You are on page 1of 9

https://www.dna20.com/genedesigner2/index.php?

pageID=216 -
standard genetic code

http://www.bioinformatics.org/sms2/primer_map.html - bacterial
genetic code
>primer map

(Shine-Dalgarno) AGGANNNNNN,
(P63F) AACTTTGGTTGGAGCCCGGCAG,
(P63R) ATCGACACTCGATGCACTCACTAGG,
(K63F) GTGGGTTACCCCTTGTCGGATCCTGAAAAT,
(F63-10) ACGAAGAGCGGCCACATGACTC,
(R63-10) GTCGGCCACCAGACCTGTGT

Positions 1-10943 of reverse complement of contig063 from


454Largecontigs_edited.fas file

GCCTAAACGAGGTGAGGGAACTAACCGAAAGCTGGATTAGGGAATACAACG
AAGAGCGGCCACATGACTCGCTGGGGGATCTGACTCCCTGGGAGTATCTG
GCCAAACATGAGCAGCTGGAAAACTCTAATTATACGTGTCACTAATTAGGGG
TGGTTTACATTTAAGGCAAGTGGATCTTCTAGTTACGTGTCCTCCTAATAAC
TAAAGCTTTGAAGTTGGTAGTTACTTATTTTTTCAAGCTCCGTAAAGTATCA
AATTACTTCTGTTTACATGATAGTATTGCATATCTTAACATCATATGATTAGAT
TAAAAATATATATATGAAATTGGTCATAGCTCCGCATTCATAACCATAATAACG
GCATAGATCTGGGAGATACCCGTGAAAAACTGCATTTTGATTTCACCTTTG
GTATGGGCGCTCTCGGGTGCTTTGTTAGTTGCAGCCTGCACTTCCTCCAC
GAATTTGGATTCTCCCCGGGCGAACGTGGGTTACCCCTTGTCGGATCCTG
AAAATACCGGTGGTTGGGTCCTTAACGCAGACATCAGTGATGAATTTAACG
CTGCACCACTGGATTCCAAGAAGTGGTTTGTGGAGGGGGAAAACGGCGAT
TACTACATCTGGAAAGGACGTCCCCCGTCACAGTTTGCGCCTCATAATGTG
TTTGTTGAGGACGGCAAGTTAAAAATTCGCTCCCAGTGGGAGCCGCATTT
CGACTTTGCCGGAGAAAGCTACGCGGATGGATCCCGCAATGACTCCTATGG
TCGTTACGACGGTCAACCTTTTCCGGTTACAACGGGGGCGGCCATTAGTCG
CAACCGTTTTTTGTACGGCTATATGGAAGTACGTACCAAGGCGGCAGACGC
CGCGATGACCAGCTCTTTCTGGACTATCGGTTATCAGTCCGAGTTGGATAT
CTATGAACAGATGGGAAGGCCTAATATCGAAGGTGATATTACTTCGACTAAT
TGGAAAGCGTCGGTGCATGATTGGCGACCACCGTCAAAGCGGcCAACCCG
TAAGTTTGGCATGAAGGAGGATTTGGGTTTTCGTGTTGCCGATGAATTTCA
TGTCTACGGTGCAGAGTGGGGCGAGGACTATCTAAAGCTCTATCTTAATGG
CGAATTAATGTATGAGGTGACCCAGAAAGACGTAGGGCGTCACTGGGTACT
TACCAACCCGCTGGAAATCTGGTTTGACTCTGAAATTTTCGTCTGGCTCGG
CTTGCCTGATAAAGAAGAGCTACCGGTGGATTACGAAATTGATTATGTGAG
AGTTTGGCAGAAGCCACACCCAAACTTGCTGGCGCGTCACTTCTATGGGTT
TGAAGGCCCATTTTTGTACGAACATCAGCCCAAACCGCTGGATTTGACCCC
GGAAAACCCAACCAACAATGCGTATCAAAAATTTTGGCAGATTCATGACGA
TGCCTCTCAATATTTAGCGGTTGTGCGTCACGAGCAACATTCTGCCGGCAC
CCGGAGTTTGCGGTTTGAATCGCGTGGTGAGGCAGCGACAGCCATTGCCA
CAGCCCCTATGGGAACCATAGATTTAGCACCGGGTAAGTACACTCTTAAAGC
CAAACTTTGGTTGGAGCCCGGCAGTGATTTAAACGCATTAAAAATCGAACT
TAACAATGCCGACACAGGTCTGGTGGCCGACGATGCTGAGTATTTAGCCGC
AGGTCAATGGCACACCCTAGCGCAAACAATCGAATTAACAGAACCCAGCGC
GGCCGAAGAAACCGTAAACATTACTTTTATACAAAGTGAAGCCGGTGCCGA
AACTCGTGCGTATCTGGATGATATATCCATTGAGCATTAATCATCATGGCCTA
GTGAGTGCATCGAGTGTCGATGTATGTTCGTTAATGATAACAAGTTGAGTTT
ATATGAGAGCAATAACTGTAATCCTCGGTTTAGGGCTGCTGAGCACTTTACT
CACGGGCTGTCAAAGCCAGCCAGAAGTTACCAAGGCCATTGTTAGTGAAGG
TTTTGTTTACGCCCAGAACCTTGCTGATAAAAACCGCAATATGCGCAAATG
GGATGCGCCTGCCTTTGCCGATTTGGATCAAGACGGTTGGGTGGATGTGA
TCTTGAATAACCATGGCTACGGTATTCAGATTGTCTGGAACAATCAGGGAGT
TTTAGCAGAGCCGTGGGACTTGCTGATGGGGGATATCCACGGCGTGACCAT
TGGCGACATCGATGCTGACGGTTTGCTTGAGCTGTTGCTCTCTCGCGGCG
GCGGCTCCGGTAGTAATGCTCGTACCGCAAGGGTATTTAAAGTCAGCCTAG
ATCGCCAGTTTACCGAAATGCGAGAGCAAGACGAATCGCTGGCGGCGATG
CGCGGACGTACCTTGGTTTTATTCGATGGTGATACCGACGGCGATCTTGAC
CTTATGAACTTCGCCTTTCCCGATAACAAGACCGAGACGAGTGAAAACTAT
TTGTACGAAAATACACCGGGTGTAGGATTTTCCGGTAATCGTACACTGGCT
CGTTCTTATTCCGATGGTCAAAAAACCTATGTCACCGATATCGATAACGATG
GTGTGGTGGATATTTTAATGTACGGACATAAACAATTGCGGGCTTTTAAAG
GCGAAGGCGCAATGAAATTCAAGGCTGCGTCCGATGTATTTGAGCAGCCG
ATTAATCATGTCACGGGCATTGCGCAGATTGATTTCGACGGTGATGGCGAT
TGGGATATCTATCTTAGCCGCGGCCAGGATTTTGAATCGGGCCAGACTTTT
TGCAGTCAGGACCAATCGGTGTGGGCAGGTTACGGCAAGCGCGGACGTTT
TGACTTTGGCTTAGTACCGTCTGGTGAAGTGTTAAAGATTAAAAACTACCA
ATCTCCCTGGCCCAACAAGCGCTTAATGATCGGTGAGTCGGCTTATCAATA
TGAATTTGAGGGTGAAACCTACAGTGGTGCCGATATTACGCTACTCAGTAGT
GACTCTTTGGGATGGCCCGACGAATTTACCGAGAAAGGGTTATACGCAGGC
TATGTCGGTAACGAGCAGTGGCACTTAGCAGGGTCCAGCTGGTCACCACTT
ACGCTGGCAGTGACCGGCTTAAGTCAGTGTAAGGCGCCGGTTTATGCCGC
GGGACCGGAAGATATTCTTTTGGAGAACCTCGGTGGGCGTTATCGGCGCG
CCCCGCAATCAATATTTGATGGAGGGCCTTCTCATAATGTGGCGATTCTTG
CCGCGGATGTTGACAACGATGGCTGGCAGGATCTAGTGGTAATGCCACGG
GGTAATCTCACCGATCCTTTGCGTCCGCAAATGTTGATGAACCAGGCGGGT
AAAGGCTTCCGCCTGCTCGACCCGACGGGTGTCAGCATGAACGAACCTGG
TGCAGTAGGTATGGCGTTAGGCGCTGTTGATGTGAATCTCGATGGTCGACT
GGATCTAGTGATCGGCAACGAGCGGGGTAAATGGAGTCTGTTTCAGAACCA
GATGCCGAAGGCGGCTCAAAACCAGTATGTCATTCTGGATTTTGGCGCCG
AGGGTTCTGGCCGAGCTACCTGGTTGGACGCCGAAGTGGAGTTAACTGCC
TGTGGTCGCACTCAAATGGCTCGTGTAGGGGATACCAGTGCCGCTTATTCA
CGTAACTACAACCGTTATACGCATTTTGGTATTGGTGATTGTAATCGTGTAG
AGAAAGCTTCGATAAGGCTGACAAATGGCGATGCTACAGTGTTAACCGATA
TTGGTGTTAACTCAATCCATCAAGTGACGTTTTAAGGCGGAGACTAGCCGC
ATGAGTGTAAAAAAATTAGCACATACGATAGCCATTTTTGGTTTGCTCGGTA
CGGTTACAGCTTTTGCCGCAACACCTTTACCATTTTCAGATCCAGATAACAC
CGGAGGTTGGACTCTGAATACGCAAGTCAGCGATGAGTTTGAAAAAGAGC
AATTAGATGAAGATAAATGGTATGTAGTAGGTAAATTTAAAGATGGTAAACC
TGAGTACGTGCACCCCGATAACCCGGATAAAAAAGTGTGGAAAGGTCGTG
CTCCGTCACAGTTTTCGGGCCGTAATTATCGCCTTGAAGATGGCAAGCTTA
TTTTGGAAACTCGCTGGGAGCCGGACTTTCCATTTGAAGAGGAAGTACAC
CAACCGGTATTTGGTGATGCTTTGCCCTACGAAAATATTACTACCGCCAGCA
TCATAGGTCGTCGTGAGTTTAAGTACGGCTACATCGAAATTAAAAGTAAGGC
GGCAGACGCCCAAATCTCAAGCGCCTTTTGGGCTATAGGCAACAAACTTGA
AATTGATTTCTTTGAGCTTTTTGGTGCTCACCCCGTGGGTGATAAAGAGCA
TTTGGACAGCCAGCTATGGTGGTCTATTCGTGATTGGAATGCTCCGGTGCG
CGGTAAACCCACTTATACCGAACATAAAGATTTAGGCTTTCGGGTAGCTGAC
GACTTTCACGTTTATGGTTTTGAGTGGAATGAATTCGGCGTTAAGTACTAC
GTAGATGGCGAGTTTTTTAGCGATGTGCCGGCCGAAGCGGTAGATGCATG
GGCGCAAGAAAACCGCGGAGTAAAACATGGCTATGTGGCGACCAAACCCA
TCGTGCTGTGGCTCGACCAAGAGACCTTCCCTTGGCACGGCGTGCCAAGC
AGCAAAGAGGATTTGGAGCGCAATAGCCCGGATGATGAAAAACACGATGG
CGTGGTGGATTTCGAAGTGGAATACGTACGCGTTTGGCAAAAACAGTAAAA
GGATACTCTTGTGATAATGAAAAAATCTTTGCTTTCGCTTTCTGTTATTGGA
GTGTTACTCGCTGGATGCGCTTCTGTTTCTGACACAGGGAGTCTGACGCC
CGGGCGTTTGTTTGCGACCTTGCCAGATACTTGCCCCACGCCCGATGCCT
TTGTGCAGACCGCGCAAGGGGACGTGCTGTTATCCTGCCCCAATTTTGCC
AGCAGAACGCAACCGGGTACTCTGCTACGATTGTCTCCCGAAGGGCAGGT
GGAAGACCTGGGGCAGGTGCCCGGTTTGGTCACGACAGCACAACCCATGG
GTATGGCGTTTGATGAGTCGGGTAATTTATATATTGCTAACAACGAAGCAGG
CGGTAATGGCAATGTTTTGAAAGTGCAGTTTCAAAATGGTCAGGTTGCAGG
GTCGCAGGTAGTGGCTAAAGGCTTTTCCTCCCCGAATGGTTTGCGCTATCA
CGACGGCTTTTTATACGTCACTCAGCTGCAGATGCCGAAAGCCGGCAAAGG
CGATATGGTGAGCGGCTTGTATCGTATTCCGGCTGAGGCTCGGGGTTTAGA
AGTCGCCAGTGATTTGAACGATTCAGAGCTTATTTTCCACGACACTACGAC
CAACCCCAAGCGTCAGTTTGGCTTAGACGGACTGGTCTTTGACGATCAGG
GGACTTTATACCTTACGAATTTTGGTGATGGCAAAGTCTACCGATTAACCCT
GTCTGAGGCAGGAGAGGTTTTGCAGAGCACCGTTTTTGCCCAGCTTCCAT
CCGAAGTTGGTCTGGACGGTATTAGTATTGATAGCAAGGGAAATCTATATGT
AGCGGGTTTTCTTTTGAATCAAATCTACCAGATTACTCCTGATGCTGAGGT
GAGCTTAATCGCTGATTACCCGGACAACAAAGGAGAAAATGGCGCCATTGA
CCAACCGGCTGATGTAATGGTTTATGGTGATAAATTATTGATTTCTAACTTT
GATTTAATGACAGGCAAGGGCATTCGTAACAGCAAACACAGTAAGCCCTATA
CGGTTTCCTATATTCTCTTGCGTTAATGCGATTCTTGCAGAAATTGTCTTCA
ATTTACATGTAGTAAACATAAACATAATATGTTTAAATTAATAGCATAATGTAA
GTAGCCGAATCACGGCCCCAACAAGAAGTCGTTGTTATGTCTATTAAAGCTA
TTAAAACCTACCACCTGCGCTGTCATCTCGACGAGCCTTTTGGCTTCTCTC
AGTGGTTTTATGACCAGAGAAACGTGTTGGTTATCGAAGTTATCGACAGCT
CTGGCGCAAGTGGCTGGGGGGAATGCTACGGCCCGGCTGATGTCATTCAA
GGTTGTGTCGAGAAATTTTATGCGTCGCGTATTATGGGTAGAAATCCCTTA
GAAACCGACGCAATCTGGCACCATATGTGGCGCGCCTCGCTGGATTTTGCT
CGTGGTGGCGTGATGATGTCGGCCATGAGTGGTATAGATATGGCGCTGTGG
GATCTGAAAGGCAAGCTTCTGAATCAGAGCGTGAGTACGTTAATGGGCGG
GCGTTTGCGTGACAAGGTGCACTGCTATGCCACGGGTATGTACTATACCGG
TATGCCCGAGGAAGAGTTGCTGCCAAGCTTGGTAGATGAAGCCCGTGGTT
ACGCTGCTCAGGGCTTTGAGGCGATGAAGATAAAGGTCGGGAAAAATCTA
GCCTTTGATaAAAAATTTATCGTCGCTTTGCGTGAAGCCTTGCCCGATACC
GAACTAATGGCAGATTCCAATCACGGCTTTGACTTGCCCGAGGCGATTGAA
ATAGGGCGCCTTTTAGATGAGTACGAATATCGCTGGTTCGAAGAACCTCTT
TCTCCCGAACATGTGGGCCTGTTTCGACAGCTGCACGACAAGTTGGATATT
GCCATTGCAACGGGAGAGTGCGAGCAAACCCGTTTCGGTTTTCAACGCCT
GATCGAAGCCGGTGGCGTCCAGTTAGTGCAGCCTGATCTCGCTTATTGTG
GTGGACCGAGCGAGGCTTTAAAAATTCGTGCGCTTGCCTCGGCTAATGGC
ATTAACTGTTTGCCCCATGTGTGGGGCACCCAGCTCAACTTGGCAGCCGCT
ACTCACTTTCTTGCCACCGCTTATCCCGAACCTGGCAGGGCCGAGGAAAA
ACGCTTGTTGTTAGAGTATGATCGCACCGAAAACCCCTTGCGCGATGAGCT
ATATAAACAACAGGTTCGTGTTGAGAGTGGCTCTGCCATCGTTCCCGAGGG
GCCTGGGCTGGGGGTCGAAATTGACCTGGCGAAACTTCCTGACTTTATAG
TCACCACGACGGAGACCACCAATGGCTAAAACTCTGCGTATGTTAATTGGC
GGAGAGTTTCACGACACCGCCGATAAAATCGATGTGTACAATCCTGCTACC
GGTAAGGTTATCGGTCAGGTGCCTCAAATTGAGCCAGATCAAGTTGCCTTG
TCGCTTAAGGTCGCACAGCAGGGCTTCACTGTCTGGTCGGGTAAATCTTTA
GCGGAGCGTAGCGACATTATCCTGCGATTTGCAGATTTACTGGAAGCGAAT
AAAGCAGAAATCGTAGACCTGCTTATCGAAGAGACCGGTAAGCCGGCTGAT
AATGCCGATTACGATTTTGGTATGTTGACCACCTGCCTACGCTTTTTTGTG
GAAGAGGCGAAACGCACCGATCAACCTACTATTACTGATCCCAATGGTGAG
TTTCTGCATTATGTTTCCCGCCAGCCTCTGGGCGTGGTCGTGGGCTACCTG
GCCTGGAACTTCCCCTTGCTTAATCTAGGTTACAAGTTAGGCCCCGCGCTG
GCGGCAGGTTGCTCGGTCATCGTTAAGCCATCTCAAATGACACCTCTTGCC
AGTTTGCGTTGTGCTGAGCTAGCACAAGAGGCAGGTATTCCGGCCGGTGT
TTTGAATGTGATTACCGGTGATCGTTTTGATGTGACCGATCCGCTGCTGAC
CAGCGATGTGACTTCAATGTTCACCATGATTGGCTCTACCAAATCGGGCGT
TAACGCTATGCGAACGGCCAGTACCAGCGTGAAAAAGTTTTCTGTGGAGTT
AGGAGGAAACGCTCCCGTCATTGTTTATCCTGATGCGGATATCGATAAAGC
CGTTGCCGATATTGTTGACTTAAAGCTGGGCAACAGTGGTCAGGTCTGTGT
ATCTCCCAACCGTTGCTATGTGCACGCCAATGTTTATGATGAGTTTTTAAGC
AAAGCCGTTGCTAGAGTACAGACGTTTAAGATCGGTAGTGGCTCAGATGAA
GGCCCATTGATGGGGCCTATCATTTCGGCTGAGGCGCGTGATCGTATTCTC
GACTCTGTAAAGCGTGCGCAAGAGCAGGGTGCTCGTTTAATGACCGGTGG
CAAAATTCCTGCCGACCAGAGCGAAGGCTATTTTATGGAGCCTACCGTTTT
GGCCGACGTTACCACAAGCATGCCGATTGCCTGCGATGAGGTTTTTGGAC
CTGTACTGCCCGTTATGAAGTATGACGACAGTCAGGATCCGGTCGCCCTGG
CTAACGATAATCCGTTTGGTCTGGCTGCGTATGTTTACACCCAGAACTTAAA
TAACGCCATGCGCGCCGCTAATGAAATTCAAGCCGGGAGTGTTTGTATCAA
TCGCGCTCACTATAGTGTGCAGTTGCCCCATGGCGGCTTAAAACAAAGTGG
TGTGGGAAAAGACTGTTCTAAATACAGCTTAGAAGAGTATTTAACTTTAAAA
CGCGTCTCTATTTTGATTCACCAGTAGGCTCTCTATCGGTGTCTTTACGCC
GAATCGAGTGGCTCGGTTCGGCGTTTTTTTGCTCGGATATAGCTTATGACC
AGGATATTTGTAGATTGGGGATCAACGAATTGTCGTGCATTTTTGTTAGATG
ACAGACGTGCGCTTGTCGATCAACGTCGCAGTGATAAAGGCGCACTTGCC
GTTACTCAAGGAGACTTTGAATCGGAGTTAAAACAATTGTTGAGGCCTTGG
CAGGCTTACTGGAGTGATAGCGACATCTGGCTGGCCGGGATGGTAGGTTCA
CGCCGCGGCTGGTACGAGGTTCCTTATGCGAAGGCCCCCGCCACAGCGTC
TGACTTACGTAACAAAGCAATTCAGGTAAATATTGATTGGGCCCGTTCGGT
GCAAATCATACCGGGAGTCAGTTGCGGCAATCAAACAGACCGATTCGATGT
CATGCGCGGTGAAGAGGTTCAACTGTTTGGCTTAAGCCAGGTGTCGCAAC
GCAAAAATTTGTACGCAATGCTGCCCGGCACCCACAACAAACACGCACATAT
ATGTGATGGTGCCATTGGTTCGTTTAGTACGCATCCCACCGGCGAATTATTT
TCCGTTCTCTCGCGTCATATGCTGATTGGCTTCGGGCTTGCCGATATGGAA
GGCAAGGGCTCCATTCAGGCTTTTTTTCGTGGCGTAGATGAAGGCGTCAA
ATCAGCTCAGCTTGGTAAAAGCCTGTTTACCGCATGGACCAACCGTCTGGG
TGGAAATTTACAAGATGAGGATGGTTTGGAATACATCAGCGGAGTTCTCAT
CGGAAATGAGCTGCGGGATTTTGAGGCGCAATATTGTGCGATTGTCTCTGA
TCAAGATATTGGCGAGCGTTACCGCAATGCGTGTACTCACTTGGGTATTAAA
TCCGATCTTTATTCTGGCGCCGAGTGTTATCTAGCGGGAATGAAGGTTATA
AGCCAGTAAGGTATACAAATGAACAATCTCAATTTTATAGATAAAAGCACTAG
GCCACTTATTGCTATTTTAAGGGGTGTAACTGAAAACGACGTACTGGACGT
TTCGAAAGCTTTGATTGAAGAGGGCATTTCGATTATCGAGGTGCCATTAAA
CAGCCCTAATGCCCTACGAAGTATTGAATATTTGGTAGAAACTTTAGGCGAT
CGCTATCTTGTGGGAGCGGGAACTGTAACCAATGTCGGAGAAGTTGATGC
TGTGATCTCGACTGGTGCAAAGCTCATTGTAACCCCTAACTTTAATGCCGC
CGTGGTAGAGCGTGCGAGTAGAGCCGGTTGCGTGTGCTTGCCTGGGGTAG
TTACCCCAACGGAAGCCTTTGCCGCATTGGCTGCTGGAGCTCACGGTTTA
AAGCTGTTTCCCGTTACGCAAATGGGATTTGAGAATTTCAAAGCGCTTATG
TCTGTACTGCCTAAAGGGACGGCTTGCTTTCCAGTCGGTGGAATCAGCGC
TGAAGAAGCTACAATGGCTCCTTACCTCACTGCAGGAGCAGCCGGCTTTGG
GATTGGATCATCGCTGTATACAGCCGGGCTGAGTACTCAAGAGCTTAGAAA
AAGAGCGCAGGAGATAGTGTCGACATTCGACAGACTGTGTAAGGCTTATTA
ATTGTTCAGCACTGGTTGGCCGATAATGGATTGTAAAATATTAAAAATATGA
GTATATTGTTTACAATATACAATAGGGGTTGAGGTTATGTCTAAACAAAGCTC
TGTACTGGTTACCGGCGGGGCGGGTTACATTGGTAGCCACGTCTGTGTTG
AGCTTATTGGCGCTGGGTTTACACCCGTTATTGTTGATAATTTGTGCAACAG
CAACCGCGAGGTGCTGGAGCGCATAGAGACGATTACCGGTATCCGGCCAGA
ACTGCATGAAGTCGATATCCGCGACCGAGCGGCGTTAGATGCGGTGTTTGC
CGCCCATAGCTTTACGGCGGTGATGCATTTTGCGGGTCTCAAGGCCGTGG
GTGAATCCACCACCATTCCTTTGTCTTACTACCAGAACAACGTTGCCGGCT
CGCTGACATTGTTTGAGGCCATGGCTGCCCACAACGTGTGGAATGTTATTT
TTAGCTCGTCGGCGACGGTGTATGGCGATCCGGCCAGTGTGCCCATTGAT
GAGAACTTCCCCATCAGCGCCACCAACCCCTATGGTCGCACCAAACTCATG
GTGGAAGAAATCCTGCGGGATATGTCCCTAGCGCCCGATGCCAAGTGGAA
CACCAGTTTACTGCGCTACTTTAATCCCGTGGGTGCCCACGAATCCGGCCT
AATCGGTGAAGATCCCTTAGGCATTCCCAACAACCTGGTGCCCTATATTGC
CCAAGTGGCGGTGGGCAAACTGCCTGCCTTGCAAGTGTTTGGCGATGACT
ACAACACCCCCGATGGCACCGGGGTGCGCGATTACATTCACGTGGTGGATT
TGGCTCGCGGGCATGTAGCGGCGCTGCAAAAGCTTC
CRTAC1 family protein [Gilvimarinus chinensis]

Protein
1 ymkvtttslg lgllgallfg cqsqpeatqd svredfayaq nlahknrnmr kwdapafadl
61 dqdgwvdvil nnhgygiqiv wnnqgtlaep wdllmgdihg vtigdidadg llemllsrgg
121 gsgsnartar vfkahqdrqf temreqdesl aamrgrtlvl fdgdadgdld lmnfafpdnk
181 aeasenylye nkpgvgfsgn rtlarsysdg qktyitdidn dgvvdilmyg hkqlrafkge
241 gamkfkaasd vfeqpihhvt giaqidydgd gdwdiylsrg qdfesgqtfc sqdqsvwagy
301 gkrgrfdfgl vpsgevlpik nyqspwpnkr lmigesayqy efegetysga ditllssdsl
361 gwpdeftekg lyagyvgneq whlagaswsp ltvavaglsq ckapayaagp edillenigg
421 ryrraphqif dggpshnvat laadvdndgw qdlvvmprgn ltdplrpqml mnqagkgfrq
481 vdpdgvsmne pgavgmalga vdvnldgqld lvignergkw slyqnqmqka aqnqyvildf
541 gaegsgratw ldaevkltac grtqmaragd tsaaysrnyn rymhfgigdc nrvekasirl
601 tngdatvltd lgvnsihkvt f

>276 bp product from circular template Untitled, base 1588 to base 
1863 (P63F ­ P63R).
AACTTTGGTTGGAGCCCGGCAGTGATTTAAACGCATTAAAAATCGAACTTAACAATGCCG
ACACAGGTCTGGTGGCCGACGATGCTGAGTATTTAGCCGCAGGTCAATGGCACACCCTAG
CGCAAACAATCGAATTAACAGAACCCAGCGCGGCCGAAGAAACCGTAAACATTACTTTTA
TACAAAGTGAAGCCGGTGCCGAAACTCGTGCGTATCTGGATGATATATCCATTGAGCATT
AATCATCATGGCCTAGTGAGTGCATCGAGTGTCGAT
>80 bp product from circular template Untitled, base 1588 to base 1667
(P63F ­ R63­10).
AACTTTGGTTGGAGCCCGGCAGTGATTTAAACGCATTAAAAATCGAACTTAACAATGCCG
ACACAGGTCTGGTGGCCGAC
5'3' Frame 1
N F G W S P A V I Stop T H Stop K S N L T Met P T Q V W W P
3'5' Frame 3
R P P D L C R H C Stop V R F L Met R L N H C R A P T K V

>1176 bp product from circular template Untitled, base 492 to base 
1667 (K63F ­ R63­10).
GTGGGTTACCCCTTGTCGGATCCTGAAAATACCGGTGGTTGGGTCCTTAACGCAGACATC
AGTGATGAATTTAACGCTGCACCACTGGATTCCAAGAAGTGGTTTGTGGAGGGGGAAAAC
GGCGATTACTACATCTGGAAAGGACGTCCCCCGTCACAGTTTGCGCCTCATAATGTGTTT
GTTGAGGACGGCAAGTTAAAAATTCGCTCCCAGTGGGAGCCGCATTTCGACTTTGCCGGA
GAAAGCTACGCGGATGGATCCCGCAATGACTCCTATGGTCGTTACGACGGTCAACCTTTT
CCGGTTACAACGGGGGCGGCCATTAGTCGCAACCGTTTTTTGTACGGCTATATGGAAGTA
CGTACCAAGGCGGCAGACGCCGCGATGACCAGCTCTTTCTGGACTATCGGTTATCAGTCC
GAGTTGGATATCTATGAACAGATGGGAAGGCCTAATATCGAAGGTGATATTACTTCGACT
AATTGGAAAGCGTCGGTGCATGATTGGCGACCACCGTCAAAGCGGcCAACCCGTAAGTTT
GGCATGAAGGAGGATTTGGGTTTTCGTGTTGCCGATGAATTTCATGTCTACGGTGCAGAG
TGGGGCGAGGACTATCTAAAGCTCTATCTTAATGGCGAATTAATGTATGAGGTGACCCAG
AAAGACGTAGGGCGTCACTGGGTACTTACCAACCCGCTGGAAATCTGGTTTGACTCTGAA
ATTTTCGTCTGGCTCGGCTTGCCTGATAAAGAAGAGCTACCGGTGGATTACGAAATTGAT
TATGTGAGAGTTTGGCAGAAGCCACACCCAAACTTGCTGGCGCGTCACTTCTATGGGTTT
GAAGGCCCATTTTTGTACGAACATCAGCCCAAACCGCTGGATTTGACCCCGGAAAACCCA
ACCAACAATGCGTATCAAAAATTTTGGCAGATTCATGACGATGCCTCTCAATATTTAGCG
GTTGTGCGTCACGAGCAACATTCTGCCGGCACCCGGAGTTTGCGGTTTGAATCGCGTGGT
GAGGCAGCGACAGCCATTGCCACAGCCCCTATGGGAACCATAGATTTAGCACCGGGTAAG
TACACTCTTAAAGCCAAACTTTGGTTGGAGCCCGGCAGTGATTTAAACGCATTAAAAATC
GAACTTAACAATGCCGACACAGGTCTGGTGGCCGAC

5'3' Frame 1
VGYPLSDPENTGGWVLNADISDEFNAAPLDSK
KWFVEGENGDYYIWKGRPPSQFAPHNVFVED
GKLKIRSQWEPHFDFAGESYADGSRNDSYGRY
D G Q P F P V T T G A A I S R N R F L Y G Y Met E V R T K A A D
A A Met T S S F W T I G Y Q S E L D I Y E Q Met G R P N I E G D
I T S T N W K A S V H D W R P P S K R P T R K F G Met K E D L
G F R V A D E F H V Y G A E W G E D Y L K L Y L N G E L Met Y
EVTQKDVGRHWVLTNPLEIWFDSEIFVWLGLP
DKEELPVDYEIDYVRVWQKPHPNLLARHFYGF
EGPFLYEHQPKPLDLTPENPTNNAYQKFWQIH
DDASQYLAVVRHEQHSAGTRSLRFESRGEAAT
A I A T A P Met G T I D L A P G K Y T L K A K L W L E P G S D L
NALKIELNNADTGLVAD

>1619 bp product from circular template Untitled, base 49 to base 1667
(F63­10 ­ R63­10).
ACGAAGAGCGGCCACATGACTCGCTGGGGGATCTGACTCCCTGGGAGTATCTGGCCAAAC
ATGAGCAGCTGGAAAACTCTAATTATACGTGTCACTAATTAGGGGTGGTTTACATTTAAG
GCAAGTGGATCTTCTAGTTACGTGTCCTCCTAATAACTAAAGCTTTGAAGTTGGTAGTTA
CTTATTTTTTCAAGCTCCGTAAAGTATCAAATTACTTCTGTTTACATGATAGTATTGCAT
ATCTTAACATCATATGATTAGATTAAAAATATATATATGAAATTGGTCATAGCTCCGCAT
TCATAACCATAATAACGGCATAGATCTGGGAGATACCCGTGAAAAACTGCATTTTGATTT
CACCTTTGGTATGGGCGCTCTCGGGTGCTTTGTTAGTTGCAGCCTGCACTTCCTCCACGA
ATTTGGATTCTCCCCGGGCGAACGTGGGTTACCCCTTGTCGGATCCTGAAAATACCGGTG
GTTGGGTCCTTAACGCAGACATCAGTGATGAATTTAACGCTGCACCACTGGATTCCAAGA
AGTGGTTTGTGGAGGGGGAAAACGGCGATTACTACATCTGGAAAGGACGTCCCCCGTCAC
AGTTTGCGCCTCATAATGTGTTTGTTGAGGACGGCAAGTTAAAAATTCGCTCCCAGTGGG
AGCCGCATTTCGACTTTGCCGGAGAAAGCTACGCGGATGGATCCCGCAATGACTCCTATG
GTCGTTACGACGGTCAACCTTTTCCGGTTACAACGGGGGCGGCCATTAGTCGCAACCGTT
TTTTGTACGGCTATATGGAAGTACGTACCAAGGCGGCAGACGCCGCGATGACCAGCTCTT
TCTGGACTATCGGTTATCAGTCCGAGTTGGATATCTATGAACAGATGGGAAGGCCTAATA
TCGAAGGTGATATTACTTCGACTAATTGGAAAGCGTCGGTGCATGATTGGCGACCACCGT
CAAAGCGGcCAACCCGTAAGTTTGGCATGAAGGAGGATTTGGGTTTTCGTGTTGCCGATG
AATTTCATGTCTACGGTGCAGAGTGGGGCGAGGACTATCTAAAGCTCTATCTTAATGGCG
AATTAATGTATGAGGTGACCCAGAAAGACGTAGGGCGTCACTGGGTACTTACCAACCCGC
TGGAAATCTGGTTTGACTCTGAAATTTTCGTCTGGCTCGGCTTGCCTGATAAAGAAGAGC
TACCGGTGGATTACGAAATTGATTATGTGAGAGTTTGGCAGAAGCCACACCCAAACTTGC
TGGCGCGTCACTTCTATGGGTTTGAAGGCCCATTTTTGTACGAACATCAGCCCAAACCGC
TGGATTTGACCCCGGAAAACCCAACCAACAATGCGTATCAAAAATTTTGGCAGATTCATG
ACGATGCCTCTCAATATTTAGCGGTTGTGCGTCACGAGCAACATTCTGCCGGCACCCGGA
GTTTGCGGTTTGAATCGCGTGGTGAGGCAGCGACAGCCATTGCCACAGCCCCTATGGGAA
CCATAGATTTAGCACCGGGTAAGTACACTCTTAAAGCCAAACTTTGGTTGGAGCCCGGCA
GTGATTTAAACGCATTAAAAATCGAACTTAACAATGCCGACACAGGTCTGGTGGCCGAC

5'3' Frame 3
EERPHDSLGDLTPWEYLAKHEQLENSNYTC
H Stop L G V V Y I Stop G K W I F Stop L R V L L I T K A L K L V
V T Y F F K L R K V S N Y F C L H D S I A Y L N I I Stop L
D Stop K Y I Y E I G H S S A F I T I I T A Stop I W E I P V K N C I
LISPLVWALSGALLVAACTSSTNLDSPRANVG
YPLSDPENTGGWVLNADISDEFNAAPLDSKKW
FVEGENGDYYIWKGRPPSQFAPHNVFVEDGKL
KIRSQWEPHFDFAGESYADGSRNDSYGRYDG
Q P F P V T T G A A I S R N R F L Y G Y Met E V R T K A A D A
A Met T S S F W T I G Y Q S E L D I Y E Q Met G R P N I E G D I T
S T N W K A S V H D W R P P S K R P T R K F G Met K E D L G F
R V A D E F H V Y G A E W G E D Y L K L Y L N G E L Met Y E V T
QKDVGRHWVLTNPLEIWFDSEIFVWLGLPDKE
ELPVDYEIDYVRVWQKPHPNLLARHFYGFEGP
FLYEHQPKPLDLTPENPTNNAYQKFWQIHDDA
SQYLAVVRHEQHSAGTRSLRFESRGEAATAIA
T A P Met G T I D L A P G K Y T L K A K L W L E P G S D L N A L
KIELNNADTGLVAD

>1815 bp product from circular template Untitled, base 49 to base 1863
(F63­10 ­ P63R).
ACGAAGAGCGGCCACATGACTCGCTGGGGGATCTGACTCCCTGGGAGTATCTGGCCAAAC
ATGAGCAGCTGGAAAACTCTAATTATACGTGTCACTAATTAGGGGTGGTTTACATTTAAG
GCAAGTGGATCTTCTAGTTACGTGTCCTCCTAATAACTAAAGCTTTGAAGTTGGTAGTTA
CTTATTTTTTCAAGCTCCGTAAAGTATCAAATTACTTCTGTTTACATGATAGTATTGCAT
ATCTTAACATCATATGATTAGATTAAAAATATATATATGAAATTGGTCATAGCTCCGCAT
TCATAACCATAATAACGGCATAGATCTGGGAGATACCCGTGAAAAACTGCATTTTGATTT
CACCTTTGGTATGGGCGCTCTCGGGTGCTTTGTTAGTTGCAGCCTGCACTTCCTCCACGA
ATTTGGATTCTCCCCGGGCGAACGTGGGTTACCCCTTGTCGGATCCTGAAAATACCGGTG
GTTGGGTCCTTAACGCAGACATCAGTGATGAATTTAACGCTGCACCACTGGATTCCAAGA
AGTGGTTTGTGGAGGGGGAAAACGGCGATTACTACATCTGGAAAGGACGTCCCCCGTCAC
AGTTTGCGCCTCATAATGTGTTTGTTGAGGACGGCAAGTTAAAAATTCGCTCCCAGTGGG
AGCCGCATTTCGACTTTGCCGGAGAAAGCTACGCGGATGGATCCCGCAATGACTCCTATG
GTCGTTACGACGGTCAACCTTTTCCGGTTACAACGGGGGCGGCCATTAGTCGCAACCGTT
TTTTGTACGGCTATATGGAAGTACGTACCAAGGCGGCAGACGCCGCGATGACCAGCTCTT
TCTGGACTATCGGTTATCAGTCCGAGTTGGATATCTATGAACAGATGGGAAGGCCTAATA
TCGAAGGTGATATTACTTCGACTAATTGGAAAGCGTCGGTGCATGATTGGCGACCACCGT
CAAAGCGGcCAACCCGTAAGTTTGGCATGAAGGAGGATTTGGGTTTTCGTGTTGCCGATG
AATTTCATGTCTACGGTGCAGAGTGGGGCGAGGACTATCTAAAGCTCTATCTTAATGGCG
AATTAATGTATGAGGTGACCCAGAAAGACGTAGGGCGTCACTGGGTACTTACCAACCCGC
TGGAAATCTGGTTTGACTCTGAAATTTTCGTCTGGCTCGGCTTGCCTGATAAAGAAGAGC
TACCGGTGGATTACGAAATTGATTATGTGAGAGTTTGGCAGAAGCCACACCCAAACTTGC
TGGCGCGTCACTTCTATGGGTTTGAAGGCCCATTTTTGTACGAACATCAGCCCAAACCGC
TGGATTTGACCCCGGAAAACCCAACCAACAATGCGTATCAAAAATTTTGGCAGATTCATG
ACGATGCCTCTCAATATTTAGCGGTTGTGCGTCACGAGCAACATTCTGCCGGCACCCGGA
GTTTGCGGTTTGAATCGCGTGGTGAGGCAGCGACAGCCATTGCCACAGCCCCTATGGGAA
CCATAGATTTAGCACCGGGTAAGTACACTCTTAAAGCCAAACTTTGGTTGGAGCCCGGCA
GTGATTTAAACGCATTAAAAATCGAACTTAACAATGCCGACACAGGTCTGGTGGCCGACG
ATGCTGAGTATTTAGCCGCAGGTCAATGGCACACCCTAGCGCAAACAATCGAATTAACAG
AACCCAGCGCGGCCGAAGAAACCGTAAACATTACTTTTATACAAAGTGAAGCCGGTGCCG
AAACTCGTGCGTATCTGGATGATATATCCATTGAGCATTAATCATCATGGCCTAGTGAGT
GCATCGAGTGTCGAT

5'3' Frame 3
EERPHDSLGDLTPWEYLAKHEQLENSNYTC
H Stop L G V V Y I Stop G K W I F Stop L R V L L I T K A L K L V
V T Y F F K L R K V S N Y F C L H D S I A Y L N I I Stop L
D Stop K Y I Y E I G H S S A F I T I I T A Stop I W E I P V K N C I
LISPLVWALSGALLVAACTSSTNLDSPRANVG
YPLSDPENTGGWVLNADISDEFNAAPLDSKKW
FVEGENGDYYIWKGRPPSQFAPHNVFVEDGKL
KIRSQWEPHFDFAGESYADGSRNDSYGRYDG
Q P F P V T T G A A I S R N R F L Y G Y Met E V R T K A A D A
A Met T S S F W T I G Y Q S E L D I Y E Q Met G R P N I E G D I T
S T N W K A S V H D W R P P S K R P T R K F G Met K E D L G F
R V A D E F H V Y G A E W G E D Y L K L Y L N G E L Met Y E V T
QKDVGRHWVLTNPLEIWFDSEIFVWLGLPDKE
ELPVDYEIDYVRVWQKPHPNLLARHFYGFEGP
FLYEHQPKPLDLTPENPTNNAYQKFWQIHDDA
SQYLAVVRHEQHSAGTRSLRFESRGEAATAIA
T A P Met G T I D L A P G K Y T L K A K L W L E P G S D L N A L
KIELNNADTGLVADDAEYLAAGQWHTLAQTIE
LTEPSAAEETVNITFIQSEAGAETRAYLDDISIE
H Stop S S W P S E C I E C R

>1372 bp product from circular template Untitled, base 492 to base 
1863 (K63F ­ P63R).
GTGGGTTACCCCTTGTCGGATCCTGAAAATACCGGTGGTTGGGTCCTTAACGCAGACATC
AGTGATGAATTTAACGCTGCACCACTGGATTCCAAGAAGTGGTTTGTGGAGGGGGAAAAC
GGCGATTACTACATCTGGAAAGGACGTCCCCCGTCACAGTTTGCGCCTCATAATGTGTTT
GTTGAGGACGGCAAGTTAAAAATTCGCTCCCAGTGGGAGCCGCATTTCGACTTTGCCGGA
GAAAGCTACGCGGATGGATCCCGCAATGACTCCTATGGTCGTTACGACGGTCAACCTTTT
CCGGTTACAACGGGGGCGGCCATTAGTCGCAACCGTTTTTTGTACGGCTATATGGAAGTA
CGTACCAAGGCGGCAGACGCCGCGATGACCAGCTCTTTCTGGACTATCGGTTATCAGTCC
GAGTTGGATATCTATGAACAGATGGGAAGGCCTAATATCGAAGGTGATATTACTTCGACT
AATTGGAAAGCGTCGGTGCATGATTGGCGACCACCGTCAAAGCGGcCAACCCGTAAGTTT
GGCATGAAGGAGGATTTGGGTTTTCGTGTTGCCGATGAATTTCATGTCTACGGTGCAGAG
TGGGGCGAGGACTATCTAAAGCTCTATCTTAATGGCGAATTAATGTATGAGGTGACCCAG
AAAGACGTAGGGCGTCACTGGGTACTTACCAACCCGCTGGAAATCTGGTTTGACTCTGAA
ATTTTCGTCTGGCTCGGCTTGCCTGATAAAGAAGAGCTACCGGTGGATTACGAAATTGAT
TATGTGAGAGTTTGGCAGAAGCCACACCCAAACTTGCTGGCGCGTCACTTCTATGGGTTT
GAAGGCCCATTTTTGTACGAACATCAGCCCAAACCGCTGGATTTGACCCCGGAAAACCCA
ACCAACAATGCGTATCAAAAATTTTGGCAGATTCATGACGATGCCTCTCAATATTTAGCG
GTTGTGCGTCACGAGCAACATTCTGCCGGCACCCGGAGTTTGCGGTTTGAATCGCGTGGT
GAGGCAGCGACAGCCATTGCCACAGCCCCTATGGGAACCATAGATTTAGCACCGGGTAAG
TACACTCTTAAAGCCAAACTTTGGTTGGAGCCCGGCAGTGATTTAAACGCATTAAAAATC
GAACTTAACAATGCCGACACAGGTCTGGTGGCCGACGATGCTGAGTATTTAGCCGCAGGT
CAATGGCACACCCTAGCGCAAACAATCGAATTAACAGAACCCAGCGCGGCCGAAGAAACC
GTAAACATTACTTTTATACAAAGTGAAGCCGGTGCCGAAACTCGTGCGTATCTGGATGAT
ATATCCATTGAGCATTAATCATCATGGCCTAGTGAGTGCATCGAGTGTCGAT

5'3' Frame 1
VGYPLSDPENTGGWVLNADISDEFNAAPLDSK
KWFVEGENGDYYIWKGRPPSQFAPHNVFVED
GKLKIRSQWEPHFDFAGESYADGSRNDSYGRY
D G Q P F P V T T G A A I S R N R F L Y G Y Met E V R T K A A D
A A Met T S S F W T I G Y Q S E L D I Y E Q Met G R P N I E G D
I T S T N W K A S V H D W R P P S K R P T R K F G Met K E D L
G F R V A D E F H V Y G A E W G E D Y L K L Y L N G E L Met Y
EVTQKDVGRHWVLTNPLEIWFDSEIFVWLGLP
DKEELPVDYEIDYVRVWQKPHPNLLARHFYGF
EGPFLYEHQPKPLDLTPENPTNNAYQKFWQIH
DDASQYLAVVRHEQHSAGTRSLRFESRGEAAT
A I A T A P Met G T I D L A P G K Y T L K A K L W L E P G S D L
NALKIELNNADTGLVADDAEYLAAGQWHTLAQ
TIELTEPSAAEETVNITFIQSEAGAETRAYLDDI
S I E H Stop S S W P S E C I E C R