observación relacionada con algunas de las
estrategias de distribución en línea de dichos productos culturales, que han sido desarrolladas
tanto fuera como al interior de los principales grupos multimedia establecidos a nivel internacio-
  
UHSKLZ[HJHUKVSHHWHYPJP}UKLU\L]VZHJ[VYLZ`OLYYHTPLU[HZX\LOHUTVKPÄJHKVSHWVZPIPSPKHK
de acceso por parte de las audiencias.

Palabras clave: digitalización, convergencia mediática, medios digitales, industria cultural, econo-
mía política, distribución alternativa, redes P2P.

I. Introducción. Juan Carlos Miguel de Bustos (1993) y Enrique


Las estrategias de producción, distribución y Bustamante (2002).
comercialización de las industrias culturales Es importante mencionar que las respuestas
(Adorno y Horkheimer, 2007), han dado lugar a de las audiencias a la oferta digital de las industrias
una gran variedad de estudios de los medios de culturales, ha sido un tema relativamente poco
comunicación, en los que destacan las relaciones abordado desde una perspectiva académica.
que se establecen entre dichos generadores de En general, podemos reconocer dos grupos de
formas simbólicas con las audiencias. trabajos hechos en este sentido:
De manera particular, en este trabajo 1)   Los que se limitan a describir las innovaciones
abordaremos lo relativo a diversas estrategias de hechas en materia de formatos y canales
distribución, formales e informales, a través de de distribución y entre los que podemos
las cuales los productos culturales digitalizados encontrar el trabajo de Rawolle y Hess
se encuentran disponibles para su consumo en (2000) y Pavlik y McIntosh (2004).
México. Para ello, tomaremos en cuenta algunos 2)   Un numeroso conjunto de artículos que,
aspectos derivados lo la economía política de desde una perspectiva técnica, proponen
la comunicación, con base en autores como estrategias de protección de los derechos
Productos culturales digitales

de autor y explotación para tales contenidos A partir de esta forma de representación numérica
digitales, como los realizados por Memon y de los elementos simbólicos que componen todo
Wong (1998) y Liu et al (2003). producto cultural, es posible manipular, almacenar,
Una excepción está dada por el trabajo de producir, duplicar y distribuir con relativa facilidad
2H[a  X\PLU YLÅL_PVUH LU [VYUV HS PTWHJ[V cualquier producción que haya sido pasado por este
que los procesos de convergencia tecnológica proceso. Hay una aparente descentralización de
y digitalización han tenido en las industrias los soportes físicos, que da lugar a manipulaciones
culturales en la región latinoamericana. Aunque que en ocasiones superaran las capacidades
no profundiza en las estrategias de consumo que de control de quienes detentan los derechos de
presentan las audiencias, y que en este contexto, explotación comercial de una obra. En términos de
adquieren además la dimensión de usuarios; Piérre Lèvy (1999), se trata de la virtualización de
WYLZLU[H \UH WLY[PULU[L YLÅL_P}U LU YLSHJP}U JVU la información que da lugar a este tipo de obras,
las implicaciones económicas que traen consigo llevando en muchas ocasiones al rompimiento de
los nuevos escenarios convergentes. las limitaciones físicas de tales soportes.
Así, el presente trabajo es el resultado  *VU LS ÄU KL JVU[YHZ[HY LS WYLZLU[L
de una observación de algunas estrategias que escenario, haremos un poco de historia. Antes de
NY\WVZ LZWLJxÄJVZ KL \Z\HYPVZ LTWSLHU LU SH que tales recursos digitales estuvieran disponibles,
actualidad para distribuir, compartir y hacerse aunque era posible duplicar algún producto
de contenidos audiovisuales en formato digital; audiovisual (al grabar en casete un disco LP, por
paralelas a los canales formales de distribución ejemplo; o copiar una película en VHS), usualmente
establecidos por las industrias culturales. Desde esto implicaba tanto una pérdida en la calidad del
una perspectiva metodológica, es importante producto resultante, como tiempos relativamente
señalar que se trata de un reporte que pertenece prolongados en dicho proceso de duplicado.
a un estudio longitudinal realizado en torno a la .YHIHY\UJHZL[LZPNUPÄJHIHYLWYVK\JPYLU[PLTWV
trayectoria que siguen las estrategias informales de real el producto original.
distribución de productos culturales digitalizados, Las implicaciones para el modelo de
por lo que algunos de los datos aquí presentados negocios de las industrias culturales derivadas
pueden ser ajustados en el futuro, de acuerdo con de estas duplicaciones, eran muy distintas a las
el comportamiento que se presente en el corpus actuales. La pérdida de calidad de las copias
analizado. resultantes era una condición ampliamente
generalizada, lo cual contribuía a una percepción
II. Canales de distribución de los productos aurática del original, en términos de Walter Benjamin
(2009). Por otro lado, producir masivamente estas
culturales.
copias implicaba un costo relativamente alto, tanto
por los equipos necesarios, como por el tiempo
En la actualidad, las industrias culturales están
que implicaba este proceso, por lo que no era una
llevando a cabo acciones que se basan en la
actividad al alcance de cualquiera.
ÅL_PIPSPKHKPU[YxUZLJHHSVZJVU[LUPKVZKPNP[HSPaHKVZ
En lo que respecta a su distribución,
las industrias culturales mantenían un control
?=,5*<,5;965(*065(3*65,0** 146
Productos culturales digitales

bastante riguroso, dado que un producto cultural como a través de una red de cómputo.
estaba contenido en un soporte físico material. De cara a estas posibilidades tecnológicas,
En prácticamente la totalidad de los casos, era las industrias culturales han visto radicalmente
necesario un transporte de dichos soportes: audio transformadas muchas de las condiciones
y/o video casetes, discos de acetato, rollos de fundamentales relacionadas con la distribución
película, etcétera, para llegar hasta las audiencias de sus productos. De manera coincidente con los
consumidoras (salvo por supuesto, bajo los procesos de integración empresarial, apertura de
modelos de radio transmisión que implicaban un mercados y globalización que se han presentado
consumo distinto al que nos hemos centrado). desde la segunda mitad de la década de 1990;
Esta sujeción material generaba además diversos la digitalización de los productos culturales, y los
costos de manejo, almacenaje y colocación en rompimientos espacio-temporales que esto ha
el mercado, que impactaban de manera directa implicado, han llevado a panoramas inéditos para
sobre el valor de cambio que el adquiriente debía los grandes grupos multimedia.
cubrir en el precio pagado para poseer un producto Como Katz (2006) plantea, esto ha traído
cultural de consumo doméstico. consigo un profundo impacto en prácticamente la
Como hemos adelantado, los procesos de totalidad de las industrias culturales, especialmente
digitalización que actualmente se presentan en LUSVX\LZLYLÄLYLHSHLKP[VYPHSJPULTH[VNYmÄJH
SHZ PUK\Z[YPHZ J\S[\YHSLZ OHU TVKPÄJHKV T\JOHZ [LSL]PZP]H`KPZJVNYmÄJH3HZ[YHUZMVYTHJPVULZX\L
de estas condiciones. La posibilidad de traducir estas industrias han atravesado, han ido desde
un producto audiovisual a un conjunto numérico sus procesos productivos –en la generación de
ÄUP[V LTWHX\L[HKV LU \U HYJOP]V KL J}TW\[V sus productos mismos– hasta su distribución y
ha llevado a su casi absoluta dislocación espacio- consumo; sin que necesariamente los ajustes
temporal. De esta forma, los productos culturales empresariales hayan ocurrido con la misma
dejan de estar necesariamente sujetos a un velocidad con que la tecnología digital ha estado
ZVWVY[LMxZPJVSVX\LZPNUPÄJH\UWYVM\UKVJHTIPV disponible.
en sus posibilidades de ser manipulado. Cabe El profundo cambio en los paradigmas
preguntarse, por ejemplo, dónde se encuentra una derivados de la digitalización de los productos
película que puede ser descargada de Internet, culturales, se ha enfrentado a las inercias
¿en el servidor de origen? ¿en el disco duro del institucionales presentes en estas industrias, y en
usuario que hace la descarga? ¿En el reproductor general, podemos hablar de respuestas lentas y
portátil donde la consume? Si la ubicuidad es una poco efectivas ante los procesos de digitalización,
característica de la virtualidad, las dimensiones por parte de la mayoría de los grupos multimedia.
clásicas del tiempo y el espacio en la distribución de Esto contrasta notablemente con algunos de
los productos culturales, deben ser replanteadas. los planteamientos iniciales del discurso optimista
Un producto cultural convertido en un archivo y hegemónico de la Sociedad de la Información,
U\TtYPJHTLU[L JVKPÄJHKV W\LKL ZLY [YHUZMLYPKV donde se hablaba de nuevas oportunidades
a través de cualquier sistema digital, tanto físico de mercado. Negroponte (1995) vislumbraba
*+964 +=+964 TLTVYPH ÅHZO<:) L[J una especie de panacea mediática basada en

?=,5*<,5;965(*065(3*65,0** 147
Productos culturales digitales

redes de banda ancha y servicios de suscripción en 1997 y la aparición de las primeras tiendas de
generalizados, y como Ruano (2007) señala, se música en línea entre 1998 y 1999 (Schubert,
HU[PJPWHIHUSVZILULÄJPVZKLLZ[LZLJ[VYKLYP]HKVZ 1999), hasta el lanzamiento de iTunes Music
de la aplicación de las nuevas tecnologías, Store en 2003; transcurrió un tiempo en el que
tanto en lo productivo como en el mercado, el modelo de descargas gratuitas se generalizó
aunado esto a la participación en el sector de las entre muchos usuarios de Internet. Durante este
telecomunicaciones y la electrónica de algunos de lapso, las grandes empresas disqueras centraron
los grupos mediáticos trasnacionales. sus esfuerzos en emprender acciones legales en
Sin embargo, las respuestas dadas por contra de quienes realizaban estas prácticas, pero
las industrias culturales fueron sintomáticamente sin realmente proponer una alternativa comercial y
cautelosas y pausadas, como posible señal de éticamente viable.
su rigidez estructural. Así, podemos sugerir que Por otro lado, un aspecto que es pertinente
la digitalización ha implicado arduos procesos de señalar, es que la que se ha convertido en la
apropiación cultural también para estos agentes principal tienda de música en línea hoy en día a
económicos, y no solamente para sus usuarios. nivel mundial, iTunes,1 se origina en el sector de
Por ejemplo, con la aparición del formato las TIC y no en el de las industrias culturales. Esto
MP3 durante el último lustro del siglo XX, refuerza nuestra hipótesis relativa a la ausencia de
destaca una estrategia de mercado que, aunque un capital simbólico que hubiera permitido a las
era aparentemente inevitable, tardó mucho en industrias culturales tradicionales ajustarse a las
cristalizarse, y más bien puede interpretarse implicaciones de los procesos de digitalización de
como una respuesta a los sistemas gratuitos de manera más oportuna; de manera similar a como
intercambio de archivos de música. Las tiendas VJ\YYP}LUSHPUK\Z[YPHKLSHJVTW\[HJP}UHÄUHSLZ
musicales en línea, estos sitios virtuales en los de la década de 1970, cuando grandes empresas
que los usuarios pueden adquirir legalmente tales de este sector fueron incapaces de percibir los
productos culturales, no necesariamente nacieron cambios que la introducción de la computación
de iniciativas de las industrias de la música personal estaba por ocasionar. Queda como materia
grabada previamente establecidas, y que en teoría para futuras investigaciones indagar en torno a las
eran quienes contaban con los recursos materiales interpretaciones que hicieron de tecnologías como
para dar este paso y aprovechar las proclamadas MP3, quienes ocupaban posiciones estratégicas
ventajas de los nuevos mercados virtuales. Como en la industria de la música grabada durante la
YLÅL_P}U LU LZ[L ZLU[PKV WVKLTVZ Z\NLYPY X\L última década del siglo pasado.
un capital material no necesariamente implica un En concordancia con las estrategias
capital cultural o simbólico que permita ajustarse a establecidas por estas industrias en el pasado y
las cambiantes condiciones del entorno, de manera KHKH SH ÅL_PIPSPKHK X\L PTWSPJH LS THULQV KL SVZ
X\L ZL WLYWL[\LU PUKLÄUPKHTLU[L SHZ WVZPJPVULZ productos culturales digitalizados, durante los
hegemónicas históricas. primeros años de operación de estas tiendas
Entre la aparición de los primeros 1 Es parte de Apple Computer Inc. Cuyo principal
accionista es Steve Jobs, cofundador de esta empresa de
reproductores MP3 para computadoras personales computadoras personales.

?=,5*<,5;965(*065(3*65,0** 148
Productos culturales digitales

en línea, se impusieron sistemas que limitaban apertura de canales de algunas de las principales
el número de copias que era posible hacer de emisoras televisivas en YouTube (como Sony,
la música en cuestión, a través de candados Warner Brothers, y la BBC, entre otras), muchas
como DRM (digital rights management). Esto de las cuales incluso ponen a disposición parte
marcaba grandes diferencias con respecto a las KL Z\Z JVU[LUPKVZ LU HS[H KLÄUPJP}U 6MLY[HZ
posibilidades de las audiencias para utilizar la similares pueden ser encontradas en los portales
música por la que habían pagado. Al adquirir un de muchas de las generadoras y/o emisoras de
LP, o incluso un CD, una persona tenía absoluta contenidos audiovisuales, donde con frecuencia
libertad de hacer copias para su uso personal, y es posible observar la repetición simultánea de
escuchar estas copias en cualquier dispositivo sus contenidos, para medios como la televisión, la
adecuado para ello. No era así con canciones radio y los periódicos; y a los que podemos agregar
que estuvieron protegidas con DRM, hasta que el almacenamiento de documentos asincrónicos
LS ZPZ[LTH M\L ÄUHSTLU[L LSPTPUHKV LU   LU disponibles bajo demanda (podcast).
iTunes Store. Sin embargo, consideramos que tanto a
En la actualidad, en nuestro país es posible partir del vacío inicial en la oferta legal, como de
observar la venta de música en línea bajo marcas las estrategias de consumo desarrolladas por
como MixUp Digital, Nokia Music Store, Tarabu (de algunos usuarios que buscan tener acceso a estos
Televisa) e Ideas Music Store (de Telcel), lo que habla contenidos de manera gratuita; prácticamente
de los cruces entre diversas ramas industriales, y desde que las tecnologías de ‘ripeado’4 estuvieron
que incluyen tanto a las industrias culturales, como disponibles, como ya hemos mencionado, se
las telecomunicaciones y las ventas al detalle; lo crearon canales ‘informales’5 de distribución,
cual habla de otra manifestación de los procesos especialmente entre aquellos usuarios que
de convergencia mediáticos. Otras industrias contaban con las competencias tecnológicas
culturales han emprendido acciones similares, necesarias tanto para realizar las conversiones
entre las que destaca la venta de libros electrónicos de formatos analógicos a digitales, como
en Amazon (bajo la plataforma Kindle), así como la para localizarlos, transferirlos, almacenarlos y
renta2 y venta3 de películas en línea en Blockbuster duplicarlos.
(sólo en su sitio web para los EEUU, cabe precisar). III. Canales informales de distribución
Sin embargo, las tiendas en línea no son los Como hemos mencionado, el tiempo que
únicos canales de distribución de los productos 4 Con este término (ripping) se suele llamar
al proceso de conversión de un formato concebido para ser
culturales digitalizados. En lo que se conoce como colocado en un soporte físico como un CD o un DVD, a un archivo
digital que puede ser transportado, almacenado, distribuido
JVUZ\TVLUSxULHWVYÅ\QVZ[YLHTPUN¶KLJHYmJ[LY y duplicado como cualquier otro documento en un sistema
generalmente gratuito– podemos mencionar la operativo determinado.

2 Por un precio que ronda entre los 3 y 5 USD, 5 Por informales entenderemos aquellos canales
los archivos descargados tienen una vigencia de 24 horas para alegales, o que incluso violan las leyes en materia de derechos
poder ser reproducidos, y luego de este periodo el documento de explotación, que se encuentran fuera del control tanto de los
queda bloqueado. grandes grupos mediáticos, como de los medianos y pequeños
productores y distribuidores, y cuya principal característica es
3 Los archivos no tienen una vigencia restringida, que son creados, administrados y mantenidos por los usuarios –
y su costo es similar al de un DVD. consumidores de estos productos culturales.

?=,5*<,5;965(*065(3*65,0** 149
Productos culturales digitales

transcurrió entre la aparición de formatos digitales entre ellos toda clase de archivos, entre los que
para productos culturales y la posibilidad de destacan contenidos audiovisuales. Su capacidad
adquirirlos legalmente; fue relativamente largo, para convertirse en medios de distribución
por lo que aunado a la cultura de la gratuidad descentralizados, fue aprovechada por sus usuarios
prevaleciente en algunos sectores de usuarios de para hacerse de una cantidad indeterminada de
Internet, pueden haber contribuido al amplio uso archivos, entre los que destacaban los MP3;7 por
de sistemas de intercambio de archivos, conocidos lo que no tardaron en ser objeto de ataques por
como P2P (peer to peer), y de los cuales Napster parte de un sector de las industrias culturales en
resulta particularmente destacado por la notoriedad defensa de sus intereses.
que adquirió su proceso judicial y eventual cierre a Uno de estos primeros esfuerzos por hacer
partir de la demanda en su contra presentada por frente al intercambio de música en las redes P2P,
la asociación norteamericana de música grabada consistió en la incorporación masiva de nodos con
(RIAA, por sus sigla en inglés). archivos alterados, que usualmente se expresaban
A pesar de que este tipo de aplicaciones en canciones incompletas o editadas. De esta
(entre las que además podemos mencionar a manera, cuando un usuario buscaba una canción
Kazaa, eMule y otras similares) han alcanzado y la seleccionaba para descargarla, al término
a tener varios millones de usuarios conectados del entonces relativamente tardado proceso,8 se
al mismo tiempo, por diversos motivos su uso encontraba con que había invertido sus recursos
ha decrecido recientemente, a favor de otras en una canción cuyo contenido había sido
estrategias. A continuación haremos un repaso de manipulado, por ejemplo, a partir de fragmentos
los principales inconvenientes que presentan este repetidos (loops) hasta dar una duración similar a
tipo de aplicaciones para sus usuarios, y hablaremos la de la canción original. Sin embargo, los sistemas
de algunos canales alternativos de distribución de socio-técnicos de los usuarios reaccionaron y
contenidos audiovisuales digitales;6 a partir de la en poco tiempo se agregaron mecanismos de
observación de una selección no probabilística de reputación, que permitían la detección de estos
casos escogidos con base en su relevancia en los nodos a partir de los reportes de quienes hacían
resultados del motor de búsqueda Google, para las descargas, logrando con ello su eventual
sitios disponibles en México. expulsión de la red.
Luego del triunfo sobre Napster,9 la industria
a) La guerra contra las redes P2P de la música grabada cambió su estrategia y
Como hemos señalado, aplicaciones P2P como
7 Formato de compresión de audio desarrollado
Napster, AudioGalaxy, Kazaa, eMule y otras por el Moving Picture Experts Group, en el que puede haber
similares; han alcanzado cada una de ellas en una pérdida más o menos importante en la calidad del producto
resultante, dependiendo de diversos parámetros en su
algún momento determinado, millones de usuarios JVUÄN\YHJP}U

conectados de manera simultánea, intercambiando 8 A consecuencia del menor ancho de banda


generalmente disponible hace un lustro.
6 Dada la velocidad con que tiene lugar la
evolución de los sistemas informáticos, se trata de herramientas y    *VTV LZ ZHIPKV LZ[L ZPZ[LTH M\L ÄUHSTLU[L
estrategias no mencionadas en el ya citado texto de Katz (2006). clausurado en julio de 2001, con lo que la industria disquera
establecía un precedente legal relevancia internacional.

?=,5*<,5;965(*065(3*65,0** 150
Productos culturales digitales

empezó a perseguir ya no a los prestadores de grandes cantidades de archivos, sin que se


esta clase de servicios de intercambio, sino a los tengan que instalar herramientas de rastreo en sus
usuarios particulares. De esta manera, para junio computadoras.
de 2006, la RIIA había actuado legalmente contra Nuevamente, los sistemas socio-técnicos de
más de 20 mil personas en los Estados Unidos usuarios reaccionaron ante esto y se desarrollaron
(Electronic Frontier Foundation, 2006), y los había nuevas aplicaciones P2P anónimas, en las que la
obligado a pagar compensaciones económicas dirección IP de los usuarios es enmascarada, lo
por el material descargado. A nivel internacional, X\L KPÄJ\S[H ZPNUPÄJH[P]HTLU[L SH WVZPIPSPKHK KL
acciones similares han sido emprendidas por la localizarlos físicamente. Sistemas como GNUnet,
-LKLYHJP}U0U[LYUHJPVUHSKLSH0UK\Z[YPH-VUVNYmÄJH Imule, MUE y Nodezilla son algunos ejemplos de
(El Mundo, 2005), y en México, la Asociación esta clase de software.
Mexicana de Productores de Fonogramas y Posiblemente a consecuencia de estos
Videogramas (Amprofon) y el Instituto Mexicano nuevos dispositivos tecnológicos de operación
de la Propiedad Industrial (IMPI) habían iniciado anónima, para diciembre de 2008, la RIIA tomó un
demandas tanto contra cibercafés donde se nuevo rumbo y ahora, cuenta con la colaboración
detectaban estas prácticas, como contra usuarios de los proveedores de servicio de Internet (ISP) en
LZWLJxÄJVZ H [YH]tZ KL HJJPVULZ LTWYLUKPKHZ los Estados Unidos para la detección de usuarios
por la Policía Cibernética10 (La Jornada, 2007). que tengan una actividad inusualmente alta en
Con base en la observación realizada a diversos puertos de comunicación asociados al uso de las
lugares públicos de acceso a Internet, es posible redes P2P (Gong, 2005). A partir de esta detección,
mencionar que muchos de ellos tienen anuncios primero se hace una advertencia a tales usuarios,
en los que expresamente prohíben este tipo de y si tal aviso es ignorado, el servicio de acceso es
descargas. bloqueado (La Jornada, 2008).
Cabe mencionar que estas detecciones Otro riesgo asociado con el uso de los
son técnica y legalmente posibles, porque, al sistemas P2P, está dado por la proliferación de
ingresar a un sistema P2P, ya sea que operen ]PY\ZKPZL|HKVZLZWLJxÄJHTLU[LWHYH[YHUZTP[PYZL
bajo esquemas convencionales o por archivos a través de estas redes de usuarios (Wired, 2006).
BitTorrent,11 se hace pública la dirección IP12 de A pesar de que no es posible ocultar un virus en
un usuario, y a partir de este dato, es posible su un archivo MP3, lo que se ha observado es la
ubicación física. De esta manera, es factible la aparición de archivos ejecutables que portan estos
PKLU[PÄJHJP}UKLHX\LSSVZ\Z\HYPVZX\LKLZJHYNHU códigos maliciosos, y que son disfrazados bajo
10 Unidad especializada en perseguir infracciones
y delitos informáticos, dependiente de la Secretaría de Seguridad
la apariencia de documentos de música, que se
Pública. activan al ser abiertos por los usuarios.
11 Sistema P2P empleado para la transferencia
de archivos de gran tamaño, que se basa en la fragmentación del
documento original y su distribución descentralizada en ‘paquetes’
de menor tamaño, a partir de los cuales se reconstruye en archivo
b) Sistemas alternativos de distribución: links de
origen, de manera no lineal, en el punto de destino. descarga.
12 Internet Protocol, sistema que permite ubicar (U[L SVZ YPLZNVZ ` KPÄJ\S[HKLZ X\L OLTVZ
unívocamente un nodo en particular dentro de Internet.
planteado que supone el uso de los sistemas P2P,

?=,5*<,5;965(*065(3*65,0** 151
Productos culturales digitales

en la actualidad observamos una relativamente por lo que constituye una acción indetectable
nueva estrategia de distribución de contenidos exclusivamente a partir de este criterio. A pesar
audiovisuales, basada en el almacenamiento de lo anterior, el peligro de propagación de virus
YLTV[VKLHYJOP]VZÄSLZOVZ[PUN`SHW\ISPJHJP}UKL persiste, en la medida en que sigue siendo posible
sus respectivos links de descarga. El procedimiento ocultar códigos malintencionados en dichos
habitualmente seguido es el siguiente: archivos comprimidos, por lo que es frecuente
1.   Se crea un archivo comprimido13 a partir del que los usuarios que llevan a cabo estas prácticas
documento audiovisual original. empleen un antivirus recientemente actualizado,
2.   Este documento es almacenado en algún capaz de analizar los archivos descargados antes
servicio de hospedaje de archivos. Algunos de estos de ser descomprimidos.
proveedores más frecuentemente observados son Como es posible suponer, se han construido
4LNH<WSVHK9HWPK:OHYL`/V[ÄSLH\UX\LL_PZ[LU sitios en los que la publicación de este tipo de enlaces
centenares14 de estos servicios, disponibles casi de descarga, constituye uno de sus principales
todos bajo alguna modalidad gratuita. contenidos. En el contexto mexicano, destacan
3.   El usuario que haya colocado estos por su relevancia sitios como Taringa y Ba-K (que
archivos en línea, publica los enlaces de descarga, ocupan las posiciones 12 y 40, respectivamente,
para que el resto de los usuarios puedan tener LU LS SPZ[H KL ZP[PVZ JVU TH`VY [YmÄJV LU 4t_PJV
acceso a tales contenidos. Esta publicación elaborada por Alexa16, consultada el 18 de mayo
puede ser hecha de muchas maneras: en actos de 2010), donde es posible observar categorías
comunicativos interpersonales, a través de chat o de productos culturales que van desde películas,
correo electrónico; o de forma pública, a través de música grabada y programas de televisión, hasta
publicaciones en blogs y foros. libros electrónicos; todos ellos en una amplia
4.   Los usuarios que lo deseen, pueden variedad de géneros. Nuestra observación no
descargar y descomprimir estos archivos. participante se ha centrado en estos dos sitios, en
En cuanto al riesgo de vigilancia, esta virtud de que son los foros donde se publican links
estrategia implica una mayor seguridad para de descarga mejor colocados en dicho ranking.
quienes realizan las descargas, dado que en Sin embargo, en estos sitios continúan los
ningún momento se hace pública su dirección IP enfrentamientos entre las industrias culturales y sus
(no se emplea aplicación P2P alguna), y todo el representantes legales, contra los administradores
[YmÄJVKLKH[VZZLYLHSPaHH[YH]tZKLSTPZTVW\LY[V de estos sitios, que además de tales links de
de comunicación que se emplea durante una descarga tienen muchas otras secciones en las
navegación típica en la World Wide Web (WWW);15 que se discuten asuntos que nada tienen que ver
con estos archivos.
13 Los dos formatos más populares empleados
para hacer esta compresión son RAR y ZIP. En mensajes dados a conocer a sus usuarios
14 La aplicación para descargas automatizadas 16 Alexa publica en su sitio web, el listado de los
Jdownloader soporta un total de 536 de estos servicios de ZP[PVZJVUTH`VY[YmÄJVLULST\UKV`WVYWHxZLZZLSLJJPVUHKVZ
hosting de archivos, de acuerdo con la más reciente actualización (\UX\L LS HSNVYP[TV LTWSLHKV WHYH LZ[L ÄU PTWSPJH \UH ZLYPL KL
descargada el 15 de mayo de 2010. sesgos metodológicos muy importantes; es una de las pocas
15 En el protocolo TCP/IP el puerto 80 está mediciones que a este respecto se encuentran disponibles de
reservado para el protocolo de la WWW que es el http. manera gratuita.

?=,5*<,5;965(*065(3*65,0** 152
Productos culturales digitales

a inicios de 2010, se ha explicado la política que de autor, se recomiendan acciones entre las que
estos dos sitios han aplicado al respecto, con destaca mantener copias tanto locales (es decir
notables coincidencias entre ellos. En resumen, los en las computadoras de los usuarios), como en
administradores han declarado que, para evitar el blogs de estas aportaciones (esto es, los links de
cierre total de los sitios en cuestión, en lo sucesivo descarga), de manera que cuando un post sea
serán cancelados sólo aquellos mensajes (posts) denunciado y eventualmente eliminado, sea posible
X\L ZLHU KLU\UJPHKVZ KL THULYH LZWLJxÄJH WVY su re-publicación en el menor tiempo posible.
quienes poseen los derechos de explotación de los Por otro lado, en la práctica, estas
productos culturales que estén siendo distribuidos denuncias han tenido un impacto más bien limitado
sin autorización en tales publicaciones. La siguiente en la disponibilidad de productos culturales
imagen muestra el resultado de la búsqueda de audiovisuales en estos sitios. Por ejemplo, los links
uno de estos posts eliminados en Taringa: de descarga de los más recientes capítulos de
Fuente: captura de pantalla realizada el 18 series como House MD, The Mentalist, y otras que
de abril de 2010 en el sitio www.taringa.net forman parte del prime time de la televisión por
cable y abierta; son publicados en una media de
10 posts distintos y más o menos simultáneos, a
los que se van agregando las re-publicaciones que
se hacen en los días subsiguientes a cada estreno.
Además de esta re-colocación de links
de descarga, es importante mencionar que
aunque las solicitudes de borrado de posts sean
atendidas por sitios como Taringa y Ba-K.com;
y a pesar de su popularidad, estas no son mas
que dos opciones entre muchísimas otras. Existe
Con base en la observación realizada en una cantidad literalmente indeterminable de
estos dos sitios durante los meses de enero a abril foros y blogs que presentan dinámicas similares,
de 2010, podemos sugerir que, aunque hay una en distintos idiomas y alojados en servidores
aparente colaboración con los representantes de ubicados en múltiples regiones, y a los que se
las industrias culturales en la eliminación de tales agregan nuevos prácticamente a diario; lo que
mensajes, en realidad se trata de cumplir con lo KPÄJ\S[HJVUZPKLYHISLTLU[LSHKLU\UJPH`L]LU[\HS
estrictamente requerido para evitar consecuencias eliminación de posts con las características antes
legales. mencionadas.
Si bien las publicaciones en cuestión son En virtud de esta amplia oferta de sitios que
eliminadas, pudimos observar que al mismo tiempo publican dichos links de descarga, la estrategia
los administradores dan a los usuarios sugerencias de los representantes legales de las industrias
para enfrentar estos reclamos. Lejos de solicitar J\S[\YHSLZOHZPKVJLU[YHYZLLUSVZZLY]PJPVZKLÄSL
que se evite la publicación de links de descarga de hosting más frecuentemente utilizados, y hacer
contenidos audiovisuales protegidos por derechos búsquedas de productos protegidos por derechos

?=,5*<,5;965(*065(3*65,0** 153
Productos culturales digitales

de autor en los buscadores especializados hechos por la Escuela de Birmingham, podemos


LU[YL SVZ X\L LZ WVZPISL TLUJPVUHY H PULLKÄSL sugerir que se trata de procesos de consumo
JVT ` ÄSLZ[\ILJVT LU[YL T\JOVZ V[YVZ  +L de productos culturales dignos de estudio, tanto
este modo, los archivos hospedados en los dos por los impactos económicos que les han sido
más utilizados servicios de hosting, que son atribuidos (Katz, 2006), como por su pertinencia
Rapidshare y Megaupload; son los primeros en en cuanto a las estrategias de apropiación
ser denunciados ante estas instancias. Ante la tecnológica que los usuarios realizan en relación
amenaza de iniciar acciones legales en su contra, JVUJVU[LUPKVZX\LSLZYLZ\S[HUZPNUPÄJH[P]VZ LU
los administradores de tales servicios eliminan los renglones que tienen que ver tanto con aspectos
links de descarga a solicitud de quien tenga los culturales como identitarios.
derechos de explotación de la obra en cuestión. El surgimiento de canales alternativos
Como es posible suponer, esto tampoco de distribución de contenidos audiovisuales,
representa una solución duradera a la situación representa un fenómeno cibercultural en torno
que enfrentan las industrias culturales, en virtud al cual se presentan múltiples acercamientos.
de que, como hemos adelantado, Rapidshare y Como hemos planteado en trabajos previos (Pérez
Megaupload son solo dos entre cientos de servicios Salazar, 2009), mientras que para algunos usuarios
similares. En este sentido, lo que hemos podido puede representar una fuente aparentemente
observar es que algunos posts que publican links inagotable de productos de entretenimiento libres
de descarga, lo hacen en más de un servicio a la de costo, para otros se trata de espacios en los
vez, e incluso de manera simultánea en hasta 6 que además se construyen comunidades virtuales
servicios de hosting diferentes. Esto nos lleva a JVUHS[VZUP]LSLZKLWHY[PJPWHJP}U`KLPKLU[PÄJHJP}U
sugerir que la estrategia de quienes distribuyen simbólica.
estos productos culturales, es la de atomizar los A partir de nuestras observaciones,
servidores empleados para llevar a cabo tales podemos decir que en sitios como los que hemos
acciones, de manera que la actividad que hace mencionado, si bien la publicación de enlaces de
unos meses se concentraba en Rapidshare y descarga puede ser la principal sustancia relacional
Megaupload; en la actualidad, lleva al empleo en torno a la cual se crea una red de usuarios;
rutinario de al menos otros 15 servicios distintos, en algunos casos hemos podido observar la
LU[YL SVZ X\L KLZ[HJHU /V[ÄSL +LWVZP[ÄSLZ transformación de tal red en comunidad, en la
4LKPHÄYL?-PSLZLY]L`-PSLMHJ[VY`LU[YLV[YVZ que se observan intercambios comunicativos que
van más allá de dichas publicaciones iniciales.
0=*VUZPKLYHJPVULZÄUHSLZ Hay gente que no solo se limita a descargar estos
contenidos, sino que en relación con ellos se
Más allá de las valoraciones que pudieran hacerse comparten reseñas y puntos de vista; se hacen
de estas prácticas desde una perspectiva jurídica preguntas y se resuelven cuestionamientos de
y sin pretender ninguna manera hacer apología de toda índole; se reportan problemas técnicos y los
cualquier acción que pudiera ser considerada como enlaces se mantienen activos (a pesar de que sean
ilegal, con base en algunos de los planteamientos reiteradamente dados de baja). En resumen, es

?=,5*<,5;965(*065(3*65,0** 154
Productos culturales digitales

posible observar interacciones sociales en las que no posean los derechos legales para ello.
WYL]HSLJLU[HU[VSHZ\WLYÄJPHSPKHK`SHIHUHSPKHK Finalmente, hay una cuestión adicional que
JVTV SH WYVM\UKH ZPNUPÄJHJP}U"  LS JVUÅPJ[V ` SH creemos oportuno señalar. Independientemente de
discordia, como la cordialidad y la solidaridad. si los productos culturales a los que hemos hecho
Son, para bien y para mal, mucho más que meros referencia son distribuidos por canales formales
canales alternativos de distribución de productos o informales, a nivel simbólico se establece una
audiovisuales. posición hegemónica que sigue siendo detentada
Por otro lado, diversos grupos activistas en por las industrias culturales. En otras palabras,
línea recientemente han planteado un debate que sin importar si las grandes empresas productoras
forma parte de este fenómeno. Citando el Artículo y distribuidoras reciben o no las ganancias que
27 de la Declaración Universal de los Derechos provienen de la venta y distribución de estas formas
Humanos, que dice que toda persona tiene simbólicas digitalizadas, sus contenidos siguen
derecho a tomar parte libremente en la vida cultural formando parte de los referentes de las audiencias
de la comunidad, a gozar de las artes y a participar que los consumen. Sin entrar en el ampliamente
LULSWYVNYLZVJPLU[xÄJV`LUSVZILULÄJPVZX\LKL discutido (y discutible) terreno de los efectos de
él resulten (ONU, 2009), han abierto una discusión los media, podemos decir que, habiendo o no
en relación a este derecho, dado que, argumentan, pagado por ellos, los productos culturales siguen
en muchas ocasiones su ejercicio está limitado por representando modelos en los que hay una
las posibilidades económicas de los individuos. cantidad relativamente pequeña de generadores
En realidad, dicho planteamiento evita de contenidos, y que éstos forman parte del
mencionar el segundo apartado de este mismo capital simbólico que las audiencias construyen
Artículo, que señala que “Toda persona tiene a partir de su consumo mediático. Así, en un
derecho a la protección de los intereses morales nivel estrictamente cultural, no importa tanto si la
y materiales que le correspondan por razón de las película de Hannah Montana que una niña consume
WYVK\JJPVULZ JPLU[xÄJHZ SP[LYHYPHZ V HY[xZ[PJHZ KL proviene del DVD original, o si fue descargada en
que sea autora” (ONU, 2009). HS[HKLÄUPJP}UKLHSN‚UMVYVKLKPZ[YPI\JP}UPUMVYTHS
En todo caso, consideramos que las como los que hemos observado, o si fue adquirida
dos dimensiones que el Artículo 27 de la citada ilegalmente a un vendedor ambulante. La ideología
Declaración incluye, representan la complejidad y los valores contenidos en tal película, siguen
del fenómeno al que nos hemos referido. Ante la siendo consumidos; y dada la parafernalia que
acción de las industrias culturales que buscan un suele acompañar a este tipo de producciones,
ILULÄJPV LJVU}TPJV LU MH]VY KLS ZPZ[LTH HS X\L permanece su potencial como escaparate y
pertenecen, y donde se incluyen tanto los creadores promotor para la adquisición de otros productos
y artistas involucrados, así como a sus ejecutivos, adyacentes, mismos que siguen siendo atendidos
directivos y accionistas; se enfrentan las estrategias por las otras ramas e hileras de las industrias
alternativas de aquellos usuarios que consumen, culturales.
KPZ[YPI\`LUHSTHJLUHU`[YHUZÄLYLUVIYHZX\LKL
HSN\UH THULYH SLZ YLZ\S[HU ZPNUPÄJH[P]HZ H\UX\L

?=,5*<,5;965(*065(3*65,0** 155
Productos culturales digitales

V. Referencias. agosto de 2009.


_______ (2007). “Descargan ilegalmente más de
Adorno, T. y Horkheimer, M. (2007). Dialéctica de 2 mil millones de canciones en cibercafés”,
la ilustración. Barcelona: Akal. 4 de diciembre. Documento electrónico
Benjamin, W. (2009). La obra de arte en la era de disponible en: http://www.jornada.unam.
la reproducción mecánica. México: UACM. mx/2007/12/04/index.php?section=espe
Bustamante, Enrique (Coord.) (2002). ctaculos&article=a08n1esp. Acceso: 7 de
Comunicación y Cultura en la era digital. agosto de 2009.
Barcelona: Gedisa. Levy, P. (1999). Qué es lo virtual. Barcelona: Paidós.
Castells, Manuel (2001). La Galaxia Internet. Liu, Qiong, Reihaneh Safavi-Naini y Nicholas Paul
Madrid: Plaza y Janés Editores. Sheppard (2003). “Digital rights management
El Mundo (2005). “La IFPI demanda a casi for content distribution”, Conferences
1.000 personas por descargar música in Research and Practice in Information
de la Red”, 12 de abril. Documento Technology Series, Vol. 34, 49 – 58.
electrónico disponible en: http://www. Memon, Nasir y Ping Wah Wong (1998). “Protecting
elmundo.es/navegante/2005/04/12/ digital media content”, Communications of
cultura/1113322120.html. Acceso: 7 de the ACM, 41 (7), 35 – 43.
agosto de 2009. Miguel de Bustos, Juan Carlos (1993). Los grupos
Electronic Frontier Foundation (2006) “How To multimedia. Barcelona: Bosch.
Not Get Sued for File Sharing” Documento Negroponte, N. (1995). Ser digital. México: Océano.
electrónico disponible en: http://www.eff. ONU, (2009). “Declaración universal de los
org/wp/how-not-get-sued-file-sharing. derechos humanos”. http://www.un.org/es/
Acceso: 6 de agosto de 2009. documents/udhr/index.shtml. Acceso: 18 de
Gong, Yiming (2005). “Identifying P2P users using mayo de 2010.
[YHMÄJ HUHS`ZPZ¹ +VJ\TLU[V LSLJ[Y}UPJV Pavlik, J. V. y S. McIntosh (2004). Converging Media:
disponible en: http://www.securityfocus. An introduction to mass communication.
com/infocus/1843. Acceso: 7 de agosto de Needham Heights, Massachussetts: Allyn &
2009. Bacon.
Katz, Jorge (2006). Las tecnologías de la Pérez Salazar, Gabriel (2009). Internet como
información y la comunicación y las industrias medio de comunicación. Tesis de doctorado.
culturales. Una perspectiva latinoamericana. México: UNAM.
Santiago de Chile: Naciones Unidas. Rawolle, Joachim y Thomas Hess (2000). “New
La Jornada (2008). “Cambio de estrategia digital media and devices: An analysis for the
antipiratería en Estados Unidos”, 21 media industry”, The International Journal on
de diciembre. Documento electrónico Media Management, 2(2), 89 – 90.
disponible en: http://www.jornada.unam. Ruano, S. (2007). “Las Industrias Culturales
mx/2008/12/21/index.php?section=espe el Negocio de la Era Digital”. Razón y
ctaculos&article=a08n2esp. Acceso: 7 de Palabra, núm. 56, abril – mayo, http://

?=,5*<,5;965(*065(3*65,0** 156
Productos culturales digitales

www.razonypalabra.org.mx/anteriores/n56/
sruano.html, acceso: 18 de mayo de 2010.
Schubert, R. (1999). “Tech-savvy Getting Music
For A Song; Industry Frustrated That Internet
Makes Free Music Simple”. SeattlePost-
Intelligencer. http://seattlepi.nwsource.com/
archives/1999/9902100013.asp. Acceso: 22
de noviembre de 2008.
Wired (2006). “P2P Viruses on the Rise”, 17 de abril.
Documento electrónico disponible en: http://
www.wired.com/listening_post/2006/04/
p2p_viruses_on_/ Acceso: 7 de agosto de
2009.

SOBRE EL AUTOR
Dr. Gabriel Pérez Salazar. Dr. en Ciencias Políti-
cas y Sociales con orientación en Comunicación
(UNAM, 2009) y Maestro en Comunicación por la
Facultad de Ciencias Políticas y Sociales (UNAM,
2004), actualmente es profesor investigador de
tiempo completo en la Facultad de Comunicación
de la Universidad Autónoma de Coahuila.

SOBRE LA PONENCIA
El presente trabajo es parte del proyecto “Los ele-
mentos identitarios en los procesos de interacción
mediados por las TICs en la región sureste de
Coahuila”, del Cuerpo Académico de Comunica-
ción Masiva de la Facultad de Comunicación de
la UadeC, coordinado por la Dra. Julieta Crabaza;
así como del proyecto PAPIME – UNAM “Las in-
dustrias culturales en México”, coordinado por la
Dra. Delia Crovi.

?=,5*<,5;965(*065(3*65,0** 157
Redalyc: ocho años
haciendo presente la ciencia
iberoamericana en el contexto
de la Sociedad de la Información
Rosario Rogel Salazar
Eduardo Aguado López
UNIVERSIDAD AUTÓNOMA DEL ESTADO DE MÉXICO

Resumen:
  
3HJVT\UPJHJP}UX\LWYVWVULTVZ[PLULJVTVÄUL_WVULYSVZHSJHUJLZ`YLZ\S[HKVZX\LLSWYV-
yecto Redalyc de la Universidad Autónoma del Estado de México ha tenido como recurso en
SxULHKLHJJLZVHIPLY[VWHYHSHPUMVYTHJP}UJPLU[xÄJHWYVK\JPKHWVYSHYLNP}UKL(TtYPJH3H[PUH
el Caribe, España y Portugal. Del mismo modo expone datos sobre el impacto que como índice y
gestor de la información en línea ha venido adquiriendo para convertirse en un recurso indispen-
sable para la representación de la Ciencia Local frente a los grandes referentes internacionales o
la denominada Gran corriente de la ciencia.

7HSHIYHZ*SH]L!(JJLZVHIPLY[VPUMVYTHJP}UJPLU[xÄJHYLWYLZLU[HJPVULZKLSHJPLUJPH*PLUJPH
Local, Gran corriente de la Ciencia.

Introducción: necesidades y problemas de investigación


de índole nacional o regional.
Partimos de la idea planteada -por diferentes 2.   Las formas de trabajo y circulación de
comunidades nacionales de académicos de información que, a su vez, se sostienen
las Ciencias Sociales- de que la producción en perspectivas ajenas a las propiedades
KL JVUVJPTPLU[V JPLU[xÄJV LZ[m M\LY[LTLU[L inherentes a las Ciencias Sociales y son,
condicionada por dos tipos de parámetros de más bien, pensados en virtud de las
difusión que resultan ajenos tanto a nuestras llamadas “Ciencias Duras”.
realidades como cientistas sociales como a nuestro
contexto latinoamericano. En ambos argumentos queda implícita la noción
KL \U JVUKPJPVUHTPLU[V L_[LYUV NLVNYmÄJV `
1.   Los criterios de calidad en la producción LWPZ[tTPJVWHYHLS[YHIHQVJPLU[xÄJVLU*PLUJPHZ
X\L ZVU ÄQHKVZ WVY WHxZLZ JLU[YHSLZ ` Sociales, de un condicionamiento que provee –a la
que poco o nada tienen que ver con las
Redalyc

]LaKLOLYYHTPLU[HZWHYHLSJVU[YVS`SH]LYPÄJHJP}U se le quitará aún eso”. A este respecto las


de lo que se produce y de las formas por las que principales oposiciones se dan en torno a
se produce. la presencia hegemónica de índices como
el JCR (Journal Citation Report) del ISI
La intención de esta ponencia es, no obstante, la de 0UZ[P[\[LMVY:JPLU[PÄJ0UMVYTH[PVUZPZ[LTH
confrontar estas ideas al plantear una perspectiva que genera taxonomías de la producción
de trabajo que, desde el año 2003 ha venido y asigna relevancia a ciertos medios
convirtiéndose en la apuesta latinoamericana y JPLU[xÄJVZHUP]LST\UKPHSX\LYLWYLZLU[HU
social para el acceso abierto a la investigación de si acaso, el 4% del total de la producción.
vanguardia y para la generación de indicadores de (KURMIS; 2003)
la ciencia local. % Filtros o “cajas negras” en donde la actividad
del investigador pasa a depender de
El papel de los Indicadores de Calidad en poderaciones relativas y poco transparentes
Comunicación de la Ciencia: (BUELA CASAL; 2003), más relacionadas
con las orientaciones particulares de un
En nuestro contexto latinoamericano no journal1 que con una supuesta esencia del
ZVU WVJHZ SHZ ]VJLZ X\L OHU JHSPÄJHKV H [YHIHQVJPLU[xÄJV
los actuales mecanismos de evaluación de % Estrategias asimétricas de ponderación,
SH JHSPKHK KL SH WYVK\JJP}U JPLU[xÄJH JVTV toda vez que se encuentran condicionadas
procesos institucionalizados que conllevan a un a la presencia de códigos de relevancia
condicionamiento de las formas de producción globales y que son proclives a ciertas
destinados por modelos editoriales propios de las ¸J\S[\YHZJPLU[xÄJHZ¹VHJPLY[HZ¸ULJLZPKHKLZ
naciones centrales y fuertemente condicionados sociales”. Sus efectos, lógicamente,
por referencias de las llamadas disciplinas marginan esquemas o desarrollos propios
“duras”. Entre las principales críticas emitidas en de otros entornos (¿la República de la
este sentido, destacan las que consideran a la Ciencia aparecería entonces como una
evaluación en ciencia como: consecuencia agravada de la “Sociedad
% Meros modelos estadísticos de medición, de la Información”?) (CASAS; 2001);
que son de corte mercantil y en los que los (VESSURI; 1995).
WYVK\J[VZ JPLU[xÄJVZ JVU TH`VY ]PZPIPSPKHK
tienden a generar una mayor demanda. Estas críticas, entre muchas otras, han dejado
Esto hace que, consecuentemente, los entrever la existencia de un manejo arbitrario de la
mismos generen un mayor impacto en política de la ciencia que la ha llevado a alejarla de
KL[LYTPUHKHZ JVT\UPKHKLZ JPLU[xÄJHZ ( su verdadero impacto (la explicación, la generación
esto se le ha denominado “Efecto Mateo” de conocimiento y la posibilidad de transformar
(ARENAS; 2007) bajo la idea de que “a el mundo) y la ha restringido en un circuito de
todo aquel que mucho tiene se le dará más intercambio en el que lo que cuenta es más la
1 Comité editorial, cartera de árbitros, periodicidad y
mientras que a todo aquel que poco posee mercado meta.

?=,5*<,5;965(*065(3*65,0** 159
Redalyc

articulación del discurso y perpetuación del mismo Los números son contundentes y esto,
en diferentes foros que la verdadera aplicación generalmente no agrada a comunidades que
contextual del conocimiento. Muchos cientistas WYVK\JLU`UV]LUYLÅLQHKHLULSSVZZ\WYVK\JJP}U
sociales coinciden con estas perspectivas y
han preferido mantener las formas tradicionales Ahora bien, que estos datos provienen de bases
de difusión del conocimiento (libros, coloquios, de información extranjeras que pueden tener
congresos y medios institucionales) por sobre KPMLYLU[LZVYPLU[HJPVULZVÄS[YVZWHYHSHTLKPJP}UKL
SVZ SSHTHKVZ ¸JHUHSLZ KL JVUÄHUaH¹ LZ KLJPY datos bibliométricos, no obstante, bases de datos
las revistas de impacto disciplinar internacional. como el JCR2 y el SJR3 resultan hoy día ineludibles
Muestra de lo anterior puede leerse en la presencia al momento de querer ponderar en impacto
relativa (ni siquiera categorizada) de las ciencias local de la ciencia en función de comparativos
sociales frente a otras disciplinas de las llamadas mundiales (simultáneos o históricos). Sus registros
“duras”. son tantos y tan completos que constituyen la
opción más viable para establecer numéricamente
el comportamiento de la producción y sus “n”
variables. Ante la contundencia de estos gigantes
informativos, a las objeciones no les resta sino
(CONACYT, 2007) adaptarse o esperar al surgimiento de una mejor
opción.
Por otro lado, la necesidad de proyección de los
académicos es una exigencia cada vez mayor que Para bien o para mal la medición de la ciencia
se traduce en los requisitos y condicionantes que depende de la información disponible sobre
las diferentes instituciones de educación superior y TLKPVZKLJVUÄHUaH`ZVIYLSVZHY[xJ\SVZX\LLU
los propios gobiernos van imponiendo a través de ellos parezcan; por ello sólo las grandes bases de
los llamados “estímulos a la investigación” o “carrera datos globales como ISI y Scopus se sostienen
de investigador”. Los números que proyectan los como referencias obligadas para la obtención de
grandes centros gestores de la investigación a   +L 0UZ[P[\[L MVY :JPLU[PÄJ 0UMVYTH[PVU ¶ 1V\YUHS *P[H[PVU
Reports en la Web es el único recurso de evaluación de publicaciones
nivel nacional, sin embargo, han dejado en claro que brinda información estadística basada en datos de citas.
Los datos son exclusivos porque sólo ISI® incluye referencias
que la presencia internacional de los trabajadores citadas en cada artículo del índice. Al compilar estas referencias
KL JPLUJPH TL_PJHUVZ UV LZ ZPNUPÄJH[P]H LU SVZ JP[HKHZ Z\TPUPZ[YHKHZWVYSVZWYVWPVZH\[VYLZ 1*9H`\KHHTLKPY
SH YLWLYJ\ZP}U ` SH PUÅ\LUJPH KL SHZ W\ISPJHJPVULZ ` T\LZ[YH SHZ
circuitos internacionales. Las cifras resultan poco relaciones entre las publicaciones que citan y las que son citadas.
;OVTWZVU:JPLU[PÄJ"
HSLU[HKVYHZ LU SVZ JVTWHYH[P]VZ X\L YLÄLYLU SH 3 La reciente respuesta Europea a ISI, es SCOPUS que
situación de la producción escrita mexicana en puede ser conocido a través del Scimago Journal Rank (SJR)
proyecto de acceso abierto impulsado mediante un acuerdo entre
materia de ciencia. Scopus y la Universidad de Granada a través de Scimago. El SJR
LZ \UH WYVW\LZ[H X\L I\ZJH HS ZLY KL HJJLZV HIPLY[V KHY H
conocer las potencialidades de Scopus que agrupa una base de
casi el doble de revistas de las que tiene ISI (Thomson-Reuters).
En ella, se plantean indicadores alternativos a Thompson para la
(CONACYT; 2007) L]HS\HJP}U KL YL]PZ[HZ JPLU[xÄJHZ 7HY[PJ\SHYTLU[L HS WVUKLYHY SH
cita recibida dependiendo el Factor del Impacto de la revista que
concede la cita.

?=,5*<,5;965(*065(3*65,0** 160
Redalyc

parámetros que permitan ajustar las políticas de Esto tiene su causa en la tradición de escritura,
ciencia en diferentes países. como veremos más adelante, ésta se ha presentado
más como un patrimonio de las llamadas “ciencias
De hecho, en México, el Consejo Nacional de duras” que de las sociales y humanas. Y es que
Ciencia y Tecnología utiliza principalmente los físicos, químicos, matemáticos, astrónomos,
indicadores del Journal Citation Report para biólogos, etc. desde su formación elemental
generar sus propias estadísticas y, pese a que tienen referencias y materiales provenientes de
las políticas de producción y difusión en nuestra publicaciones de primer nivel o, al menos, de
región continental se han apegado relativamente revistas altamente especializadas en las que (con
tarde a estos índices, la recurrencia a la información un lenguaje propio, sistematicidad y proclividad
presentada por los mismos es algo que ya varias a estándares de los grandes índices) el usuario
JVT\UPKHKLZ JPLU[xÄJHZ OHU YLJVUVJPKV JVTV encuentra siempre actualidad en el estado del arte
idóneo desde hace tiempo en varios países. y desarrollos de punta en lo referente a proyectos..

Tal es el caso de las constituidas por las llamadas


“ciencias duras” (matemáticas, física, química, (CONACYT; 2007)
biología, informática, astronomía, etc), las cuáles
incorporan en sus marcos internos de producción Tras la apreciación de estos datos y en vista de que
y evaluación recurrencia inexcusable a referencias las formas de trabajo de las ciencias duras distan
de esta naturaleza. Esto le ha proveído de de parecerse a las nuestras ¿podríamos decir
la posibilidad para consolidar sus diferentes que las Ciencias Sociales y humanas sufren una
formaciones más allá de los marcos meramente marginación con respecto a las llamadas Ciencias
institucionales acercándose, desde hace tiempo Duras? Más aún, ¿podríamos intuir que en esta
ya, al trabajo en red a nivel internacional. No es raro parcela del saber humano se trabaja menos que
darnos cuenta, por lo mismo, que la producción en el resto?
en estas áreas de la ciencia –aún en nuestro país,
y a nivel global- supere con mucho a lo logrado a En ambos casos la respuesta es negativa y lo es
las ciencias sociales y/o humanas. WVYX\L SV YLÅLQHKV WVY SH [HISH KL *65(*@; ¶
ISI, no es indicador de la capacidad de trabajo
Para las Ciencias Sociales y las humanidades el en sí sino del impacto comunicacional de dicho
problema expuesto se agudiza pues, además trabajo. Las disciplinas duras tienen mucho más
de que la ciencia mexicana tiene una bajísima WYVJSP]PKHKHSHJVT\UPJHJP}UJPLU[xÄJH
representación en las cifras mundiales, de este
porcentaje todavía una fracción mucho menor la ,U KLÄUP[P]H UV LZ X\L UV ZL [LUNHU SVZ TVU[VZ
integran los productos nacionales que, en dichas de producción sino que, para decirlo llanamente,
áreas del saber, logran tener eco internacional. éstos no se promueven adecuadamente.

?=,5*<,5;965(*065(3*65,0** 161
Redalyc

En realidad, para poder promover la producción derecho, la historia, la ciencia política, la


es necesario no sólo saber de lo que se escribe comunicación, el urbanismo, la geografía y
sino volverse depositario de toda una serie de las artes.
referencias sobre sistematicidad, formatos o
dispositivos, manejo de la información y circuitos -­‐   Para las comunidades académicas de
LKP[VYPHSLZ JVU WVSx[PJHZ LZWLJxÄJHZ LU SHZ X\L estas disciplinas la vinculación permanente
más que nada, se requerirán ajustes a las formas entre teoría, práctica e intervención en
tradicionales de trabajo académico. casos concretos han hecho que el impacto
de las investigaciones se restrinja al marco
Ante esta lectura, las réplicas y objeciones a la de lo inmediato y, en el mejor de los casos,
“hegemonía de los circuitos internacionales de a lo nacional. No existe como norma el
JVT\UPJHJP}UJPLU[xÄJH¹`HSVZMHTVZVZ¸xUKPJLZ desarrollo de informes, artículos o avances
y factores de impacto”4 también nos han llevado de investigación que permitan implicar a
a reconocer que algunos de los investigadores en otras comunidades, latitudes o, incluso
Ciencias Sociales y Humanidades mantenemos instituciones en el esfuerzo.
formas de producción que están plenamente
interiorizadas cultural e incluso tradicionalmente. Se -­‐   En segundo término la inercia histórica y
trata de formas de trabajo cuya naturaleza induce el consecuente reconocimiento por parte
a generar niveles de resistencia al cambio que van de las diferentes comunidades de las
desde la forma de escribir hasta la ponderación ciencias sociales hacia libro como “medio
de los criterios para seleccionar los medios de de comunicación por excelencia” para la
difusión de su escritura. Éstas han llevado a las comunicación. Hoy es claro que, a pesar de
KPMLYLU[LZ WYVK\JJPVULZ JPLU[xÄJHZ ZVJPHSLZ OHJPH su impacto y difusión en el terreno social,
verdaderas inercias de trabajo que tienden a dejar los libros son eventos ‘efímeros’ que tienen
la obra del investigador en espacios locales sin alcance, por lo general, en ámbitos de
que pueda ser contratada por otras comunidades circulación restringidos. Por otro lado, los
o en otras latitudes. artículos (aparente patrimonio de las ciencias
duras) tienen posibilidad de indizarse en
Este fenómeno se debe posiblemente a diferentes cientos o miles de bases de datos a nivel
combinaciones de las siguientes causas: mundial; bases que circulan entre todos
aquellos que desean saber qué es lo que
-­‐   En primer lugar, el condicionamiento al se ha publicado en un determinado ámbito.
trabajo de impacto local o circunscrito que
distinguen a ciencias como la antropología, -­‐   En cuarto lugar la presencia de una
la misma sociología, la psicología, el tendencia institucional al reconocimiento
4 (RODRÍGUEZ ; 2006)en Revista de Investigación en (en forma de estímulos académicos) a
Gestión de la Innovación y Tecnología. C...ACIÓN, INNOVACIÓN
Y CONOCIMIENTO II. Número 37, julio - agosto 2006; (BUELA una producción (individual, disciplinar o de
CASAL; 2003) en Psicothema, año/vol. 15, número 001
Universidad de Oviedo Oviedo, España pp. 23-35;  
comunidades) “demostrada” en forma de

?=,5*<,5;965(*065(3*65,0** 162
Redalyc

o   *HWx[\SVZKLVIYHZTVUVNYmÄJHZ “hegemonía de los indicadores”.

o   Cuadernos de investigación Sabemos que, en el otro lado de la moneda,


en lo que respecta al trabajo cotidiano de los
o   Libros coordinados JPLU[xÄJVZ ZVJPHSLZ ` LU SV JVUJLYUPLU[L H Z\Z
WYmJ[PJHZLZWLJxÄJHZSVZU‚TLYVZW\LKLUYLZ\S[HY
o   Compilaciones y otras formas de irrelevantes ya que las mediciones en sí mismas
literatura “gris” o, mejor dicho pueden tener un sinfín de sesgos, restricciones y
proclive a pasar inadvertida más allá ÄS[YVZPUJS\ZVJ\S[\YHSLZJVTVLSPKPVTHSHMVYTH
del impacto a nivel institucional. de medición o los objetivos). No obstante también
sabemos que no existe, al menos a nivel nacional
-­‐   *VTV \U X\PU[V MHJ[VY WVKYxHTVZ HÄYTHY o continental una contrapropuesta a los grandes
que en México y en Iberoamérica en general, generadores de números que pueda expresar en
existe aún una marcada proclividad al forma más adecuada las particularidades de la
trabajo individual, una práctica que limita la generación de Ciencia Social en México. Y es que los
capacidad de relación y, consecuentemente, grandes indicadores se ha gestado históricamente
de extensión de los alcances tanto de la y son producto de siglos de sistematización del
investigación como de los canales por los conocimiento. Retomemos los casos de la Royal
que ésta se discute entre la comunidad Society y de la Academia Francesa enunciados en
JPLU[xÄJH la primera cita de este texto como origen barroco
de la institucionalización del saber.
-­‐   Finalmente, no hay que olvidar que,
aunado a lo anterior, aún prevalecen Cada vez que nos reunimos con colegios de
trabas ideológicas que auto segregan la profesionales o grupos de investigación de
producción nacional o iberoamericana en universidades públicas y privadas del país para
ciertos campos. Entre estas trabas está la exponer la forma en la que operan índices como
idea de una hegemonía del primer mundo el JCR o el SJR, se presenta la natural duda
que condiciona en fondo y forma las “foucaultiana” sobre la legitimidad que tiene
maneras de trabajo de las periferias. cualquier entidad que ejerce la vigilancia del
entorno haciéndolo visible a costa de volverse
La necesidad de indicadores propios o invisible a sí misma.
LZWLJxÄJVZ
La respuesta generalmente la emplazamos hacia
Pese al reconocimiento del valor de los índices y de el rol del vigilado porque, siendo él quien se sitúa
la apelación que a ellos hace distintas instancias, como agente pasivo en el centro del panóptico,
no es pretensión de esta ponencia desacreditar ÄUHSTLU[L UV SL X\LKH V[YH TmZ X\L YLJPIPY SH
las voces que, desde las Ciencias Sociales y las acción de los verbos, el peso de las cifras o la
Humanidades, se oponen a la ya denunciada ausencia de los mismos por fuerte que esta sea.

?=,5*<,5;965(*065(3*65,0** 163
Redalyc

,S0UZ[P[\[LMVY:JPLU[PÄJ0UMVYTH[PVU0:0`:JVW\Z (México) han constituido pasos importantes para


del grupo Scimago han integrado sendas bases de lo que podríamos llamar: la formación o integración
información gracias a iniciativas de investigación de índices locales que, a partir de bases de
que redundaron en un producto coherente con revistas latinoamericanas (escritas en español,
perspectivas de desarrollo americanas, europeas y que representen universidades o centros de
de tradición occidental en investigación en ciencias investigación regionales y cuyas investigaciones
duras. YLÄLYHU YLHSPKHKLZ SH[PUVHTLYPJHUHZ YLÅLQLU SHZ
condiciones de la ciencia continental frente a
Actualmente, se han erigido ya como fuente de al las corrientes de índole global y, generlamente,
ser las primeras en generar cartografías sobre la anglófonas.
condición de la ciencia en el mundo. ¿Desde su
óptica?... Sí, pero también desde la óptica de los Para Redalyc la generación de mapas de la ciencia
]PHQLYVZ YLUHJLU[PZ[HZ ZL JVUÄN\YHYVU SVZ THWHZ es un proyecto en desarrollo que pretende hacer
del “Nuevo Mundo”. Sus mapas operan desde sus L_WSxJP[HSHKPUmTPJHKLYLSHJP}UJPLU[xÄJHUVZ}SV
aparatos de medición porque los tienen y porque entre diferentes naciones iberoamericanas sino,
[PLULULSTH[LYPHSZ\ÄJPLU[LWHYH[YHIHQHYSVZ incluso, entre áreas de conocimiento, medios,
instituciones y autores de los países de habla
hispana.

(Grupo Scimago)

Como país y como región del continente hoy


comenzamos a avanzar en la posibilidad de
producir y difundir cartografías como la precedente
pero con información local. Las bases de datos
KL YL]PZ[HZ JPLU[xÄJHZ ZL LZ[mU JVU]PY[PLUKV TmZ
que en una moda, en un recurso sustantivo para
garantizar el acceso a al información. Del tamaño
KL SHZ TPZTHZ KL Z\Z WLYÄSLZ KL Z\ WV[LUJPHS
para sistematizar citas y sistemas de referencia
va dependiendo la construcción de índices. Este
trabajo puede competir a nivel nacional, continental 5V Z}SV SH JHU[PKHK KL TLKPVZ KL JVUÄHUaH
L PUJS\ZV PU[LYUHJPVUHS YLÅLQHUKV SHZ JVUKPJPVULZ existentes en las bases de datos sino la información
de la ciencia en nuestro país y del continente en concerniente a patrones de colaboración
forma coherente con la lengua y con la tradición institucional, autoral e internacional se vuelven
disciplinar de Iberomérica. relevantes para su trabajo. De ellos dependerá el
Esfuerzos latinoamericanos como Latindex reconocimiento internacional de la comunicación
(México), Scielo (Brasil) y, concretamente, Redalyc JPLU[xÄJHYLHSPaHKHLUSHYLNP}U
?=,5*<,5;965(*065(3*65,0** 164
Redalyc

La coautoría muestra una tendencia a la El reconocimiento institucional por otra parte,


PU[LUZPÄJHJP}U WVY KP]LYZHZ YHaVULZ LU[YL SHZ dependerá de los niveles de colaboración que
X\LKLZ[HJHUSHULJLZPKHKKLLSL]HYSHLÄJPLUJPH diferentes instituciones de adscripción ocupen en
de los recursos disponibles al incrementar el determinado medio o en determinado número de
número de colaboradores, sumar recursos y artículos. Hoy por hoy resulta imposible pensar
buscar colocar los documentos en revistas de en un impacto institucional que pase por alto las
alta calidad y posicionamiento. El análisis de la redes colaborativas.
WYVK\JJP}U JPLU[xÄJH ` KL YLKLZ KL JVSHIVYHJP}U
WLYTP[LPKLU[PÄJHYSHZmYLHZKLLZWLJPHSPaHJP}U`SHZ
instituciones que están detrás del esfuerzo de un
WHxZLPKLU[PÄJHYLSWHWLSX\LLZ[mUQ\NHUKVLUSH
YLKJVUSVJ\HSZLWVKYmUPKLU[PÄJHYWVSx[PJHZWHYH
fortalecer el posicionamiento alcanzado.

La colaboración puede presentarse a nivel nacional


cuando dos o más investigadores del mismo país
pero de diferentes organizaciones trabajan en el
Cada uno de los mapas producidos por el sistema
mismo proyecto; regional, que se desarrolla entre
KLPUMVYTHJP}UJPLU[xÄJH9LKHS`JZVUJVUZLJ\LUJPH
JPLU[xÄJVZKLKPMLYLU[LZWHxZLZZP[\HKVZKLU[YVKL
de un trabajo de recopilación, sistematización y
SHTPZTHYLNP}UNLVNYmÄJHLPU[LYUHJPVUHSJ\HUKV
análisis de una base de más de 655 revistas, todas
LUSHPU]LZ[PNHJP}UWHY[PJPWHUKVZVTmZJPLU[xÄJVZ
de habla castellana o portuguesa, que se agrupan
de diferentes países. Las redes de colaboración
por disciplina, país o revista. De ellas es posible
permiten observar la forma en que se organiza la
comenzar a detectar niveles de citación, cocitación
LZ[Y\J[\YHJPLU[xÄJHKLSJVUVJPTPLU[VLPKLU[PÄJHY
y autocitación que permiten generar ciertas
cuál es el avance respecto a la internacionalización
inferencias sobre los grupos y formas de trabajo
de la investigación.
KL SVZ JPLU[xÄJVZ PILYVHTLYPJHUVZ :\Z TVU[VZ
(Redalyc. 2009) relaciones y niveles de cooperación institucional.

El esquema mostrado es solo un prototipo pero que


puede bien mostrar la forma por la que nexos entre
países llegan a visualizarse y hacerse accesibles a
diferentes niveles de usuario.
No obstante el alcance de este proyecto es coherente
aún con estándares más bien generalizados sobre
[YHIHQV JPLU[xÄJV (‚U OH` KLZHMxVZ PTWVY[HU[LZ

sociología por parte de diferentes países referidos en la base de


datos de Redalyc. El grosor de los nexos y el tamaño de los nodos
sor correlativos a la magnitud de la colaboración. Los recuadros en
(Redalyc; 2009)5 UL_VZYLÄLYLU[V[HSLZLU[YLUVKVZ
5 Modelo (prototipo) de red de colaboración en el área de
?=,5*<,5;965(*065(3*65,0** 165
Redalyc

que atañen –ahora sí- al trabajo propio o inherente Las comunidades disciplinares del Sistema de
de las comunidades de las diferentes disciplinas, 0UMVYTHJP}U*PLU[xÄJH9LKHS`JZVU!
trabajo que, en cierto sentido, es particular,
LZWLJxÄJV ` YLX\PLYL KL THU[LULY \U LX\PSPIYPV
LU[YL SHZ JVUKPJPVULZ KL WYVK\JJP}U LZWLJxÄJHZ % Comunidad de Estudios Territoriales
de las áreas y, al mismo tiempo, de condiciones
coherentes con los procesos de comunicación e % Comunidad de Comunicación
indización a nivel internacional.
% Comunidad de Ciencia Política
En este sentido es que el sistema de información
JPLU[xÄJH 9LKHS`J OH JVUMVYTHKV JVT\UPKHKLZ % Comunidad de Psicología
KPZJPWSPUHYLZ mYLHZ LZWLJxÄJHZ KLS JVUVJPTPLU[V
que pueden sostener diálogos internos y, a la vez, % Comunidad de Administración Pública
mantener nexos con una base generalizada de
información de la que partan para que produzcan % Comunidad de Educación
los índices y las cartografías relativos a los países,
autores y medios de Iberoamérica y del resto del *HKH\UHKLLSSHZJ\LU[HJVU\U*VTP[t*PLU[xÄJV
mundo. WYVWPV PU[LNYHKV WVY ÄN\YHZ KLZ[HJHKHZ KL
cada comunidad, que avala y propone proyectos
independientes a la base de datos general. Todos
los proyectos contenidos implican ciertos niveles
de comunicación, difusión y vinculación para los
PU]LZ[PNHKVYLZLULSmYLHLZWLJxÄJH`W\LKLU[LULY
alcances que van desde un impacto meramente
promocional (de congresos, foros, conferencias
o paneles en diferentes lugares) hasta estratégico
(como es el volverse repositorios de trabajos
en desarrollo o arbitraje, tesauros de tesis de
(Redalyc 2009) licenciatura o posgrado y punto de vinculación
para proyectos coordinados entre instituciones o
<U LQLTWSV KL LSSV ` X\L ZL PS\Z[YH LU SH ÄN\YH grupos de investigación).
anterior es el caso de la comunidad de sociología,
segmento de Redalyc que integra un marco Por el momento el trabajo de las comunidades con
de discusión interno para la disciplina a través las que el sistema Redalyc cuenta es incipiente y,
de nexos con asociaciones de profesionales, no obstante unas avanzan más rápido que otras,
instituciones y revistas. no se ha contemplado a plenitud el potencial que
tienen como generadoras de recursos propios de
medición y ponderación del conocimiento.

?=,5*<,5;965(*065(3*65,0** 166
Redalyc

validación y un puente hacia la recuperación de los


Una vez reconocido el potencial e involucrados espacios, procesos, criterios y variables propios,
los comités de las comunidades, podría llegar a tanto de la disciplina como del lugar en el que ésta
ser natural el hecho de que emergiesen criterios se hace.
de referencia para tratar la pertinencia de ciertos
aspectos inherentes a la disciplina y coadyuvar a Al tiempo de constituir sus referencias, cada
la gestión de indicadores, de procesos de calidad, comunidad puede mantener nexos con
de mantenimiento de los trabajos en tesauros publicaciones propias que pueden ser indizadas
y repositorios y de promoción de la oferta de dentro de la base y con otras que trabajan en
cursos, seminarios y congresos. Ello sin contar las LS HQ\Z[L KL Z\Z WYVJLZVZ LKP[VYPHSLZ H ÄU KL
posibilidades de la investigación coordinada por pertenecer a la hemeroteca central y generar
diversos medios. impacto en los indicadores a escala global.

Entre los desafíos pendientes está la integración


de más comunidades y más amplias que no
sólo puedan acceder a vínculos externos y
comunicaciones mediadas sino que encuentren en
el espacio de su comunidad repositorios, carteras
de contactos, información sobre proyectos y
facilidades para la vinculación.

Todo esto, sin duda, sería la base para la generación


paulatina de indicadores de calidad propios y de
referencias que sirvieran o fueran representativos
(Redalyc, 2009) WHYH\UTHYJVKPZJPWSPUHYLZWLJxÄJV

Cada uno de esos links, más allá de llevar a un Afortunadamente la posibilidad de desarrollo de
ZP[PV LZWLJxÄJV HS \Z\HYPV W\LKL JVUZ[P[\PY \U este potencial depende en todo de la vocación
potencial nodo de red que sirva para realizar de las propias comunidades y de la capacidad
proyectos investigación colegiados o bien nuevas de gestión que estas tengan para convertir los
formas de generación de referencias para la espacios comunitarios a formatos autogestivos.
comunidad. Puede haber hipervínculos hacia
repositorios (propios y externos), nexos hacia Los primeros pasos están siendo dados y sólo
publicaciones y hacia redes de investigación en queda esperar que las comunidades de diferentes
cada uno de los diferentes temas de interés para la áreas de las ciencias sociales y humanas puedan
psicología. El trabajo de las comunidades en línea incorporarse a propuestas de trabajo comunitario
W\LKL SSLNHY H JVUZ[P[\PY \U H]HUJL ZPNUPÄJH[P]V en línea y de generación de índices bajo parámetros
en el cuestionamiento a los criterios externos de WYVWPVZ ÄU KL SVNYHY SH PU[LNYHJP}U KL \UH PKLH

?=,5*<,5;965(*065(3*65,0** 167
Redalyc

de calidad que sea coherente con las formas


de trabajo, las áreas y las necesidades de los http://www.thomsonisi.com/regions/latinamerica/
diferentes grupos nacionales e iberoamericanos spanish
de investigación.
http://redalyc.uaemex.mx/
Fuentes Consultadas:
h t t p : / / re d a l y c . u a e m e x . m x / re d a l y c / m e d i a /
BUELA CASAL, G. 2003 “Evaluación de la calidad principal/proyectos/redes/index.html
KL SVZ HY[xJ\SVZ ` KL SHZ YL]PZ[HZ JPLU[xÄJHZ!
propuesta del factor de impacto ponderado y de SOBRE LOS AUTORES
un índice de calidad” en Psicothema, año/vol. 15, Rosario Rogel Salazar. Facultad de Ciencias Po-
número 001, Universidad de Oviedo, España. líticas y Sociales de la Universidad Autónoma del
Estado de México. Miembro fundador del Grupo
RODRÍGUEZ RUÍZ, O. 2006 “Por qué he dejado de Investigación Redalyc y del cuerpo Académico
de creer en la evaluación basada en las citas Difusión y Divulgación de la Ciencia.
JPLU[xÄJHZ¹LU9L]PZ[HKL0U]LZ[PNHJP}ULU.LZ[P}U Eduardo Aguado López. Facultad de Ciencias Po-
de la Innovación y Tecnología. COOPERACIÓN, líticas y Sociales de la Universidad Autónoma del
INNOVACIÓN Y CONOCIMIENTO II. Número 37. Estado de México. Miembro fundador del Grupo
España. de Investigación Redalyc y del cuerpo Académico
Difusión y Divulgación de la Ciencia.
VILLAVICENCIO, D. “Cambios institucionales
` LZWHJPVZ WHYH SH PU]LZ[PNHJP}U JPLU[xÄJH ` SH
innovación en México” en VALENTI, G. (Coord.)
Ciencia, Tecnología e Innovación. 2008. México.
Flacso

http://www.conacyt.mx/Indice/Index_Indice.html
(2009)

http://www.conacyt.mx/Sinecyt/Introduccion_
Sinecyt.html (2009)

*65(*@; 0UKPJHKVYLZ KL HJ[P]PKHKLZ JPLU[xÄJHZ


y tecnológicas versión de bolsillo. México. 2007.

SCImago.2007. SJR — SCImago Journal &


Country Rank. Retrieved September 21, 2009,
from http://www.scimagojr.com

?=,5*<,5;965(*065(3*65,0** 168
9LKLZZVJPHSLZLUILULÄJPVKL
la educación para la salud
Experiencia de trabajo colaborativo en
la comunidad en línea estudiabetes.org

María Elena Sáinz de la Maza Viadero


UNIVERSIDAD PANAMERICANA

RESUMEN
 
La diabetes mellitus es un padecimiento crónico-degenerativo que afecta a más de 285 millones
KLWLYZVUHZLULST\UKV`ZLLZWLYHX\LHSJHUJLSVZTPSSVULZLU-LKLYHJP}U0U[LY-
nacional de Diabetes, 2009). Los grupos de ayuda mutua constituyen una herramienta de apoyo
fundamental para quienes comparten esta circunstancia. La Diabetes Hands Foundation (DHF),
VYNHUPaHJP}UZPUÄULZKLS\JYVJVUZLKLLU*HSPMVYUPH,Z[HKVZ<UPKVZKL(TtYPJHVMYLJLKVZ
comunidades en línea donde los usuarios comparten experiencias de vida y brindan apoyo a sus
pares desde la comodidad de sus hogares. La gestión de estos espacios gratuitos es un trabajo
colaborativo que requiere de la participación coordinada de los miembros de la comunidad. Tu-
Diabetes.org, comunidad en inglés y EsTuDiabetes.org, para hispanohablantes, representan una
oportunidad única de aprendizaje e interacción para todos aquellos tocados de alguna manera
por la diabetes. El próposito de este escrito es describir la experiencia de trabajo colaborativo en
SHJVT\UPKHK]PY[\HS,Z;\+PHIL[LZVYNWHYHTV[P]HYSHYLÅL_P}U`LSKPmSVNVHJLYJHKLSWV[LUJPHS
de aplicación de las redes sociales online en la educación para la salud.

Palabras clave: Educación para la salud, educación en diabetes, comunidad virtual, redes socia-
les.
1. INTRODUCCIÓN las redes informáticas, las personas, más que
Las nuevas tecnologías de la información y la buscar, encontrar e intercambiar información, las
comunicación han revolucionado la manera en la utilizaron particularmente para comunicarse entre
que los seres humanos nos relacionamos en casi sí y crear nuevos espacios de interacción social.
todos los aspectos de nuestra vida. Como señala La fría herramienta de intercambio de datos se ha
López Aguirre (2010), resulta innegable que estas convertido en un espacio para conectarnos con el
tecnologías están transformando la capacidad otro emocionalmente.
de asociación humana. Desde el surgimiento de Las aplicaciones que le hemos dado a la red son
9LKLZZVJPHSLZLUILULÄJPVKLSH
educación para la salud

tan diversas como lo es la imaginación humana. familia deben enfrentarse a una serie de cambios de
Ejemplo de estas posibilidades son los grupos hábitos, no sólo para aprender a llevar un estilo de
de ayuda mutua de personas que comparten vida más saludable sino para llevar a cabo la difícil
PU[LYLZLZ KL LZ[\KPV HÄJPVULZ V JPYJ\UZ[HUJPHZ tarea de “desaprender” aquellas conductas que no
difíciles, quienes han encontrado un modo práctico favorecen el buen control de este padecimiento.
`LÄJHaWHYHNLULYHYLZWHJPVZKLJVT\UPJHJP}UL El tratamiento contra la diabetes es un trabajo en
interacción social. Tal es el caso de las comunidades equipo que va más allá de una relación tradicional
virtuales para personas afectadas por la diabetes, médico-paciente. Además, es un trabajo de tiempo
TuDiabetes.org y EsTuDiabetes.org. completo que requiere tomar decisiones las 24
Hasta el momento en que los usuarios se unen horas del día los 365 días del año. El resultado de
a esta red social únicamente han hablado de estas decisiones será no sólo el alcanzar la meta
diabetes con su médico una vez cada tres meses o de regular los niveles de glucosa en sangre, sino
KLTHULYHZ\WLYÄJPHSJVUZ\ZMHTPSPHYLZ`HTPNVZ lo más difícil: mantenerlos, para así gozar de una
Hay muchas preguntas que quedan sin respuesta, buena calidad de vida y prevenir el desarrollo de
algunas que quizá no puedan contestar ni el complicaciones.
médico ni la familia ni los amigos, sólo alguien que La Asociación Americana de Educadores en
vive una situación similar. En ese sentido, en estas Diabetes (AADE) (2007) propone 7 conductas eje
comunidades online los miembros pueden sentirse para el autocontrol de esta condición:
comprendidos, apoyados y compartir experiencias ALIMENTARSE DE FORMA
SALUDABLE.- En el control
que los ayuden a entender la situación y a tener
de la diabetes es fundamental
un mejor automanejo de su diabetes o la de su ingerir alimentos saludables,
ser querido. Por ello, el objetivo de nuestro trabajo comprender el tamaño de las
es rescatar y compartir la experiencia de casos de porciones, y conocer los mejores
horarios para comer. El control
éxito como éste para explotar el enorme potencial
del peso también puede ser una
de las redes sociales online en el campo de la parte importante del autocontrol
educación para la salud. exitoso.
MANTENERSE ACTIVO La
actividad regular es importante
2. CAMBIO DE PLANES: TIENES para la salud física en general, el
DIABETES control del peso y de la glucosa
en sangre.
Cualquier noticia que implique realizar un
REALIZAR CONTROLES El
cambio genera un impacto en nuestras vidas. El autocontrol diario de la glucosa en
diagnóstico, casi siempre inesperado, de una sangre proporciona a las personas
condición de salud crónica e incurable, como la con diabetes información acerca
de cómo los alimentos, la actividad
diabetes, provoca una avalancha de emociones,
física y los medicamentos afectan
incertidumbre, miedo, preguntas sin respuesta sus niveles de glucosa en sangre.
y muchos cambios que afectan todo el entorno TOMAR LOS MEDICAMENTOS
social del paciente. La terapia farmacológica efectiva
en combinación con las decisiones
La persona con diabetes y, en el panorama ideal, su
?=,5*<,5;965(*065(3*65,0** 170
9LKLZZVJPHSLZLUILULÄJPVKLSH
educación para la salud

saludables de la vida cotidiana pueden reforzar la propia identidad. (Asociación


pueden disminuir los niveles de *H[HSHUHKL5L\YVÄIYVTH[VZPZ
glucosa en sangre y reducir el
En México, los grupos de ayuda mutua (GAM)
riesgo de sufrir complicaciones
derivadas de la diabetes. constituyen una estrategia importante en materia
SOLUCIONAR LOS PROBLEMAS de salud pública, incluso forman parte del
La persona con diabetes debe Programa de Salud del Adulto y el Anciano del
mantener una marcada capacidad
Centro Nacional de Vigilancia Epidemiológica y
para solucionar sus problemas.
Un episodio de hiperglucemia Control de Enfermedades (CENAVECE). Los GAM
o hipoglucemia exigirá tomar se implementaron con el objetivo de estimular a
decisiones informadas acerca de sus participantes a adoptar estilos de vida más
la alimentación, la actividad y los
saludables al considerar la educación, la actividad
medicamentos.
ENFRENTAR LA DIABETES DE física y la alimentación del paciente como parte
FORMA SALUDABLE Enfrentar fundamental e indispensable del tratamiento, tal
la diabetes depende de una como lo ha difundido la Organización Mundial
mentalidad positiva. Para lograrlo,
de la Salud y otras organizaciones expertas en la
debe aprender qué puede
controlar, establecer objetivos de materia. (Organización Panamericana de la Salud
autocontrol realizables y hablar & Organización Mundial de la Salud, 2002 en
acerca de las preocupaciones y Lara Esqueda, Aroch Calderón, Jiménez, Arceo
miedos.
Guzmán, & Velázquez Monroy, 2004)
REDUCIR LOS RIESGOS La
prevención de las complicaciones Tras evaluar el cumplimiento de las metas básicas
derivadas de la diabetes y la de tratamiento de personas que asisten a los
optimización de la salud en general Grupos de Ayuda Mutua (GAM) de la Secretaría de
dependen de las conductas
Salud de México (SS) por padecer diabetes tipo 2,
para reducir los riesgos, tales
como dejar de fumar y realizarse ZLSSLN}HSHJVUJS\ZP}UKLX\LZLSVNYHUILULÄJPVZ
controles de la visión, los pies y mayores en el control de las personas con diabetes
dentales con regularidad (AADE, o hipertensión que asisten a los Grupos de Ayuda
2007).
Mutua con respecto a lo reportado en el Sistema
de Información en Salud para Población Abierta
3. EL VALOR DE LOS GRUPOS DE AYUDA
(SISPA) (Lara Esqueda, Aroch Calderón, Jiménez,
MUTUA
Arceo Guzmán, & Velázquez Monroy, 2004).
Los grupos de ayuda mutua son conjuntos
de personas que comparten un problema Como podemos apreciar, los GAM son una
o situación, se reúnen para superarlo, estrategia fundamental en la línea educativa
conseguir cambios sociales y/o personales. para mejorar el control de la enfermedad, ya
Éstos enfatizan la interacción personal y la asunción que las personas con diabetes o hipertensión
individual de responsabilidades de sus miembros. y sus familiares juegan un papel activo en el
Suelen proporcionar ayuda material o emocional cumplimiento del desarrollo del tratamiento, así
y promueven valores entre sus miembros que como en la prevención y control de la enfermedad

?=,5*<,5;965(*065(3*65,0** 171
9LKLZZVJPHSLZLUILULÄJPVKLSH
educación para la salud

(Lara Esqueda, Aroch Calderón, Jiménez, Arceo unirse a uno ya existente e intercambiar mensajes
Guzmán, & Velázquez Monroy, 2004). con otros miembros de la red social. Así mismo,
pueden informar a otros usuarios acerca de chats,
4. TUDIABETES.ORG Y ESTUDIABETES. conferencias y otros eventos en sus localidades,
SSL]HUKVSHL_WLYPLUJPHVUSPULH\UHTIPLU[LVMÅPUL
ORG. COMUNIDADES EN LÍNEA DE
PERSONAS AFECTADAS POR LA
Estos espacios de participación abierta, como
DIABETES todo grupo social, cuentan con ciertas normas
básicas de convivencia que se sustentan en los
La Diabetes Hands Foundation (DHF) es una valores de:
VYNHUPaHJP}U ZPU ÄULZ KL S\JYV JVU ZLKL LU
Apoyo y Ayuda
Berkeley, California, cuyos programas incluyen dos
Promovemos un ambiente positivo
comunidades en línea para personas afectadas por donde nuestros miembros se dan
la diabetes: TuDiabetes.org, comunidad en inglés apoyo y se ayudan mutuamente.
,Z[V UV ZPNUPÄJH X\L [VKV LZ JVSVY
y EsTuDiabetes.org, en español. Ambas ofrecen de rosa todo el tiempo, pero en
un espacio de comunicación para que todas las general buscamos mantener un
personas afectadas por la diabetes, ya sea que espacio donde nos reforzamos
y apoyamos mutuamente.
vivan con esta condición o que tengan algún ser
querido que la padezca, puedan conectarse con Salud y Bienestar
sus pares. Promovemos activamente acciones
positivas y proactivas para
mantenernos saludables viviendo
EsTuDiabetes.org es la comunidad en línea líder con diabetes. Esto va tomado de
la mano con los programas que
en el tema en español. A tan sólo 3 años de su
desarrollamos para crear consciencia
creación, cuenta ya con 10 mil miembros (Agosto acerca de la diabetes, en los cuales
2010), de los cuales 72% vive con diabetes (51% contamos con la participación de
los miembros de la comunidad.
tipo 1; 46% tipo 2); 30% de los miembros son de
México, 18% de España, 10% de Argentina, 8% Comunicación e Información
de Venezuela, 7% de Colombia, 5% de Perú, 5% Buscamos que haya un intercambio
de información y que se compartan
de Chile y 4% de Estados Unidos; tiene cerca de 4 experiencias acerca de la vida con
mil visitas diarias. (Hernández, 2010). diabetes. Creemos que la comunidad
como un todo va a tener acceso a más
información y recursos que cualquier
Cabe subrayar que estas comunidades cumplen individuo en particular y queremos
una función equiparable a la de los grupos de aprender de lo que todos comparten.
ayuda mutua, con la diferencia de la modalidad
Diversidad y Respeto
“a distancia”. Además, sus miembros pueden Valoramos diversos puntos de vista
compartir videos, fotografías y experiencias a través y damos la bienvenida a miembros
de distintas culturas. Todas las
de los blogs; participar en los foros de discusión o personas afectadas por diabetes son
proponer nuevos temas en éstos; crear grupos o bienvenidas. Puede que consigas

?=,5*<,5;965(*065(3*65,0** 172
9LKLZZVJPHSLZLUILULÄJPVKLSH
educación para la salud

opiniones y posiciones distintas de


la tuya. A veces los diferentes paises
pueden tener nombres para la 5. EXPERIENCIA PERSONAL DE TRABAJO
misma cosa y lo que puede resultar COLABORATIVO EN ESTUDIABETES.
completamente normal en un sitio
puede resultar ofensivo en otro lugar. ORG

No es un problema estar en
Ingresé a EsTuDiabetes.org el 1 de julio de 2008
desacuerdo. Lo que no está bien es
manifestar el desacuerdo faltando a las 4:30pm por invitación de mi amiga y colega,
al respeto a otro miembro. Si no educadora en diabetes y paciente con diabetes
estás seguro(a) de cómo puede ser
interpretado un comentario tuyo, tipo 1, Mariana Gómez. En ese entonces la
trata de ponerte en los zapatos de comunidad contaba con menos de mil miembros.
la otra persona. Considera cómo te No habían pasado dos horas cuando ya tenía
sentirías si fueras tú quien recibiera los
comentarios que tú estás haciendo. varios comentarios de otros usuarios dándome la
bienvenida e invitándome a participar :
Expresión Creativa “Hola Elena! Bienvenida a la
Vemos la creatividad como un
catalizador para ayudar a curar el familia de EsTuDiabetes. Por
espíritu y para crear consciencia en favor, ayúdanos a regar la voz
[VYUVHSHKPHIL[LZ,Z[VZLTHUPÄLZ[H
sobre la comunidad: Invita
por medio de tu participación
contribuyendo comentarios, noticias, a familiares, amigos y otras
videos sobre diabetes, fotos, personas que sientas que
dibujos, etc. para expresarte de
forma creativa mientras contribuyes W\LKLU ILULÄJPHYZL KL
al enriquecimiento de la comunidad. \UPYZL H SH JVT\UPKHK 
Manny (4:33pm del julio 1,
Transparencia
Somos partidarios de la apertura y la 2008)
transparencia, siempre y cuando no
ZL JYLL \U JVUÅPJ[V JVU SVZ KLTmZ ;L YLJPIPTVZ JVU PUTLUZV
valores. (Hernández, 2009)
cariño y brazos abiertos
desde Venezuela a tus
Cabe señalar que está prohibido promocionar VYKLULZ  .SHK`Z  !WT
productos o servicios comerciales sin la del julio 1, 2008)
autorización de los administradores. Además se
LZWLJPÄJH[HU[VLUSVZ[tYTPUVZKL\ZVKLTHULYH )PLU]LUPKHHSHNYHUMHTPSPH
explícita, como en la convivencia diaria de la propia de EsTuDiabetes, veo que
comunidad, que “el contenido en Estudiabetes rapidamente te integraste,
[PLULU\UÄUPUMVYTH[P]V‚UPJHTLU[L`UVWYL[LUKL que bueno, tu experiencia,
sustituir la consulta, consejo o asesoría, diagnóstico comentarios y aportaciones
o tratamiento médico profesional” (Hernández, serán de mucha utilidad
2009). para todos. Un saludo

?=,5*<,5;965(*065(3*65,0** 173
9LKLZZVJPHSLZLUILULÄJPVKLSH
educación para la salud

KLZKLSH5mWVSLZ ,KNHY y su esposa Andreina Dávila, organizaban


( 5:55pm del julio 1, 2008) contenidos relevantes en secciones. Conforme las
necesidades de gestión de la comunidad crecieron,
)PLU]LUPKH ,SLUH ZLYm crearon comités de voluntarios con diversas tareas
un agrado conocerte y como dar la bienvenida a nuevos miembros,
compartir. Saludos desde moderar los foros o generar contenido. Fue así
*OPSL  ,SPaHIL[O !WT como me invitaron a participar como voluntaria en
del julio 1, 2008) el comité de contenidos. Los administradores se
comunican de manera síncrona periódicamente con
)PLU]LUPKHHSHJVT\UPKHK los distintos comités por medio de Skype1, donde
wow, veo que llevas revisamos algunos foros destacados, proponemos
ya algunos años con el actividades, artículos, temas a tratar y asignamos
padecimiento así que de tareas de acuerdo con la disponibilidad de tiempo
seguro sabrás aconsejarme de cada uno. Así mismo nos comunicamos de
muy bien, yo apenas manera asíncrona continuamente por medio de
empiezo y tengo de repente Basecamp2 con los coordinadores, voluntarios de
unos altibajos que para qué otros comités y personal de la Diabetes Hands
te cuento. Un saludo desde Foundation (DHF).
Venezuela”- Diego (6:20pm
del julio 1, 2008) (Manny, La experiencia de trabajo colaborativo en línea
Gladys, Edgar, Diego, & (muy bien coordinado) es realmente enriquecedora
Elizabeth, 2008) ya que la convivencia e intercambio de puntos de
vista y el trabajo interdisciplinario y multicultural
Al poco tiempo empecé a descubrir y explorar que se da en este espacio son realmente únicos.
las opciones que ofrecía el sitio, no me fue difícil Difícilmente se presentan estas oportunidades en
comenzar a participar en los foros de discusión, un ambiente presencial.
después empecé a compartir artículos de revistas
LZWLJPHSPaHKHZ  `  WYLZLU[HJPVULZ TmZ NYmÄJHZ Ahora bien, este trabajo en conjunto conlleva
con información sencilla para responder a temas L]LU[\HSTLU[LH[LULYLUJ\LU[YVZVMÅPULJVTVWVY
recurrentes en la comunidad. Los contenidos ejemplo la participación de Mariana Gomez, líder
del sitio son frecuentemente etiquetados y del comité de contenidos quien reside en Mérida,
referenciados en nuevas discusiones por los Yucatán, y de una servidora en el local de exhibición
mismos miembros. de la Diabetes Hands Foundation durante la 37ª
Conferencia Anual de la Asociación Americana
5.1 GESTIÓN DE LA COMUNIDAD de Educadores en Diabetes que tuvo lugar en
ONLINE DE AYUDA MUTUA San Antonio, Texas, en agosto del presente año.
1 Servicio de llamadas y videollamadas telefónicas via
Internet.
Los fundadores y coordinadores, Manuel Hernández 2 Herramienta de gestión de proyectos en línea.

?=,5*<,5;965(*065(3*65,0** 174
9LKLZZVJPHSLZLUILULÄJPVKLSH
educación para la salud

Durante este evento, tuvimos la oportunidad de más frecuentes que detectamos en los foros de la
conocer en persona a Manuel Hernández (Manny) red social, realicé una presentación con diapositivas
fundador de la DHF tras dos años de trabajar a que subí con ayuda de SlideShare3. Después abrí
distancia. Este tipo de encuentros refuerzan los una cuenta en Ustream.tv4. Mariana me envió, por
lazos de colaboración, e incluso amistad que correo electrónico, un breve instructivo de esta
dieron inicio a través de internet. aplicación para poder crear el video. El evento se
anunció con anticipación en la comunidad y el día
5.2 EL PAPEL DE LOS VIDEOCHATS 25 de marzo a las 5:00 pm, una hora antes de dar
inicio a la transmisión en vivo, me puse en contacto
Como parte de las actividades y eventos que con Manny, via Skype, para realizar unas pruebas.
tienen lugar en el sitio EsTudiabetes.org, se llevan Él se encargó de montar en la página principal
a cabo videochats con diversos temas, desde de la comunidad la pantalla de Ustream para
las celebraciones de aniversario de la comunidad, visualizar la transmisión en vivo, inmediatamente
donde los miembros pueden ver el mensaje del debajo colocó la ventana con la presentación de
fundador en vivo y conversar en tiempo real con diapositivas enlazada desde SlideShare, activó la
él mediante la sala de chat que se abre durante sala de chat y en punto de las 6:00 pm hora de
la sesión; hasta videoconferencias con miembros la Ciudad de México dio inicio la sesión. Manny
destacados que son expertos en algun tema: moderaba la sala de chat y fue recopilando todas
microinfusoras de insulina, actividad física, mitos las preguntas que surgieron durante la ponencia,
de la diabetes… al mismo tiempo nos comunicábamos mediante
Skype (que también cuenta con la opción de chat
Durante una de las reuniones del comité de para transmitir mensajes escritos) para monitorear
contenidos, a principios de este año, se discutió lo que ocurría, ya que exponer y seguir la
sobre la gran cantidad de foros con inquietudes conversación de la sala de chat era imposible.
de mitos de la diabetes y se acordó programar
\U]PKLVJOH[[P[\SHKV¸+LZTP[PÄJHUKVSHKPHIL[LZ¹ Por otro lado, hay muchos aspectos que tomar en
que tuve la oportunidad de impartir. Fue una cuenta durante este tipo de conferencias: indicar
L_WLYPLUJPH NYH[PÄJHU[L ` SSLUH KL HWYLUKPaHQL frecuentemente qué diapositiva debía consultar
tanto en el aspecto personal como profesional, ya la audiencia, ya que cada usuario debía pasar las
que por primera vez conversé en tiempo real con diapositivas para seguir la conferencia mientras
muchos de los miembros de la comunidad con observaban la transmisíón en vivo. Durante el
los que solo había tenido contacto en los foros desarrollo de la sesión llegaban nuevas personas
de discusión o en los mensajes de mi muro, así que necesitaban integrarse rápidamente pues sus
mismo tenía muy poca experiencia en impartir preguntas en la sala de chat distraían mucho a los
conferencias a distancia por lo que la preparación otros participantes quienes además estaban muy
técnica fue todo un reto. 3 Aplicación en línea para compartir presentaciones con
diapositivas.
4 Plataforma que permite transmitir videos en línea y
Diseñé la charla basando mi contenido en las dudas almacenarlos de manera gratuita

?=,5*<,5;965(*065(3*65,0** 175
9LKLZZVJPHSLZLUILULÄJPVKLSH
educación para la salud

emocionados de poder conversar. Asistieron en


promedio 45 personas de diferentes países. 5.3 OTROS PROGRAMAS Y ACTIVIDADES:
TUANALIZE.ORG, HEALTHSEEKER Y
(S ÄUHSPaHY SH L_WVZPJP}U TL KP H SH [HYLH KL SLLY
NO-SUGAR ADDED POETRY
y responder una por una todas las preguntas
que Manny recopiló y me envió por Skype, en
Dentro de los programas de la DHF existen
ese momento tuve oportunidad de interactuar
interesantes proyectos, por mencionar tan solo
más con los asistentes en la sala de chat. Éste
dos que ya se encuentran en una primera fase de
y otros videochats están disponibles para todos
implementación están:
los miembros de la comunidad que no pudieron
asistir, o quienes deseen verlos de nuevo, en la
TuAnalize.org, proyecto desarrollado en
sección de videos del sitio.
colaboración con el Children’s Hospital Boston,
que consiste en capturar y mostrar en un mapa
información acerca de la Hemoglobina glucosilada
HbA1c. Se trata de un análisis que indica el
promedio ponderado de los niveles de glucosa
en sangre en los tres meses más recientes, este
importante parámetro proporciona información
acerca del grado de control de la diabetes. Los
médicos recomiendan que los pacientes realicen
este análisis de 3 a 4 veces por año. Los miembros
de la comunidad, que así lo deseen, ingresan el
resultado de su análisis y su lugar de residencia,
de este modo un mapa interactivo de los Estados
Unidos y Canadá se enciende por estados, en
verde si el promedio de datos de esa región se
encuentra por debajo de 7% de HbA1c (rango
recomendado por la Asociación Americana de
Diabetes1) ; en amarillo si el promedio está entre
7% y 8% ; en rojo si está por arriba de 8%. Estos
datos proporcionan valiosa información para los
investigadores del Children’s Hospital Boston. El
proyecto se extenderá este mismo año al resto del
continente americano comenzando con México.

“ El análisis de estos datos


podría determinar, por ejemplo,
tendencias o una correlación entre
?=,5*<,5;965(*065(3*65,0** la participación de las personas en 176
9LKLZZVJPHSLZLUILULÄJPVKLSH
educación para la salud

redes sociales en línea relacionadas


con la salud y su nivel de control No-Sugar Added Poetry, el primer libro publicado
de la diabetes”- Manny Hernández por la DHF. Surge a partir de un concurso de
(2010) poesía que se llevó a cabo en la comunidad en
inglés TuDiabetes.org. Los poemas ganadores
se incluyeron en esta recopilación donde las
personas de la comunidad expresan de manera
creativa diversas situaciones y emociones ligadas
al hecho de vivir con diabetes. Los miembros de
la comunidad pueden leer todos los poemas en
línea de manera gratuita. El libro se puede adquirir
a través del sitio www.nosugaraddedpoetry.org.

HealthSeekerTM , desarrollado en colaboración


con Joslin Diabetes Center, una dependencia de
la Escuela de Medicina de Harvard, es un juego
en línea que combina un ambiente de red social
con información importante sobre el manejo y
tratamiento de la diabetes. Este juego utiliza la lista
de amigos de Facebook (otra conocida red social)
6. LO QUE PASA EN LAS REDES SOCIALES
de cada jugador como fuentes de inspiración y
COMO FUENTE DE INSPIRACIÓN: CRUCE DE
apoyo en su camino hacia una vida más saludable.
LOS ANDES Y PROYECTO DIABETES ENTRE
En este juego se trabaja con misiones y pasos
PARES.
para la acción que ayudan a los jugadores a
alcanzar metas sobre estilo de vida, ofreciendo así
la oportunidad para avanzar en el juego.
Los encuentros, intercambios y experiencias

?=,5*<,5;965(*065(3*65,0** 177
9LKLZZVJPHSLZLUILULÄJPVKLSH
educación para la salud

vividas en la comunidad EsTuDiabetes.org inspiran profesionales de la salud que la apoyan. Para ello
y motivan a sus miembros a llevar a cabo desde pretendemos generar un espacio de encuentro,
ZPNUPÄJH[P]VZ JHTIPVZ KL OmIP[VZ OHZ[H NYHUKLZ información pero sobre todo, de formación con
hazañas. Tal es el caso de Edgar García, miembro ayuda de las herramientas que nos ofrece internet
de la comunidad quien vive con diabetes tipo 2. A y las redes sociales.
raíz de su diagnóstico en 2006, tomó la decisión
de salir a caminar diariamente en su colonia. tal
como le había sugerido el médico. Las caminatas
se convirtieron en sesiones de trote, poco después
comenzó a correr, se inscribió en varias carreras
cortas hasta que llegó a la meta de su primer
maratón en 2008. Gracias a EsTuDiabetes.org
conoció al líder del grupo de atletas con diabetes
Diabesport quién lo invitó a participar en el Cruce
de los Andes, una carrera en relevos de gran
KPÄJ\S[HKX\LYLJVYYLKPJOHJVYKPSSLYHKLZKL*OPSL
hasta Argentina. El 8 de febrero del 2009, Edgar
se tomó orgulloso estas fotografías tras llegar a la
meta. 7. CONCLUSIONES
Las redes sociales online ofrecen un sinnúmero de
3H PUÄUPKHK KL ZH[PZMHJJPVULZ X\L UVZ OH posiblidades inexploradas a través de las cuales
dejado participar en el comité de contenido de una persona, o una comunidad, puede responder
EsTuDiabetes.org han sido fuente de inspiración a la necesidad de miles.
para mi amiga y colega Mariana Gomez Hoyos y
para mí. Ahora, tras 25 y 16 años, respectivamente, Desde mi vivencia, el trabajo colaborativo
de contínuo aprendizaje en el arte y ciencia de vivir que da frutos es aquel en el que se valoran los
bien con diabetes tipo 1, hemos emprendido un conocimientos y habilidades de cada uno de los
nuevo proyecto: el portal www.diabetesentrepares. miembros de la comunidad y se explotan al máximo
com. Un espacio dedicado a la educación de para perseguir el bien común. En ese sentido, la
diabetes entre quienes tenemos dicha condición, experiencia de trabajo voluntario colaborativo en
incluyendo a familiares, amigos y profesionales la red social EsTuDiabetes.org ha sido única.
de la salud quienes la viven de corazón. Nos
planteamos la misión de motivar a quienes viven Quizá nunca llegue a conocer en persona a tantos
con diabetes a tomar la responsabilidad del cuidado compañeros valiosos con quienes comparto
de su salud por medio de la educación entre pares una situación de vida y la motivación de ayudar
así como concientizar a toda la comunidad acerca a nuestros pares a vivir mejor, pero la falta de
de la importancia de reconocer a la persona comunicación interpersonal no es obstáculo para
que vive con diabetes como líder del equipo de sumar esfuerzos, habilidades, conocimientos
técnicos y aptitudes para perseguir un objetivo.
?=,5*<,5;965(*065(3*65,0** 178
9LKLZZVJPHSLZLUILULÄJPVKLSH
educación para la salud

REFERENCIAS BIBLIOGRÁFICAS
Hay que subrayar que en la red donde no sólo
American Diabetes Association. (2010).
los datos y la información se transmiten, también
Standards of Medical Care in Diabetes.
se comparten el aprendizaje, la motivación y las Diabetes Care, 33 (Sup. 1), S11-S61.
emociones permean. Lo que se vive a través de las
(ZVJPHJP}U *H[HSHUH KL 5L\YVÄIYVTH[VZPZ
redes sociales puede impactar a las comunidades (2005). Los Grupos de Ayuda Mutua o GAM.
y entornos físicos de quienes participan en ellas. Recuperado el 31 de Agosto de 2010, de
O[[W!^^^HJULÄVYNJHZ[LSSHNHTULÄO[T

Es un hecho que resulta prácticamente imposible Basecamp. (2010). Basecamp. Recuperado


el 1 de Septiembre de 2010, de http://
seguirle el paso al desarrollo de las nuevas
basecamphq.com/
tecnologías de la comunicación, pero no estamos
Covey, S. R., & Diabetes, A. A. (2007). Los siete
solos, vivimos en comunidad, únicamente algunos
hábitos de las personas altamente efectivas
canales de comunicación están cambiando. Las con diabetes. Tarrytown, NY: Bayer Health
posibilidades de aplicación son tantas como Care.
nuestra imaginación discurra y la educación para Diabetes Hands Foundation. (2010). Health
la salud es una más de las áreas en las que estas Seeker. Recuperado el 1 de Septiembre de
2010, de http://www.healthseekergame.org/
herramientas están siendo explotadas.
Diabetes Hands Foundation. (2009). Information
Package. Berkeley, California, United States of
America.
Diabetes Hands Foundation. (2010). No-
SugarAdded Poetry. Recuperado el 1
de Septiembre de 2010, de http://www.
nosugaraddedpoetry.org
Federación Internacional de Diabetes. (2009).
Diabetes Atlas. Recuperado el 19 de agosto de
2010, de http://www.diabetesatlas.org/
Hernández, M. (25 de Agosto de 2010).
Estadísticas actualizadas de las comunidades
en línea. (M. E. Sáinz de la Maza Viadero,
Entrevistador)
Hernández, M. (19 de Septiembre de 2009).
Los Valores de EsTuDiabetes. Recuperado el
1 de Septiembre de 2010, de EsTuDiabetes:
http://www.estudiabetes.org/notes/Los_
Valores_de_EsTuDiabetes
Lara Esqueda, A., Aroch Calderón, A., Jiménez,
R. A., Arceo Guzmán, M., & Velázquez Monroy,
Ó. (2004). Grupos de Ayuda Mutua: Estrategia
para el control de diabetes e hipertensión
arterial. Archivos de Cardiología de México , 74
(4), 330-336.
?=,5*<,5;965(*065(3*65,0** 179
9LKLZZVJPHSLZLUILULÄJPVKLSH
educación para la salud

López Aguirre, J. L. (2010). Diseño de


propuesta metodológica para el estudio de las
comunidades convergentes y su impacto en la
persona. XXII Encuentro Nacional AMIC 2010
(pág. 22). México: Asociación Mexicana de
Investigadores de la Comunicación.
Manny, Gladys, Edgar, Diego, & Elizabeth. (1 de
Julio de 2008). EsTuDiabetes.org. Recuperado
el 1 de Septiembre de 2010, de http://www.
LZ[\KPHIL[LZVYNWYVÄSLZJVTTLU[SPZ[&H[[HJO
edToType=User&attachedTo=152y4xhcda95f
&page=13
Sáinz de la Maza Viadero, M. E. (2010).
+LZTP[PÄJHUKV SH KPHIL[LZ WHY[L 
videoconferencia. Recuperado el 1 de
Septiembre de 2010, de EsTuDiabetes:
http://www.estudiabetes.org/forum/topics/
KLZTP[PÄJHUKVSH
Sáinz de la Maza Viadero, M. E. , Gómez
Hoyos, Mariana (2010). Nuestra Experiencia.
Recuperado el 6 de Septiembre de 2010,
de Diabetesentrepares: http://www.
diabetesentrepares.com/NuestraExperiencia.
aspx?who=Mariana&tit=Nuestra%20
Experiencia
Skype. (2003). Skype . Recuperado el 1 de
Septiembre de 2010, de http://www.skype.
com/intl/es/home/
SlideShare Inc. (2010). SlideShare. Recuperado
el 1 de Septiembre de 2010, de http://www.
slideshare.net/
Ustream, Inc. (2010). Ustream. Recuperado
el 1 de Septiembre de 2010, de http://www.
ustream.tv/

?=,5*<,5;965(*065(3*65,0** 180
TIC’s, implicaciones en
el ámbito electoral
Luis Alfonso Guadarrama Rico
Jannet Valero Vilchis
UNIVERSIDAD AUTÓNOMA DEL ESTADO DE MÉXICO

Saber de política es importante aunque a muchos no les importe, por-


que la política condiciona toda nuestra vida y nuestra convivencia.

Giovanni Sartori, Homo Videns

  
1. Introducción asistiremos al acrecentamiento de este tipo de
formas de comunicación e interacción mediática,
La aplicación de las Tecnologías de la Información para tratar de llegar a segmentos de electores con
y la Comunicación (TIC) se ha desplegado hacia \U WLYÄS LZWLJxÄJV ` JVUZPKLYHTVZ X\L [HTIPtU
distintos campos de la vida económica, educativa, para generar formas distintas de concebir y
social y cultural. Cada día que los usuarios se asoman desarrollar las campañas electorales y su relación
en la red de redes para consultar información, con la sociedad.
se pueden apreciar diversas dinámicas y, cada
día, emergen nuevas herramientas desarrolladas A través de las TIC, al tiempo que se individualiza el
desde el Internet convencional así como a través consumo, se abren posibilidades para la creación
de Internet 2.0, para hacer llegar información a de redes sociales virtuales, que pueden prosperar
distintos segmentos de la población que logran y desmoronarse en el tiempo. En la materia que
contar con acceso a la Web desde un sinnúmero aquí nos ocupa, ahora se pueden generar mítines
de puntos del orbe. en las plazas públicas, a partir de la capacidad de
convocatoria que los ciudadanos pueden detonar a
Por lo que toca a su uso en el ámbito de las través de avisos e invitaciones desde los teléfonos
campañas electorales, se trata de un fenómeno celulares (Lucas, 2007).
relativamente reciente pero creemos que en el
próximo lustro –desde el quehacer de los partidos Nuestro interés se cifró en averiguar si el hecho de
políticos y el de los candidatos y candidatas a emplear los recursos y herramientas que ofrecen
puestos de elección popular en nuestro país- SHZ ;0* UVZ WLYTP[L PKLU[PÄJHY \UH T\[HJP}U
TIC’s, implicaciones en el ámbito electoral

gradual pero creciente en torno las formas de En este como en otros campos, el uso de
participación, tanto de la ciudadanía como de algunas expresiones técnicas –y si hablamos de
los partidos políticos y de sus representantes o tecnologías, con mayor razón—los lectores deben
candidatos. Además, si derivado de ello, estamos permitirnos el uso de ciertas expresiones técnicas,
HYYPIHUKVH\UHJPILYKLTVJYHJPHX\LZLLKPÄJH` aunque muy frecuentemente los puristas soliciten
mezcla con formas tradicionales de participación, que los autores acampados en este ámbito de la
tanto en el electorado como entre los actores vida social debamos hacer esfuerzos por hallar o
políticos1. proponer la traducción de ciertas expresiones o
plataformas al idioma castellano.
2. Tecnologías de Información y
Comunicación, aproximación conceptual 2.1. Dispositivos tecnológicos

4PJOLS6UMYH`\UÄS}ZVMVMYHUJtZJVU[LTWVYmULV La mayoría de las personas, cuando aluden al tema


publicó un importante trabajo acerca de un grupo de las TIC, tendrán imágenes relacionadas con un
KLÄS}ZVMVZKLSZPNSV0=WYL]PVZHSHLYHJYPZ[PHUH racimo de equipos, de artefactos tecnológicos
entre los que, a nuestro entender, destacaron como los videojuegos, la computadora personal,
Antístenes y Diógenes Laercio. En dicho libro, determinado sitio de internet, televisores de
6UMYH`¶OHISHUKVKLSVZÄS}ZVMVZKLZ\PU[LYtZ· HS[H KLÄUPJP}U HJJLZV H ZL|HSLZ KL [LSL]PZP}U
apunta lo siguiente: YLZ[YPUNPKH JmTHYHZ MV[VNYmÄJHZ KPNP[HSLZ
videocámaras manuales ultraligeras, teléfonos
Ciertamente, hace falta contar con un celulares o móviles, prensa en línea, equipos
lenguaje que, en determinadas ocasiones,
miniatura para almacenamiento y reproducción de
necesita recurrir a las palabras técnicas. Sólo
alguien que nunca hubiera frecuentado el música y, seguramente un conjunto de herramientas
taller de un zapatero o de un herrero puede y de sitios a los que se puede acceder a través del
PTHNPUHY X\L LZ WYP]H[P]V KL SVZ ÄS}ZVMVZ internet convencional y mediante internet 2.02. Sin
[también de los comunicólogos] usar un
embargo, pretender ceñir el concepto de las TIC a
vocabulario especializado. Reducido al
mínimo útil para decir cosas precisas, un conjunto de artefactos sería un equívoco, por
ese vocabulario debe emplearse en dosis más que a la mayoría de las personas les pudiese
homeopáticas (Onfray, 2002:110). resultar una clara referencia acerca de lo que
pretendemos aclarar. Como deseamos ofrecer
Este planteamiento nos conecta de manera un avance de este orden (conceptual), enseguida
directa al tema de las TIC y de sus aplicaciones. tratamos de poner en claro qué entendemos por
1 Este trabajo forma parte de los esfuerzos que se realizan
las TIC. Veamos.
en el Cuerpo Académico: Estudios interdisciplinarios sobre plane-
ación, desarrollo y calidad de vida, registrado en la Universidad 2 Fue Tim O’Reilly quien acuñó el término web 2.0, para
Autónoma del Estado de México (UAEM) y ante la Secretaría de referirse a la forma en que el Internet se había transformado en una
Educación Pública (SEP). Asimismo, constituye parte de las re- plataforma de alta interacción para los usuarios que, además, con-
ÅL_PVULZX\LLTHUHUKLSWYV`LJ[VKLPU]LZ[PNHJP}U!<ZVKL[LJ- taban con un mejor ancho de banda para contar con servicio que
nologías de Información y Comunicación en jóvenes escolarizados, requiere mayor y mejor velocidad para transmisión de archivos de
TPZTVX\LYLJPILÄUHUJPHJP}UKLSH:LJYL[HYxHKL0U]LZ[PNHJP}U` datos, voz, texto y video.
Estudios Avanzados de la UAEM.

?=,5*<,5;965(*065(3*65,0** 182
TIC’s, implicaciones en el ámbito electoral

La particularidad de esos dispositivos tecnológicos 2.2. Información digitalizada


es que ponen en funcionamiento capacidades,
conocimientos, intereses y las habilidades de Antes de entrar en materia, en torno a las
quienes están conectados, sea en calidad repercusiones que tienen en el campo político
únicamente de usuarios o, como lo señala electoral, queremos abordar algunas características
Fernando Ureña, en condición de prosumidores, básicas que están –digámoslo así—detrás de la
es decir, “en productores de información que ellos operación de TIC. En primer término, habría que
mismos [y otros] consumen” (Ureña, 2007:42). tener presente que aquello que circula a través
de internet, de muchos dispositivos tecnológicos
Es cierto que los dispositivos tecnológicos de (teléfonos móviles, videocámaras, prensa en línea,
los que hablamos cuentan con una amplia etc.) y de un sinnúmero de plataformas interactivas
diversidad de funciones y de capacidades de (Hi5, You Tube, Facebook, entre otras) es que se
almacenamiento e interacciones dinámicas para trata de información digitalizada. Así, lo digital se
brindar mayor comodidad y manejo de información torna en información traducida al lenguaje binario
al usuario. Pero no es menos relevante el hecho (1 ó 0). En consecuencia, datos, voz e imágenes,
de que generalmente los usuarios subutilizamos mediante complejos procesos de programación
dichas funciones, acaso por no corresponder de muchísimas empresas y personas, con los
realmente con nuestros requerimientos personales consecuentes conocimientos de matemáticas,
ni condiciones actuales o futuras. Así que ese son convertidos en ceros y unos para su manejo,
dispositivo tecnológico, la mayoría de las ocasiones, operación, articulación, propagación e interacción,
simplemente queda por encima de nuestras mediante el uso de las Tecnologías de Información
capacidades, aunque los usuarios paguemos el y Comunicación (TIC).
costo de la novedad y tiramos a la basura aquellos
dispositivos que percibimos como obsoletos.
2.3. Mega-velocidad en la información

Sin embargo, cuando nosotros referimos a las


Dicha transmutación de la información hace posible
TIC nos orientamos más por el planteamiento
que pueda viajar no sólo de manera fácil de un
que ha formulado Albert Borgmann, en el sentido
sitio electrónico a otro, sino que lo puede hacer
de concebir a esos dispositivos tecnológicos
a gran velocidad. Debido a esa celeridad con la
que están incluidos en las llamadas TIC, como
que transmite y difunde la mega-información que
“una conjunción de maquinaria y comodidad”
corre por diversas venas y arterias de las TIC, le
(Borgmann, 2000: 296). Pero dicha comodidad,
PTWYPTL\UHJVUKPJP}UKLHS[VILULÄJPVWHYH\UVZ
genera un conjunto de procesos sociales que
y de alta vulnerabilidad para otros. Los conectados
se desencadenan como resultado de lo que
a las TIC tendrán mayores probabilidades de saber
hacen las personas a la hora de usar o consumir
primero, de ser informados. Los que forman parte
determinados dispositivos tecnológicos, así como
del ancho mundo de los sin acceso a las TIC,
las tareas o problemas que tratan de atender o
los que involuntariamente nutren la brecha digital
resolver a través del uso de las TIC.

?=,5*<,5;965(*065(3*65,0** 183
TIC’s, implicaciones en el ámbito electoral

en cada región, país, municipio y localidad, se que circula a través de las TIC y que se ayudan
enterarán después, tarde o nunca. para nutrir su quehacer informativo cotidiano. A
su vez, lo que sucede o se genera en y para los
También, debido a esa altísima velocidad de medios de comunicación impresos y electrónicos
transmisión con la que viaja y se difunde video- convencionales, es enviado a sitios web de distinta
PUMVYTHJP}U ZL W\LKLU NLULYHY ILULÄJPVZ naturaleza, nomenclatura y cobertura, a efecto de
inesperados y/o daños difíciles de indemnizar. que otros y/o ellos mismos lo pongan a circular
Diríamos que hacer clic para buscar o hacer circular a través de los anchos circuitos tecnológicos del
determinada información en el torrente vertiginoso ciberespacio y de las llamadas redes sociales.
de la red convencional y del internet 2.0, puede
generar repercusiones a escala global, social, Consecuentemente, las TIC contribuyen a
política, económica, cultural, familiar e individual. generar, al menos, dos vías profundamente
Se trata --como le gusta llamarlo a Todd Gitlin-- interconectadas. La primera, está constituida
de “un torrente mediático […] corriendo de nodo a por interacciones, usos, comunidades virtuales y
nodo […] en una ciudad extraña, en una habitación --luego-- sociales, que se generan desde y para
de hotel, en la carretera, nunca estamos fuera. O los conectados a la sociedad del conocimiento,
quizá es el aquí el que está fuera. Por extraño que en la era digital. En la otra pista, la producción
resulte, el torrente se convierte en nuestro hogar de los medios de comunicación convencionales
(Gitlin, 2005: 133). (radio, prensa, televisión abierta, cine y, desde
luego, los sucesos sociales, políticos, económicos
2.4. Coexistencia entre las TIC y otros y culturales de resonancia mediática), aparte
de producir y difundir lo suyo no sólo hacia sus
medios de comunicación
audiencias originales sino también para los usuarios
potencialmente conectados, retoman ese gran
Frente a otros medios de comunicación impresos
torrente de información omnipresente y generado
(prensa, revistas), electrónicos (radio, televisión)
por las TIC, para revivir --mediante la repetición o
` HS[LYUVZ JHY[LSLZ V HÄJOLZ \ZV KL IHYKHZ
el tratamiento diferenciado-- voces, datos y toda la
perifoneos, anuncios espectaculares, etc.) las
producción de la industria del entretenimiento, con
TIC parecen complementarias, en tanto circulan
el objetivo primordial de ganar audiencias, ventas
y gravitan en otra vertiente del campo mediático
y, si es posible, credibilidad.
para tratar de llegar a otros segmentos de la
audiencia o, en este caso, del electorado.
2.5. Interacción virtual o nuestra vida en
las pantallas
Es cierto que desde una óptica, el mundo
podría quedar dividido en dos grandes gajos: los
Podemos agregar que debido a las condiciones de
conectados, que son los menos en el mundo,
producción, circulación, consumo, actualización,
y «los desconectados» a las TIC. Pero no es
usos, apropiación, recreación, retención, olvido y
menos cierto que los medios de comunicación
a la multiplicidad de intereses de toda de índole,
convencionales aprovechan la información
?=,5*<,5;965(*065(3*65,0** 184
TIC’s, implicaciones en el ámbito electoral

tanto las TIC como la información que viaja a en la red. De allí que, como lo advierte el mismo
través de éstas, tienen como característica que Quéau, «Las imágenes virtuales no son simples
están inmersas en un mundo informático que ilusiones virtuales, imaginerías de representación
se mueve constantemente entre el orden y el pura. Al contrario, es posible visitar, explorar e
caos; matriculado en estructuras organizadas y incluso palpar […] estas realidades virtuales»
JSHYHTLU[L PKLU[PÄJHKHZ X\L ]P]LU ` JPYJ\SHU LU (Quéau, 1995: 17).
la red de redes y que viajan hacia otros medios
de comunicación, pero también inscrito en un 3VX\LHU\LZ[YVLU[LUKLYKLÄULHSHZ;0*ZVULZVZ
esquema –por así decirlo-- de participación nuevos procesos que se desencadenan como
anárquica que busca y consigue su propio espacio resultante de la interacción virtual y de la relación
a través de las TIC. mediático-social que se fragua entre personas,
grupos, instituciones y comunidades, a partir del
Es decir, a través de estos dispositivos tecnológicos uso de un conjunto de artefactos tecnológicos que
ZLVYX\LZ[HSHLKPÄJHJP}UYLJYLHJP}U`KLZHYYVSSV presentan un torrente informativo-digital; mismo
de un mundo virtual. Este tipo de dispositivos que ahora forma parte de la vida cotidiana de,
tecnológicos permiten y proponen que las personas todavía, una selecta capa social de usuarios.
establezcamos otra manera de experimentar la
realidad. Virtual, deviene del latín virtus, es decir, 2.6. Redes sociales virtuales
fuerza, energía, impulso inicial. En tal sentido,
cuando hablamos de virtualidad –sostiene Philippe Prácticamente desde la década de los ochenta
8\tH\ZPNUPÄJHX\L¸SHJH\ZHLZ[m]PY[\HSTLU[L (referida al pasado siglo XX) para muchos infantes
presente en el efecto, [pero] el efecto también está y adolescentes que hoy fortalecen el grupo de los
virtualmente presente en la causa” (Quéau,1995: ciudadanos urbanos, el juego, la actividad lúdica,
27). comenzó a emerger de un monitor de televisión
y un dispositivo para videojugar, más un aparato
Para ilustrarlo con el tema que aquí nos ocupa, para hacer posible la interacción entre el homo
diríamos que, tenemos como causa a un ludens –como diría Johan Huizinga (1972)-- y
candidato de carne y hueso que contiende por el programa o videojuego (Valero, 2002). Dicha
una demarcación municipal o autonómica. Dicha actividad interactiva, virtualmente exhibida y
persona, abre un sitio en internet para colocar su representada digitalmente frente a su mirada,
fotografía, mensajes en video, semblanza sobre ZPNUPÄJ}Q\NHY(|VZTmZ[HYKLJVUVJLYWLYZVUHZ
sí mismo, una parte de su oferta político-electoral de otras localidades y de distintos países, para
y formas de intercomunicación diversas que, en –enseguida o poco más tarde-- considerarlos
el mundo de lo virtual, crean precisamente ese HTPNVZ JVUVJPKVZ V PUJS\ZV WHYH LKPÄJHY \UH
efecto, su página en internet. A su vez, lo que se relación amorosa, se consideró otra manera de
coloca en la página web es la resultante de una ensanchar las relaciones interpersonales.
causa que se mueve en el mundo de lo real, del día En forma notoria, a partir de la emergencia y
a día que se experimenta y que se decide colocar propagación de plataformas o herramientas
?=,5*<,5;965(*065(3*65,0** 185
TIC’s, implicaciones en el ámbito electoral

digitales que operan en la red de redes, algunos internet así como a través de las plataformas que
conductores que laboran en los medios de diariamente se desarrollan son, a nuestra entender,
comunicación electrónica, comenzaron a decir redes sociales virtuales. Pero dicha virtualidad
que este tipo de relaciones e interacciones eran: conlleva todo lo que hemos apuntado en los
redes sociales. Es posible que la expresión haya acápites previos: información digitalizada (datos,
decantado del término computacional red (nodos voz, imagen, movimientos, video); que corre a en la
y terminales electrónicas) y, simplemente, por YLKKLYLKLZHNYHU]LSVJPKHK"Z\YJHUKVSHZÄIYHZ
tratarse de un grupo de personas interconectadas ópticas y las señales telemáticas entre el orden
a través de las TIC, pero procedentes del tejido y el caos; se trata de información despuntada
social, se les ocurrió que debían tratarse de «redes desde las TIC y sus dispositivos tecnológicos; de
sociales». Sin embargo, es de muchos sabido que un caudal informativo interconectado con otros
stricto sensu, redes sociales han existido desde medios electrónicos convencionales e incluso
que hace varios siglos, sin que para ello existiesen con medios alternos y, con una multiplicidad de
herramientas como el correo electrónico, Twitter, centros y megacentros que tratan de dar cuenta
Hi5, Facebook, You Tube, Myspace, Blogs y otras de lo que hacen los consumidores conectados
plataformas que seguirán naciendo en los meses y y los prosumidores que habitan y crecen
años por venir. aceleradamente en el ciberespacio.

Michel Brito, nos recuerda que a partir de la web 2.0, Los impactos de distinta índole (inocuos, positivos
al conglomerado de redes y tecnologías creadas o negativos) son generados después hacer clic
con esta versión del internet, se les denominó: para colocar la información en el ciberespacio
Social Media. Las características que propone el H ÄU KL OHJLYSH JPYJ\SHY H [YH]tZ KL SHZ ;0*
autor para distinguir a las redes sociales detonadas Como nos ha llevado a pensar con claridad el
por estas plataformas tecnológicas, de otras más investigador canadiense Reg Whitaker: vivimos
convencionales, es que disponen de amplias vías en una sociedad que es vigilada y que vigila,
para la participación, la conversación, la formación como una suerte de Panóptico de Bentham
del sentido de comunidad y que, ello se debe a omnipresente y virtual que es capaz de invadir
la amplia facilidad con la que se pueden crear nuestra privacidad e intimidad, a fuerza de una
nuevas redes, al tiempo que es posible conocer amplia red videotecnológica y telecomunicacional
los criterios para lograr la incorporación o rechazo remota. Dicha cibersociedad puede concentrar y
de nuevos integrantes (Brito, 2007). hacer circular a voluntad información circunscrita
a personas, organizaciones, grupos, instituciones,
Desde dicha óptica, por las características gobiernos y regiones, en nombre de la era de la
particulares que hemos abordado anteriormente, sociedad del conocimiento y del libre acceso a la
aquí optamos por usar la expresión: redes sociales información. La posición de Whitaker al respecto,
virtuales. Hemos preferido, cuando menos con una es la siguiente: “Las nuevas tecnologías de la
categoría aditiva, distinguir a unas redes sociales de PUMVYTHJP}UZVU\UHYTHKLKVISLÄSV!H\TLU[HU
otras. Las que se tejen mediante el acceso y uso de nuestras capacidades y nuestro poder, pero

?=,5*<,5;965(*065(3*65,0** 186
TIC’s, implicaciones en el ámbito electoral

también hacen a sus usuarios más vulnerables a la de prosuarios. Dichas plataformas presentan una
vigilancia y a la manipulación” (Whitaker, 1999:128). serie de características que no deben ser pasadas
WVYHS[VLZWLJPHSTLU[LJ\HUKVZL\ZHUJVUÄULZ
Debido a este conjunto de características que están de apoyo a las campañas electorales. Enseguida,
presentando las TIC y al manejo que se les está por razones de espacio, una apretada revisión de
dando en la vida político-electoral, nos parece que las principales.
se han abierto diversos senderos que comienzan
a dejar clara la urgencia de regular, para los 2.7.1. Sitios o páginas en internet
procesos electorales, el uso, manejo y aplicación
de estas herramientas digitales que forman parte Jeremy Rifkin nos recuerda que Internet fue creado
constitutiva de la red (Guadarrama y Valero, 2010). WVYLS7LU[mNVUV,,<<OHJPHÄUHSLZKLSVZH|VZ
Se trata de mega-información a gran velocidad; sesenta. Y que si bien el primer host fue puesto en
de prosumidores que ponen en operación sus operación hacia el año 1969, en apenas un poco
capacidades, conocimientos y habilidades para el más de una década los host conectados alcanzaban
uso, manejo, apropiación y difusión de infografía; la nada despreciable cifra de 60,000. Para calibrar
de la convivencia de las TIC con otros medios el impacto de Internet, a decir del mismo autor,
de comunicación convencionales y, desde luego, OHJPHÄUHSLZKLSZPNSV??LS4PUPZ[LYPVKL*VTLYJPV
hablamos de la experimentación de mundos y de los Estados Unidos de Norteamérica, calculaba
redes sociales virtuales que, gradualmente y de que poco más de 200 millones de personas en
manera irreversible, tendrán su peso en las justas todo el mundo estaban conectadas a Internet y se
electorales. estimaba que para el año 2005 más de mil millones
de individuos tendrían acceso a la red (Rifkin,
2.7 Plataformas de y para las TIC 2002). A pesar de estas grandes cifras, el acceso
a internet en el mundo ha excluido a la mayoría de
Cuando las personas hablan de las TIC, como SHWVISHJP}U@LZHZx3VZJmSJ\SVZVÄJPHSLZLULS
lo hemos dicho líneas arriba, aluden a los ámbito internacional reportan que apenas la cuarta
dispositives tecnológicos, aunque también suelen parte de la población mundial (25.6) tiene acceso
referir un conjunto de plataformes o herramientas a la red de redes. México no es la excepción
desarrolladas sobre la base de la preexistència pues bordeaba, en septiembre de 2009, los 26.7
del internet y las computadoras personales. Pero millones de usuarios de internet, es decir, 24.8%
lo que ha quedado claro es que sobre dichos del total de la población mexicana (Internet World
cimientos descansan y se desarrollan –mediante Stats, 2009).
avanzados leguajes de programación y uso de
las nanociencias-- un amplio racimo de interfases Quizá debido a estas cifras, en términos de acceso
orientadas a usuarios con poca o casi nula real y porque los temas electorales o las campañas
formación en las ciències computacionales. De para cargos públicos no viven su mejor época
LSSV UVZ OLTVZ ILULÄJPHKV \UH NYHU JHU[PKHK entre la ciudadanía ni en las aguas vertiginosas de
las internautas, una gran cantidad de candidatos y

?=,5*<,5;965(*065(3*65,0** 187
TIC’s, implicaciones en el ámbito electoral

candidatas se han mostrado reacios a emplear más WVSx[PJH" I\ZJHY M\LU[LZ HS[LYUHZ KL ÄUHUJPHJP}U
intensivamente sitios en internet para promocionar ` KLZKL S\LNV WHYH LKPÄJHY ` KLZHYYVSSHY YLKLZ
sus propuestas. sociales virtuales, capaces de incentivar la activa
participación a favor del candidato o candidata
Sin embargo, entre aquellos candidatos a cargos en cuestión. Desde esta óptica, como lo advierte
públicos que se han animado a emplear esta TIC, Delia Crovi, es indispensable comprender que:
han abierto la posibilidad para tratar de llegar
a la población en general y a la ciudadanía en
La aparición de Internet en el panorama
particular. Los propósitos y aplicaciones, hasta
complejo de las campañas políticas, permite
ahora, han sido disímbolos en cada país, cultura también la posibilidad de una comunicación
y justa electoral. Aunque se trata de una opción horizontal, tanto por el intercambio de
todavía limitada en su uso y aprovechamiento, es roles entre emisor y receptor, como por
la emergencia de fuentes alternativas,
importante resaltar que:
generalmente provenientes de la sociedad
civil (Crovi, 2004: 123).
Internet puede contribuir, asimismo, a una
necesaria diferenciación entre la información
que proporciona un candidato, del candidato Sin embargo, en cada momento, país, entidad
como fuente de información. Esta precisión y municipio, debido a la gran velocidad que
es fundamental, porque podría constituir
caracteriza al internet y el desarrollo de herramientas
un primer paso para enseñar a audiencias
y usuarios a distinguir entre el manejo de de aplicación para usos diversos, los partidos
imagen que se realiza del político […] de la políticos, sus candidatos y los equipos de trabajo,
información que proporciona un candidato se ven inmersos en condiciones particulares que
(Crovi, 2004: 125).
les impelen a usar determinadas ventajas que
ofrece tanto internet como esas herramientas con
Las herramientas con que se cuentan en cada
las que, al menos potencialmente, se cuentan para
TVTLU[VW\LKLUH`\KHYKLTHULYHZPNUPÄJH[P]H
su aprovechamiento, uso y aplicación.
a llegar a segmentos de la población que
THU[PLULU \U WLYÄS JSHYHTLU[L KPMLYLUJPHKV KLS Como veremos más adeltante, los usos que se han
resto de los votantes, pues regularmente se trata desarrollado en materia de campañas electorales,
de ciudadanos ubicados en mejores estratos a través del internet, han presentado diversos
socioeconómicos, con mayor información y, quizá, enfoques y formas de aplicación. Hay partidos
con esquemas de participación más proactivos y candidatos que básicamente han colocado la
hacia la actividad político-electoral. misma información que difunden en otros medios
de comunicación convencionales, mientras
Por lo reportado en varios paises, el uso de que otras experiencias dan cuenta de una visión
PU[LYUL[ JVU ÄULZ KL WYVZLSP[PZTV LSLJ[VYHS ZL OH más interactiva, dinámica y en pleno uso de las
enfocado a buscar alternativas para abrir otros ventajas que se pueden obtener al aprovechar las
canales de comunicación con la ciudadanía, a plataformas que están a la mano desde el internet
efecto de recibir propuestas para mejorar la oferta 1.0 e internet 2.0. Particularmente véanse –en esta

?=,5*<,5;965(*065(3*65,0** 188
TIC’s, implicaciones en el ámbito electoral

ponencia-- las experiencias reportadas en distintas Bell, al menos en sus orígenes4, tuvo la intención
campañas electorales vívidas en los últimos años de ayudar a los sordos, pues tanto la madre como
en los Estados Unidos de Norteamérica. la esposa del propio Graham Bell padecían de esta
limitación o discapacidad sonora (Sacks, 2003).
2.7.2. Telefonía móvil Desde luego, de aquellos comienzos e intenciones
primigenias, poco queda. Pero ahora demos un
Hoy, el teléfono móvil es una TIC acentuadamente vistazo a sus orígenes y veloz posicionamiento
miniaturizada, altamente versátil para la como una de las TIC más emblemáticas.
intercomunicación interpersonal, con un generoso
abanico de multifunciones, gracias a billones de Corría el año de 1983 cuando la empresa Motorola
transistores colocados en microchips. Quizá la dio a conocer su primer prototipo de teléfono
mayoría de los usuarios han advertido que se trata celular, aunque la misma compañía había realizado
de una computadora verdaderamente manual, de un ensayo precedente con un dispositivo que
bolsillo. Este dispositivo tecnológico está sometido presentaron una década anterior. Consideramos
a una voraz obsolescencia e innovación; capaz de el año 1983 como el inicio de la telefonía celular,
enviar y recibir llamadas; intercambiar mensajes porque desde entonces inició la comercialización
de texto, almacenar música, video, fotografías a gran escala5. Años más tarde, gracias a los
digitales; establecer conexión a internet (con todas históricos y robustos esfuerzos del matemático
las bondades y riesgos que ello implica), más una Thomas Kailath, en el Massachusetts Institute of
serie de funciones que amplían la disponibilidad Technology (MIT), quien lograría romper la barrera
de recursos y tareas que puede realizar el usuario, de los 100 nanómetros, fue posible que la telefonía
en función de sus necesidades, conocimientos y celular fuese el dispositivo que hoy conoce un
habilidades. Se trata, nos parece, de una tecnología amplio porcentaje de personas del mundo urbano.
paradigmática de nuestra sociedad posmoderna.
Poco más de una década después de la aparición
Esencialmente, nuestra idea es que el dispositivo de los primeros celulares, logramos apreciar que,
tecnológico al que aludimos mediante la expresión gracias a la capacidad que brindan los satélites,
teléfono celular o teléfono móvil, ya no cabe en la telemática, la computación, el desarrollo
dichas expresiones sino que debemos proponer matemático y las nanotecnologías, en México,
un término que dé cuenta de todo aquello que 4 Nos referimos al año 1863, un 14 de febrero, fecha en
que el escocés Alexander Graham Bell solicitaba una patente para
potencialmente somos capaces de realizar con registrar su original invento, un teléfono electromagnético. No debe-
mos pasar por alto que Thomas Alva Edison desarrolló el fonógrafo
este revolucionario y paradigmático artefacto3. porque creía que el teléfono de Graham Bell era poco práctico,
Hemos de recordar, junto con el neurólogo clínico pues se trataba de un dispositivo tecnológico que podia llegar a
unos cuantos usarios, debido a su alto costo. A la distancia de
londinense Oliver Sacks, que el teléfono de Graham poco de 130 años ¿qué le diríamos hoy a inventor de la bombilla
eléctrica? Para mayores referencias e implicaciones en el campo de
la comunicación, revisar los trabajos de: De Sola Pool (1992) y el
 ,U\U[YHIHQVTmZHTWSPVNSVZHTVZHSN\UHZYLÅL_PVULZ texto de De Botton (2004).
al respecto y proponemos que –al menos en principio-- debería ser
denominado (MICOM) micro-computadora manual (Guadarrama y 5 Realmente en el año 1984 daría inicio la comercialización
Valero, 2010b). del primer teléfono celular. Un dispositivo que pesaba poco más de
   
tres cuartos de kilo.

?=,5*<,5;965(*065(3*65,0** 189
TIC’s, implicaciones en el ámbito electoral

como en otros países, a partir de la segunda mitad Puestos en este escenario, caben al menos las
de la década de los 90, se generó claramente siguientes interrogantes básicas: ¿Cómo se hacen
la propagación de la telefonía móvil o, como de bases de datos de usuarios que pagan, con
usualmente se conoce «telefonía celular». Hacia su dinero, el servicio telefónico? ¿Qué costo
el año 1996, cuando en nuestro país comenzó a económico o en especie le representa al candidato
tener relieve este tipo de servicio de comunicación en cuestión, el uso y aprovechamiento de esas
a distancia, apenas había un poco más de un IHZLZKLKH[VZJVUÄULZLSLJ[VYHSLZ&¦*\mU[V`
millón de dispositivos tecnológicos. El punto de a quién o a quiénes les cuesta el envio de cada
PUÅL_P}UX\LKHYxHJ\LU[HKLZ\HTWSPHL_WHUZP}U mensaje que «de manera gratuita e invasiva» llega
en el territorio nacional, fue el año 2000, pues a cada cellular, sin pedirlo?
pasó de casi ocho millones de teléfonos celulares
registrados en 1999, a poco más de 14 millones Desde luego, no tenemos interés en viajar por el tren
unidades en el año que marcaría el amanecer del de la especulación y por ello no ofrecemos ninguna
siglo XXI. De allí en adelante, el crecimiento sería respuesta. Pero el punto que por ahora nos ocupa
considerablemente sostenido, al superar las cifra es el siguiente: si los partidos y candidatos, para
de los 83 millones de usuarios en el año 2009. Es su labor, usan recursos públicos que aportamos
decir, en prácticamente una década este dispositivo los ciudadanos, a través de nuestros impuestos,
de comunicación móvil cubrió casi al 80 por ciento al menos tenemos derecho –nos parece—a saber
de la población en México (COFETEL, 2010). cuándo dinero destinan o se les autoriza para
hacer proselitismo, a través del uso de TIC como el
El despunte de la telefonía celular ha permitido teléfono celular que contrata y paga el ciudadano.
que empresas de toda índole y partidos políticos
comiencen a explorar las enormes «ventajas» que Si hasta hace muy poco la cifra conservadora
brinda el hecho de que un amplio segmento de la superaba ligeramente los 80 millones de usuarios
población disponga de este dispositivo tecnológico de telefonia celular, entonces los partidos y
de intercomunicación que, sin más ni más, puede candidatos, están en condiciones, como ya lo han
ser «invadido» desde la voluntad e interés del demostrado en los hechos, de enviar mensajes a
otro para hacerle llegar información y propuestas un amplio segmento de la ciudadanía y de invadir
de contenido variopinto. Así, a pesar de que un dispositivo tecnológico, en principio, de uso
enmedio de diverses justas electorales muchos privado. Consideramos que el uso de la telefonía
candidatos y candidatas muestran resistencia celular ha comenzado a dar clara cuenta de amplias
para emplear abiertamente las TIC, muchos y profundas transformaciones en prácticamente
V[YVZ OHU ÄUNPKV TPYHY OHJPH V[YV SHKV TPLU[YHZ todos los órdenes de la vida social, económica,
les ofrecen (y autorizan) –usando las respectives educativa, cultural y, desde luego, política.
bases de datos—enviar mensajes «gratuitamente» Podemos vislumbrar, con este ejemplo, que el
a radiolocalizadores y teléfonos celulares, para aprovechamiento, uso y consumo de las TIC, en
invitar a los possedores de estos equipos móviles, la atmósfera de las campañas electorales, podría
que voten por el candidato o la fórmula política estar apuntando hacia lo que Diane Michelfelder
respectiva.
?=,5*<,5;965(*065(3*65,0** 190
TIC’s, implicaciones en el ámbito electoral

señaló: que si bien «la tecnología ofrece crear más varios amigos de su red social; intentar realizar
oportunidades y ampliar tanto la libertad como un negocios; crear blogs, así como invitar a otros
cierto sentido de realización personal, debemos amigos a participar, mediante un subsistema de
preguntarnos qué ganamos y qué perdemos en invitación en línea.
autonomía, participación, privacidad y libertad
social (Michelfelder, 2000), como resultado de Aunque inicialmente los principales usuarios
contar con la comodidad de acceder a información pertenecían al grupo de adolescentes, Myspace
digital en línea y a la intercomunicación. Michel pronto logró atraer a otros segmentos colocados
Power, con unas cuantas palabras pone el dedo en distintos rangos de edad. El crecimiento, la
en la llaga, cuando apunta: «Las tecnologías demanda y el crecimiento exponencial mostrado
tienden a darle el poder a unos y a quitárselo a en Myspace hicieron que en el año 2005, sus
otros» (Power, 2000: 273). Y este es el aspecto, en creadores originales lo vendieran a News Corp.,
nuestra opinión, es el que debemos revisar desde propiedad de uno de los magnates de mayor peso
el campo de la comunicación y la política o, más en el mundo de los medios de comunicación:
LZWLJxÄJHTLU[LKLZKLSHJHTWH|HZLSLJ[VYHSLZ Rupert Murdoch.

2.7.3. MySpace En el tema que nos ocupa, detengámonos un


momento. Este tipo de plataformas que están
El surgimiento de herramientas videotecnológicas colgadas en internet –y otras que continúan y
interactivas, procedentes del campo de las seguirán perfeccionándose— ponen casi en estado
TIC, como en otros ámbitos de la vida, tienen de shock a los partidos políticos, a los candidatos/
trayectorias que las enlazan con otros proyectos as a cargos públicos y a las «autoridades
que les han precedido y que pronto dejan de ciudadanas» que tratan de regular las campañas
operar. Este fue el caso de Myspace. En el año electorales.
2003, Thomas Anderson, junto con Christopher
DeWolfe, habían observado cómo desde el año Visto que la mayoría de ellos gustan del control
2002, había despuntado un sitio especializado – vertical y de penalizar a quienes les reportan
llamado Friendster—una herramienta capaz de mejores dividendos ¿cómo es que un cibernauta
ayudar a formar círculos sociales en la web. (incluso imberbe) está en posibilidades de hacer
de las suyas, para crear su propia página; colocar
Esta idea básica de los círculos sociales fue videos para incomodar a los candidatos (y
desarrollada por Thomas Anderson y Christofer gobernantes) en turno; al enviar mensajes a través
DeWolfe, en el año 2002, pues lograron que cada de su teléfono celular o desde le mismo MySpace,
usuario contara con opciones adicionales para multiplicando su resonancia? Y todo ello on line
personalizar su propia página; incluir fotografías, y sin previa «consulta ciudadana a la autoridad».
colocar videos, subir la música de su preferencia y Pues eso son las TIC y las redes sociales virtuales:
compartirla, además de poder conversar en línea interconexión, horizontalidad, multiplicación (de
(chatear); enviar mensajes instantáneos a uno o
?=,5*<,5;965(*065(3*65,0** 191
TIC’s, implicaciones en el ámbito electoral

VWPUPVULZ WVSx[PJHZ PU[LYJHTIPV ` ÅL_PIPSPKHK6. nuestro nombre, uno se pregunta cómo es que
¿No les gusta? Comiencen la historia nuevamente. todavía se atreven los partidos políticos y sus
A quienes incomode esta horizontalidad y libre candidatos, en todo el orbe, a pronunciar ofertas
intercambio que a borbotones surge y se recrea políticas sobre empleo, salud, educación, vivienda
desde las TIC, convendría recordales lo que un día y desarrollo humano. Como gusta expresarlo Javier
LZJYPIP}LSÄS}ZVMVMYHUJtZ(UKYt*VT[L:WVU]PSSL Armentia, astrofísico y director de la Sociedad para
«Si las libertades de creencia, de opinión, de el Avance del Pensamiento Crítico: ¡Vaya timo! Pero
expresión y de culto son un derecho, no tienen por volvamos a lo nuestro. Ofrecemos las disculpas
qué ser toleradas, sino simplemente respetadas, correspondientes a los lectores y a los oyentes por
protegidas y celebradas (Comte-Sponville, 2005: este impúdico paréntesis.
179).
/PB/PÄ]LD
Es aquí donde nos encontramos y creemos que
un largo tiempo estaremos en arenas movedizas. En el año 2003, Ramun Yalamanchis creó una
¦+}UKL LZ[m V LZ[HYxH LS W\U[V KL PUÅL_P}U WHYH de las redes sociales virtuales, soportadas en el
redactar aquellas líneas regulatorias? ¿Que la acceso a internet. Su centro de operaciones está
libertad no se reglamenta porque sería cuento HÄUJHKV LU :HU -YHUJPZJV *HSPMVYUPH 3H ^LI
de nunca acabar? No planteamos reglamentar HI5 ha sido reconocida como uno de los sitios de
el uso de la libertad. No levantemos cortinas de entretenimiento más grande del mundo y ostenta
humo. Creemos que la ciudadanía tiene derecho la etiqueta de ser una de las herramientas con
de saber en qué emplean y cuánto gastan de el crecimiento más acelerado en el mundo. Para
nuestros impuestos los partidos políticos y sus dar una idea del alto impacto que tiene entre las
candidatos, para diseñar, mantener actualizada personas con acceso a internet, recientemente
e interactuar virtualmente con los electores para se reportó que está catalogado como el primer
intentar convercer a poco menos del 60% de sitio, especializado en comunidades virtuales, más
ciudadanos --si bien les va-- que se animan a ir a visitado en países latinoamericanos, europeos
las urnas porque todavía piensan que requerimos y asiáticos. Consecuentemente, se trata de una
de un sistema de partidos para marcar el rumbo herramienta que permite su acceso en más de 50
que ha de tomar un municipio, una entidad o un idiomas7.
país. Desde luego, Fondo Monetario Internacional Esta herramienta dispone de motores de búsqueda
(FMI) y Banco Mundial (BM) mediante y, según y de enlace de avisos que les permiten a los
los marque el dedo de la galopante e intocable usuarios realizar tres actividades o procesos de
globalización económica. HS[VZPNUPÄJHKV!
Enmedio de fuertes torrenciales que generan
7 Como se sabe, en el orbe de hablan un total 6,912 len-
las recurrentes crisis económicas que nos han guas. Sin embargo, el grueso de los hablantes se concentran en los
obsequiado una minoría que dirige el mundo en siguientes cinco: Chino-Mandarín (más de 800 millones); Español
(más de 350 millones); Inglés (poco más de 340 millones de perso-
6 María Elena Meneses y Jacob Bañuelos, elaboraron una nas); en cuarto lugar el Árabe (ligeramente arriba de 240 millones) y,
tabla en la que dan cuenta de las características o atributos que el Hindi, con poco más de 250 millones de hablantes.
pueden presentar las redes sociales virtuales (Meneses y Bañuelos,    
2009).
?=,5*<,5;965(*065(3*65,0** 192
TIC’s, implicaciones en el ámbito electoral

1). Búsqueda de personas que pueden 2.7.5. Facebook


ser de interés para el usuario en turno. Mark Elliot Zuckerberg, a inicios del año 2004,
Mediante avisos automatizados soportados era un estudiante de la Universidad de Harvard;
en las direcciones electrónicas, Hi5 puede estando allí, le pasó la idea de hacer una red
enviar mensajes electrónicos a un grupo para compartirla con otros alumnos de la propia
de cibernautas para informarles que un institución8. En unos cuantos meses, cuando vio
«conocido» suyo les ha incluido como que el número de compañeros que se adhería
«amigo» en el Hi5 y que les invita, tanto a la cibertrama crecía, entonces se propuso –y
a formar parte de su red social en esta logró-- expandir la malla internauta, logrando
herramienta, como a visitar el sitio individual sumar a otros estudiantes de las universidades de
que «ha creado» su contacto. Stanford, Columbia y Yale. Justo a la mitad de ese
mismo año, debido al descomunal éxito que había
0UMVYTHJP}UVYLWVY[LZLZWLJxÄJVZHJLYJH registrado con la red «Facebook», Zuckerberg
de los amigos que forman parte de la red ZL]PVPTWLSPKVHSHHWLY[\YHKL\UHVÄJPUHLULS
JPILYZVJPHSKL\UHWLYZVUHLZWLJxÄJH(Zx emblemático Palo Alto, California9. Actualmente,
mediante ambos recursos, se trazan nuevos Zuckerberg es el jefe ejecutivo de Facebook. Tras
nodos interaccionales que pueden ampliar doce meses de haber iniciado la ciber-experiencia,
o limitar las llamadas «redes sociales» que la red Facebook ya había alcanzado un millón de
ZLLKPÄJHUJVULSHWV`VKLSHZ;0* usuarios en el mundo.
Poco tiempo después, esta red alcanzaría la nada
3). Cada vez que un usuario de Hi5 realiza despreciable suma de 50 millones de usuarios
\UJHTIPVZPNUPÄJH[P]VLUZ\WYVWPHWmNPUH y, hace apenas unos días, los cibernautas
o que se aproxima su cumpleaños, esta conectados a Facebook llegarían a casi 400
herramienta envía avisos a la red cibersocial millones de personas en todo el orbe, es decir, casi
del nodo respectivo, para tratar de generar cuatro veces el número de habitantes de nuestro
nuevas interacciones apoyadas en este
8 Mark Elliot Zuckerberg. Nació en White Plains, Estados
recurso que proveen las TIC. Unidos de Norteamérica, el 14 de mayo de 1984. Reconocido
programador y empresario. Para desarrollar facebook, Zuckerberg
contó con la ayuda de sus compañeros de estudio Dustin Mos-
Olvidémonos por un momento del Hi5 como tal. En kovitz y Chris Hughes, además de su coordinador de ciencias de
la computación Andrew McCollum. Actualmente, Zuckerberg es
todo caso, dentro de algún tiempo desaparecerá el jefe ejecutivo de Facebook. Una nota periodística reciente, en
la que se aborda el tema de Facebook, ha señalado que el joven
VT\[HYmOHJPHV[YHZWSH[HMVYTHZTmZZVÄZ[PJHKHZ Zuckerberg contó con la ayuda de los hermanos Cameron y Tayler
e interactiva en la red de redes. Nos parece que Winklevoss, quienes fueron escindidos tempranamente por el pro-
pio Zickerberg (Galán, 2010).
debemos colocar en la palestra algunos aspectos,
9 Para el campo de los estudios de comunicación, Palo
en torno a las campañas electorales. Trataremos de Alto, California, resulta emblemático porque allí surgió y se desar-
escribirlos en el menor espacio posible, mediante rolló la escuela denominada la «Nueva Comunicación», encabezada
por Gregory Bateson, Paul Watzlawick y Donald D. Jackson. Es
el artilugio de los siguientes dos acápites. JPLY[VX\L[HTIPtUM\LPKLU[PÄJHKHWVYSVZHWVY[LZHSHWZPX\PH[YxH
como la «Escuela de Palo Alto California». Estos y otros autores
aportaron nuevas categorías analíticas que se conocieron como:
«doble vínculo», «interacción estratégica», «presentación de sí mis-
mo», entre otras más. Cf. Winkin, Yves (1990). La nueva comuni-
cación. España: Kairós.
?=,5*<,5;965(*065(3*65,0** 193
TIC’s, implicaciones en el ámbito electoral

país (Acosta, 2010). La cifra más fresca con la que en realidad, como lo señala Juan Faerman, su
contamos es que los usuarios de Facebook ya principal objetivo es permitir que el prosumidor
superaron los 500 millones de usuarios, mismos se exhiba en la red de redes, que «se muestre»;
que centralmente se dedican a colocar y compartir no hay sentido de privacidad y la intimidad suele
en la red de redes fotografías, noticias y escuetas desaparecer en varios sentidos (Faerman, 2009).
opiniones respecto a un alud de temas de lo más Tal ha sido el crecimiento vertiginoso y resonancia
más variopinto (Galán, 2010). de Facebook que recientemente su multimillonario
inventor recientemente ha sido advertido que en la
Este tipo de redes sociales virtuales han favorecido película que ya se estrenó en la Unión Americana,
la creación de nodos individuales y grupales, para ponen al desnudo cómo se gestó el proyecto de
quienes –desde la política y otros ámbitos de la esta red social virtual y cómo se comportó Mark
vida— han logrado comprender rápidamente las Zuckerberg con sus compañeros y amigos que le
ventajas de poner en marcha este tipo de vínculos acompañaron al inicio con la plataforma Facebook;
on line que, luego generan actividades efectivas off amen de presentar episodios en los que ponen
line. Baste poner en claro la estructura de registro HS KLZJ\IPLY[V SHZ HÄJPVULZ KL Z\ JYLHKVY! ZL_V
de información que solicitan este tipo de redes drogas y amistades rotas (Galán, 2010). En menos
virtuales. palabras, el Panóptico creado por su inventor
VÄJPHS ZL SL OH YL]LY[PKV ` HOVYH Z\Z KL[YHJ[VYLZ
Después de solicitar los primeros datos personales:
I\ZJHUOHJLYSLKH|VH[YH]tZKL\UÄSTL
nombre, edad, sexo y los intereses del cibernauta,
lo que sigue es que solicitan al usuario su posición
En torno al tema electoral, hemos de poner de
partidista y la religión que profesa. Estas variables
relieve que los usuarios de esta plataforma se
se convierten en indicadores clave para los motores
convierten en nodos que van ligando cada día
de búsqueda y de control de información. Cierto es
a más personas, incluidas un amplio segmento
que en una amplia cantidad de casos, los usuarios
de desconocidos; ello se debe a que los
suelen responder únicamente a las primeras
prosumidores, cuando aceptan (haciendo clic)
variables, dejando en blanco o sin responder los
a un nuevo contacto o «amigo» el software del
rubros de posición partidista y de religión, pero
Facebook automáticamente le avisa qué otros
existe otra porción de los prosumidores que
cibercontactos tiene esa persona y cuáles resultan
inocente o intencionalmente aportan estos datos
«conocidos» de ambos nodos. Así, la red social
y, luego, el software con el que cuentan estas
virtual se va ensanchando cada minuto, hora y día,
WSH[HMVYTHZOHJLUÄS[YVZH\[VTm[PJVZWHYHI\ZJHY
según la frecuencia con la que los cibernaturas
por ejemplo, posibles votantes. Hemos de recordar
ingresan al Facebook.
que la religión y la política gozan de una fraternidad
histórica.
A pesar de que el padre del Facebook advierte
A su vez, para quienes disponen de modelos
que dicha plataforma la creó para que los
avanzados de microcomputadoras manuales
internautas se conectaran con sus «amigos»,
(teléfonos celulares), constantemente dicha

?=,5*<,5;965(*065(3*65,0** 194
TIC’s, implicaciones en el ámbito electoral

plataforma les envía mensajes para indicar escenas de lo que en el argot se denomina «sexo
la actividad que está teniendo en su propia explícito».
red virtual de contactos. Lo que básicamente
colocan los prosumidores en esta plataforma Adicionalmente a este tipo de material, el sitio You
son: mensajes (qué estás pensando), fotografías Tube contiene clips sobre películas, programas
digitales y videos10. Aunque existe la posibilidad televisivos, videomusicales y videoblogs. Usando
de intercambiar mensajes a través del chat, los blogs o sitios personales creados en la misma red,
usuarios tienden realizar fundamentalmente este los internautas pueden hacer ligas (links) a videos
tipo de actividades. Al tratarse de una red social You Tube. Debido a la gran popularidad que ha
virtual que va construyendo el mismo cibernauta, no adquirido entre la mayoría de los usuarios en el
dudamos que haya tenido y que tenga en los años T\UKV\UHNYHUJHU[PKHKKLTH[LYPHS]PKLVNYmÄJV
por venir un alto potencial para ser aprovechado circula en la red de redes a través de este sitio.
en las campañas electorales ¿Qué dividendos Hay que señalar también que no han sido pocos
generará para los candidatos a cargos públicos? los personajes, de todos los ámbitos y órdenes,
¿Qué respuesta obtendrán en las urnas de este tipo que se han visto sorprendidos al enterarse de que
de ciudadanos que están enganchados a la red de circulan escenas que contribuyen a dar cuenta de
redes mendiante el Facebook? ¿Estos nodos y sus presuntos aspectos de su vida íntima, privada o
redes estarán en el ánimo de pasar de lo lúdico o pública.
del aburrimiento para saltar a temas electorales?
Ahora no tenemos en el bolsillo ninguna respuesta Además de estas cualidades, el reproductor online
a estas interrogantes, pero consideramos que lleva un registro tanto del número de visitantes
estarán en la palestra en un futuro próximo. como del material más «visto» por los internautas,
sistema que le permite catalogar y recomendar
2.7.6. You Tube el material que registra las más altas visitas.
El posicionamiento de You Tube ha tenido tal
En el mes de febrero de 2005, tres personas que magnitud en el mundo virtual que desde el año
habían trabajado para una empresa norteamericana 2006 la empresa Google Inc., lo compró a sus
que se dedicaba al comercio electrónico (PayPal), dueños por la módica cantidad de 1.650 millones
es decir, a la transferencia de dinero entre personas de dólares y ahora tiene este sitio como una de
que disponían de correo electrónico, crearon un Z\ZÄSPHSLZ
sitio web en el que los usuarios de internet podrían
subir y compartir videos. Se trata de un sitio capaz Respecto a los usos que se han observado en el
de alojar videos sencillos y de reproducirlos en mundo de la política y de los procesos electorales
línea. El único criterio que «trata de cuidar» You en general, se aprecia una creciente tendencia
;\ILLZX\LLSTH[LYPHS]PKLVNYmÄJVX\LZLJVSVJH entre los candidatos a cargos públicos, para
en la red no sea obsceno o bien que no contenga colocar en You Tube, material videograbado,
10 Faerman, en su trabajo, da cuenta de las siguientes cifras
VÄJPHSLZ KL -HJLIVVR! ­*HKH TLZ ZL W\ISPJHU  TPSSVULZ KL especialmente aquel relacionado con las jornadas
fotos y 14 millones de vídeos […] Existen más de 45 millones de
grupos activos» (Faerman, 2009: 61).
proselitistas para buscar votos entre la ciudadanía.

?=,5*<,5;965(*065(3*65,0** 195
TIC’s, implicaciones en el ámbito electoral

Asimismo, no han sido pocos los casos en que LYHYHaVUHISL¶JVUÄULZKLWYVZLSP[PZTVLSLJ[VYHS


en este sitio virtual se colocan videos que buscan el uso del teléfono celular (móvil), en tanto su
poner en evidencia conductas ilícitas por parte de expansión entre distintos segmentos de población
V[YVZ WHY[PKVZ `V JHUKPKH[VZ H ÄU KL WVULY LU era considerable, aunque no se disponía de todas
operación lo que se denomina como campaña las plataformas de aplicación que hoy nos parecen
negra. comunes, altamente interactivas y con sólidos
enlaces a internet, al correo electrónico o bien a
Así, las TIC han abierto la posibilidad a los Facebook, por sólo citar los más emblemáticos.
candidatos y partidos políticos para tratar de llegar
a la población en general y a la ciudadanía en Igualmente, como lo hemos apuntado, las
particular. Aunque se trata de una opción limitada, WSH[HMVYTHZ 4`ZWHJL ` /P Ä]L /P JYLHKHZ
es importante resaltar que: en 2003; Facebook, inventada en el año 2004;
el mega-sitio You Tube, puesto en la red de
Internet puede contribuir, asimismo, a YLKLZ LU  ` ;^P[[LY LZ[HISLJPKV H ÄULZ KL
una necesaria diferenciación entre la
información que proporciona un candidato, 2009, no podrían haber formado parte de las
del candidato como fuente de información. TIC disponibles, para uso de aspirantes cuyas
Esta precisión es fundamental, porque candidaturas jugaron su futuro ante el electorado
podría constituir un primer paso para antes de esos años (Guadarrama y Valero, 2010).
enseñar a audiencias y usuarios a distinguir
entre el manejo de imagen que se realiza Lo que sí esperaríamos es que, cada campaña
del político […] de la información que electoral, su candidato y el país o localidad en
proporciona un candidato (Crovi, 2004: cuestión, hubiesen comenzado a explorar algunas
125). de las funciones y ventajas que podrían retribuirles
el uso de las TIC. Veamos los casos seleccionados.

3. Breve recuento de campañas


En el año 1997, en Argentina, ubicamos un claro
electorales y uso de TIC esfuerzo por emplear un sitio en internet (la página
web) de lo que constituyó la Alianza, formada por
En primer término, habría que señalar que,
el partido Unión Cívica Radical y el partido Frepaso,
comprensiblemente, los partidos políticos y sus
para dar visibilidad electrónica en la red de redes,
candidatos a cargos de elección popular no
a los candidatos que entonces contendían por una
podrían haber hecho uso de todas las TIC ni
J\Y\SHÄUKLYLWYLZLU[HYHSHJP\KHKKL)\LUVZ
plataformas conocidas hasta ahora, debido a
Aires en el Congreso Local. Se trató de un sitio, si
que su aparición y aplicación ha sido, --si bien
bien del Partido Político en cuestión, parte de su
vertiginoso—claramente gradual. Por ejemplo,
KPZL|VLZ[\]VVYPLU[HKVHKPM\UKPYLSWLYÄSKLZ\Z
antes 1997 habría sido difícil concebir el uso de
candidatos y sus propuestas (Lanza, 2007).
sitios electrónicos en internet (páginas web) por la
Un par de años después, nuestro colega Juan Rey,
sencilla razón de que la propagación y uso de éste
junto con un grupo de profesores y estudiantes,
comenzaba a despuntar. Hacia el año 2000, ya
se dieron a la tarea de realizar un seguimiento a

?=,5*<,5;965(*065(3*65,0** 196
TIC’s, implicaciones en el ámbito electoral

las campañas electorales que se vivieron entre Con el inicio del Siglo XXI, en el año 2000, tanto
mayo y junio de 1999, y que contendieron por en los Estados Unidos de América (EUA) como
el Ayuntamiento de Sevilla, España. Entre otros en España, despuntaron con mayor claridad los
hallazgos, Juan Rey y cols., reportaron que las sitios web de partidos y candidatos. En el primer
formaciones políticas que se «integraron» para caso, los partidos Republicano y Demócrata,
aconseguir la gestión del ayuntamiento en pugna, crearon sus respectivos sitios para dar cuenta de
emplearon de manera diferenciada los recursos su participación. Ese mismo año, en la contienda
tecnológicos e interactivos que para esos años por la Casa Blanca, tanto George W. Busch como
ofrecía el internet. La coalición formada por su adversario Al Gore, hicieron uso de correos
Izquierda Unida-Los Verdes-Convocatoria por LSLJ[Y}UPJVZ JVU ÄULZ WYVZLSP[PZ[HZ (YYPL[H L[
Andalucía [IU-LVCA], aprovechó la existencia del al., 2004). Consecuentemente, debido a la tasa
sitio web que se había confeccionado desde el de usuarios de computadoras personales con
año 1997, para únicamente colocar información acceso a internet (501 por cada mil habitantes),
actualizada en torno al candidato y al programa les permitió llegar a un considerable número de
electoral que se ofrecía al electorado andaluz. posibles votantes, digamos, invadiendo el buzón
de los ciber-ciudadanos.
Asimismo, dichos partidos decidieron colocar las
fotografías digitalizadas de las diez personas que, Por lo que toca al país ibérico, en marco de
en caso de ganar, integraban la lista de la colación. las elecciones para integrar la Asamblea de
El Partido Andalucista –que había colocado en Madrid, el Parlamento de Cataluña y durante
la red de redes su página electrónica desde un las elecciones generales de ese mismo año, los
año anterior a las justas electorales-- se dio a la partidos participantes y sus candidatos se dieron
tarea de incluir una síntesis del programa; un video a la tarea de crear sitios web, cuyos objetivo
sobre los aspectos centrales de la campaña del central era transmitir información y contenidos
candidato y, a decir del propio Juan Rey y sus de las campañas electorales (2004). Lo que
colegas, «las vallas publicitarias [se convirtieron] en resulta de especial trascendencia en el caso
el eje central de esta web en la que predomina[ba] español, es que dichos sitios fueron concebidos
un exceso de información en detrimento de la de manera más audaz, pues buscaban incentivar
información semàntica» (Rey, 1999: 113). Las la interacción entre la ciudadanía, los partidos
candidaturas enarboladas, respectivamente, por políticos y sus candidatos, al tiempo que invitaban
el Partido Socialista Obrero Español de Andalucía a la movilización del mismo electorado para tomar
[PSOE-A] y el Partido Popular de Andalucía [PP- parte en la misma campaña. He aquí otro punto
A] diseñaron y colocaron en internet, información KLPUÅL_P}ULU[HU[VX\LZLW\LKLJVUZPKLYHYX\L
que mediante otros canales de comunicación, comenzaban a despuntar las acciones online, con
podían tener los potenciales electores, es decir: el evidente propósito de gestar la participación y el
programa de trabajo; currículum del candidato y ]V[VVMÅPUL
los compromisos centrales que cada uno asumía
frente a la ciudadanía (Rey, 1999).

?=,5*<,5;965(*065(3*65,0** 197
TIC’s, implicaciones en el ámbito electoral

Desde luego, no debemos imaginar que el grueso dinero e, incluso, convertirse en prosumidores,
de la ciudadanía estaba interconectado a los aportando argumentos para defender temas
sitios de la web, puesto que para el naciente siglo centrales del candidato como para generar ideas
XXI, el acceso a computadoras personales y los encaminadas a contrarrestar a quienes, desde
conectados a internet eran aún incipientes, pues muchos ámbitos, atacaban las propuestas y
en España reportaban una tasa de 168 usuarios de candidatura de Dean. Podemos decir que las
PC y de 182 de internet por cada mil habitantes. cualidades centrales de esta campaña electrónica
Para el mismo año 2000, los EUA tasaban 625, operada por el ex-aspirante a la Casa Blanca, fue
para el caso de las PC y de casi 501 usuarios de su gran interactividad y la amplia autonomía con
la red de redes, por cada mil habitantes (Banco la que podía participar tanto su equipo de trabajo
Mundial, 2003). como los seguidores que, desde distintas latitudes,
fueron sumándose a dicha campaña.
En el marco de las elecciones primarias, celebradas
por el Partido Demócrata de la Unión Americana A partir de la experiencia exhibida por Dean, otros
en el año 2003, contendió Howard Dean, contra candidatos comenzaron a dirigir su atención hacia
nueve aspirantes más, entre ellos, quien habría PU[LYUL[`LS\ZVKLSHZ;0*JVUÄULZLSLJ[VYHSLZ
de vencerlo, John Kerry. A pesar de su dramática Al mismo tiempo, debido al claro revés que
derrota, lo que resulta especialmente emblemático vivió el candidato demócrata que nos ocupa, se
de la campaña desplegada por Dean es que comprendió, como lo señalan Sey y Castells, que:
transformó la visita de voluntarios, casa por casa,
en la búsqueda de ciudadanos clic por clic; recaudó Internet no genera por sí mismo una
campaña política efectiva ni aumenta
ZPNUPÄJH[P]VZ MVUKVZ LJVU}TPJVZ WHYH PTW\SZHY
la mentalidad cívica [pues] En Lugar de
aún más su candidatura y, su portal electrónico en provocar transformaciones radicales, su
la web, mostró considerables avances y una nueva impacto en la política es gradual, contextual
manera de emplear internet así como diversas `HTWSPÄJHKVYB¯D7VYLSSVBOHKLLU[LUKLYZL
que] la clave para la utilización de internet en
de plataformas aplicadas de manera creativa.
la política nos es la tecnología per se, sino el
Enseguida, algunos botones de muestra. uso de ésta para promover un mensaje y un
estilo de participación política que sintonice
Cuando los usuarios ingresaban a la página del con el electorado (2006: 454).
candidato Howard Dean, no sólo podían conocer
que se pronunciaba contra la guerra en Irak; En el año 2006, en México, se vivió la contienda
que estaba a favor del derecho al aborto; de la electoral más cerrada de nuestra historia reciente.
\[PSPaHJP}U KL KYVNHZ JVU ÄULZ [LYHWt\[PJVZ" X\L El candidato de derecha, Felipe Calderón
apoyaba la unión civil entre homosexuales o que Hinojosa, superó apenas con 0.6% de los votos
pugnaba por la creación de una seguridad social a su adversario más cercano, el perredista Andrés
para jubilados (Sey y Castells, 2006). Además, los Manuel López Obrador. Las TIC que ambos
visitantes electrónicos podían participar en los foros contendientes usaron para tratar de conectar
de discusión; unirse a la campaña para recaudar con un segmento de la ciudadanía fueron, como

?=,5*<,5;965(*065(3*65,0** 198
TIC’s, implicaciones en el ámbito electoral

lo reportan Meneses y Bañuelos, el envío de Como podemos cotehar, estas herramientas


mensajes a través del correo electrónico y el uso virtuales están al alcance de los partidos políticos
de blogs (Meneses y Bañuelos, 2009). En torno a y de sus candidatos. Sin lugar a dudas, van a
dichas estrategias, la empresa Consulta Mitofsky ser usadas con mayor énfasis en los próximos
realizó una encuesta para tratar de estimar qué procesos electorales que se vivan en los distintos
candidato había sido blanco de un mayor número países. Si bien está claro que actualmente en
de correos electrónicos favorables o en contra. México el porcentaje de usuarios de internet
apenas llega al 28.3% de la población, es decir, a
Las cifras dieron clara cuenta de que los 27.2 millones de personas y que, la gran mayoría
internautas habían recibido en sus buzones un de internautas son adolescentes y jóvenes (INEGI,
mayor porcentaje de mensajes desfavorables en 2009), debe considerarse que la brecha digital
torno al candidato López Obrador (32.4), seguido continuará cerrándose gradualmente pero de
del priísta Roberto Madrazo Pintado (13.7). A decir manera sostenida.
de los mismos autores de referencia, parece que
el uso de estos correos electrónicos no dio cuenta Con el advenimiento del internet 2.0, los candidatos
de un impacto sobre la decisión que ya tenían los norteamericanos, en el año 2007, hicieron gala de
electores cuando acudirían a lar urnas (Meneses y su cultura de la oportunidad. En dicho cometido,
Bañuelos, 2009). descollaron Hilllary Clinton y Barack Obama, pues
desde entonces se dieron a la tarea de emplear
Debido a lo cerrado de las votaciones, se presentó con gran ahínco las ventajas que ofrecían las TIC,
\UJVUÅPJ[VWVZLSLJ[VYHSKLIPKVHX\LLSJHUKPKH[V para llegar a diferenciados sectores del electorado.
3}WLa 6IYHKVY HK\JxH OHILY PKLU[PÄJHKV
anomalías en el conteo de votos. Para ello, apelaba La estrategia empleada por el equipo de asesores
al Tribunal Electoral con el propósito de que de Barack Obama resulta especialmente
aprobara un nuevo conteo, voto por voto. Mientras interesante para analizar el papel que pueden
ello sucedía, en You Tube se colocaba un video desempeñar las TIC en los procesos electorales.
editado para hacer burla de su petición acerca de El núcleo central en el empleo y buen desarrollo
contar los votos emitidos en la jornada electoral de materiales y estrategias comunicaciones
del 2 de julio de 2006. Como podemos apreciar, reside en la capacidad que se tenga para lograr
plataformas digitales, altamente horizontales, que mediante el uso de las TIC se construyan y
difíciles de controlar como el You Tube, han llevado desarrollen redes sociales virtuales para, como se
a la conclusión de que, en tanto no se puede apunta en los estudios de comunicación política,
adjudicar la autoría de este y otros materiales, las acciones online se trasladen a familiares,
resultaría infructuoso e imposible pretender regular amigos y conocidos; en suma, hacer posible
su uso en las campañas electorales, mediante los que se propague una diáspora de contactos
partidos políticos y sus candidatos. WLYZVUHSLZ VMÅPUL JHWHJLZ KL YLHSPaHY HJJPVULZ
tareas y que, de ser posible, ideas, proyectos y, los
nada despreciables, recursos económicos.

?=,5*<,5;965(*065(3*65,0** 199
TIC’s, implicaciones en el ámbito electoral

espacios de participación y colaboración.


3VZ,Z[HKVZ<UPKVZKL5VY[LHTtYPJHÄN\YHU ¿Reglamentar o no el uso de las TIC en las
entre los países reconocidos que muestran
JHTWH|HZLSLJ[VYHSLZ&(SYLZWLJ[VPKLU[PÄJHTVZ
ZPNUPÄJH[P]VZHJJLZVZHSHZJVTW\[HKVYHZ`
al internet. Dicha condición, los ha colocado, tres posiciones más o menos claras. A). Los que
junto con Japón, Reino Unido, Corea del señalan que es infructuoso porque se trata de
Sur, Canadá, España y Alemania, entre recursos interactivos que viajan en la red de redes
los países con los mejores porcentajes de
y sobre los que resultaría imposible señalar autoría
usuarios de internet, pues los indicadores
de estos países se movían, para el año y costos. B). Los todavía no se detienen a pensar
2009, en rangos que iban del 60 al 77 por en las ventajas o inconvenientes de reglamentar
ciento (Internet World Stats, 2009). su uso y aplicaciones en materia electoral y. C).
Quienes sostenemos que, en tanto los partidos
En el mismo año 2007, Nicolas Sarkozy, candidato y candidatos emplean recursos públicos para
a la presidencia de la república francesa, sabedor invertir en este tipo de desarrollo y aplicaciones,
de que una fracción ciudadana tiene acceso a una debe intentarse al menos trazar un boceto para
computadora y al internet 1.0 ó 2.0, también empleó averiguar, en el camino, qué sucedería si en México
todos los dispositivos que su equipo de asesores se normara este tipo de artilugios que ofrecen
tenía a su alcance en las TIC, para convencer a las TIC para ampliar el impacto de las campañas
un selecto grupo de electores, ubicados en su electorales.
empleo, casa o en la empresa. Mientras se han colocado estas tres grandes
posiciones, los partidos políticos y los candidatos,
4. Balance en distintas campañas desplegadas en varios
países, están empleando estos recursos que
Con esta revisión sucinta y referida a los casos proveen las TIC. Crear un sitio en la web, emplear
de Argentina, México, Estados Unidos de las bondades del internet 2.0 y «enganchar»
Norteamérica, España y Francia, podemos apreciar plataformas como: buzón electrónico, Facebook,
que la tendencia internacional, en materia de Twitter, You Tube; colocar información para recibir
campañas electorales, apunta hacia un creciente e desde propuestas para mejorar el programa de
intensivo uso de las TIC, especialmente colocadas trabajo del candidado en turno, hasta la invitación
desde la venta de la web 2.0, debido a su gran tanto al activismo partidista como a la aportación
capacidad para dar visibilidad e interactividad de fondos económicos a la campaña para encarar
multidireccional a través de un conjunto de de mejor manera los gastos que representan las
herramientas como: You Tube, Hi5, Facebook, campañas, implica –por principio de cuentas—
Myspace, blogs, correos electrónicos y mensajes disponer de personal que esté al frente de este
a teléfonos celulares, entre otras opciones. Este tipo de tecnologías interactivas, para monitorear
racimo de TIC, usado estratégicamente y con y dar respuestas a los cibernautas. Ello implica
pleno conocimiento de sus ventajas para tratar de el uso de recursos públicos ¿Por qué no se va a
llegar a un segmento particular de los ciudadanos, reglamentar?
OH ZPKV JHWHa UV ZPU KPÄJ\S[HKLZ KL HTWSPHY SVZ

?=,5*<,5;965(*065(3*65,0** 200
TIC’s, implicaciones en el ámbito electoral

Quienes se pronuncian por la invabilidad e


orden-caos de You Tube como tal, el Facebook
impracticidad de regular este tipo de TIC en el
de un ciudadano en particular o su buzón
ámbito de las campañas político-electorales,
electrónico. De hecho, se sabe que esta sociedad
especialmente el uso de internet y sus plataformas,
de la información avanza a pasos agigantados
aducen dos cuestiones centrales: a). Que una ley o
hacia la constitución del nuevo Gran Hermano
un reglamento debe tener posibilidades de observar
Orwelliano11. No comenzaríamos por buen camino
su cumplimiento o incumplimiento y, b). Que,
si pretendiésemos la reglamentación de internet
debido a las características de orden y caos que
y sus plataformas. Veamos algunos ejemplos
presenta la vida de la red de redes y un sinnúmero
emblemáticos.
de plataformas o aplicaciones, resultaría muy difícil
PKLU[PÄJHYJ\mUKVSHH\[VYPHKLSVX\LLZ[mHSVQHKV
La particularidad que revisten TIC como You Tube es
en la web se debe a un partido y/o candidato y
que se trata de información digitalizada que puede
cuándo dicha información y aplicación proviene de
acampar largo tiempo en el sitio electrónico; que
simpatizantes voluntarios; de verdaderos activistas
se pueden reenviar los videos a través del uso de
que viven del partido (es decir, que tienen salario
correo lectrónico, del Facebook y, actualmente del
o que están con el candidato en turno) y, cuándo
Twitter. Que tal vez se puede estimar su impacto al
dicha información ha sido colocada como parte
revisar el conteo que se registra cada ocasión que
de las nada infrecuentes «campañas negras»
un cibernauta reproduce el material seleccionado.
desplegadas por sus farragosos adversarios que
¿Cómo podríamos pretender regular este tipo
luchan por llegar al mismo poder.
de tecnologías para, por ejemplo, acotarlas a los
WLYPVKVZ VÄJPHSLZ THYJHKVZ WHYH LS KLZWSPLN\L
El abanico de plataformas que estamos viendo
de cada campaña electoral? Simplemente no se
surgir por los cuatro costados y a cada paso,
podría porque los prosumidores que dan vida al
ya admiten y seguirán permitiendo crear redes
You Tube emergen de un sinnúmero de lugares
sociales virtuales on line, off line y, viceversa. Dicho
virtuales. Y precisamente esa forma de operación,
pontencial y condición está siendo aprovechado
de alimentación y de recreación es lo abre algunas
por los partidos políticos y sus candidatos, aunque
arterias para ensanchar esquemas de participación
taimadamente, a la mayoría o bien a todos, les
más democráticos e incluso lúdicos.
convenga apoyar la no regulación de la libertad.
Por lo que toca al caso mexicano, a pesar
Desde una óptica sistémica, una de las operaciones
de que algunos partidos y candidatos han
que realiza toda organización (sistema) es que
empleado el internet, también con distintos
trata de distinguir qué está adentro y qué está
HSJHUJLZ ` ILULÄJPVZ U\LZ[YH SLNPZSHJP}U LU SH
afuera. Así, podríamos comenzar por reglamentar
materia ha declarado que esta TIC forma parte
` TVUP[VYLHY L_JS\ZP]HTLU[L SVZ ZP[PVZ VÄJPHSLZ
de la categoria de «otros» y se ha optado por no
que están acreditados como tales ante las
incorporar normatividad o reglamentación para
autoridades electorales, por los propios partidos
su uso en las campañas electorales. Nuestra
políticos, coaliciones y/o candidatos. Como se
posición al respecto es que si los partidos políticos
puede apreciar, no se trata de reglamentar el
11 Desde luego, aludimos a la interesantísima y vigente
novela de Eric Arthur Blair, mejor conocido como George Orwell,
?=,5*<,5;965(*065(3*65,0** cuyo título es: 1984. 201
TIC’s, implicaciones en el ámbito electoral

y candidatos usan recursos públicos (es decir, al uso que están realizando los partidos políticos,
el dinero de nuestros impuestos) para difundir lo así como los fondos públicos que se destinan a
que queda de sus plataformas ideológicas y sus este generoso rubro.
respectivas propuestas de trabajo, debería ser
analizada la conveniencia de generar, al menos, Este tipo de cibertecnología colocada en la web
lineamientos que regularan su uso y la cantidad que llega a población escolarizada, urbana, con
de recursos públicos, en pesos y centavos, que empleo, con acceso a una computadora y/o a
ZL W\LKLU LZ[HY KLZ[PUHUKV ­VÄJPHSTLU[L® JVTV una microcomputadora manual (MICOM), será de
parte de las estrategias proselitistas desplegadas especial valía para las partidos y los candidatos
en cada campaña. que aprendan rápidamente a reconocer las
enormes ventajas que tiene y que tendrá tratar de
A pesar de que llegásemos al mismo puerto, hacer llegar información –y tratar de convencer—a
es decir, al «no se puede o no es viable», el un segmento de la ciudadanía que se mantiene
ejercicio podria ser preparatorio para cuando el en contacto con un grupo de personas que
acceso a internet12, los usos, las prácticas y la trasciende su hogar, su escuela y su barrio o
ciberparticipación ciudadana hayan alcanzado, JVSVUPH ,SSV UV ZPNUPÄJHYm LU TVKV HSN\UV X\L
en varios puntos del orbe, mayor acceso entre la aquellas propuestas político-electorales que viajen
ciudadanía. por banda ancha y a toda velocidad, provocarán
un alto impacto en los electores y los llevarán a
Ante este comprensible remolino de aguas turbias cambiar su posición electoral inicial. Lo que nos
que generan partidos políticos, candidatos y, en parece que debe estar en la mesa es si este
general, los prosumidores, la mejor alternativa que tipo de formas de intercomunicación consumen
se les ha ocurrido a quienes se ocupan de legislar fondos públicos y a cuánto asciende en cada caso
los asuntos político-electorales, en materia de uso y contienda.
de las TIC, ha sido –simplemente—cerrar la puerta,
hasta nuevo aviso, es decir, hasta que la realidad Una óptica más ha tenido claro que las posibilidades
nos rebase aun más. Nosotros consideramos que que ofrece internet y las herramientas con que
debería reabrirse el debate, para darnos a la tarea, se cuentan en cada momento, pueden ayudar
desde la academia o como ciudadanos, de realizar KL THULYH ZPNUPÄJH[P]H H SSLNHY H ZLNTLU[VZ KL
los primeros bocetos para ver qué pasaría si SH WVISHJP}U X\L THU[PLULU \U WLYÄS JSHYHTLU[L
tratásemos de regular algunos usos de las TIC en diferenciado del resto de los votantes, pues se
el ámbito de las campañas electorales y/o en torno trata de ciudadanos ubicados en mejores estratos
12 Dicho acceso está creciendo a través de la propagación socioeconómicos, con mayor información y, quizá,
KLJVTW\[HKVYHZWLYZVUHSLZHÄUJHKHZLULSLTWSLVLUSVZOVN-
ares y en los cibercafés y mediante la microcomputadora manual, con esquemas de participación más proactivos
cuyo uso predominante, por ahora, es como teléfono móvil y en
calidad de intercambio de mensajes escritos (chat). Como lo hemos
hacia la actividad político-electoral.
señalado en otro trabajo, tal vez siempre será prematuro atisbar qué Apreciamos un proceso en el que los candidatos
sucederá con la siguiente innovación en materia de las TIC, espe-
cialmente con lo que hoy conocemos como «teléfono celular», pero y candidatas comienzan a valorar la importancia
que dista mucho de ser solo un dispositivo para realizar y recibir
llamadas (Guadarrama y Valero, 2010b).
estratégica que podría representar el uso de las TIC,

?=,5*<,5;965(*065(3*65,0** 202
TIC’s, implicaciones en el ámbito electoral

como elementos constitutivos y complementarios Crovi, Delia (2004): «Internet en las Elecciones de
en sus campañas. Sin embargo, el uso de las 2003», en Revista Mexicana de Ciencias Políticas y
herramientas de información y comunicación está Sociales, año XLVI, núm. 190. México: Facultad de
dejando a la vista variaciones que dan cuenta de un Ciencias Políticas y Sociales/Universidad Nacional
uso y aprovechamiento claramente diferenciado y Autónoma de México.
desigual. De aquí que las TIC reclaman un espacio
KLYLÅL_P}UHUmSPZPZ`WHYHLSJHZVKLSVZWYVJLZVZ De Botton, Alain (2004). Ansiedad por el estatus.
y campañas electorales, de una regulación urgente. México: Taurus.

De Sola, Ithiel (1992). «Discursos y sonidos de largo


9LMLYLUJPHZIPISPVNYmÄJHZ alcance», en Williams, Raymond [ed.]. Historia de
la comunicación. De la imprenta a nuestros días.
Arrieta, Félix et al (2004): «Campaña electoral y Vol. 2. España: Bosch.
Tecnologías de la Información y la Comunicación.
E-imagen política en las elecciones generales Faerman, Juan (2009). Faceboom. Facebook, el
españolas del 2004». Ponencia presentada en el nuevo fenómeno de masas. Argentina: Alienta,
VIII Congreso Español de Sociología: Grupo de editorial.
trabajo 25. Sociología de la Comunicación y del
Lenguaje. Alicante: España. Galán, Lola (2010). «Cuidado, caen puñaladas por
Facebook. Una agria película sobre la gestación de
Banco Mundial (2003): Indicadores sobre Desarrollo la red social obliga a su creador a dar la cara», en
Humano. USA, Banco Mundial. El País. Domingo 3 de octubre. Año XXXV, número
12.158. Edición internacional. España: El País.
Borgmann, Albert (2000): «Replay to my critics», en
Higgs, Eric et al [editores]. Technology and good Gitlin, Todd (2005): Enfermos de información.
De cómo el torrente mediático está saturando
life? EUA: The University of Chicago Press. nuestras vidas. España: Paidós.

Brito, Michael (2007): «5 distinct characteristics of Guadarrama, Luis Alfonso y Valero, Jannet (2010a):
Social Media», en «Emergencia de las TIC. Uso en las elecciones
http://www.britopian.com/2007/03/16/5-distinct- municipales del Estado de México, 2009».
characteristics-of-social-media/. Ponencia presentada en el XXII Encuentro Nacional
(Consultado: 19/01/2010). de la Asociación Mexicana de Investigadores de la
Comunicación (AMIC). México: AMIC-IUA.
Comte-Sponville, André (2005). Pequeño tratado
de las grandes virtudes. Barcelona: Paidós. Guadarrama Rico, Luis Alfonso y Valero
CONAPO (2005): Índice de Marginación, 2005. Vilchis, Jannet (2010b). «¿Teléfono celular
México: CONAPO. o microcomputadora manual?». Ponencia
presentada en el marco de la IV Reunión de Redes

?=,5*<,5;965(*065(3*65,0** 203
TIC’s, implicaciones en el ámbito electoral

de Cuerpos Académicos, celebrada en la Facultad Modern social, structure and the entrenchment
de Ciencias Políticas y Sociales de la UAEM. of the device», en Higss, Eric et al., Technology
and the good life? EUA: The University of Chicago
INEGI (2009): Encuesta Nacional sobre Press.
disponibilidad y uso de tecnologías de la información
en los hogares. ENDUTIH/México: INEGI. Quéau, Philippe (1995): Lo virtual. Virtudes y
vértigos. España: Paidós.
Internet World Stats (2009): «Internet usage
Sacks, Oliver. 2003. Veo una voz. Viaje al mundo
statistics for the Americas», en America Internet
de los sordos. España: Anagrama.
Usage Statistics, population and telecom reports,
en http://www.internetworldstats.com/stats2.htm
Sey, Araba y Castells, Manuel (2006): «De la política
(consultado: 2/02/2010).
en los medios a la política en la red: Internet y el
proceso político», en Castells, Manuel (ed.): La
Lucas, Lanza (2007): «Política 2.0. Campañas
sociedad red: Una visión global. Madrid: Alianza
políticas en la sociedad de la información», en
editorial.
Política 2.0. Campañas y acción política en la era
de internet, en http://epolitica.word.wordpress.
Ureña E., Fernando (2008): «La Web 2.0»”, en
com/ (consultado: 31/01/ 2010).
Revista Posgrado y Sociedad. Sistema de Estudios
de Posgrado. Costa Rica: Universidad Estatal a
Meneses, María Elena y Bañuelos, Jacob (2009).
Distancia, en
Internet y campañas electorales en México. La
http://www.uned.ac.cr/SEP/recursos/revista/
oportunidad postergada. México: Instituto Electoral
documents/Laweb2.0-Fer nandoUrena.pdf
del Estado de México.
(consultado: 31/01/2007).

Michelfelder, Diane (2000): «Technological ethics in


Huizinga, Johan (1972): Homo ludens. España,
a different voice», en Higss, Eric et al., Technology
Alianza Editorial/Emecé Editores.
and the good life? EUA: The University of Chicago
Press.
Orwell, George (2002). 1984. México: Lectorum.
Onfray, Michel (2002): Cinismos. Retrato de los
ÄS}ZVMVZSSHTHKVZWLYYVZ(YNLU[PUH!7HPK}Z
Rey, Juan [ed]. (1999). Comunicación Política
electoral. Elecciones municipales de Sevilla en
O’Reilly, T. (2005): «What is Web 2.0: Design
1999. Questiones Publicitarias. Monografías No.
patterns and Business models for the next
2. Sevilla: Facultad de Ciencias de la Información,
generation of software», en http://www.oreillynet.
Universidad de Sevilla.
com/pub/a/oreilly/tim/news/2005/09/30/what-is-
web-20.html?page=1 (consultado: 25/01/ 2010).
Valero, Jannet (2002): “Surgimiento de los
videojuegos. Inicios y despunte”, en Revista
Power, Michael (2000): «Trapped in consumption:
Espacio Públicos No. 9. México: UAEM.
?=,5*<,5;965(*065(3*65,0** 204
TIC’s, implicaciones en el ámbito electoral

>OP[HRLY9LN !,SÄUKLSHWYP]HJPKHK*}TV
la vigilancia total se está convirtiendo en realidad.
España: Paidós.

SOBRE LOS AUTORES


Luis Alfonso Guadarrama Rico. Doctor en
Comunicación. Profesor de tiempo completo en
la Facultad de Ciencias Políticas y Sociales de
la UAEM. Lidera el Cuerpo Académico: Estudios
interdisciplinarios sobre planeación, desarrollo y
calidad de vida. Integrante del Sistema Nacional
de Investigadores. Autor de artículos y libros sobre
comunicación, familia y uso de TIC.
Jannet Valero Vilchis. Maestra en Comunicación.
Profesora de tiempo completo en la Facultad de
Ciencias Políticas y Sociales de la UAEM. Integrante
del Cuerpo Académico: Estudios interdisciplinarios
sobre planeación, desarrollo y calidad de vida.
Autora de textos sobre comunicación, sexualidad
adolescente y uso de TIC en jóvenes escolarizados.

?=,5*<,5;965(*065(3*65,0** 205
?=,5*<,5;965(*065(3*65,0**

?=,5*<,5;965(*065(3*65,0**

Capítulo 2.
Comunicación Política
y Legislación

Coordinadora: Dra. María Teresa Nicolás Gavilán.


Análisis de la opinión pública, a
partir de la imagen proyectada
por candidatos a gobernador
de Puebla, México, durante
el proceso electoral 2010
Ana Karen Márquez Castro
Alejandro Iván Vázquez Álvarez
UNIVERSIDAD AUTÓNOMA DE PUEBLA

Resumen
 
Durante el proceso electoral realizado en el mes de Julio de 2010 para la gubernatura en el es-
tado de Puebla, México, el manejo de la imagen política implicó una relevancia especial para la
generación de la opinión pública respecto a los candidatos de los dos partidos políticos de mayor
presencia en la entidad, Partido Acción Nacional (PAN) que presentó una candidatura en alianza
con los partidos de la Revolución Democrática (PRD), Nueva Alianza (PNA) y Convergencia (PC)
bajo el nombre de “Compromiso por Puebla” y el Partido Revolucionario Institucional (PRI) que
también presentó una candidatura común en alianza con el Partido Verde Ecologista Mexicano
(PVEM) bajo el nombre de “Puebla Avanza”.

El manejo estratégico de campañas a partir de la imagen proyectada en medios impresos, aporta


SHWVZPIPSPKHKKLYLHSPaHY\UHUmSPZPZKLZKLSHWLYZWLJ[P]HKLSVZLSLTLU[VZX\LJVUÄN\YHU\UH
opinión respecto de los candidatos en el ánimo de los electores. Con base en lo anterior, se pro-
pone la aplicación de un modelo de análisis que permita discernir acerca del uso de los medios
impresos en las campañas electorales, así como la incidencia del manejo de la imagen política
como un factor que incide en los resultados de procesos electorales.

1.   Introducción.
El presente trabajo propone analizar la imagen
La prensa escrita en procesos electorales participa proyectada de los candidatos a partir del manejo
en dos maneras, en primer lugar realiza la labor de de la información publicada en medios impresos,
difundir información de interés público en relación JVUSHÄUHSPKHKKLPKLU[PÄJHYSHYLSHJP}UX\LL_PZ[L
al proceso, simultáneamente proyecta una imagen entre esa imagen y la generación de una opinión
construida en función de objetivos políticos, que KLWHY[LKLSVZLSLJ[VYLZ`X\LW\LKLYLÅLQHYZLLU
ZLYLÅLQHLUSHMVYTHKLWYLZLU[HYSHPUMVYTHJP}U los resultados electorales.
Análisis de la opinión pública, a partir de la imagen proyectada
por candidatos a gobernador de Puebla, México

Para desarrollar este estudio es indispensable Cuadro No. 2


revisar conceptos fundamentales de incidencia
en procesos políticos. En este sentido se propone Actores políticos
como eje de análisis a la participación ciudadana
y a la opinión pública por tratarse de conceptos
YLSHJPVUHKVZ JVU SH PUÅ\LUJPH X\L [PLULU SHZ
personas en su entorno político.

A partir de su incorporación a los programas


académicos relativos al estudio de las ciencias
políticas y de la administración pública a mediados
del decenio de 1990, el enfoque de políticas
Es pertinente puntualizar que el Partido del Trabajo
públicas se ha ido insertado con cada vez mayor
(PT) también está participando en la contienda
incidencia en el lenguaje de los actores políticos en
electoral, pero debido al bajo porcentaje de
México, estando presente de manera preeminente
votación que ha recibido históricamente, no se
en la forma en la que éstos se proponen describir
considera para el objeto de estudio del presente
la forma que ha adoptado su relación con los
análisis, debido a que la competencia real se
ciudadanos, enfatizando el hecho de que las
presenta entre las dos alianzas “Puebla avanza” y
decisiones públicas no son posibles si no cuentan
“Compromiso por Puebla”.
con la participación ciudadana que las promueve,
retroalimenta e incluso evalúa, favoreciendo su
Se implementó una metodología de triangulación,
continuidad o en sentido inverso, propiciando su
combinando el análisis de discurso de las líneas
HKLJ\HJP}U V TVKPÄJHJP}U WHYH YLZWVUKLY H SHZ
KLVWPUP}UYLÅLQHKHLUSHZWYPTLYHZWSHUHZKLSVZ
expectativas reales de solución a los problemas
diarios metropolitanos y el número de menciones
para los cuales fueron gestadas e incluidas en la
[V[HSLZ PKLU[PÄJHUKV SHZ ]HYPHISLZ KL PTHNLU
agenda pública.
política de los diferentes actores de la contienda
electoral. Los diarios consultados durante este
2.   Metodología proceso fueron: El Sol de Puebla1, Milenio2, La
Jornada de Oriente3.
Para desarrollar esta investigación se realizó un Análisis de imagen política en campaña y opinión
análisis comparativo entre las dos principales pública en campaña
fuerzas políticas de la ciudad de Puebla, por
1 El sol de Puebla, es un periódico perteneciente a la
\U SHKV LS VÄJPHSPZ[H 7HY[PKV 9L]VS\JPVUHYPV Organización Editorial Mexicana (OEM) que aparece en 1944 y
Institucional (PRI) alianza “Puebla Avanza” y por cuenta con un tiraje de 45,000 ejemplares diarios, además de su
versión en Internet.
el otro la oposición apoyada desde la presidencia 2 El corporativo Milenio cuenta desde 1965 con su edición
impresa que el día de hoy distribuye 13, 561 ejemplares, además de
de la república, el Partido Acción Nacional (PAN), una versión on-line, también cuenta con Milenio TV.
alianza “Compromiso por Puebla”, los actores 3 La jornada de oriente desde hace 18 años se coloca
como uno de los principales periódicos de la zona al contar con un
políticos que fueron considerados para hacer el tiraje diario de 14, 671 ejemplares.
análisis son:
?=,5*<,5;965(*065(3*65,0** 208
Análisis de la opinión pública, a partir de la imagen proyectada
por candidatos a gobernador de Puebla, México

La instrumentación de las variables de los elementos


estructurales se describe en los cuadros 3 y 4.

Análisis de la imagen política y análisis de la opinión


publicada en campaña.
La instrumentación de las variables de los
elementos operativos se describe en los cuadros
7y8

Opinión publicada /dimensiones de la imagen


política
La instrumentación de las variables de los
elementos funcionales se describe en los cuadros
5 y 6.

?=,5*<,5;965(*065(3*65,0** 209
Análisis de la opinión pública, a partir de la imagen proyectada
por candidatos a gobernador de Puebla, México

El periódico El Sol de Puebla resulto ser el que


público en más ocasiones a favor de la coalición
Puebla Avanza.

(JVU[PU\HJP}UZLWYLZLU[H\UHNYmÄJHLUKVUKL
se ilustra la cantidad de espacios que le dieron a
cada candidato los tres periódicos que analizamos
en este proyecto.
Percepción de la imagen política en campaña y
resultado de las elecciones

La instrumentación de las variables de los


elementos complementarios requiere que se
implementen sondeos de opinión acerca de cómo
son percibidos los candidatos en la contienda
electoral.

Líneas de opinión
3. Análisis de resultados:

3VX\LZLYLÅLQHLUSHSxULHKLVWPUP}UUVLZSVX\L
En primera instancia es importante hacer referencia
la persona quiere mostrar, sino lo que los medios
de la cantidad de espacios que han tenido los
publican al darse algún hecho periodístico. Las
partidos políticos analizados en la prensa escrita.
ideas que se plasman a partir de una actividad de
,U SH NYmÄJH X\L LUJVU[YHTVZ H JVU[PU\HJP}U
campaña se convierten en imaginarios que forman
ubicamos a la alianza Puebla Avanza como la
la opinión pública.
coalición que recibió un mayor seguimiento de
la prensa en el estado, con un total de 8,619
De acuerdo con esto, los temas más importantes
impactos mediáticos contra 7,076 de la alianza
para el ciudadano fueron ubicados en las
Compromiso por Puebla.
plataformas políticas de cada partido.

?=,5*<,5;965(*065(3*65,0** 210
Análisis de la opinión pública, a partir de la imagen proyectada
por candidatos a gobernador de Puebla, México

Las plataformas de ambas coaliciones resultan candidato se dio más en reuniones con líderes
similares, pues los temas de agenda para la sectoriales, organizaciones de trabajadores y otros
sociedad poblana ya estaban establecidos en tipos de agrupaciones que permiten pensar en un
función de la plataforma utilizada por los partidos voto sectorial. De modo que el trabajo en tierra no
contendientes desde el proceso electoral federal fue tan notorio.
del año 2009, siendo estos, la economía y el
apoyo a la mujer, créditos y proyectos productivos; El cuadro No. 9 muestra algunas de las cabezas
canasta básica a mejores precios; educación y o titulares más importantes y que impactaron
becas para estudiantes, útiles escolares gratis, directamente en las preferencias de los electores
apoyo a sectores vulnerables y comunidades sobre los candidatos.
indígenas.

El tratamiento de los temas es más accesible,


pero con mayor seriedad. El candidato de la
alianza “Puebla avanza” en general, se ha visto
preparado en cuanto a su discurso y la transmisión
de sus propuestas centrándose en temas clave,
proponiendo más que discutiendo. Lo anterior ha
contribuido a impactar en los electores, teniendo
\UH TH`VY PKLU[PÄJHJP}U KL Z\ PTHNLU JVTV
aspirante al cargo de representación.

A pesar de que ambos candidatos tuvieron temas


en común en sus propuestas, fue el de la alianza
“Puebla Avanza” quien encontró los puntos clave
que eran del interés de la población. Esta alianza
ha logrado hacer llegar a la población temas que
eran parte de su preocupación cotidiana, que
debían ser resueltos y que son atribuciones del
gobernador, de tal manera que sus mensajes
fueron mejor recibidos que los del candidato de la Imagen política de los candidatos:
alianza “Compromiso por Puebla”.
La imagen de los candidatos fue notoriamente
La alianza “Compromiso por Puebla”, pese a la institucional aunque con un cambio de imagen
similitud de temas y propuestas, se distrajo en de los dos partidos mucho más fresco respecto
la campaña haciendo énfasis en los ataques y al proceso electoral federal del año 2009, con
la respuesta de comentarios de ciertos actores lineamientos muy precisos sobre el uso de camisas,
políticos de la alianza adversaria. El trabajo del gorras y demás distintivos y publicidad.

?=,5*<,5;965(*065(3*65,0** 211
Análisis de la opinión pública, a partir de la imagen proyectada
por candidatos a gobernador de Puebla, México

El candidato de la alianza “Puebla avanza” se vio El análisis de las variables de imagen política
más cercano a la gente, el candidato y su equipo permite obtener las siguientes conclusiones:
de trabajo visten pantalones de mezclilla y playeras
LU \U YVQV T\` SSHTH[P]V LZ[V  YLÅLQH KPUHTPZTV
y energía. El uso de elementos promocionales
es importante pues llama la atención del elector,
así como el eslogan que maneja la campaña del
candidato priista “Con Zavala Puebla gana” este
eslogan ha permitido que él candidato tenga
mayor contacto con las personas, logrando un
posicionamiento más rápido entre la población.

El candidato de la alianza “Compromiso por Puebla”


maneja una imagen más fresca comparada con la
imagen que proyectaron en campañas anteriores
sus compañeros de partido, su vestimenta es de
WHU[HS}UKL]LZ[PY`JHTPZHHa\SJPLSVLZ[VYLÅLQH
seriedad y compromiso. El uso de sus elementos
promocionales es diferente a los que ha presentado
el PAN en campañas anteriores, se muestran con
más colores, a pesar de esto, el posicionamiento
que tiene es menor comparado con el candidato
de la otra alianza.
La imagen y las propuestas son importantes en
Con base al anterior análisis, se puede determinar su conjunto porque legitiman el quehacer del
que el candidato de la alianza “Compromiso por candidato, cuando no son congruentes en su
Puebla”, no ha logrado posicionarse estando PU[LYYLSHJP}ULSJHUKPKH[VYLÅLQHKLZJVUÄHUaH`LZ
a casi 5 días de la elección, obteniendo menor escasa la aceptación que recibe por parte de los
reconocimiento entre los electores que el candidato electores.
de la alianza Puebla avanza. ,ULZ[LHUmSPZPZZLPKLU[PÄJHX\LSHHSPHUaH¸7\LISH
Avanza” proyectó una imagen sólida, dinámica y de
El candidato de la alianza “Puebla Avanza” ha compromiso; relacionada con una plataforma seria,
logrado posicionarse de una manera más clara transmitida puntualmente con temas de interés
entre los electores tradicionales y contribuyó para la sociedad, lo que favoreció su aceptación
a generar un mayor grado de conocimiento por y reconocimiento, así como la ampliación de
parte de la población. propuestas plasmadas en la publicidad, que hizo
más presente al candidato en toda la entidad.
La imagen de la alianza “Compromiso por Puebla”
?=,5*<,5;965(*065(3*65,0** 212
Análisis de la opinión pública, a partir de la imagen proyectada
por candidatos a gobernador de Puebla, México

se apoyó en un cambio visual, ya que cada uno El cambio en la imagen durante el último mes de
de los elementos que se hizo presente durante la campaña
elección cambiaron la percepción del electorado A raíz de una actividad de campaña del candidato
y propició que existiera más cercanía con los de la coalición “Compromiso por Puebla” Rafael
ciudadanos, también se vio más presente en cuanto Moreno Valle, se dio un cambio en toda la imagen
a publicidad distribuida y la gama de colores que de la publicidad que manejaba hasta el momento,
implementaron, esto ha contribuido a mejorar su esto sucede al empezar el mes de junio, último
posicionamiento al candidato preferentemente en mes de campaña.
la ciudad y en menor medida en las comunidades +PJOHHJ[P]PKHKM\LSHÄYTHHU[LUV[HYPVW‚ISPJVKL
aledañas. los compromisos de campaña que el candidato
Rafael Moreno Valle hizo para legitimar su propuesta
Consideraciones del entorno: y generar empatía con las personas.
El cambio de imagen consistió en aparecer en la
Alianza publicidad y en los medios, con una vestimenta
En esta ocasión los candidatos a la gubernatura formal, como lo es un traje y una camisa color azul
del estado de Puebla no fueron candidatos de un cielo.
solo partido. A lo largo de la república se gesto (J[V ZLN\PKV KL SH ÄYTH KL JVTWYVTPZVZ M\L
una alianza opositora al PRI, que fue formada el aumento en la intención del voto a favor del
por el Partido Acción Nacional, conocido por su candidato de “Compromiso por Puebla”.
tendencia de derecha, el Partido de la Revolución Por otro lado Javier López Zabala, mantuvo una
Democrática, de izquierda, el Partido Convergencia misma línea de imagen durante toda su campaña. Y
y el Partido Nueva Alianza. De acuerdo a las si habláramos de algo que le haya dado un repunte
ideologías de estos partidos la alianza resulto a este candidato, esto puede ser la presencia de
controversial y con escaso reconocimiento de personas del medio artístico y político durante la
parte de la sociedad. YLJ[H ÄUHS KL SH JHTWH|H KPJOHZ WLYZVUHSPKHKLZ
fueron, entre otras, Angélica Rivero (Actriz), Joan
Ataque a la campaña Sebastián (Cantante), José Manuel de la Torre
El día 24 de mayo los medios de comunicación (Técnico de Futbol) y Enrique Peña Nieto (Figura
más importantes del estado de Puebla sacaron a del partido PRI).
la luz una noticia que ha afectado al candidato de
la alianza “Compromiso por Puebla”, acusándolo El debate
de fraude durante su función como Secretario de El 16 de junio se da el tan ansiado debate que
Finanzas y Desarrollo Social, causando ataques “Compromiso por Puebla”, propuso y en el
constantes de los medios. Esto ha provocado una que esperaba lograr desvanecer los 7 puntos
coyuntura entre el electorado y el candidato, que porcentuales que lo alejaban del candidato Javier
WVZPISLTLU[LZL]LYmYLÅLQHKHLUSHZ\YUHZ López Zavala. El dia posterior al debate los medios
de comunicación, expresaron que el vencedor
había sido el candidato de “Puebla Avanza” Javier

?=,5*<,5;965(*065(3*65,0** 213
Análisis de la opinión pública, a partir de la imagen proyectada
por candidatos a gobernador de Puebla, México

López Zavala, dejando muchas dudas y muy clara Conclusiones


la tendencia que manejan.
El debate había sido acordado para ser limpio y La importancia de la imagen política en la estrategia
de exposición de propuestas, pero termino siendo de ambos candidatos, en su mayoría está basada
un circo de acusaciones que no aporto nada a la en un adecuado diseño de imagen institucional
sociedad mas que chismes, chistes e imputaciones que está permeando entre los electores.
nada sanos, mucho menos cuando se está en la
búsqueda de abatir el abstencionismo, no solo a Un punto importante que se observó en el desarrollo
nivel estatal, sino federal. de la investigación fue el de la editorialización de
las notas que favorecen al candidato de la alianza
Sobre las Encuestas “Puebla Avanza”, ya que como resultado de este
Hablar sobre ventajas contundentes o puntos HUmSPZPZ ZL PKLU[PÄJH X\L ZL [YHUZTP[PLYVU \UH
WVYJLU[\HSLZ LZWLJxÄJVZ KL KPMLYLUJPH LU[YL \U mayor cantidad de mensajes propagandísticos
candidato y otro resulta muy complicado. Las del Partido Revolucionario Institucional, en este
encuestas de diferentes casas que se encargaron sentido medios como El Sol de Puebla, funge
de medir la temperatura electoral en el estado son como un órgano de comunicación con estrechos
T\`WVJVJVUÄHISLZSHTH`VYxHM\LYVUTHUKHKHZ vínculos con el gobierno estatal, que se encarga
a hacer por uno u otro contendiente, arrojando de ampliar la cobertura mediática que se hace
resultados diversos y cambiantes. Un día los al candidato de la alianza “Puebla Avanza”,
números podían estar a favor de un candidato y al mientras que los espacios publicitarios del la
día siguiente el contrario, podía tener una ventaja alianza “Compromiso por Puebla” se centran en
avasalladora. la presentación de propuestas, en el refuerzo de
De tal modo que fue complicado estimar una una imagen positiva y de compromiso y trabajo
evolución real en la intención del voto del electorado por parte del candidato, no obstante lo anterior
poblano. Los medios impresos publicaban los los electores que tradicionalmente sufragan por
JHTIPVZLUSVZWVYJLU[HQLZ`HÄYTHIHU[LULYLUZ\ el PAN ahora integrado a la alianza “Compromiso
poder las encuestas que avalaban los resultados, por Puebla” no han sido disminuidos por la imagen
pero nunca fueron publicadas, solo mencionadas. proyectada por el candidato de la otra alianza.
Los únicos resultados que nos resultaron tangibles
fueron los de la casa encuestadora “BEAP Los eventos de campaña o mítines fueron eventos
Estadística & Opinión Pública”. Resultando ser con mucha cobertura por parte de la prensa y
[LUKLUJPVZVZ ` UV [HU ÄKLKPNUVZ +L [HS TVKV sin duda grandes demostraciones del uso de
que nos queda el análisis de la experiencia para mercadotecnia e imagen política de los candidatos.
HÄYTHYSHZP[\HJP}UU\TtYPJHLULZ[HZLSLJJPVULZ Los eventos de la alianza “Puebla Avanza” fueron
Siendo que después de la consulta de diversos muy concurridos, y el candidato trabajaba haciendo
medios, a quince días de la elección Javier López recorridos con los habitantes de las distintas
Zavala, aventaja al candidato de “Compromiso por zonas que visitaba. El voto tradicional priista ha
Puebla” Rafael Moreno Valle por entre 7 y 9 puntos sido una constante en las últimas elecciones y la
porcentuales.
?=,5*<,5;965(*065(3*65,0** 214
Análisis de la opinión pública, a partir de la imagen proyectada
por candidatos a gobernador de Puebla, México

movilización de las bases del partido se ha hecho Finalmente cabe señalar que la posibilidad de
presente, dejando ver la aceptación del partido en trascender éste hecho radica en la viabilidad de
la sociedad. generar una ciudadanía crítica y participativa, sin
embargo la apatía del ciudadano común, así como
Mientras que el candidato Moreno Valle trabajo SHI‚ZX\LKHKLILULÄJPVZKPYLJ[VZLULSJVY[VWSHaV
su campaña reuniendo a miembros de distintos por parte de los escasos grupos organizados que
sectores y su trabajo directo con las personas no existen en Puebla, implica la escasa expectativa
M\L[HUUV[VYPVYLÅLQHUKV\UHPTHNLUHSLQHKHKL de que esta situación sea superada y surja una
la gente. ciudadanía efectiva y participativa que promueva
la generación de condiciones que favorezcan el
El voto de castigo a la alianza “Compromiso por desarrollo político y social en Puebla.
Puebla” por los eventos suscitados a raíz de las
acciones del gobierno federal, se ha intentado Referencias
disminuir, evitando mostrar los logotipos de los
partidos que conforman su coalición en toda su Argueta, F. y Esparza J.(2009) La comunicación
publicidad, por tanto la creación de un nuevo estratégica en el diseño e implementación
logo de la alianza fue importante para sacar del de políticas públicas intermunicipales: caso
imaginario de las personas al PAN y PRD. Región Angelópolis, (documento en proceso de
integración) BUAP, México.
En correspondencia con lo propuesto a lo largo
KL LZ[L YLWVY[L KL PU]LZ[PNHJP}U ZL PKLU[PÄJH \U Arroyo, I. (2001) La legitimidad fragmentada,
control mediático de parte del gobierno del estado, transición e institucionalidad en Puebla. BUAP,
X\LPUÅ\`LLUSHNLULYHJP}UKLVWPUP}UW‚ISPJHLU México.
el Estado de Puebla. Esta situación se presenta de
manera preferente en épocas electorales. Fernández. C. (2007) Marketing político e imagen
de gobierno en funciones, Mc Graw Hill, Méxcico.
A pesar de los resultados obtenidos en esta
investigación, el resultado de la contienda electoral León, S. et al. (2008) Libertad Secuestrada. CIMAC
resulta contradictorio a lo esperado de acuerdo a y Fundación Friedrich Ebert. México.
la imagen y la opinión pública, es decir, no existe
una correspondencia entre estos elementos y el Martín. L. (2002) Marketing Político. Paidós.
resultado que señala a Rafael Moreno Valle como el Barcelona, España.
vencedor con un total de 1, 111, 318 votos contra
883, 285 del candidato Javier López Zavala, los Masi, O. (2001) Comunicación gubernamental.
porqué de esta situación pueden ser investigados Paidós. Buenos Aires, Argentina.
en otra momento y se deberán considerar factores
además de los presentados en esta trabajo para Ochoa, O. (2000) Comunicación política y opinión
llegar a conclusiones concretas del resultado. pública. Mc. Graw Hill. México.
?=,5*<,5;965(*065(3*65,0** 215
Análisis de la opinión pública, a partir de la imagen proyectada
por candidatos a gobernador de Puebla, México

Paredes, A. (2005) Imagen Política, En Imagología.


Grijalbo. México.

SOBRE EL AUTOR
Ana Karen Márquez Castro y Alejandro Iván Váz-
quez Álvarez. Alumnos investigadores, estudiantes
de la Facultad de Ciencias de la Comunicación de
la Benemérita Universidad Autónoma de Puebla.

?=,5*<,5;965(*065(3*65,0** 216
Análisis del impacto de los
procesos comunicativos
en el interés ciudadano
hacia la política en México
Carlos Muñiz
UNIVERSIDAD AUTÓNOMA DE NUEVO LEÓN

Resumen
Son numerosos los estudios que en diversos países han analizado el interés demostrado hacia la
  
política por parte de la población. Se ha constatado igualmente que uno de los factores explicati-
vos de esta mayor o menos implicación en política puede venir dada por el consumo de noticias
y programas que transmiten los medios de comunicación. En este contexto, el estudio analizó
los datos ofrecidos por la cuarta Encuesta de Cultura Política (ENCUP) realizada en 2008 con una
muestra representativa de México. Los resultados muestran una clara relación entre el desarrollo
de comunicación interpersonal y el consumo de contenidos políticos con el interés hacia la po-
lítica por parte de la población mexicana. Además, se constata cómo el desarrollo de conversa-
ciones sobre esta temática generaba mayor implicación con el mundo político. Se discuten los
YLZ\S[HKVZLULSTHYJVKLSVZWVZPISLZLMLJ[VZX\LLZ[HZLZ[YH[LNPHZ[LUNHULUSHZVÄZ[PJHJP}U
política de la población mexicana.

Palabras clave
Consumo mediático, conversación política, interés político, implicación, encuesta

Marco teórico McCombs y Evatt (1995) proponen que los


Prácticas comunicativas y políticas en México medios cumplen dos tipos de roles informativos:
El papel que los medios de comunicación alertan al público acerca de los acontecimientos y
tienen en la conformación de democracias más cambios que están teniendo lugar en el entorno,
estables es claro (Avery, 2009), estableciendo cumpliendo así una función indicadora, pero
puentes entre el sector político y gran parte de la también son traductores de los lenguajes, es decir,
sociedad, la cual sin su labor no podría llegar a hacen comprensibles las noticias para una gran
conocer o incluso entender los principales hechos parte del público que la consume. Sin duda, los
acaecidos en la esfera política. En este sentido, temas políticos constituyen un terreno donde estas
Análisis del impacto de los procesos comunicativos en
el interés ciudadano hacia la política en México

funciones de los medios tienen lugar, al traducir programas periodísticos (45%) o espacios de sátira
el lenguaje del discurso público, difícil y poco política, como El privilegio de mandar seguido por
comprensible para la mayor parte de las personas el 30% para informarse durante las elecciones.
al no estar familiarizadas con él.

Teorías del impacto mediático sobre las


Es por tanto de esperar que para una
gran parte de la sociedad, su único conocimiento actitudes políticas
político provenga de los contenidos que los
medios de comunicación le transmiten sobre Existe abundante evidencia empírica
la actualidad, favoreciendo así su compromiso del impacto que el consumo de los medios de
cívico. Pero, por desgracia, muchas veces los comunicación tiene sobre ciertas manifestaciones
medios de comunicación realizan un tratamiento de la cultura política, tales como el interés,
informativo pobre de la política, presentando el participación o implicación políticas (Avery,
JVUÅPJ[V ` SH ULNH[P]PKHK SV X\L W\LKLU PTWSPJHY 2009; Cappella y Jamieson, 1997; Hollander,
una disminución en los niveles de compromiso 2007; Rojas, 2006; Schreiber y García, 2004;
cívico, interés público y participación política Valentino, Matthew, Beckmann y Buhr, 2001). Los
de la sociedad, lo que conlleva una enfermedad WYPTLYVZ LZ[\KPVZ ZVIYL SH PUÅ\LUJPH TLKPm[PJH
democrática. en especial de la televisión, sobre los aspectos
políticos plantearon un fuerte efecto negativo,
En períodos electorales, como el ocurrido X\L YLK\UKHIH LU NLULYHJP}U KL KLZJVUÄHUaH
en 2006 durante la elección presidencial, es alienación y desinterés entre la audiencia con
LZWLYHISL X\L LS JVUZ\TV TLKPm[PJV JVU ÄULZ respecto a la política. Es en estos momento cuando
PUMVYTH[P]VZH\TLU[L(ZxSVYLÅLQH(I\UKPZ comienzan los postulados del malestar mediático
quien señala que la televisión fue en ese período (media malaise) (Rojas, 2006). En 1975 Robinson
el medio más utilizado por los mexicanos para propone la tesis del videomalestar (Schreiber y
enterarse de las campañas políticas y elecciones, García, 2004), señalando que la negatividad y
marcado así por el 58% de los encuestados. El JVUÅPJ[V JVU SVZ X\L UVYTHSTLU[L ZL WYLZLU[HU
segundo lugar lo ocuparon los periódicos y la radio las noticias sobre política, especialmente en
con el 32% respectivamente, siendo Internet el SH [LSL]PZP}U TLUVZJHIHU SH JVUÄHUaH LU SVZ
medio menos utilizado, pues sólo un escaso 7% gobiernos, instituciones, sistema, etc. (Avery, 2009).
dijo haberse informado a través de sus contenidos. Esta propuesta ha sido seguida, especialmente en
La conversación política con familiares (24%) el ámbito norteamericano por Cappella y Jamieson
o con amigos (22%) fue una práctica realizada (1997), cuyos estudios han sido abordados por
por una buena parte de la población, si bien se otros autores tanto en Norteamérica (Valentino et
observa que dista de ser el mecanismo principal al., 2001) como en Europa (de Vreese, 2005; de
KLPUMVYTHJP}U,UJ\HU[VHSJVU[LUPKVLZWLJxÄJV Vreese y Elenbaas, 2008).
visto en la televisión, destacaron las noticias (53%),
si bien también fue importante la atención a otros

?=,5*<,5;965(*065(3*65,0** 218
Análisis del impacto de los procesos comunicativos en
el interés ciudadano hacia la política en México

Desde la teoría del framing, Cappella y democracia” (Kim, Wyatt y Katz, 1999, p. 362).
Jamieson (1997) plantearon que el tratamiento Ello se debe a que junto a la conversación política
de la información política, especialmente durante realizada con quienes tienen ideas similares, y que
campañas electorales, se realiza desde dos HWYPVYPW\LKLWYVK\JPYTH`VYWSHJLYHSJVUÄYTHY
posibles enfoques: el estratégico, que conlleva las ideas previas, también se da con quienes
enfocarse en los aspectos negativos, de piensan de forma diferente, estableciéndose así
enfrentamiento entre candidatos, los sondeos, un diálogo público que promueve el aumento
etc., o el temático, que implica dar información del conocimiento político, complejidad cognitiva
sobre las propuestas de los candidatos y partidos. e integración social (Rojas, 2006). En su estudio,
Los resultados de su estudio mostraron que el uso Kim et al. (1999) detectaron que el consumo de
del enfoque estratégico genera en los ciudadanos los medios para buscar información temática
KLZJVUÄHUaH`JPUPZTVWVSx[PJV:PULTIHYNVSVZ genera mayor conversación política. Por su parte,
resultados de éste y otros estudios posteriores no esta conversación propiciaba, frente al consumo
son del todo consistentes (Rojas, 2006), pues se mediático, mayor participación política de los
ha detectado que el consumo mediático también sujetos investigados.
puede conllevar efectos positivos a nivel político.
Esta es la idea de Norris (2000), quien plantea
Investigación sobre el impacto mediático
la teoría del círculo virtuoso, rompiendo así con
la noción lineal del efecto mediático sobre las en México
actitudes políticas. De esta manera, se presupone
que aquellas personas más activas políticamente Como ocurre en otros terrenos de la
hablando serán las que accederán en mayor PU]LZ[PNHJP}U JPLU[xÄJH TL_PJHUH SHZ YLSHJPVULZ
medida a contenidos informativos para acrecentar entre consumo de medios y actitudes políticas no
su información sobre política, generando a su vez han sido abordadas de forma empírica y sistemática
mayor activismo político en todas sus facetas: anteriormente, constituyendo los únicos referentes
PU[LYtZJVUÄHUaHWHY[PJPWHJP}UL[J encontrados varios estudios que han abordado el
asunto de forma adyacente. Es el caso del estudio
Pero, no sólo el consumo mediático provoca panel realizado por Moreno (2008) con motivo
un efecto sobre las actitudes políticas, también se de las elecciones presidenciales de 2006, donde
ha detectado que las prácticas conversacionales se evaluó el impacto que tuvo el seguimiento de
tienen impacto sobre el aumento del interés, el UV[PJPHZ ZVIYL SH JVUÄHUaH LU JPLY[VZ HZWLJ[VZ
ZLU[PTPLU[V KL LÄJHJPH WVSx[PJH ` SH WHY[PJPWHJP}U de índole político o electoral. El autor detectó que
cívica y, especialmente, política (Rojas, 2006; Shah, la búsqueda de información política a través de
Cho, Nah, Gotlieb, Hwang, Leem, … McLeod, noticias en televisión, prensa y radio impactaba
2007). Aunque la conversación política se desarrolla LU SH KLZJVUÄHUaH JVU LS WYVJLZV LSLJ[VYHS KL
LULSmTIP[VKLSHLZMLYHWYP]HKHZ\PUÅ\LUJPHZVIYL  $W#NLULYHUKVTH`VYHWV`VH
la esfera pública es básica, llegándose a considerar TLKPKHZJVTVSHPTW\NUHJP}UKLSVZYLZ\S[HKVZ 
como un “bloque constructivo fundamental de la $W#SHZTV]PSPaHJPVULZHU[LSVZTPZTVZ

?=,5*<,5;965(*065(3*65,0** 219
Análisis del impacto de los procesos comunicativos en
el interés ciudadano hacia la política en México

  $  W #  V SH JYLLUJPH KL X\L O\IV \U principal conocer si en el contexto mexicano este
JVTWSV[K\YHU[LSHZLSLJJPVULZKL $W proceso también se está produciendo. Y, más en
#7LYVLSTPZTVJVUZ\TV[HTIPtUPTWHJ[V concreto, saber cómo y en qué grado los hábitos
WVZP[P]HTLU[LLUSHJVUÄHUaHOHJPHSHZPUZ[P[\JPVULZ comunicativos de la población mexicana, frente
` SVZ WYVJLZVZ KLTVJYm[PJVZ   $  W #  a otros factores posibles, están afectando en el
observándose por tanto que las personas con interés hacia la política. Ello debido al importante
implicación e interés político independientemente papel que el interés juega en cualquier ámbito de
de su orientación ideológica buscaron en mayor la vida de las personas, y obviamente, también
medida los medios como factor de información en el político. Es de esperar que las personas
para generar o reforzar sus ideas al respecto de más interesadas sean también quienes busquen
los acontecimientos, ya estuvieran a favor o en en mayor medida información en los medios,
contra de ellos. conversen sobre política más habitualmente
con otras personas y tenga niveles mayores de
*LU[YHKV LULSHUmSPZPZKLSHPUÅ\LUJPHKLS participación cívica. Sin embargo, y siguiendo los
consumo mediático sobre la participación cívica, se postulados del círculo virtuoso, estas variables
sitúa el trabajo realizado por García Luengo y Ruiz también pueden generar un aumento en el interés
(2007), quienes se basaron en datos obtenidos WVSx[PJV`WVYLUKLLUSHZVÄZ[PJHJP}UWVSx[PJH7VY
de la World Value Survey (WVS) realizada en el ello, el presente estudio se plantea las siguientes
año 2000 para realizar su estudio. Los resultados preguntas de investigación que se tratarán
mostraron cómo el mayor predictor del activismo de responder a partir del análisis de los datos
político era el nivel educativo, seguido por la edad. obtenidos sometidos a investigación:
Mientras que la exposición mediática se mostró
como una variable no explicativa del modelo. Un PI1: ¿Existe un impacto de la exposición
análisis del consumo mediático y el desarrollo de a los medios sobre el interés político y, en
una socialización política entre estudiantes de caso de darse, qué medio contribuye en
primaria y secundaria de la Ciudad de México, mayor medida a este efecto?
mostró que la exposición a la información política
de los medios es baja (49.3%) o media (37.4%) PI2: ¿Qué hábito comunicativo tiene un
y que sólo el 10% de los estudiantes mostraba mayor impacto en el interés político de
un alto grado de consumo de esta información las personas, la comunicación masiva o la
(Nateras, 2007). El estudio no arrojó datos al comunicación interpersonal?
respecto de la relación existente entre las variables
de consumo y las relativas al nivel de socialización
política entre la muestra estudiada.
Metodología
Tomando en cuenta la revisión de la literatura
Sujetos participantes en el estudio
anterior, que marca el importante papel jugado por
los medios en la generación de actitudes políticas,
el presente trabajo se plantea como objetivo

?=,5*<,5;965(*065(3*65,0** 220
Análisis del impacto de los procesos comunicativos en
el interés ciudadano hacia la política en México

Para la realización del estudio, se utilizaron H J\LZ[PVULZ KL [PWV ZVJPVKLTVNYmÄJV KL SVZ
los datos correspondientes a la Encuesta Nacional participantes en el estudio. En este sentido, se les
sobre Cultura Política y Prácticas Ciudadanas, preguntó al respecto de su sexo y edad, cuyas
realizada por la Secretaría de Gobierno de México1. datos han sido aportados anteriormente. Además,
Esta encuesta se viene aplicando desde 2001 y se evaluó su nivel educativo, preguntándoles
los datos utilizados en este trabajo corresponden para ello