You are on page 1of 121

Notices

5693--5813/18

ADMIRALTY
NOTICES TO MARINERS
Weekly Edition 49
06 December 2018
(Published on the ADMIRALTY website 26 November 2018)

CONTENTS

I Explanatory Notes. Publications List


II ADMIRALTY Notices to Mariners. Updates to Standard Nautical Charts
III Reprints of NAVAREA I Navigational Warnings
IV Updates to ADMIRALTY Sailing Directions
V Updates to ADMIRALTY List of Lights and Fog Signals
VI Updates to ADMIRALTY List of Radio Signals
VII Updates to Miscellaneous ADMIRALTY Nautical Publications
VIII Updates to ADMIRALTY Digital Services

For information on how to update your ADMIRALTY products using ADMIRALTY Notices to
Mariners, please refer to NP294 How to Keep Your ADMIRALTY Products Up--to--Date.
Mariners are requested to inform the UKHO immediately of the discovery of new or suspected
dangers to navigation, observed changes to navigational aids and of shortcomings in both paper
and digital ADMIRALTY Charts or Publications.
The H--Note App helps you to send H--Notes to the UKHO, using your device’s camera, GPS and
email. It is available for free download on Google Play and on the App Store.
The Hydrographic Note Form (H102) should be used to forward this information and to report any
ENC display issues.
H102A should be used for reporting changes to Port Information.
H102B should be used for reporting GPS/Chart Datum observations.
Copies of these forms can be found at the back of this bulletin and on the UKHO website.
The following communication facilities are available:
NMs on ADMIRALTY website: Web: admiralty.co.uk/msi
Searchable Notices to Mariners: Web: www.ukho.gov.uk/nmwebsearch
Urgent navigational information: e--mail: navwarnings@btconnect.com
Phone: +44(0)1823 353448
Fax: +44(0)1823 322352
H102 forms e--mail: sdr@ukho.gov.uk
(see back pages of this Weekly Edition) Post: UKHO, Admiralty Way, Taunton,
Somerset, TA1 2DN, UK
All other enquiries/information e--mail: customerservices@ukho.gov.uk
Phone: +44(0)1823 484444 (24/7)
 Crown Copyright 2018. All rights Reserved. Permission is not required to make analogue or PDF copies
of these Notices, but such copies may not be sold without the permission of the UKHO. For permission to
sell copies of the Notices or to make (non -- PDF) digital copies please email
intellectual.property@ukho.gov.uk

For UKHO use only 218449


,

*8,'$1&(127(6)257+(86(2)$'0,5$/7<127,&(6720$5,1(56
217+(8.+2:(%6,7(

7KH:HHNO\1RWLFHVWR0DULQHUV 10 XSGDWHVIRUSDSHU&KDUWVDQG3XEOLFDWLRQVFDQEHDFFHVVHGYLD
DGPLUDOW\FRXNPVL RU WKH VHDUFKDEOH 10 :HEVLWH ZZZXNKRJRYXNQPZHEVHDUFK 7KH ODWHVW
GLJLWDO 10 :HHNO\ XSGDWH LV DYDLODEOH  GD\V SULRU WR WKH SDSHU SXEOLFDWLRQ GDWH WKHUH DUH QR
VXEVFULSWLRQIHHVIRUDFFHVVWRWKH8.+21RWLFHVWR0DULQHUV:HEVLWH

1%7KH10GDWDEDVHLQFOXGHVKLVWRULFDO10GDWDIURP-DQXDU\IRU10VSULRUWRWKH
&XPXODWLYH/LVWRI1RWLFHVWR0DULQHUV 13% PXVWEHXVHG

6RIWZDUHUHTXLUHG

$GREH$FUREDW5HDGHU 9HUVLRQRUODWHU 5HDGHUVRIWZDUHFDQEHREWDLQHGGLUHFWIURPWKH$GREH


ZHEVLWH ZZZDGREHFRP 

6($5&+$%/(127,&(6720$5,1(56

(QWHU WKH ZZZXNKRJRYXNQPZHEVHDUFK ZHEVLWH DQG VHOHFW WKH VHDUFK RSWLRQ WKDW \RX UHTXLUH
IROORZLQJWKHRQVFUHHQLQVWUXFWLRQV

 6HDUFK10VE\&KDUW1XPEHURQO\
 6HDUFK10VE\&KDUW1XPEHU3UHYLRXV101XPEHU<HDU
 6HDUFK10VE\&KDUW1XPEHU%HWZHHQ3UHYLRXVDQG3UHVHQW'DWHV
 6HDUFKIRU6LQJOH10E\101XPEHU<HDU

7RYLHZWKH10101RWHRUIXOOFRORXU10%ORFNVFOLFNRQWKHUHOHYDQWOLQN

127,&(6720$5,1(5621/,1(

(QWHUWKHDGPLUDOW\FRXNPVLZHEVLWHDQGWKHQVHOHFW1RWLFHVWR0DULQHUV7KLVZLOOJLYH\RXDFFHVV
WRWKHIROORZLQJUDQJHRI1RWLFHWR0DULQHUVVHUYLFHV
 $'0,5$/7<10:HE6HDUFK
 :HHNO\10V
 10%ORFN1RWHVDQG'LDJUDPV
 $QQXDO10V
 &XPXODWLYH10/LVW

)857+(5*8,'$1&(127(6

)RU IXUWKHU GHWDLOV RI WKH RQOLQH 10 IDFLOLWLHV SOHDVH VHH WKH 10 *XLGDQFH 1RWHV RQ WKH ZHEVLWH
DGGLWLRQDOGHWDLOLQFOXGHV
 )LOHFRQWHQWDQGGHVFULSWLRQ
 3&DQGSULQWHUVSHFLILFDWLRQV

&86720(56(59,&(

,I\RXH[SHULHQFHDQ\GLIILFXOWLHVSOHDVHFRQWDFWWKH8.+2&XVWRPHU6HUYLFHRQ
7HO    
HPDLOFXVWRPHUVHUYLFHV#XNKRJRYXN

Wk49/18 
,

ADMIRALTY NOTICES TO MARINERS


7KLV $'0,5$/7< 1RWLFHV WR 0DULQHUV %XOOHWLQ $10%  LV SXEOLVKHG E\ WKH 8.
+\GURJUDSKLF2IILFH 8.+2 7KH8.0DULWLPHDQG&RDVWJXDUG$JHQF\DFFHSWVWKDWERWK
WKH SDSHU DQG GLJLWDO IRUPV RI WKH $10% FRPSO\ ZLWK FDUULDJH UHTXLUHPHQW IRU 1RWLFHV WR
0DULQHUV ZLWKLQ 5HJXODWLRQ  RI WKH UHYLVHG &KDSWHU 9 RI WKH 6DIHW\ RI /LIH DW 6HD
&RQYHQWLRQ DQG WKH 0HUFKDQW 6KLSSLQJ 6DIHW\ RI 1DYLJDWLRQ  5HJXODWLRQV ERWK RI ZKLFK
FDPHLQWRIRUFH-XO\

:KLOHHYHU\HIIRUWLVPDGHWRHQVXUHWKDWWKHGDWDSURYLGHGWKURXJKWKH1RWLFHVWR0DULQHUV
VHUYLFHLVDFFXUDWHWKHXVHUQHHGVWREHDZDUHRIWKHULVNVRIFRUUXSWLRQWRGDWD,WLVLPSRUWDQW
WKDWWKHXVHUVKRXOGRQO\XVHWKHGDWDRQVXLWDEOHHTXLSPHQWDQGWKDWRWKHUDSSOLFDWLRQVVKRXOG
QRW EH UXQQLQJ RQ WKH XVHU¶V PDFKLQH DW WKH VDPH WLPH 8VHUV VKRXOG H[HUFLVH WKHLU
SURIHVVLRQDOMXGJHPHQWLQWKHXVHRIGDWDDQGDOVRFRQVXOWWKH0DULQHUV¶+DQGERRN 13 
IRUIXUWKHUGHWDLOV

7KH XVHU QHHGV WR EH DZDUH WKDW WKHUH LV D SRVVLELOLW\ WKDW GDWD FRXOG EH FRUUXSWHG GXULQJ
WUDQVPLVVLRQRULQWKHSURFHVVRIGLVSOD\RUSULQWLQJRQWKHXVHU¶VHTXLSPHQWRULIFRQYHUWHG
WR RWKHU VRIWZDUH IRUPDWV DQG LV DFFRUGLQJO\ DGYLVHG WKDW WKH 8.+2 FDQQRW DFFHSW
UHVSRQVLELOLW\ IRU DQ\ VXFK FKDQJH RU DQ\ PRGLILFDWLRQV RU XQDXWKRULVHG FKDQJHV PDGH E\
OLFHQVHHVRURWKHUSDUWLHV

Planning for the future


Plan with ADMIRALTY Maritime Data Solutions, brought to you by the UK Hydrographic Office.

Admiralty Way, Taunton, Somerset


TA1 2DN, United Kingdom
Telephone +44 (0)1823 484444
customerservices@ukho.gov.uk MANAGEMENT
SYSTEMS
gov.uk/ukho
013

Find out more about our market-leading


ADMIRALTY Maritime Data Solutions:
admiralty.co.uk

and are trademarks of the Secretary of State for Defence

© Crown Copyright 2018. All rights reserved. Correct at the time of publishing.

 Wk49/18
,

EXPLANATORY NOTES
Dating
Weekly Notices are dated for the Thursday appropriate to the week that the printed version is despatched from the UKHO.
They are available earlier from the UKHO website.
Section I - Publications List
At the beginning of the Publications List is an index of ADMIRALTY Charts affected by the Publications List. Thereafter
there are a number of standard lists which contain details and announcements concerning charts and publications relevant for
the particular Weekly Notice. Full details of how to use the various lists contained in Section I are available in NP294.
Special Announcements and Errata are occasionally included at the end of this Section.
Section IA - Temporary and Preliminary (T&P) Notices
A list of T&P Notices in force (along with a list of those cancelled during the previous month), is included in the Weekly NM
each month (see below).
Section IB - Current Nautical Publications
Information about Publications including the current edition numbers is included in the Weekly NM at the end of March,
June, September and December.
Section II - Updates to Standard Nautical Charts
The notices in Section II give instructions for the updating of standard nautical charts and selected thematic charts in the
ADMIRALTY series. Geographical positions refer to the horizontal datum of the current edition of each affected chart
which is stated in the notice alongside the appropriate chart number. Positions are normally given in degrees, minutes and
decimals of a minute, but may occasionally quote seconds for convenience when plotting from the graduation of some older-
style charts. Where Leisure Products are referred to different horizontal datums from the standard nautical charts for that
geographical area, positions in the notices cannot be plotted directly on these products. Bearings are true reckoned clockwise
from 000° to 359°; those relating to lights are from seaward. Symbols referred to are those shown in NP5011. Depths and
heights are given in metres or fathoms and/or feet as appropriate for the chart being updated (abbreviated where necessary to
m, fm and ft respectively). Blocks and notes accompanying notices in Section II are placed towards the end of the section.
T&P Notices. These are indicated by (T) or (P) after the notice number and are placed at the end of Section II. They are
printed on one side of the paper in order that they may be cut up and filed. To assist in filing, the year is indicated after the
notice number and an in-force list is published monthly. Information from these notices is not included on charts before
issue; charts should be updated in pencil on receipt. Associated diagrams are reproduced with Blocks at the end of Section II.
Original Information. A star (*) adjacent to the number of a notice indicates that the notice is based on original
information.
Section III - Navigational Warnings
NAVAREA I Navigational Warnings in force at the specified time quoted in the header are reprinted in Section III. It is
recommended that this reprint should be kept in a file or book, followed by subsequent weekly reprints. Only the most
convenient ADMIRALTY Chart is quoted. The full text of all Warnings in force is included in Weeks 1, 13, 26 and 39 each
year.
Section IV - Sailing Directions
Updates to all Sailing Directions are given in Section IV of ADMIRALTY Notices to Mariners. Those in force at the end of
the year are reprinted in NP247(2) Annual Summary of ADMIRALTY Notices to Mariners Part 2. A list of updates in force is
published in Section IV of the Weekly Edition quarterly. Full details of how to keep Sailing Directions up-to-date can be
found in NP294 How to Keep Your ADMIRALTY Products Up-to-Date.
Section V - Lights
Updates to all the List of Lights are given in Section V and may be published in an earlier edition than the chart-updating
notice. The entire entry for each light updated will be printed (including minor changes) and an asterisk (*) will denote which
column contains a change. In the case of a new light, or where a new sequence is added below the main light, an asterisk (*)
will appear under all columns. All Section V entries are intended to be cut out and pasted into the appropriate volume. It is
emphasised that the List of Lights is the primary source of information on lights and that many alterations, especially those of
a temporary but operational nature, are promulgated only as updates to the List of Lights. Light positions should be
regarded as approximate and are intended to indicate the relative positions of lights only. Charts should be consulted for a
more authoritative position. When a light is affected by a separate chart-updating notice, its Light List number is always
included in the relevant text contained in Section II. The range of a light is normally the nominal range, except when the
responsible authority quotes luminous or geographical range - see special remarks for ranges used by each country.

Wk49/18 
,

6HFWLRQ9,5DGLR6LJQDOV
8SGDWHVWRDOOWKH5DGLR6LJQDOVDUHJLYHQLQ6HFWLRQ9,:KHQDFKDUWXSGDWLQJQRWLFHLVLVVXHGIRULQIRUPDWLRQWKDWLVDOVR
LQFOXGHG ZLWKLQ WKH 5DGLR 6LJQDOV WKH DSSURSULDWH YROXPH UHIHUHQFH QXPEHU LV TXRWHG IROORZHG LQ SDUHQWKHVHV E\ WKH
QXPEHURIWKH:HHNO\(GLWLRQFRQWDLQLQJ LQ6HFWLRQ9, WKHFRUUHVSRQGLQJXSGDWHWRWKHVHUYLFHGHWDLOV7KHXSGDWHVLQ
6HFWLRQ9,VKRXOGEHFXWRXWDQGSDVWHGLQWRWKHDSSURSULDWHYROXPHV
6HFWLRQ9,,0LVFHOODQHRXV3XEOLFDWLRQV
8SGDWHVWRWKHIROORZLQJVHOHFWHGPLVFHOODQHRXV1DXWLFDO3XEOLFDWLRQVDUHFRQWDLQHGLQ6HFWLRQ9,,
13 7KH0DULQHU¶V+DQGERRN
13$ 3DSHU&KDUW0DLQWHQDQFH5HFRUG
13& (1&0DLQWHQDQFH5HFRUG
13 $'0,5$/7<*XLGHWRWKH3UDFWLFDO8VHRI(1&V
13 $'0,5$/7<*XLGHWR,PSOHPHQWDWLRQ3ROLF\DQG3URFHGXUHV
13 +RZWR.HHS\RXU$'0,5$/7<3URGXFWV8SWRGDWH
13   $'0,5$/7<2FHDQ3DVVDJHVIRUWKH:RUOG±$WODQWLF2FHDQ
13   $'0,5$/7<2FHDQ3DVVDJHVIRUWKH:RUOG±,QGLDQDQG3DFLILF2FHDQV
13   $'0,5$/7<'LVWDQFH7DEOHV±$WODQWLF2FHDQ
13   $'0,5$/7<'LVWDQFH7DEOHV±3DFLILF2FHDQ
13   $'0,5$/7<'LVWDQFH7DEOHV±,QGLDQ2FHDQ
13 ,$/$0DULWLPH%XR\DJH6\VWHP
13 6\PEROVDQG$EEUHYLDWLRQVXVHGRQ$'0,5$/7<3DSHU&KDUWV
13 $'0,5$/7<*XLGHWR(1&6\PEROVXVHGLQ(&',6
$OO7LGHV3XEOLFDWLRQV
1DXWLFDO$OPDQDF3XEOLFDWLRQVLQFOXGLQJ6LJKW5HGXFWLRQ7DEOHV
6HFWLRQ9,,,±$'0,5$/7<'LJLWDO6HUYLFHV
,QIRUPDWLRQUHOHYDQWWR$'0,5$/7<'LJLWDO6HUYLFHV
)XUWKHU*XLGDQFH
7KH0DULQHU¶V+DQGERRN 13 JLYHVDIXOOHUH[SODQDWLRQRIWKHOLPLWDWLRQVRIFKDUWVDQGGHWDLOVRIWKH8.+2SROLF\IRU
WKHSURPXOJDWLRQDQGVHOHFWLRQRIQDYLJDWLRQDOO\VLJQLILFDQWLQIRUPDWLRQIRUFKDUWV'HWDLOVRIFKDUWXSGDWLQJPHWKRGVFDQEH
IRXQG LQ ³+RZ WR .HHS <RXU $'0,5$/7< 3URGXFWV 8SWRGDWH´ 13  $OO XVHUV DUH DGYLVHG WR VWXG\ WKHVH
SXEOLFDWLRQV
&$87,21$5<127(6
8SGDWLQJ
8SGDWLQJ LQIRUPDWLRQ LV SXEOLVKHG E\ :HHNO\ 1RWLFHV WR 0DULQHUV VXSSOHPHQWHG E\ QDYLJDWLRQDO ZDUQLQJV IRU LWHPV RI
LPPHGLDWHLPSRUWDQFH,WVKRXOGEHERUQHLQPLQGWKDWWKH\PD\EHEDVHGRQUHSRUWVZKLFKFDQQRWDOZD\VEHYHULILHGEHIRUH
SURPXOJDWLRQDQGWKDWLWLVVRPHWLPHVQHFHVVDU\WREHVHOHFWLYHDQGSURPXOJDWHRQO\WKHPRUHLPSRUWDQWLWHPVWRDYRLG
RYHUORDGLQJXVHUVWKHUHPDLQGHUEHLQJLQFOXGHGLQUHYLVHGHGLWLRQVRIWKHFKDUWVDQGSXEOLFDWLRQVFRQFHUQHG
/DZVDQG5HJXODWLRQV
:KLOHLQWKHLQWHUHVWVRIWKHVDIHW\RIVKLSSLQJWKH8.+2PDNHVHYHU\HQGHDYRXUWRLQFOXGHLQLWVSXEOLFDWLRQVGHWDLOVRIWKH
ODZVDQGUHJXODWLRQVRIDOOFRXQWULHVDSSHUWDLQLQJWRQDYLJDWLRQLWPXVWEHFOHDUO\XQGHUVWRRG
a WKDWQROLDELOLW\ZKDWVRHYHUFDQEHDFFHSWHGIRUIDLOXUHWRSXEOLVKGHWDLOVRIDQ\SDUWLFXODUODZRUUHJXODWLRQDQG
b WKDWSXEOLFDWLRQRIWKHGHWDLOVRIDODZRUUHJXODWLRQLVVROHO\IRUWKHVDIHW\DQGFRQYHQLHQFHRIVKLSSLQJDQGLPSOLHVQR
UHFRJQLWLRQRIWKHLQWHUQDWLRQDOYDOLGLW\RIWKHODZRUUHJXODWLRQ
5HOLDQFHRQ&KDUWVDQG$VVRFLDWHG3XEOLFDWLRQV
:KLOH HYHU\ HIIRUW LV PDGH WR HQVXUH WKH DFFXUDF\ RI WKH LQIRUPDWLRQ RQ $'0,5$/7< FKDUWV DQG ZLWKLQ QDXWLFDO
SXEOLFDWLRQVLWVKRXOGEHDSSUHFLDWHGWKDWLWPD\QRWDOZD\VEHFRPSOHWHDQGXSWRGDWH7KHPDULQHUPXVWEHWKHILQDOMXGJH
RIWKHUHOLDQFHKHFDQSODFHRQWKHLQIRUPDWLRQJLYHQEHDULQJLQPLQGKLVSDUWLFXODUFLUFXPVWDQFHVORFDOSLORWDJHJXLGDQFH
DQGWKHMXGLFLRXVXVHRIDYDLODEOHDLGVWRQDYLJDWLRQ
&KDUWV
&KDUWVVKRXOGEHXVHGZLWKSUXGHQFH WKHUHDUHDUHDVZKHUH WKHVRXUFHGDWDDUHROG LQFRPSOHWHRURISRRUTXDOLW\7KH
PDULQHUVKRXOGXVHWKHODUJHVWVFDOHDSSURSULDWHIRUKLVSDUWLFXODUSXUSRVHDSDUWIURPEHLQJWKHPRVWGHWDLOHGWKHODUJHU
VFDOHVDUHXVXDOO\XSGDWHGILUVW:KHQH[WHQVLYHQHZLQIRUPDWLRQ VXFKDVDQHZK\GURJUDSKLFVXUYH\ LVUHFHLYHGVRPH
PRQWKV PD\ HODSVH EHIRUH LW FDQ EH IXOO\ LQFRUSRUDWHG LQ SXEOLVKHG FKDUWV 2Q VPDOO VFDOH FKDUWV RI RFHDQ DUHDV ZKHUH
K\GURJUDSKLFLQIRUPDWLRQLVLQPDQ\FDVHVVWLOOVSDUVHFKDUWHGVKRDOVPD\EHLQHUURUDVUHJDUGVSRVLWLRQOHDVWGHSWKDQG
H[WHQW8QGLVFRYHUHGGDQJHUVPD\H[LVWSDUWLFXODUO\DZD\IURPZHOOHVWDEOLVKHGURXWHV
6DWHOOLWH'HULYHG3RVLWLRQVDQG&KDUW$FFXUDF\
0DULQHUVPXVWQRWDVVXPHWKDWFKDUWVZKLFKDUHUHIHUUHGWR:*6'DWXPRUWKRVHIRUZKLFKVKLIWVWR:*6'DWXPDUH
SURYLGHGKDYHEHHQVXUYH\HGWRPRGHUQVWDQGDUGVRIDFFXUDF\2QVRPHFKDUWVRZLQJWRWKHDJHDQGTXDOLW\RIWKHVRXUFH
LQIRUPDWLRQVRPHRIWKHFKDUWHGGHWDLOPD\QRWEHSRVLWLRQHGDFFXUDWHO\,QVXFKFDVHVPDULQHUVDUHDGYLVHGWRH[HUFLVH
SDUWLFXODUFDXWLRQZKHQQDYLJDWLQJLQWKHYLFLQLW\RIGDQJHUVHYHQZKHQXVLQJDQHOHFWURQLFSRVLWLRQLQJV\VWHPVXFKDV*36
)RUIXUWKHUGHWDLOVVHH7KH0DULQHU¶V+DQGERRN 13 7KLVDSSOLHVWRERWKSDSHUDQGGLJLWDO $'0,5$/7<5DVWHU
&KDUW6HUYLFHDQG(1& YHUVLRQVRIFKDUWV

 Wk49/18

I
[49/18]
ADMIRALTY Charts affected by the Publication List

ADMIRALTY Chart International Chart

139 INT 1176


272 INT 1201
798 INT 1206
809 INT 1220
924 INT 1416
1042 INT 1642
1138 INT 1643
1250 INT 2516
1286 INT 4184
1480 INT 7356
1565
1630 ADMIRALTY Publication
1749
1771 NP 7
1951 e-NP 7
2001 NP 131
2015 NP 283(1)
2082
2645 Erratum
2653
2654 NM Weekly Section II - Wk 45/18
3045 2018
3490 2856
4756
4757
4758
4908
8048
8194
8239
IN 220
IN 221
IN 259

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk49/18 1.6
I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE

NEW ADMIRALTY CHARTS AND PUBLICATIONS

Reproductions of Indian Government Charts


(Publication dates of these charts reflect the dates shown on the Indian Government Charts)

Chart Published Title, limits and other remarks Scale Folio 2018 Catalogue
page

IN220 15/06/2018 India - West Coast, Tānūr Nagaram to Manakkodam. 1:150,000 41 58


9° 33´·00 N. — 10° 59´·00 N., 75° 26´·00 E. — 76° 21´·00 E.

One of a series of new charts providing improved coverage of


the west coast of India. (A modified reproduction of Chart 220
published by India.)

IN221 15/06/2018 India - West Coast, Alappuzha (Alleppey) to Kollam (Quilon). 1:150,000 41 58
8° 45´·50 N. — 9° 40´·00 N., 75° 23´·00 E. — 76° 45´·80 E.

One of a series of new charts providing improved coverage of


the west coast of India. (A modified reproduction of Chart 221
published by India.)

IN259 31/03/2018 International Chart Series, India - West Coast, Badagara to 1:300,000 41 58
INT 7356 Kochi.
8° 51´·00 N. — 11° 39´·00 N., 74° 42´·00 E. — 76° 35´·00 E.

One of a series of new charts providing improved coverage of


the west coast of India. (A modified reproduction of INT7356
published by India.) (This chart is included in the International
Chart Series.)

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.7 Wk49/18
I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

New Editions of ADMIRALTY Charts published 06 December 2018

Chart Title, limits and other remarks Scale Folio 2018 Catalogue
page

272 North Sea Offshore Charts, Sheet 8. 1:200,000 7 28, 32

Includes significant safety-related information as follows: a new


submarine cable.

Note: On publication of this New Edition former Notice 5182(P)/18 is


cancelled. This chart remains affected by Notices 1256(P)/18 and
2429(P)/18.

798 Sweden - East Coast, Gotland - Northern Part. 1:120,000 10 36


INT 1220 A Visby. 1:10,000
B Kappelshamnsviken. 1:25,000
C Fårösund. 1:50,000
D Slite Approaches. 1:50,000
E Slite. 1:10,000
F Ports of Fårösund. 1:12,500

Includes changes to firing practice areas. (A modified reproduction of


Chart 731 published by Sweden.)

Note: On publication of this New Edition former Notice 5320(P)/18 is


cancelled. This chart remains affected by Notice 5453(P)/18.

1138 Channel Islands, Jersey - East Coast. 1:25,000 16 24

Includes the latest British Government survey.

Note: On publication of this New Edition former Notice 3555(P)/18 is


cancelled.

1630 International Chart Series, North Sea, Netherlands, West Hinder and 1:150,000 9 24, 32
INT 1416 Outer Gabbard to Vlissingen and Scheveningen.

Includes changes to depths, wind farms, submarine cables, restricted


areas and aids to navigation. Published jointly by the UKHO and by the
Hydrographer of the Royal Netherlands Navy.

Note: This chart is to be deleted from the list of charts affected by


Notices 3496(P)/17, 301(P)/18, 5513(P)/18 and 5577(P)/18. This chart
remains affected by Notices 5132(P)/17, 1745(P)/18 and 4078(T)/18.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk49/18 1.8
I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

New Editions of ADMIRALTY Charts published 06 December 2018 (continued)

Chart Title, limits and other remarks Scale Folio 2018 Catalogue
page

1771 International Chart Series, South Atlantic Ocean, Saint Helena 35 52


INT 2516 Dependencies, Saint Helena with Approaches to Ascension Island.
A Approaches to Ascension Island. 1:150,000
B Saint Helena. 1:125,000
15° 40´·00 S. — 16° 17´·00 S., 5° 14´·23 W. — 6° 06´·79 W.
C Saint Helena, Rupert's and James Bays. 1:15,000
15° 53´·70 S. — 15° 56´·10 S., 5° 42´·05 W. — 5° 44·53 W.
D Saint Helena, Rupert's Bay. 1:4,500
15° 54´·650 S. — 15° 55´·222 S., 5° 42´·454 W. — 5° 43·200 W.

Includes changes to depths from the latest British Government and Saint
Helena Government Surveys. A new plan has been included, providing
improved coverage of Rupert's Bay. The limits of Panels B and C have
been changed.

1951 International Chart Series, England - West Coast, Approaches to 1:25,000 3 26


INT 1642 Liverpool.

Includes changes to depths from the latest Mersey Docks and Harbour
Company Surveys.

Note: On publication of this New Edition former Notice 3670(P)/18 is


cancelled. This chart remains affected by Notices 4499(T)/18.

2082 International Chart Series, Gulf of Bothnia, Grundkallen to Hudiksvall 1:250,000 11 36


INT 1206 and Kaurissalo to Yttergrund.

Includes changes to depths, wrecks, rocks, obstructions, aids to


navigation and nature reserves. (A modified reproduction of INT1206
published by Sweden.)

3490 International Chart Series, England - West Coast, Port of Liverpool. 3 26


INT 1643 A 1:15,000
B 1:15,000

Includes changes to depths from the latest Mersey Docks and Harbour
Company Surveys.

Note: On publication of this New Edition former Notice 3670(P)/18 and


5626(P)/18 are cancelled.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.9 Wk49/18
I

ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

New Editions of ADMIRALTY Charts published 06 December 2018 (continued)

Chart Title, limits and other remarks Scale Folio 2018 Catalogue
page

8194 Port Approach Guide, Livorno. - 26 141


A Approaches to Livorno.
B Livorno.

Includes changes to anchorages, depths, dredged areas, coastline and


works.

Note: On publication of this New Edition former Notice 3388(P)/18 is


cancelled.

8239 Port Approach Guide, La Spezia. - 26 141


A Rada di La Spezia.
B Approaches to La Spezia.

Includes changes to coastline, unsurveyed areas, works, depths and


restricted areas.

Note: On publication of this New Edition former Notices 157(P)/17,


4439(P)/17, 4566(P)/17, 352(P)/18 ad 2364(P)/18 are cancelled.

ADMIRALTY Publications

NP No. Title and other remarks Date Remarks

NP7 ADMIRALTY Sailing Directions. South America Pilot Volume 3 06/12/2018 Updated to Week 35/18
& (Thirteenth Edition) 2018. (30/08/18) First updates in NM
e-NP7 week 49/18. This edition
ISBN Number: 978-0-70-774-5329 supersedes NP7 (Twelfth Edition
2015) which is cancelled.

NP283(1) ADMIRALTY List of Radio Signals. Maritime Safety Information Updated to Week 42/18
Services. Europe, Africa and Asia (excluding the Far East). 2018/19 (18/10/18) First updates in NM
Edition. week 49/18. The 2017/18 Edition
of NP283(1) is cancelled.
ISBN Number: 978-0-70-774-4704

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk49/18 1.10
I
ADMIRALTY CHARTS AND PUBLICATIONS TO BE PUBLISHED

ADMIRALTY CHARTS TO BE PUBLISHED 20 DECEMBER 2018

New ADMIRALTY Charts


Charts to be
Chart Title, limits and other remarks Scale WITHDRAWN Folio

4908 United States - West Coast, California, Port Hueneme and Approaches. 1:20,000 4908 89
34° 00´·40 N .— 34° 11´·40 N., 119° 09´·40 W .— 119° 17´·70 W.
Port Hueneme.
34° 08´·50 N .— 34° 09´·33 N., 119° 12´·00 W .— 119° 13´·00 W. 1:12,500

A metric replacement of Chart 4908. For the convenience of chart


users, the number of the cancelled chart has been retained for this
New Chart.

New Editions of ADMIRALTY Charts


Charts to be
Chart Title, limits and other remarks Scale WITHDRAWN Folio

139 China - Hainan Dao, Macun Gangqu. 1:12,500 139 47

Includes significant safety-related information as follows: changes


to depths.

809 China - Yellow Sea, Dongjiakou Gangqu. 1:15,000 809 52

Includes significant safety-related information as follows: changes


to depths and coastline.

924 International Chart Series, Sweden - East Coast, Approaches to 1:50,000 924 11
INT 1176 Skelleftehamn. INT 1176

Includes significant safety-related information as follows: changes


to Firing Practice Area.

1042 International Chart Series, West Indies - Lesser Antilles, Montserrat 1:300,000 1042 87
INT 4184 to Saint Lucia. INT 4184

Includes changes to depths, aids to navigation, obstructions,


submarine cables and maritime limits. (A modified reproduction of
INT4184 published by France.)

1250 China - Bo Hai, Miaodao Qundao to Tianjin Gang. 1:300,000 1250 52

Include general updating throughout.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.11 Wk49/18
I
ADMIRALTY CHARTS AND PUBLICATIONS TO BE PUBLISHED

ADMIRALTY CHARTS TO BE PUBLISHED 20 DECEMBER 2018

New Editions of ADMIRALTY Charts (continued)


Charts to be
Chart Title, limits and other remarks Scale WITHDRAWN Folio

1286 China - Bo Hai, Liaodong Wan, Approaches to Panjin Gang and 1:50,000 1286 52
Yingkou Gangqu.
Continuation to Yingkou Gangqu. 1:50,000

Includes significant safety-related information as follows: changes


to depths, buoyage and coastline.

1480 Italy - East Coast, Porto Marghera and Porto di Chioggia. 1480 27
A Porto di Chioggia. 1:12,500
B Porto Marghera. 1:12,500

Includes significant safety-related information as follows: changes


to dredged depths and dredged depth areas within Porto Marghera
and in the Canal Litoraneo.

1749 Argentina - Uruguay, Río de la Plata, Montevideo to Buenos Aires. 1:250,000 1749 95

Includes significant safety-related information as follows: new


restricted areas and changes to depths, firing practice area and pilot
boarding place.

2001 Uruguay, Montevideo and Approaches. 2001 95


A Bahía de Montevideo. 1:20,000
B Approaches to Montevideo. 1:75,000

Includes significant safety-related information as follows: changes to


depths, firing practice area and pilot boarding place and new
restricted areas.

2015 International Chart Series, Baltic Sea, Falsterbo to Świnoujście. 1:250,000 2015 10
INT 1201 A Trelleborg. 1:25,000 INT 1201
B Ystad. 1:15,000

Includes significant safety-related information as follows:changes to


firing practice areas and buoyage.

2645 China - Bo Hai - Tianjin Gang, Dagang Gangqu and Approaches. 1:50,000 2645 52

Includes significant safety-related information as follows: changes to


coastline, depths, breakwater and works..

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk49/18 1.12
I
ADMIRALTY CHARTS AND PUBLICATIONS TO BE PUBLISHED

ADMIRALTY CHARTS TO BE PUBLISHED 20 DECEMBER 2018

New Editions of ADMIRALTY Charts (continued)


Charts to be
Chart Title, limits and other remarks Scale WITHDRAWN Folio

2653 China - Bo Hai, Approaches to Tianjin Gang. 1:50,000 2653 52

Includes significant safety-related information as follows: changes to


depths and coastline.

2654 China - Bo Hai, Dongying Gang. 1:25,000 2654 52

Includes significant safety-related information as follows: changes to


coastline, breakwaters, lights and depths.

3045 Russia - Pacific Coast, Approaches to Vladivostok. 1:100,000 3045 56

Includes general updating throughout.

8048 Port Approach Guide, Salvador and Associated Terminals. 8048 95


A Salvador including Approaches to Porto de Aratu and
Porto de Madre de Deus.
B Porto de Aratu.
C Porto de Madre de Deus.

Includes changes to anchorages and pilot boarding place.

ADMIRALTY CHARTS AND PUBLICATIONS PERMANENTLY WITHDRAWN

ADMIRALTY Charts

Chart to be On publication of
WITHDRAWN Main Title New Chart/New Edition

272 North Sea Offshore Charts, Sheet 8. 272

798 International Chart Series, Sweden - East Coast, Gotland - Northern Part. 798
INT 1220 INT 1220

1138 Channel Islands, Jersey - East Coast. 1138

1565 India - West Coast, Alleppey to Sacrifice Rock. IN259


INT 7356
Note: On withdrawal of this chart former Notices 3204(T)/17, 4482(T)/18 and
4484(T)/18 are cancelled.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.13 Wk49/18
I
ADMIRALTY CHARTS AND PUBLICATIONS PERMANENTLY WITHDRAWN

ADMIRALTY Charts (continued)

Chart to be On publication of
WITHDRAWN Main Title New Chart/New Edition

1771 International Chart Series, South Atlantic Ocean, Saint Helena Dependencies, 1771
INT 2516 Saint Helena with Approaches to Ascension Island. INT 2516

1951 International Chart Series, England - West Coast, Approaches to Liverpool. 1951
INT 1642 INT 1642

2082 International Chart Series, Gulf of Bothnia, Grundkallen to Hudiksvall and 2082
INT 1206 Kaurissalo to Yttergrund. INT 1206

3490 International Chart Series, England - West Coast, Port of Liverpool. 3490
INT 1643 INT 1643

8194 Port Approach Guide Livorno. 8194

8239 Port Approach Guide La Spezia. 8239

ADMIRALTY CHARTS INDEPENDENTLY WITHDRAWN

ADMIRALTY Charts

Chart to be WITHDRAWAL Date


WITHDRAWN Main Title

4756 Canada, Nova Scotia/Nouvelle-Écosse, Strait of Canso and Approaches 06 December 2018
/ et Les Approches..

4757 Canada, Nova Scotia/Nouvelle-Écosse, St George’s Bay. 06 December 2018

4758 Canada, Nova Scotia/Nouvelle-Écosse, Strait of Canso. 06 December 2018

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk49/18 1.14
I
ADMIRALTY CHART AGENT / DISTRIBUTOR INFORMATION

NP131 - Catalogue of ADMIRALTY Charts (NP131), 2018 Edition


Amendments to Part 1, ADMIRALTY Authorised Chart Agents / Distributors
Page 6, Distributors section,

Amend:

Beijing Shipping Business Tech.


Development Co., Ltd. (Ningbo Branch)
Room 1606, Lane 77
Lane 528
Haishu District
Ningbo City
Zhejiang Province
China
T: +86 574 87324911
F: +86 574 27860573
info@nbsimlux.com

Digital

Add:

Beijing Shipping Business Tech.


Development Co., Ltd. (Shanghai Branch)
Room D21, Building 2, City Concept
No. 619, Longchang Road
Yangpu District
Shanghai
China
T: +86 21 65138911
F:
longfeng@nbsimlux.com

Digital

ERRATUM
(certain copies only)

Weekly Notice to Mariners Week 45/18

Section II, Page 2.13

Blocks to accompany Notices to Mariners 5334/18, Charts 2018 and 2856 were omitted from some printed paper copies. These blocks are
now available within Section II – Admiralty Notices to Mariners Wk 49-18.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.15 Wk49/18
II

GEOGRAPHICAL INDEX

(1) Miscellaneous . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.7 – 2.9


(2) British Isles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.9 – 2.11
(3) North Russia, Norway, The Færoe Islands and Iceland . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(4) Baltic Sea and Approaches . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.11 – 2.12
(5) North Sea and North and West Coasts of Denmark, Germany, Netherlands and Belgium . . . . . . . . . . . . . . 2.12
(6) France and Spain, North and West Coasts, and Portugal . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.13
(7) North Atlantic Ocean. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.13
(8) Mediterranean and Black Seas. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.14 – 2.16
(9) Africa, West Coast and South Atlantic . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.16
(10) Africa, South and East Coasts, and Madagascar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(11) Red Sea, Arabia, Iraq and Iran. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.17 – 2.19
(12) Indian Ocean, Pakistan, India, Sri Lanka, Bangladesh and Burma . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.19 – 2.22
(13) Malacca Strait, Singapore Strait and Sumatera . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(14) China Sea with its West Shore and China . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.22 – 2.24
(15) Japan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.24 – 2.25
(16) Korea and the Pacific Coasts of Russia . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.25 – 2.26
(17) Philippine Islands, Borneo and Indonesia except Sumatera . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(18) Australia and Papua New Guinea . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.26 – 2.31
(19) New Zealand . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(20) Pacific Ocean . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.32
(21) Aleutian Islands, Alaska and West Coast of North America including Mexico . . . . . . . . . . . . . . . . . 2.32 – 2.34
(22) West Coasts of Central and South America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.35
(23) Antarctica. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(24) East Coast of South America and The Falkland Islands . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.36
(25) Caribbean Sea, West Indies and the Gulf of Mexico. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.36 – 2.37
(26) East Coast of North America and Greenland . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.37 – 2.39
(27) T & P Notices . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.40 – 2.49

2.1
Wk49/18
II

INDEX OF NOTICES AND CHART FOLIOS

Notice No. Page Admiralty Chart Folio Notice No. Page Admiralty Chart Folio
5693 2.24 53 5750 2.38 78
5694 2.24 53 5751(P)/18 2.41 9
5695 2.25 53 5752 2.7 34
5696 2.25 53 5753 2.33 91
5697 2.25 54 5754 2.38 79
5698 2.25 54 5755* 2.10 1
5699(T)/18 2.45 55 5756 2.38 81
5700(T)/18 2.45 54 5757 2.33 90
5701(T)/18 2.45 54 5758* 2.16 34
5702(T)/18 2.46 54 5759 2.13 1, 9
5703(T)/18 2.46 54 5760 2.13 16
5704(T)/18 2.46 53 5761 2.33 91, 92
5705 2.32 89 5762* 2.10 6
5706(P)/18 2.44 47 5763 2.18 40
5707(T)/18 2.48 72 5764 2.25 52
5708 2.22 50 5765 2.39 81
5709 2.14 30 5766 2.14 27
5710 2.26 63 5767(P)/18 2.40 7, 9
5711(T)/18 2.40 6 5768 2.34 90
5712* 2.19 40, 42, 45 5769 2.11 11
5713(T)/18 2.47 63 5770 2.21 41
5714 2.36 87 5771* 2.37 86
5715(T)/18 2.40 7 5772 2.15 27
5716 2.26 65 5773 2.15 28, 29
5717 2.27 66 5774* 2.32 70
5718 2.27 66 5775 2.7–2.9 41, 42
5719 2.32 68 5776 2.34 90
5720 2.27 66 5777 2.34 90
5721 2.27 64 5778 2.13 18
5722 2.28 64 5779(T)/18 2.40 6
5723 2.28 63 5780 2.21 41
5724 2.28 63 5781 2.23 50
5725(T)/18 2.47 66 5782 2.35 98
5726 2.28 64 5783 2.12 9
5727 2.29 67 5784 2.19 40
5728 2.29 66 5785(P)/18 2.42 31
5729(T)/18 2.47 66 5786* 2.11 2, 3
5730 2.32 90, 91 5787 2.13 19
5731(T)/18 2.45 47 5788 2.21 41, 42
5732(T)/18 2.48 66 5789 2.16 25
5733 2.31 66 5790 2.36 34
5734(T)/18 2.48 66 5791* 2.16 34
5735(T)/18 2.48 63 5792 2.35 89
5736 2.14 31 5793 2.22 41
5737 2.22 52 5794(T)/18 2.44 41, 42
5738* 2.9 3 5795 2.26 52
5739* 2.16 34 5796 2.23 50
5740(P)/18 2.49 88 5797 2.26 52
5741 2.12 9 5798 2.9 31
5742 2.14 31 5799 2.24 50
5743 2.33 90 5800(T)/18 2.43 31
5744 2.33 91 5801* 2.11 3
5745* 2.17 40 5802 2.9 30
5746 2.37 80 5803(T)/18 2.41 18
5747* 2.10 7 5804 2.12 10
5748(P)/18 2.43 40 5805(P)/18 2.42 18
5749 2.37 79 5806 2.39 81

2.2
Wk49/18
II

INDEX OF NOTICES AND CHART FOLIOS

Notice No. Page Admiralty Chart Folio Notice No. Page Admiralty Chart Folio
5807 2.12 10
5808(T)/18 2.43 27
5809(T)/18 2.42 18
5810(T)/18 2.41 9
5811(P)/18 2.46 52
5812(T)/18 2.41 11
5813(P)/18 2.47 52

2.3
Wk49/18
II

INDEX OF CHARTS AFFECTED

Admiralty Chart No. Notices


Notices Admiralty
Admiralty Chart
Chart No.
No. Notices

26 5755 1764 5805P


39 5794T 1768 5799
47 5776 1872 5759
66 5706P 1873 5759
73 5778 1889 5711T, 5762
89 5803T 1890 5762
91 5809T 1895 5787
93 5809T 1950 5787
156 5715T 1954 5779T
166 5789 1965 5731T
201 5808T 1981 5738
202 5772 2047 5771
223 5711T 2049 5786
246 5709, 5802 2079 5771
247 5709 2131 5801
306 5739 2135 5760
323 5759 2167 5769
483 5714 2218 5812T
583 5771 2230 5736
595 5791 2232 5736
655 5792 2234 5798
707 5794T 2243 5800T
709 5794T 2282 5736
813 5712 2284 5736
828 5775, 5794T 2662 5737
847 5804 2711 5766
874 5807 2738 5775, 5788, 5794T
1024 5792 2832 5789
1026 5792 2887 5745
1044 5714 2888 5745
1045 5714 2889 5745
1058 5773 3034 5789
1061 5773 3089 5782
1063 5705 3118 5790
1065 5795 3174 5745
1077 5711T 3175 5745
1082 5705 3236 5796
1087 5773 3302 5785P
1163 5764 3327 5752, 5790
1178 5786 3328 5752
1199 5781 3391 5797
1258 5813P 3405 5745
1275 5742 3434 5758
1306 5781 3457 5765
1350 5759 3497 5747
1383 5791 3518 5763
1408 5767P 3520 5784
1410 5786 3522 5763
1457 5810T 3523 5712
1461 5808T 3617 5741
1465 5794T 3619 5751P
1503 5767P 3636 5803T
1504 5767P 3658 5796
1509 5775, 5794T 3666 5811P
1516 5806 3688 5756
1528 5806 3709 5784
1566 5775 3723 5784
1587 5712, 5794T 3746 5801
1595 5790 3754 5753
1624 5773 3818 5812T
1631 5767P 3875 5731T
1633 5783 3900 5712
1670 5774 3919 5712
1702 5789 3943 5712
1703 5789 4603 5710, 5723
1716 5708 4721 5710, 5723
1736 5708 4722 5710
1761 5796 4739 5750
1762 5805P 4748 5746

2.4
Wk49/18
II

INDEX OF CHARTS AFFECTED

Admiralty Chart No. Notices


Notices Australian
Admiralty Chart No. Notices
Chart No.
4776 5749
4777 5754
4935 5761 New Zealand
Notices
4936 5761 Chart No.
4939 5744
4940 5761 NZ 6321 5707T
4942 5730
4943 5730 Panamanian
4951 5777 Notices
4952 5777 Chart No.
4955 5777
4956 5777 CP 1 5740P
4958 5768
4962 5777 Japanese
4963 5743 Notices
Chart No.
4965 5757
8072 5751P JP 67 5695
8191 5748P JP 87 5693, 5694
JP 90 5693, 5694
Australian JP 135 5703T
Notices JP 137B 5700T
Chart No. JP 142 5702T
Aus 57 5713T JP 149 5699T
Aus 58 5713T JP 153 5700T, 5701T
Aus 81 5722 JP 1057B 5696
Aus 117 5726 JP 1061 5693, 5694
Aus 202 5716 JP 1086 5693
Aus 208 5718 JP 1102 5702T
Aus 235 5725T JP 1108 5701T, 5702T
Aus 236 5729T JP 1112A 5698
Aus 237 5720 JP 1127B 5697
Aus 238 5720, 5732T JP 1227 5704T
Aus 249 5734T JP 1262 5703T
Aus 250 5734T JP 1263 5703T
Aus 309 5723
Aus 319 5710 Indian
Aus 325 5735T Notices
Chart No.
Aus 326 5735T
Aus 327 5724 IN 22 5775, 5788, 5794T
Aus 332 5722 IN 203 5780
Aus 377 5733 IN 206 5770
Aus 389 5727 IN 211 5793
Aus 700 5728 IN 221 5794T
Aus 739 5735T IN 253 5794T
Aus 751 5722 IN 258 5794T
Aus 756 5721 IN 259 5794T
Aus 814 5729T IN 292 5794T
Aus 815 5717 IN 293 5775, 5794T
Aus 816 5728 IN 2018 5780
Aus 818 5728 IN 2029 5775
Aus 819 5728 IN 2080 5780
Aus 821 5728 IN 2359 5775
Aus 822 5728
Aus 823 5728
Aus 824 5728 Soloman Islands
Notices
Aus 825 5728 Chart No.
Aus 826 5728
Aus 827 5728 SLB 301 5719
Aus 828 5728 SLB 302 5719
Aus 829 5728
Aus 830 5728 International
Aus 831 5728 Notices
Aus 832 5728 Chart No.
Aus 833 5728
Aus 835 5728 INT 603 5710, 5723
Aus 839 5728 INT 721 5710, 5723
Aus 840 5728 INT 722 5710
Aus 841 5728 INT 752 5775, 5788, 5794T
INT 1159 5812T

2.5
Wk49/18
II

INDEX OF CHARTS AFFECTED

International
Admiralty Chart No. Notices Admiralty Chart No. Notices
Notices
Chart No.
INT 1231 5804
INT 1250 5812T
INT 1319 5807
INT 1417 5783
INT 1418 5767P
INT 1452 5751P
INT 1456 5741
INT 1464 5810T
INT 1480 5759
INT 1482 5759
INT 1509 5767P
INT 1510 5767P
INT 1540 5711T, 5762
INT 1554 5747
INT 1564 5759
INT 1601 5779T
INT 1609 5786
INT 1611 5786
INT 1612 5786
INT 1635 5801
INT 1724 5755
INT 1812 5809T
INT 1901 5778
INT 2087 5791
INT 2088 5790
INT 2806 5791
INT 2811 5752, 5790
INT 2812 5752
INT 2814 5739
INT 3660 5709, 5802
INT 3784 5773
INT 3794 5709
INT 5251 5811P
INT 5360 5797
INT 7021 5794T
INT 7022 5775, 5794T
INT 7199 5745
INT 7200 5784
INT 7209 5745
INT 7211 5745
INT 7212 5745
INT 7215 5745
INT 7232 5745
INT 7318 5794T
INT 7319 5780
INT 7321 5780
INT 7328 5794T
INT 7348 5794T
INT 7350 5775
INT 7356 5794T
INT 7358 5775
INT 7386 5712
INT 11321 5769

2.6
Wk49/18
II
5752 MISCELLANEOUS UPDATES TO CHARTS

Source: UKHO

Chart Previous Update Details

3327 4975/18 Effective from 29/11/18 on publication of Chart 3325


INT 2811 Insert magenta limit and chart number, 3325, as follows:

North: 0° 31´·2N. East: 9° 34´·5E.


South: 0° 15´·0N. West: 9° 10´·8E.
Delete magenta limit and chart reference, 1356 (see Note – POSITIONS), in the
following positions:

0° 06´·6N., 9° 05´·8E.
1° 13´·6N., 9° 05´·6E.
Delete note, CHART 1356: POSITIONS, centred on 1° 34´·5N., 6° 28´·5E.

3328 3013/16 Effective from 29/11/18 on publication of Chart 3325


INT 2812 Insert magenta limit and chart number, 3325, as follows:

North: 0° 31´·2N. East: 9° 34´·5E.


South: 0° 15´·0N. West: 9° 10´·8E.
Delete magenta limit and chart reference, 1356 (see Note – POSITIONS), in position
0° 06´·5N., 9° 05´·7E.
Delete note, CHART 1356: POSITIONS, centred on 1° 47´·5S., 9° 46´·3E.

5775 MISCELLANEOUS UPDATES TO CHARTS

Source: UKHO

Chart Previous Update Details

IN 22 5435/18 Effective from 29/11/18


INT 752 Insert accompanying note, CHART IN258: POSITIONS, centred on
13° 12´·2N., 76° 56´·2E.
Amend chart reference to read, IN258 (see Note – POSITIONS), in position
13° 56´·9N., 75° 43´·8E.
Effective from 6/12/18.
Insert accompanying note, CHART IN259: POSITIONS, centred on
13° 24´·0N., 76° 56´·2E.
Amend chart reference to read, IN259 (see Note – POSITIONS), in position
11° 37´·5N., 74° 45´·7E.

IN 293 5435/18 Effective from 29/11/18


INT 7022 Insert magenta limit and chart reference, IN258 (see Note – POSITIONS), as follows:

North: 13° 58´·5N. East:-


South:- West: 73° 55´·5E.
Insert accompanying note, CHART IN258: POSITIONS, centred
on16° 18´·9N., 74° 29´·5E.
Delete magenta limit and chart number, 1564, in position 14° 00´·4N., 74° 01´·0E.

828 4663/18 Effective from 6/12/18


Insert magenta limit and chart number, IN259, as follows:

North: 11° 39´·0N. East:76° 35´·0E.


South: 8° 51´·0N. West:-
Delete magenta limit and chart number, 1565, in position 8° 59´·7N., 76° 22´·2E.

2.7
Wk49/18
II
5775 MISCELLANEOUS UPDATES TO CHARTS (continued)

Source: UKHO

Chart Previous Update Details

1509 4900/18 Effective from 29/11/18


Insert magenta limit and chart reference, IN216 (see Note – POSITIONS), as follows:

North: 14° 49´·9N. East: 74° 41´·0E.


South: 13° 28´·9N. West: 73° 47´·0E.
Insert magenta limit and chart reference, IN217 (see Note – POSITIONS), as follows:

North: 13° 39´·9N. East:-


South:- West: 74° 10´·0E.
Insert accompanying note, CHARTS IN217 AND IN258: POSITIONS, centred on
15° 30´·7N., 74° 22´·2E.
Insert accompanying note, CHART IN216: POSITIONS, centred on
15° 27´·0N., 74° 22´·2E.
Amend reference in S border at longitude 70° 20´·0E. to read, Adjoining Chart IN258
(see Note – POSITIONS)

1566 4663/18 Effective from 6/12/18


Insert magenta limit and chart reference, IN221 (see Note – POSITIONS), as follows:

North: 9° 39´·9N. East: 76° 45´·9E.


South: 8° 45´·4N. West:-
Insert magenta limit and chart reference, IN220 (see Note – POSITIONS), as follows:

North:- East: 76° 21´·1E.


South: 9° 32´·9N. West:-
Insert accompanying note, CHART IN259: POSITIONS, centred on
9° 15´·0N., 77° 17´·4E.
Amend reference in N border at longitude 76° 05´·0E. to read, Adjoining Chart IN259
(see Note – POSITIONS).
Replace existing note, CHART IN262: POSITIONS, with the accompanying note,
CHARTS IN220, IN221 AND IN262: POSITIONS, centred on 9° 18´·5N., 77° 17´·4E.
Delete magenta limit and chart reference, IN2029 (see Note – POSITIONS), in position
9° 44´·3N., 75° 58´·1E.
Delete note, CHART IN2029: POSITIONS, centred on 9° 22´·1N., 77° 17´·4E.

IN 2029 3654/18 Effective from 6/12/18


INT 7358 Delete note, CHARTS 1565 AND 1566: POSITIONS, centred on
10° 08´·61N., 76° 13´·17E.

IN 2359 4728/18 Effective from 29/11/18


INT 7350 Delete note, CHART 1564: POSITIONS, centred on 12° 56´·20N., 74° 51´·32E.

2.8
Wk49/18
II
5775 MISCELLANEOUS UPDATES TO CHARTS (continued)

Source: UKHO

Chart Previous Update Details

2738 4929/18 Effective from 29/11/18


Insert magenta limit and chart reference, IN258 (see Note – POSITIONS), as follows:

North: 13° 58´·5N. East: 75° 48´·5E.


South: 11° 13´·0N. West: 73° 55´·5E.
Insert accompanying note, POSITIONS, centred on 12° 28´·6N., 75° 57´·2E.
Delete magenta limit and chart number, 1564, in position 11° 16´·0N., 74° 06´·8E.
Effective from 6/12/18
Insert magenta limit and chart reference, IN259 (see Note – POSITIONS), as follows:

North: 11° 39´·0N. East:-


South:8° 51´·0N. West: 74° 42´·0E.
Insert magenta limit and chart reference, IN221 (see Note – POSITIONS), as follows:

North: 9° 40´·0N. East:-


South: 8° 45´·5N. West: 75° 23´·0E.
Delete magenta limit and chart number, 1565, in position 8° 58´·9N., 74° 47´·2E.

5798 MISCELLANEOUS UPDATES TO CHARTS

Source: UKHO

Chart Previous Update Details

2234 5464/18 Effective from 29/11/18 on publication of Chart 3302


Replace the existing note with the accompanying note, CHART 3302: POSITIONS,
centred on 45° 23´·9N., 39° 26´·3E.

5802 MISCELLANEOUS UPDATES TO CHARTS

Source: UKHO

Chart Previous Update Details

246 5709/18 Effective immediately


INT 3660 Delete Panel A, ULUÇINAR
Delete magenta limit and reference, See Plan A, in position 36° 24´·74N., 35° 53´·39E.

5738* ENGLAND - West Coast - Obstruction.


Source: Spirit Energy

Chart 1981 [ previous update 5557/18 ] ETRS89 DATUM


Insert
å Unexploded Ordnance Rep (2018) (buried) 53° 50´·24N., 3° 34´·42W.

2.9
Wk49/18
II

5747* ENGLAND - East Coast - Depths.


Source: ABP Humber
Note: Former Notice 5675(P)/18 is cancelled

Chart 3497 (INT 1554) [ previous update New Edition 15/11/2018 ] ETRS89 DATUM
Insert depth, 19 , and extend 2m contour NW to enclose (a) 53° 43´·38N., 0° 19´·06W.
Delete depth, 25 , close SE of: (a) above
Insert depth, 07 53° 43´·27N., 0° 19´·16W.

5755* ENGLAND - South Coast - Buoyage.


Source: Teignmouth Harbour Commission

Chart 26 (INT 1724) (Panel C, Teignmouth Harbour) [ previous update 2088/18 ] ETRS89 DATUM
Insert
CbFl.G.2s Spratt Sands Inner 50° 32´·370N., 3° 29´·900W.
BdFl.R.2s Ness Rocks 50° 32´·342N., 3° 29´·788W.

5762* SCOTLAND - East Coast - Buoyage.


Source: Northern Lighthouse Board

Chart 1889 (INT 1540) [ previous update 5412/18 ] ETRS89 DATUM


Replace
Df with D;f Q(2)Y.5s 57° 40´·950N., 4° 11´·880W.
Df with D;f Fl(3)Y.10s 57° 40´·950N., 4° 11´·240W.
Cb with Cb Fl(2)G.6s 57° 40´·810N., 4° 11´·880W.
Cb with Cb Q(3)G.5s 57° 40´·810N., 4° 11´·240W.

Chart 1890 [ previous update 5412/18 ] ETRS89 DATUM


Replace
Df with D;f Q(2)Y.5s 57° 40´·950N., 4° 11´·880W.
Df with D;f Fl(3)Y.10s 57° 40´·950N., 4° 11´·240W.
Cb with Cb Fl(2)G.6s 57° 40´·810N., 4° 11´·880W.
Cb with Cb Q(3)G.5s 57° 40´·810N., 4° 11´·240W.

2.10
Wk49/18
II

5786* IRELAND - South Coast - Wrecks.


Source: rv Keary

Chart 1178 (INT 1611) [ previous update 3641/18 ] ETRS89 DATUM


Replace
62, Wk with 71, Wk 51° 59´·49N., 6° 10´·14W.

Chart 1410 (INT 1609) [ previous update 4217/18 ] ETRS89 DATUM


Replace
32, Wk with 28%- Wk 52° 05´·36N., 6° 42´·27W.
77, Wk with 71, Wk 51° 59´·49N., 6° 10´·14W.

Chart 2049 (INT 1612) [ previous update New Edition 21/06/2018 ] ETRS89 DATUM
Replace
32, Wk with 28%- Wk 52° 05´·36N., 6° 42´·27W.
77, Wk with 71, Wk 51° 59´·49N., 6° 10´·14W.

5801* SCOTLAND - Firth of Clyde - Wrecks.


Source: British Government Survey

Chart 2131 [ previous update 3349/18 ] ETRS89 DATUM


Replace
^ with 9#+ Wk 56° 06´·15N., 4° 52´·58W.

Chart 3746 (INT 1635) (Panel B, Approaches to Finnart) [ previous update 3349/18 ] ETRS89 DATUM
Insert
9#+ Wk (a) 56° 06´·150N., 4° 52´·583W.
Delete
^, close E of: (a) above

Chart 3746 (INT 1635) [ previous update 3349/18 ] ETRS89 DATUM


Replace
^with 9#+ Wk 56° 06´·15N., 4° 52´·58W.

5769 FINLAND - West Coast - Buoy.


Source: Finnish Notice 30/312/18

Chart 2167 (INT 11321) (Panel, Rauma) [ previous update 4309/18 ] WGS84 DATUM
Move
J], from: 61° 07´·454N., 21° 26´·169E.
to: 61° 07´·458N., 21° 26´·101E.

Chart 2167 (INT 11321) [ previous update 4309/18 ] WGS84 DATUM


Move
J], from: 61° 07´·45N., 21° 26´·17E.
to: 61° 07´·46N., 21° 26´·10E.

2.11
Wk49/18
II

5804 SWEDEN - East Coast - Swept areas. Dredged depths.


Source: Swedish Notice 728/13526/18

Chart 847 (INT 1231) (Panel B, Norrköpings Hamn) [ previous update New Edition 30/08/2018 ] WGS84 DATUM
Replace swept depth, 10$Ã (2011), with, dredged depth, 10m (2018) 58° 37´·456N., 16° 14´·569E.
swept depth, 14"Ã (2011), with, dredged depth, 13,7m (2018)
58° 37´·372N., 16° 14´·869E.

5807 SWEDEN - West Coast - Lights.


Source: Swedish Notice 728/13525/18

Chart 874 (INT 1319) (Panel E, Falkenberg) [ previous update 5078/18 ] WGS84 DATUM
Move
¶ Falkenberg front 2 Q, from: 56° 53´·398N., 12° 28´·516E.
to: 56° 53´·365N., 12° 28´·476E.
Move
¶{, from: 56° 53´·371N., 12° 28´·542E.
to: 56° 53´·356N., 12° 28´·523E.

5741 GERMANY - North Sea Coast - Depths.


Source: German Notice 44/2/18

Chart 3617 (INT 1456) [ previous update 5627/18 ] WGS84 DATUM


Insert depth, 57 (a) 53° 49´·50N., 7° 53´·97E.
Delete depth, 63 , close W of: (a) above
Insert depth, 43 (b) 53° 49´·39N., 7° 54´·29E.
Delete depth, 48 , close NW of: (b) above
Insert depth, 149 53° 43´·93N., 8° 03´·89E.

5783 NETHERLANDS - NM Block.


Source: Netherlands Notice 45/387/18

Chart 1633 (INT 1417) [ previous update New Edition 11/10/2018 ] WGS84 DATUM
Insert the accompanying block, centred on: 54° 00´·4N., 6° 31´·1E.

2.12
Wk49/18
II

5759 FRANCE - North Coast - Buoyage.


Source: French Notice 44/45/18

Chart 323 (INT 1564) [ previous update 5603/18 ] WGS84 DATUM


Delete
D;f Fl.Y.2·5s 51° 05´·90N., 2° 09´·53E.
51° 04´·45N., 2° 11´·15E.

Chart 1350 (INT 1482) [ previous update 5311/18 ] WGS84 DATUM


Delete
D;f Fl.Y.2,5s 51° 05´·90N., 2° 09´·45E.
51° 04´·45N., 2° 11´·25E.

Chart 1872 [ previous update 5603/18 ] WGS84 DATUM


Delete
D;f Fl.Y.2,5s 51° 05´·90N., 2° 09´·45E.
51° 04´·45N., 2° 11´·25E.

Chart 1873 (INT 1480) [ previous update 5603/18 ] WGS84 DATUM


Delete
D;f Fl.Y.2,5s 51° 05´·90N., 2° 09´·45E.
D;f Fl.Y.2·5s 51° 04´·45N., 2° 11´·20E.

5760 FRANCE - North Coast - Buoyage.


Source: French Notice 44/51/18

Chart 2135 [ previous update 5531/18 ] WGS84 DATUM


Insert
B\d Fl.R.4s No2 (a) 49° 23´·93N., 1° 08´·32W.
Delete former No2 light buoy, close SW of: (a) above
Amend No1 light-buoy to, Fl.G.4s 49° 24´·29N., 1° 08´·57W.

5778 SPAIN - South West Coast - Buoyage.


Source: Spanish Notice 44/361/18

Chart 73 (INT 1901) [ previous update New Edition 23/11/2017 ] WGS84 DATUM
Insert
J;f Fl.Y.5s No 1 37° 07´·90N., 6° 50´·25W.
J;f Fl.Y.5s No 2 37° 07´·94N., 6° 50´·17W.

5787 NORTH ATLANTIC OCEAN - Arquipélago dos Açores - Light.


Source: Portuguese Notice 10/246/18
Note: Former Notice 5297(T)/18 is cancelled

Chart 1895 [ previous update 4656/17 ] WGS84 DATUM


Amend light to, Fl(2)10s65m19M 37° 49´·45N., 25° 08´·13W.

Chart 1950 [ previous update 4190/18 ] WGS84 DATUM


Amend light to, Fl(2)10s65m19M 37° 49´·5N., 25° 08´·2W.

2.13
Wk49/18
II

5709 TURKEY - South Coast - Buoy.


Source: Turkish Notice 41/205/18

Chart 246 (INT 3660) [ previous update 4949/18 ] WGS84 DATUM


Delete
B 36° 53´·09N., 35° 58´·43E.

Chart 247 (INT 3794) [ previous update New Edition 18/10/2018 ] WGS84 DATUM
Delete
B 36° 53´·09N., 35° 58´·42E.

5736 ROMANIA - Buoy.


Source: Romanian Notice 10/273/18
Note: Automatic Identification System remains unchanged.

Chart 2230 [ previous update 4014/18 ] WGS84 DATUM


Amend light-buoy to, Oc.10s 44° 04´·6N., 28° 43´·4E.

Chart 2232 [ previous update 2953/18 ] WGS84 DATUM


Amend light-buoy to, Oc.10s 44° 04´·6N., 28° 43´·4E.

Chart 2282 (Panel A, Mangalia to Midia) [ previous update 5651/18 ] WGS84 DATUM
Amend light-buoy to, Oc.10s 44° 04´·63N., 28° 43´·37E.

Chart 2284 [ previous update 4590/18 ] WGS84 DATUM


Amend light-buoy to, Oc.10s 44° 04´·58N., 28° 43´·41E.

5742 TURKEY - Black Sea Coast - Lights.


Source: Turkish Notice 41/202/18
Note: AIS remains unchanged.

Chart 1275 (Panel C, Zonguldak) [ previous update 5347/18 ] WGS84 DATUM


Amend light to, Fl.R.5s16m5M 41° 27´·518N., 31° 46´·763E.
light to, Fl.G.5s19m5M 41° 27´·423N., 31° 46´·872E.

Chart 1275 [ previous update 5347/18 ] WGS84 DATUM


Amend range of light to, 5M 41° 27´·51N., 31° 46´·74E.
41° 27´·43N., 31° 46´·85E.

5766 CROATIA - Depth.


Source: Croatian Notice 10/6/18

Chart 2711 [ previous update 4113/18 ] WGS84 DATUM


Insert depth, 174 , enclosed by 20m contour 43° 50´·40N., 15° 22´·70E.

2.14
Wk49/18
II

5772 CROATIA - Beacon. Light-beacon.


Source: Croatian Notice 10/4/18

Chart 202 [ previous update 5327/18 ] WGS84 DATUM


Replace
Kvwith
¤ TvFl(2)W.5s5m2M
¤ 44° 41´·78N., 14° 43´·78E.

5773 TURKEY - West Coast - Submarine cable. Buoy.


Source: Turkish Notices 42/206-207/18

Chart 1058 [ previous update 5081/18 ] WGS84 DATUM


Insert submarine cable, É, joining: 38° 47´·57N., 26° 30´·22E.
38° 39´·45N., 26° 30´·25E.
38° 39´·18N., 26° 30´·57E.
38° 39´·00N., 26° 30´·48E.

Chart 1061 [ previous update 5081/18 ] WGS84 DATUM


Insert submarine cable, É, joining: 38° 47´·57N., 26° 30´·22E.
38° 43´·83N., 26° 30´·23E.

Chart 1087 [ previous update 5081/18 ] WGS84 DATUM


Insert submarine cable, É, joining: 38° 47´·6N., 26° 30´·2E.
38° 39´·5N., 26° 30´·3E.
38° 39´·2N., 26° 30´·6E.
38° 39´·0N., 26° 30´·5E.

Chart 1624 (INT 3784) [ previous update 5469/18 ] WGS84 DATUM


Insert submarine cable, É, joining: 38° 44´·94N., 26° 30´·23E.
38° 39´·45N., 26° 30´·25E.
38° 39´·18N., 26° 30´·57E.
38° 39´·00N., 26° 30´·48E.
Delete
B¥ 38° 39´·22N., 26° 30´·69E.

2.15
Wk49/18
II

5789 SPAIN - Islas Baleares - Fog signal.


Source: Spanish Lights List

Chart 166 [ previous update 536/18 ] WGS84 DATUM


Delete symbol, fog signal, at light: 39° 27´·5N., 2° 31´·5E.

Chart 1702 [ previous update New Edition 10/05/2018 ] WGS84 DATUM


Delete fog signal, Siren, at light: 39° 27´·5N., 2° 31´·4E.

Chart 1703 [ previous update 2725/17 ] WGS84 DATUM


Delete fog signal, Siren(2)12s, at light: 39° 27´·5N., 2° 31´·3E.

Chart 2832 [ previous update 2608/18 ] WGS84 DATUM


Delete fog signal, Siren(2)12s, at light: 39° 27´·46N., 2° 31´·33E.

Chart 3034 [ previous update 5238/18 ] WGS84 DATUM


Delete fog signal, Siren(2)12s, and associated symbol, fog signal, at
light: 39° 27´·46N., 2° 31´·34E.

5739* ANGOLA - Development area. Legend.


Source: UKHO

Chart 306 (INT 2814) [ previous update 4612/18 ] WGS84 DATUM


Insert circular limit of development area, radius 1000m (0.54M),
pecked line, centred on: (a) 5° 46´·2S., 11° 55´·2E.
legend, Development Area (see Note), close NE of: (a) above

5758* NIGERIA - NM Block. Note.


Source: UKHO

Chart 3434 (Panel B, Ports of Calabar) [ previous update 805/13 ] UNDETERMINED DATUM
Insert the accompanying block, centred on: 5° 01´·3N., 8° 19´·0E.
the accompanying note, DEPTHS, centred on: 5° 01´·158N., 8° 17´·962E.

5791* GHANA - NM Blocks. Notes.


Source: IMO

Chart 595 (INT 2087) [ previous update 5310/18 ] WGS84 DATUM


Insert the accompanying block, centred on: 4° 17´·2N., 2° 44´·2W.
Replace the existing note with the accompanying note, AREAS TO BE
AVOIDED, centred on: 5° 41´·5N., 4° 15´·4W.

Chart 1383 (INT 2806) [ previous update 4617/18 ] WGS84 DATUM


Insert the accompanying block, centred on: 4° 28´·2N., 2° 34´·0W.
Replace the existing note with the accompanying note, AREA TO BE
AVOIDED, centred on: 5° 28´·9N., 1° 28´·6W.

2.16
Wk49/18
II

5745* UNITED ARAB EMIRATES - Harbour limit. Legends. Anchorage areas.


Source: Umm Al Quwain Harbour Master

Chart 2887 (INT 7232) [ previous update 5145/18 ] WGS84 DATUM


Insert limit of anchorage area, pecked line, joining: 25° 42´·0N., 55° 32´·0E.
25° 41´·0N., 55° 33´·0E.
25° 40´·0N., 55° 31´·0E.
25° 41´·0N., 55° 30´·0E.

Chart 2888 (INT 7199) [ previous update 5277/18 ] WGS84 DATUM


Insert limit of anchorage area, pecked line, joining: 25° 42´·0N., 55° 32´·0E.
25° 41´·0N., 55° 33´·0E.
25° 40´·0N., 55° 31´·0E.
25° 41´·0N., 55° 30´·0E.

Chart 2889 (INT 7211) [ previous update 5145/18 ] WGS84 DATUM


Insert limit of anchorage area, pecked line, joining: 25° 42´·0N., 55° 32´·0E.
25° 41´·0N., 55° 33´·0E.
25° 40´·0N., 55° 31´·0E.
25° 41´·0N., 55° 30´·0E.

Chart 3174 (INT 7209) [ previous update 5277/18 ] WGS84 DATUM


Insert harbour limit, pecked line, joining: (a) 25° 40´·50N., 55° 33´·75E.
(b) 25° 41´·00N., 55° 35´·00E.
(c) 25° 40´·50N., 55° 35´·25E.
legend, Umm Al Quwain Port Limit, within: (a)-(c) above
limit of anchorage area, pecked line, joining: 25° 40´·50N., 55° 30´·50E.
25° 41´·00N., 55° 30´·00E.
25° 42´·00N., 55° 32´·00E.
25° 41´·00N., 55° 33´·00E.
25° 40´·50N., 55° 32´·00E.

Chart 3175 (INT 7212) [ previous update 5145/18 ] WGS84 DATUM


Insert harbour limit, pecked line, joining: (a) 25° 34´·19N., 55° 32´·89E.
(b) 25° 39´·00N., 55° 30´·00E.
(c) 25° 41´·00N., 55° 35´·00E.
(d) 25° 36´·99N., 55° 37´·01E.
legend, Umm Al Quwain Port Limit, along NE side of: (a)-(b) above
legend, Umm Al Quwain Port Limit, along SE side of: (b)-(c) above
legend, Umm Al Quwain Port Limit, along SW side of: (c)-(d) above
limit of anchorage area, pecked line, joining: 25° 42´·00N., 55° 32´·00E.
25° 41´·00N., 55° 33´·00E.
25° 40´·00N., 55° 31´·00E.
25° 41´·00N., 55° 30´·00E.
Delete former limit of anchorage area, pecked line, joining: 25° 39´·00N., 55° 34´·50E.
25° 37´·70N., 55° 35´·20E.
25° 37´·00N., 55° 34´·00E.
25° 38´·00N., 55° 33´·20E.

2.17
Wk49/18
II
5745* UNITED ARAB EMIRATES - Harbour limit. Legends. Anchorage areas. (continued)

Chart 3405 (INT 7215) (Panel B, Umm Al Qaywayn) [ previous update 4894/18 ] WGS84 DATUM
Insert harbour limit, pecked line, joining: (a) 25° 39´·40N., 55° 35´·80E.
(b) 25° 39´·00N., 55° 36´·00E.
and
(c) 25° 36´·44N., 55° 31´·53E.
(d) 25° 34´·14N., 55° 32´·92E.
legend, Umm Al Quwain Port Limit, along SW side of: (a)-(b) above
legend, Umm Al Quwain Port Limit, along NE side of: (c)-(d) above
Delete limit of anchorage area, pecked line, joining: 25° 39´·00N., 55° 34´·50E.
25° 37´·70N., 55° 35´·20E.
25° 37´·00N., 55° 34´·00E.
25° 38´·00N., 55° 33´·20E.

5763 OMAN - Depths. Wrecks.


Source: Omani Notice 10/32/18

Chart 3518 (Panel B, Port Sultan Qa- boos and Muscaţ (Masqaţ) [ previous update 4683/18 ] WGS84 DATUM
Insert depth, 81 , and extend 10m contour W to enclose (a) 23° 37´·578N., 58° 35´·117E.
Delete depth, 96 , close NE of: (a) above
Insert depth, 58 , and extend 10m contour NW to enclose 23° 37´·528N., 58° 35´·059E.
31, Wk
(b) 23° 38´·217N., 58° 34´·282E.
Delete
20(, Wk close SE of: (b) above

Chart 3518 (Panel A, Muscaţ (Masqaţ) to Mõ- na- ’ al Faḩl) [ previous update 4683/18 ] WGS84 DATUM
Replace
20(, Wk with 31, Wk 23° 38´·22N., 58° 34´·28E.

Chart 3522 [ previous update 4683/18 ] WGS84 DATUM


Replace
20(, Wk with 31, Wk 23° 38´·22N., 58° 34´·28E.

2.18
Wk49/18
II

5784 UNITED ARAB EMIRATES - Buoyage. Beacon. Lights.


Source: Port of Fujairah Notice 249/18 and Port of Fujairah Harbour Master

Chart 3520 (INT 7200) [ previous update 3021/17 ] WGS84 DATUM


Insert
¶Oc.R.3s7M (a) 25° 11´·16N., 56° 22´·60E.
Delete
¶ Fl.R.2·5s5M, close SW of: (a) above

Chart 3709 [ previous update 572/18 ] WGS84 DATUM


Insert
Gd Fl.R.3s B4 25° 11´·20N., 56° 22´·61E.
TwOc.R.3s22m7M (a) 25° 11´·16N., 56° 22´·60E.
Delete
¶Fl.R.2·5s12m5M, close SW of: (a) above
Insert
Bd Fl.R B1 (b) 25° 09´·33N., 56° 22´·19E.
Delete
Bd Fl.R.2s B3, close S of: (b) above
Amend B8 light-buoy to, Fl.R 25° 12´·00N., 56° 23´·18E.
B5 light-buoy to, Fl.R 25° 10´·68N., 56° 23´·41E.
light-buoy to, Fl.R B3 25° 10´·25N., 56° 21´·91E.
B2 light-buoy to, Fl.R 25° 09´·79N., 56° 22´·05E.

Chart 3723 [ previous update 572/18 ] WGS84 DATUM


Insert
¶Oc.R.3s7M (a) 25° 11´·16N., 56° 22´·60E.
Delete
¶ Fl.R.2·5s5M, close SW of: (a) above
Insert
Bd Fl.R B1 (b) 25° 09´·33N., 56° 22´·19E.
Delete
Bd Fl.R.2s B3, close S of: (b) above
Amend light-buoy to, Fl.R 25° 12´·00N., 56° 23´·18E.
25° 10´·68N., 56° 23´·41E.

5712* INDIAN OCEAN - Submarine cable.


Source: UKHO

Chart 813 (INT 7386) [ previous update 2819/18 ] WGS84 DATUM


Insert submarine cable, É, joining: 6° 49´·9N., 79° 51´·8E.
6° 48´·7N., 79° 47´·0E.
6° 47´·0N., 79° 42´·9E.
6° 46´·5N., 79° 42´·2E.
6° 44´·8N., 79° 38´·2E.

2.19
Wk49/18
II
5712* INDIAN OCEAN - Submarine cable. (continued)

Chart 1587 [ previous update 4923/18 ] CEYLON 1933 DATUM


Insert submarine cable, É, joining: 6° 49´·8N., 79° 51´·5E.
6° 48´·7N., 79° 46´·9E.
6° 47´·6N., 79° 44´·2E.
6° 44´·5N., 79° 37´·9E.
the accompanying note, SUBMARINE CABLES, centred on: 6° 31´·9N., 77° 31´·8E.

Chart 3523 [ previous update 5128/18 ] WGS84 DATUM


Insert submarine cable, É, joining: 23° 44´·76N., 57° 48´·78E.
23° 46´·62N., 57° 51´·27E.
23° 48´·13N., 57° 52´·60E.
23° 51´·11N., 57° 54´·28E.
23° 52´·12N., 57° 55´·05E.
23° 54´·08N., 57° 58´·09E.
23° 54´·80N., 57° 58´·48E.
23° 54´·89N., 57° 59´·30E.

Chart 3900 [ previous update 4443/18 ] WGS84 DATUM


Insert submarine cable, É, joining: 5° 46´·1N., 98° 58´·0E.
5° 53´·5N., 98° 05´·6E.
5° 53´·5N., 98° 00´·8E.
5° 54´·3N., 97° 55´·8E.
5° 55´·7N., 97° 50´·6E.
6° 02´·3N., 97° 39´·0E.
6° 03´·8N., 97° 35´·6E.

Chart 3919 [ previous update 627/18 ] WGS84 DATUM


Insert submarine cable, É, joining: 5° 51´·73N., 98° 17´·90E.
5° 53´·54N., 98° 06´·33E.
5° 53´·48N., 98° 00´·83E.
5° 54´·25N., 97° 55´·85E.
5° 55´·71N., 97° 50´·59E.
5° 57´·32N., 97° 47´·75E.

Chart 3943 [ previous update 980/18 ] WGS84 DATUM


Insert submarine cable, É, joining: 5° 37´·11N., 100° 13´·52E.
5° 38´·62N., 100° 10´·60E.
5° 44´·08N., 99° 55´·80E.
5° 45´·71N., 99° 46´·27E.
5° 45´·75N., 99° 44´·19E.
5° 45´·21N., 99° 35´·00E.
5° 44´·98N., 99° 24´·16E.
5° 44´·31N., 99° 10´·77E.
5° 49´·31N., 98° 35´·69E.

2.20
Wk49/18
II

5770 INDIA - West Coast - Harbour limits. Legends.


Source: Indian Notices 21/167-168/18

Chart IN 206 [ previous update 5435/18 ] WGS84 DATUM


Insert harbour limit, pecked line, joining: 20° 44´·00N., 70° 43´·00E.
(a) 20° 42´·50N., 70° 41´·00E.
(b) 20° 40´·00N., 70° 48´·00E.
20° 41´·83N., 70° 48´·93E.
and
(b) above
(c) 20° 42´·27N., 70° 52´·02E.
legend, Chha- ra Port Limit, along NE side of: (a)-(b) above
legend, Ma- dhwa- d Port Limit, along NW side of: (b)-(c) above

5780 INDIA - West Coast - Wreck.


Source: Indian Notice 21/166/18

Chart IN 203 (INT 7319) [ previous update 4203/18 ] INDIAN DATUM


Insert
´ PA 22° 50´·04N., 70° 06´·56E.

Chart IN 2018 (INT 7321) [ previous update New Chart 31/10/2016 ] WGS84 DATUM
Insert
´ PA 22° 50´·08N., 70° 06´·55E.

Chart IN 2080 [ previous update 3386/18 ] WGS84 DATUM


Insert
´ PA 22° 50´·08N., 70° 06´·55E.

5788 INDIA - West Coast - Wreck.


Source: Indian Notice 21/170/18

Chart IN 22 (INT 752) [ previous update 5775/18 ] UNDETERMINED DATUM


Insert
´ PA 10° 27´·1N., 75° 38´·3E.

Chart 2738 [ previous update 5775/18 ] UNDETERMINED DATUM


Insert
´ PA 10° 27´·2N., 75° 38´·2E.

2.21
Wk49/18
II

5793 INDIA - West Coast - Submarine cable.


Source: Indian Notice 21/169/18

Chart IN 211 [ previous update 5581/18 ] WGS84 DATUM


Insert submarine cable, É, joining: 19° 05´·19N., 72° 49´·38E.
19° 05´·25N., 72° 49´·13E.
19° 05´·52N., 72° 48´·63E.
19° 05´·48N., 72° 48´·00E.
19° 05´·41N., 72° 47´·61E.
19° 05´·41N., 72° 47´·19E.
19° 05´·26N., 72° 46´·73E.
19° 02´·19N., 72° 40´·32E.
19° 01´·99N., 72° 40´·02E.
19° 01´·60N., 72° 39´·81E.
19° 01´·42N., 72° 39´·49E.
19° 01´·23N., 72° 38´·29E.
19° 00´·72N., 72° 35´·89E.
19° 00´·35N., 72° 35´·21E.
19° 00´·15N., 72° 34´·91E.
19° 00´·09N., 72° 34´·81E.

5708 CHINA - South Coast - Buoyage. Lights. Virtual aid to navigation.


Source: Chinese Notices 43/1893-1896/18

Chart 1716 [ previous update 5246/18 ] CGCS 2000 DATUM


Insert
G;f Mo(Q)Y.15s Q3-1 24° 59´·09N., 119° 07´·61E.
G;f Mo(Q)Y.12s Q3 24° 57´·47N., 119° 07´·62E.

Chart 1736 [ previous update 377/18 ] CGCS 2000 DATUM


Insert
G;f Mo(O)Y.12s No 1 25° 11´·55N., 119° 00´·78E.
¶ Fl(2)6s10m3M 25° 11´·17N., 119° 00´·77E.
¶ Fl.4s9m3M 25° 10´·93N., 119° 00´·73E.
symbol, Virtual aid to navigation, isolated danger topmark, V-
AIS 25° 06´·50N., 119° 03´·60E.
G;f Mo(Q)Y.15s Q3-1
24° 59´·09N., 119° 07´·61E.
G;f Mo(Q)Y.12s Q3 24° 57´·47N., 119° 07´·62E.
Delete
I]n Fl(2+1)G.6s No 1 25° 03´·38N., 119° 02´·77E.

5737 CHINA - Bo Hai - Legend.


Source: UKHO

Chart 2662 [ previous update New Edition 08/11/2018 ] CGCS 2000 DATUM
Insert legend, Works in progress (2017), centred: 38° 56´·061N., 117° 48´·878E.

2.22
Wk49/18
II

5781 CHINA - East Coast - Wreck.


Source: Chinese Notice 44/1935/18

Chart 1199 [ previous update 5197/18 ] CGCS 2000 DATUM


Delete
´ 30° 45´·9N., 122° 26´·0E.

Chart 1306 [ previous update 5197/18 ] CGCS 2000 DATUM


Delete
´ 30° 45´·90N., 122° 26´·00E.

5796 TAIWAN - Submarine cables.


Source: UKHO

Chart 1761 [ previous update 5246/18 ] WGS84 DATUM


Insert submarine cable, É, joining: (a) 25° 29´·2N., 121° 30´·3E.
25° 29´·5N., 121° 31´·4E.
25° 29´·5N., 121° 32´·2E.
25° 25´·2N., 121° 43´·6E.
25° 20´·2N., 121° 57´·9E.
(b) 25° 19´·9N., 121° 58´·1E.
Delete former submarine cable, É , joining:
(a) above
(b) above

Chart 3236 [ previous update 5487/18 ] WGS84 DATUM


Insert submarine cable, É, joining: 25° 26´·3N., 121° 25´·9E.
25° 27´·6N., 121° 25´·9E.
25° 29´·5N., 121° 31´·4E.
25° 14´·2N., 122° 15´·0E.
Insert the accompanying note SUBMARINE CABLES, centred on: 22° 04´·5N., 128° 39´·7E.

Chart 3658 [ previous update 5150/18 ] WGS84 DATUM


Insert submarine cable, É, joining: (a) 25° 29´·22N., 121° 30´·27E.
25° 29´·52N., 121° 31´·42E.
25° 29´·46N., 121° 32´·23E.
25° 25´·19N., 121° 43´·61E.
25° 20´·18N., 121° 57´·92E.
(b) 25° 19´·91N., 121° 58´·13E.
Delete former submarine cable, É , joining:
(a) above
(b) above

2.23
Wk49/18
II

5799 CHINA - East Coast - Anchorage area. Legend.


Source: UKHO
Note: Certain Copies Only

Chart 1768 [ previous update 5335/18 ] CGCS 2000 DATUM


Insert semi-circular limit of anchorage area, radius 0·3M, pecked
line, centred on 23º 39’·44N.,117º 35’·61E, joining: (a) 23° 39´·25N., 117° 35´·36E.
(b) 23° 39´·25N., 117° 35´·86E.
legend, ½ Tanker, within: (a)-(b) above

5693 JAPAN - Honshu- - Light. Fixed point.


Source: Japanese Notice 45/772/18

Chart JP 87 [ previous update 5217/18 ] WGS84 DATUM


Delete
·{ 35° 36´·67N., 140° 01´·40E.

Chart JP 90 [ previous update 5217/18 ] WGS84 DATUM


Replace
¶¿ Mo(U) 9s 5M Tr (Observation) and associated sector,
with, è Tr
35° 36´·66N., 140° 01´·39E.

Chart JP 1061 [ previous update 5217/18 ] WGS84 DATUM


Replace
¶¿ Mo(U) 9s 18m 5M (Observation)Tr and associated sector,
with, è Tr (Lt)
35° 36´·66N., 140° 01´·39E.

Chart JP 1086 [ previous update 4980/18 ] WGS84 DATUM


Replace
¶¿ Mo(U) 9s 18m 5M Tr (Observation), with, è Tr (Lt) 35° 36´ 39·4"N., 140° 01´ 23·5"E.

5694 JAPAN - Honshu- - Obstruction.


Source: Japanese Notice 45/773/18

Chart JP 87 [ previous update 5693/18 ] WGS84 DATUM


Insert
å Anchor chain PA 35° 33´·80N., 139° 52´·10E.

Chart JP 90 [ previous update 5693/18 ] WGS84 DATUM


Insert
å Anchor chain PA 35° 33´·80N., 139° 52´·10E.

Chart JP 1061 [ previous update 5693/18 ] WGS84 DATUM


Insert
å Anchor chain PA 35° 33´·80N., 139° 52´·10E.

2.24
Wk49/18
II

5695 JAPAN - Honshu- - Legend.


Source: Japanese Notice 45/774/18

Chart JP 67 [ previous update 4978/18 ] WGS84 DATUM


Amend legend to, Ruins, centred on: 35° 30´ 35·4"N., 139° 45´ 26·3"E.

5696 JAPAN - Honshu- - Buoy.


Source: Japanese Notice 45/775/18

Chart JP 1057B [ previous update 4866/18 ] WGS84 DATUM


Move
Gf (Y Lt), from: 34° 44´ 02·7"N., 137° 18´ 26·9"E.
to: 34° 44´ 07·0"N., 137° 18´ 27·0"E.

5697 JAPAN - Seto Naikai - Jetties. Legend.


Source: Japanese Notice 45/779/18

Chart JP 1127B [ previous update 3148/18 ] WGS84 DATUM


Insert submerged jetty, dotted line, joining: (a) 34° 30´ 25·2"N., 133° 38´ 58·7"E.
(b) 34° 30´ 19·7"N., 133° 38´ 55·1"E.
submerged jetty, single pecked line, joining: (b) above
(c) 34° 30´ 17·2"N., 133° 38´ 53·4"E.
legend, Submerged Jetty, along: (a)-(c) above

5698 JAPAN - Seto Naikai - Depths. Foul.


Source: Japanese Notice 45/780/18

Chart JP 1112A [ previous update 3519/18 ] WGS84 DATUM


Insert
« 34° 21´ 23·8"N., 132° 28´ 45·0"E.
depth, 08 , enclosed by 2m approximate contour, Rep (2018) (a) 34° 21´ 36·0"N., 132° 30´ 52·7"E.
Delete depth, 37 , close NE of: (a) above
Insert depth, 32 , enclosed by 5m approximate contour, Rep (2018) (b) 34° 21´ 36·1"N., 132° 31´ 00·7"E.
Delete depth, 52 , close W of: (b) above

5764 KOREA - South Coast - Automatic Identification System.


Source: Korean Notice 44/935/18

Chart 1163 [ previous update 5639/18 ] WGS84 DATUM


Insert Automatic Identification System, AIS, at A light-buoy 35° 04´·062N., 128° 47´·378E.

2.25
Wk49/18
II

5795 KOREA - South Coast - Light. Beacons. Measured distance. Legends.


Source: Korean Notices 44/936-937/18

Chart 1065 [ previous update 5489/18 ] WGS84 DATUM


Amend light to, Iso.WRG.4s57m8/7M 35° 00´·90N., 128° 45´·22E.
Delete symbol, beacon with triangle topmark and associated legend, 2
Bns (a) 34° 49´·11N., 128° 44´·99E.
(b) 34° 47´·50N., 128° 44´·22E.
pecked line, joining (a) above
34° 48´·82N., 128° 45´·87E.
and
(b) above
34° 47´·22N., 128° 45´·07E.
and
(c) 34° 47´·27N., 128° 44´·95E.
(d) 34° 48´·87N., 128° 45´·72E.
legend, Measured Distance 3207·2m 202°-022°, along: (c)-(d) above

5797 KOREA - South Coast - Buoyage.


Source: Korean Notice 45/978/18

Chart 3391 (INT 5360) [ previous update 5572/18 ] WGS84 DATUM


Insert symbol, white blue white pillar light-buoy, Fl.6s 34° 45´·80N., 128° 16´·73E.
Delete former symbol, white blue white pillar light-buoy, Fl.6s 34° 47´·74N., 128° 14´·01E.

5710 AUSTRALIA - Western Australia - Depths.


Source: Australian Notice 22/961/18

Chart Aus 319 [ previous update 4037/18 ] WGS84 DATUM


Insert depth, 44, enclosed by 50m contour 13° 46´·2S., 124° 57´·6E.

Chart 4603 (INT 603) [ previous update 6063/17 ] WGS84 DATUM


Insert depth, 44 (a) 13° 46´·2S., 124° 57´·6E.
Delete depth, 57, close SE of: (a) above

Chart 4721 (INT 721) [ previous update 1164/18 ] WGS84 DATUM


Insert depth, 44 13° 46´·2S., 124° 57´·6E.

Chart 4722 (INT 722) [ previous update 589/18 ] WGS84 DATUM


Insert depth, 44 13° 46´·2S., 124° 57´·6E.

5716 AUSTRALIA - New South Wales - Depth.


Source: Australian Notice 22/947/18

Chart Aus 202 [ previous update 5446/18 ] WGS84 DATUM


Insert depth, 19 , enclosed by 2m contour 33° 52´·262S., 151° 10´·939E.

2.26
Wk49/18
II

5717 AUSTRALIA - Queensland - Light. Leading line.


Source: Australian Notice 22/954/18

Chart Aus 815 [ previous update 1386/18 ] WGS84 DATUM


Amend light to, Fl.3s9M (a) 25° 47´·02S., 153° 04´·72E.
Delete leading line, pecked line and firm line, and associated legend,
Dir 277·5°, extending in direction 097·5°, from: (a) above

5718 AUSTRALIA - New South Wales - NM Blocks.


Source: Australian Notice 22/946/18

Chart Aus 208 [ previous update 4993/18 ] WGS84 DATUM


Insert the accompanying block A, centred on: 32° 53´·4S., 151° 45´·5E.

Chart Aus 208 (Panel, Hunter River (South Arm)) [ previous update 4993/18 ] WGS84 DATUM
Insert the accompanying block B, centred on: 32° 53´·1S., 151° 45´·5E.

5720 AUSTRALIA - Queensland - NM Block.


Source: Australian Notice 22/949/18

Chart Aus 237 [ previous update 5174/18 ] WGS84 DATUM


Insert the accompanying block, centred on: 27° 25´·1S., 153° 08´·7E.

Chart Aus 238 [ previous update 4915/18 ] WGS84 DATUM


Insert the accompanying block, centred on: 27° 25´·1S., 153° 08´·7E.

5721 AUSTRALIA - Western Australia - Traffic separation scheme.


Source: Australian Notice 22/960/18

Chart Aus 756 [ previous update 1321/18 ] WGS84 DATUM


Insert limit of routeing measure, pecked line, joining: (a) 34° 10´·50S., 114° 36´·90E.
34° 00´·00S., 114° 33´·00E.
Delete former limit of routeing measure, pecked ine, joining: (a) above
34° 00´·00S., 114° 32´·60E.

2.27
Wk49/18
II

5722 AUSTRALIA - Western Australia - Light-beacon. Buoyage. Light.


Source: Australian Notice 22/963/18

Chart Aus 81 [ previous update 1599/18 ] WGS84 DATUM


Amend light-beacon to, Iso.3s & F.Bu 28° 44´·76S., 114° 36´·54E.
Replace
Jb Jb
Fl(2)G.5s with Fl(2)G.5s A
28° 44´·09S., 114° 35´·52E.
Jd Fl(2)R.5s with Jd Fl(2)R.5s B 28° 44´·06S., 114° 35´·67E.
Ib Fl(2)G.5s with Ib Fl(2)G.5s C 28° 44´·69S., 114° 35´·67E.
Gd Fl(2)R.5s with Gd Fl(2)R.5s D 28° 44´·66S., 114° 35´·81E.

Chart Aus 332 [ previous update 2254/18 ] WGS84 DATUM


Amend light to, Iso.3s & F.Bu 28° 44´·8S., 114° 36´·5E.

Chart Aus 751 [ previous update 2254/18 ] WGS84 DATUM


Amend light-beacon to, Iso.3s & F.Bu 28° 44´·76S., 114° 36´·57E.

5723 AUSTRALIA - Northern Territory - Depths.


Source: Australian Notice 22/959/18

Chart Aus 309 [ previous update 5397/17 ] WGS84 DATUM


Insert depth, 36, enclosed by 50m contour, Rep (2018) 11° 47´·8S., 128° 56´·0E.

Chart 4603 (INT 603) [ previous update 5710/18 ] WGS84 DATUM


Replace depth, 56, with depth, 36 Rep 11° 47´·8S., 128° 56´·0E.

Chart 4721 (INT 721) [ previous update 5710/18 ] WGS84 DATUM


Insert depth, 36 Rep (a) 11° 47´·8S., 128° 56´·0E.
Delete depth, 56, close SW of: (a) above

5724 AUSTRALIA - Western Australia - NM Block.


Source: Australian Notice 22/964/18

Chart Aus 327 [ previous update 5188/18 ] WGS84 DATUM


Insert the accompanying block, centred on: 21° 09´·5S., 116° 37´·3E.

5726 AUSTRALIA - Western Australia - Light-beacon. Buoy.


Source: Australian Notice 22/962/18

Chart Aus 117 [ previous update 5461/18 ] WGS84 DATUM


Replace
Tt< Q with GUm Q 32° 14´·38S., 115° 42´·08E.

2.28
Wk49/18
II

5727 PAPUA NEW GUINEA - Depths.


Source: Australian Notice 22/956/18

Chart Aus 389 [ previous update 5430/18 ] WGS84 DATUM


Replace depth, 113 , with depth, 64 3° 24´·3S., 143° 28´·5E.

5728 AUSTRALIA - Queensland - Legends. Radio reporting points.


Source: Australian Notice 22/951/18

Chart Aus 700 [ previous update 4360/16 ] WGS84 DATUM


Insert
ë, direction of vessel movement 045°/225°, Booby VHF 14(a) 10° 37´·00S., 141° 49´·00E.
Delete
ë D, close NE of: (a) above
Insert legend, Endeavour VHF 14, centred on: (b) 10° 48´·90S., 142° 15´·99E.
Delete designation, E, at radio reporting point, close W of: (b) above

Chart Aus 816 [ previous update 5689/18 ] WGS84 DATUM


Insert legend, Sandy Cape VHF 14, centred on: 24° 30´·17S., 153° 36´·37E.
Delete designation, Z3, at radio reporting point 24° 30´·00S., 153° 34´·96E.

Chart Aus 818 [ previous update 5689/18 ] WGS84 DATUM


Delete
ë Z6 and associated legend, SRS (see Note) 23° 54´·00S., 151° 45´·00E.
ë Z7 and associated legend, SRS (see Note) 24° 30´·00S., 152° 25´·00E.
ë Z8 and associated legend, SRS (see Note) 24° 30´·00S., 152° 48´·00E.

Chart Aus 819 [ previous update 1775/18 ] WGS84 DATUM


Delete
ë Z4 and associated legend, SRS (see Note) 23° 23´·00S., 151° 03´·00E.
ë Z5 and associated legend, SRS (see Note) 23° 45´·03S., 151° 31´·51E.
ë Z6 and associated legend, SRS (see Note) 23° 54´·00S., 151° 45´·00E.

Chart Aus 821 [ previous update 3383/17 ] WGS84 DATUM


Insert legend, Blossom VHF 14, centred on: 19° 44´·00S., 150° 24´·64E.
Delete designation, U, at radio reporting point 19° 44´·00S., 150° 25´·50E.
ë Y and associated legend, SRS (see Note) 20° 36´·00S., 150° 15´·00E.

Chart Aus 822 [ previous update 3020/17 ] WGS84 DATUM


Delete
ë Z and associated legend, SRS (see Note) 21° 52´·50S., 150° 45´·00E.

Chart Aus 823 [ previous update 4964/18 ] WGS84 DATUM


Delete
ë Y1 and associated legend, SRS (see Note) 21° 08´·00S., 149° 22´·00E.
ë Y3 and associated legend, SRS (see Note) 21° 12´·50S., 149° 30´·00E.
ë Y4 and associated legend, SRS (see Note) 21° 14´·00S., 149° 30´·00E.

2.29
Wk49/18
II
5728 AUSTRALIA - Queensland - Legends. Radio reporting points. (continued)

Chart Aus 824 [ previous update 4964/18 ] WGS84 DATUM


Delete
ì V and associated legend, SRS (see Note) 20° 10´·18S., 148° 50´·24E.
ì W and associated legend, SRS (see Note) 20° 33´·00S., 149° 00´·50E.
ë X and associated legend, SRS (see Note) 20° 12´·00S., 149° 14´·50E.

Chart Aus 825 [ previous update 3005/18 ] WGS84 DATUM


Delete
ì V and associated legend, SRS (see Note) 20° 10´·18S., 148° 50´·24E.
ë X and associated legend, SRS (see Note) 20° 12´·00S., 149° 14´·50E.

Chart Aus 826 [ previous update 2780/18 ] WGS84 DATUM


Delete
ë S and associated legend, SRS (see Note) 19° 09´·00S., 147° 30´·00E.
ë T and associated legend, SRS (see Note) 19° 16´·00S., 147° 30´·00E.
ë T1 and associated legend, SRS (see Note) 19° 48´·00S., 148° 04´·00E.

Chart Aus 827 [ previous update 5472/18 ] WGS84 DATUM


Delete
ë S1 and associated legend, SRS (see Note) 19° 06´·00S., 146° 54´·00E.
ë S2 and associated legend, SRS (see Note) 19° 08´·00S., 146° 57´·00E.
ë S and associated legend, SRS (see Note) 19° 09´·00S., 147° 30´·00E.
ë T and associated legend, SRS (see Note) 19° 16´·00S., 147° 30´·00E.

Chart Aus 828 [ previous update 5688/18 ] WGS84 DATUM


Insert legend, Palm Passage VHF 14, centred on: 18° 14´·74S., 147° 04´·23E.
Delete designation, P, at radio reporting point 18° 14´·91S., 147° 05´·06E.
ë R1 and associated legend, SRS (see Note) 18° 28´·76S., 146° 26´·02E.

Chart Aus 829 [ previous update 3213/18 ] WGS84 DATUM


Delete
ë Q1 and associated legend, SRS (see Note) 17° 34´·89S., 146° 10´·09E.
ë Q and associated legend, SRS (see Note) 17° 39´·90S., 146° 16´·06E.

Chart Aus 830 [ previous update 294/18 ] WGS84 DATUM


Insert legend, Grafton Passage VHF 11, centred on: 16° 39´·76S., 146° 12´·05E.
Delete designation, P, at radio reporting point 16° 39´·90S., 146° 12´·87E.
ë P1 and associated legend, SRS (see Note) 16° 47´·89S., 145° 51´·07E.

Chart Aus 831 [ previous update 3199/18 ] WGS84 DATUM


Delete
ë M and associated legend, SRS (see Note) 15° 01´·00S., 145° 24´·00E.
ë N and associated legend, SRS (see Note) 15° 42´·00S., 145° 27´·70E.
ë O and associated legend, SRS (see Note) 15° 43´·00S., 145° 23´·00E.

2.30
Wk49/18
II
5728 AUSTRALIA - Queensland - Legends. Radio reporting points. (continued)

Chart Aus 832 [ previous update 5691/18 ] WGS84 DATUM


Delete
ë M1 and associated legend, SRS (see Note) 14° 54´·00S., 145° 18´·00E.
ë M and associated legend, SRS (see Note) 15° 01´·00S., 145° 24´·00E.

Chart Aus 833 [ previous update 2719/18 ] WGS84 DATUM


Delete
ë L and associated legend, SRS (see Note) 14° 08´·15S., 144° 30´·05E.

Chart Aus 835 [ previous update 5691/18 ] WGS84 DATUM


Delete
ë I and associated legend, SRS (see Note) 11° 35´·01S., 142° 57´·68E.
ë J and associated legend, SRS (see Note) 12° 16´·01S., 143° 16´·17E.

Chart Aus 839 [ previous update 5844/17 ] WGS84 DATUM


Delete
ë C and associated legend, SRS (see Note) 10° 25´·73S., 142° 33´·62E.
ë F and associated legend, SRS (see Note) 10° 36´·22S., 142° 32´·15E.
ë G and associated legend, SRS (see Note) 10° 37´·81S., 142° 31´·16E.
ë H and associated legend, SRS (see Note) 10° 55´·00S., 142° 45´·00E.

Chart Aus 840 [ previous update 4531/18 ] WGS84 DATUM


Insert legend, Bramble VHF 14, centred on: 9° 15´·19S., 143° 48´·79E.
Delete designation, A, at radio reporting point 9° 15´·00S., 143° 50´·00E.
ë B and associated legend, SRS (see Note) 9° 23´·90S., 143° 27´·00E.

Chart Aus 841 [ previous update 5173/17 ] WGS84 DATUM


Delete
ë C and associated legend, SRS (see Note) 10° 25´·72S., 142° 33´·63E.

5733 AUSTRALIA - Queensland - NM Block. Depths.


Source: Australian Notices 22/957-958/18

Chart Aus 377 [ previous update 5499/18 ] WGS84 DATUM


Insert the accompanying block, centred on: 10° 45´·9S., 145° 48´·8E.
depth, 94, and extend 100m approximate contour SE to enclose 9° 38´·0S., 144° 36´·4E.
depth, 88, enclosed by 100m contour 9° 42´·0S., 144° 39´·7E.

2.31
Wk49/18
II

5719 SOUTH PACIFIC OCEAN - Solomon Islands - Light.


Source: Australian Notice 22/969/18

Chart SLB 301 [ previous update 1789/18 ] WGS84 DATUM


Amend range of light to, 8/6M 7° 10´·2S., 156° 52´·0E.

Chart SLB 302 [ previous update 5502/18 ] WGS84 DATUM


Amend range of light to, 8/6M 7° 10´·2S., 156° 52´·0E.

5774* SOUTH PACIFIC OCEAN - Fiji Islands - NM Block. Rocks.


Source: UKHO

Chart 1670 (Panel B, Lautoka Harbour) [ previous update 5525/18 ] WGS84 DATUM
Insert the accompanying block, centred on: 17° 36´·4S., 177° 26´·3E.
. 17° 37´·059S., 177° 25´·042E.
17° 37´·036S., 177° 25´·067E.

5705 UNITED STATES OF AMERICA - West Coast - Wreck.


Source: US Coast Guard District 11 LNM 44/18749/18

Chart 1063 [ previous update 3564/18 ] NAD83 DATUM


Insert
5"+ Wk 33° 43´·18N., 118° 08´·23W.

Chart 1082 [ previous update 1753/18 ] NAD83 DATUM


Insert
32, Wk 33° 43´·18N., 118° 08´·23W.

5730 CANADA - British Columbia - Light.


Source: Canadian Notices 10/3604-3605/18

Chart 4942 [ previous update 1983/18 ] NAD83 DATUM


Amend light to, Fl R 50° 27´·83N., 127° 56´·24W.

Chart 4943 [ previous update 6632/16 ] NAD27 DATUM


Amend light to, Fl R 50° 27´·86N., 127° 56´·14W.

2.32
Wk49/18
II

5743 CANADA - British Columbia - Restricted area.


Source: Canadian Notice 10/3493/18

Chart 4963 [ previous update 5229/18 ] NAD83 DATUM


Delete limit of restricted area, ÇÅÇ, joining: 49° 17´ 38.5"N., 123° 07´ 24.5"W.
49° 17´ 21.0"N., 123° 06´ 00.0"W.
Å 49° 17´ 31.8"N., 123° 07´ 21.6"W.
49° 17´ 27.0"N., 123° 06´ 48.2"W.
49° 17´ 18.2"N., 123° 06´ 10.4"W.

5744 CANADA - British Columbia - Depth.


Source: Canadian Notice 10/3977/18

Chart 4939 [ previous update 1986/18 ] NAD83 DATUM


Replace sounding out of position, 1 2 , with sounding out of position, 09 53° 24´·45N., 129° 25´·08W.

5753 CANADA - British Columbia - Depths.


Source: Canadian Notice 10/3868/18

Chart 3754 [ previous update 2876/18 ] NAD27 DATUM


Insert depth, 96 , enclosed by 10m contour (a) 53° 53´·11N., 133° 12´·27W.
Delete depth, 31, close W of: (a) above
Insert depth, 68 , enclosed by 10m contour 53° 52´·13N., 133° 10´·80W.

5757 CANADA - British Columbia - Anchor berth.


Source: Canadian Notice 10/3495/18

Chart 4965 [ previous update 4617/17 ] NAD83 DATUM


Insert
î O, centred on: 49° 19´ 43·0"N., 122° 56´ 00·0"W.

5761 CANADA - British Columbia - NM Block. Depths.


Source: Canadian Notices 10/3947/18 and 10/3956-3957/18

Chart 4935 [ previous update New Edition 28/12/2017 ] NAD83 DATUM


Insert the accompanying block, centred on: 54° 06´·0N., 130° 25´·2W.

Chart 4936 [ previous update New Edition 28/12/2017 ] NAD83 DATUM


Insert the accompanying block, centred on: 54° 06´·2N., 130° 25´·2W.

Chart 4940 [ previous update 2906/18 ] NAD83 DATUM


Insert depth, 41 , enclosed by 5m contour (a) 54° 05´·57N., 130° 23´·47W.
Delete depth, 82 , close N of: (a) above
Insert depth, 26, and extend 5m contour S to enclose 54° 05´·27N., 130° 23´·57W.

2.33
Wk49/18
II

5768 CANADA - British Columbia - NM Block.


Source: Canadian Notice 10/3447/18

Chart 4958 [ previous update 5024/16 ] NAD83 DATUM


Insert the accompanying block, centred on: 49° 08´ 44·6"N., 123° 52´ 13·2"W.

5776 UNITED STATES OF AMERICA - West Coast - Light-beacons.


Source: US Coast Guard District 13 LNM 43/18477/18

Chart 47 [ previous update 3918/18 ] NAD83 DATUM


Insert
T¦Fl.G.2·5s5m4M
h ’1’
(a) 47° 51´·81N., 122° 34´·61W.
Delete
ThFl.G.2·5s5m4M
¦ ’3’ Dn, close S of:
(a) above
Replace
T¦Fl.G.4s5m4M
h ’5’ Dn with T¦hFl.G.4s5m4M ’3’
47° 51´·54N., 122° 34´·60W.

5777 CANADA - British Columbia - Buoyage. Rock. Depths.


Source: Canadian Notices 10/3442-3443/18, 10/3462-3463/18 and 10/3481/18

Chart 4951 [ previous update 3677/18 ] NAD83 DATUM


Insert
³ (0 7) and extend 2m contour W to enclose
48° 52´·70N., 123° 27´·69W.

Chart 4952 [ previous update 3677/18 ] NAD83 DATUM


Insert
Gf Fl(5)Y.20s ODAS/SADO 49° 18´·10N., 123° 21´·40W.
49° 01´·50N., 123° 25´·80W.
³ (0 7) and extend 2m contour W to enclose
48° 52´·70N., 123° 27´·69W.

Chart 4955 [ previous update 3677/18 ] NAD83 DATUM


Insert
Gf Fl(5)Y.20s ODAS/SADO, out of position 49° 01´·50N., 123° 25´·80W.
depth, 12 , and extend 2m contour S to enclose (a) 48° 57´·14N., 123° 34´·91W.
Delete depth, 94 , close SE of: (a) above
Replace
¯ with ³ (0 7)
48° 52´·70N., 123° 27´·69W.

Chart 4956 [ previous update 2859/18 ] NAD83 DATUM


Insert
Gf Fl(5)Y.20s ODAS/SADO 49° 01´·50N., 123° 25´·80W.

Chart 4962 [ previous update 4632/18 ] NAD83 DATUM


Insert
Gf Fl(5)Y.20s ODAS/SADO 49° 18´ 06·0"N., 123° 21´ 24·0"W.

2.34
Wk49/18
II

5782 PERU - Light.


Source: Peruvian Notice 10/99/18

Chart 3089 (Panel E, Pimentel) [ previous update 5992/17 ] WGS84 DATUM


Delete
¶ F.R.3M 6° 50´·39S., 79° 56´·54W.

5792 MEXICO - Pacific Ocean Coast - Submarine cables. Note.


Source: UKHO

Chart 655 [ previous update 5427/18 ] WGS84 DATUM


Insert submarine cable, É, joining: 17° 53´·90N., 102° 15´·00W.
17° 54´·35N., 102° 14´·65W.
17° 54´·46N., 102° 14´·63W.
17° 54´·83N., 102° 14´·25W.
17° 55´·19N., 102° 13´·99W.
and
17° 54´·60N., 102° 15´·00W.
17° 54´·84N., 102° 14´·66W.
17° 55´·31N., 102° 14´·13W.
the accompanying note, SUBMARINE CABLES, centred on: 17° 58´·50N., 102° 13´·69W.

Chart 1024 [ previous update 3556/18 ] WGS84 DATUM


Insert submarine cable, É, joining: 17° 39´·8N., 101° 36´·9W.
17° 37´·5N., 101° 37´·2W.
17° 36´·1N., 101° 38´·9W.
17° 36´·8N., 101° 42´·9W.
the accompanying note, SUBMARINE CABLES, centred on: 16° 45´·1N., 97° 29´·7W.

Chart 1026 [ previous update 4731/18 ] WGS84 DATUM


Insert submarine cable, É, joining: 17° 36´·2N., 101° 40´·0W.
17° 36´·8N., 101° 43´·0W.
and
19° 06´·9N., 104° 21´·3W.
19° 04´·3N., 104° 24´·3W.
18° 57´·6N., 104° 23´·0W.
the accompanying note, SUBMARINE CABLES, centred on: 18° 38´·8N., 102° 17´·8W.

2.35
Wk49/18
II

5790 SOUTH ATLANTIC OCEAN - Submarine cables.


Source: Alcatel Submarine Networks Ltd

Chart 1595 (Panel G, Isla de Annobón) [ previous update 1062/18 ] WGS84 DATUM
Insert submarine cable, É, joining: 1° 24´·65S., 5° 38´·53E.
1° 24´·32S., 5° 38´·98E.
1° 23´·23S., 5° 39´·91E.
1° 22´·91S., 5° 40´·28E.
1° 22´·60S., 5° 40´·92E.

Chart 1595 (Panel F, Ilha de São Tomé) [ previous update 1062/18 ] WGS84 DATUM
Insert submarine cable, É, joining: 0° 18´·43N., 6° 44´·89E.
0° 18´·36N., 6° 45´·65E.
0° 17´·96N., 6° 46´·64E.
0° 16´·80N., 6° 47´·57E.
0° 16´·55N., 6° 47´·90E.

Chart 3118 (INT 2088) [ previous update 4975/18 ] WGS84 DATUM


Insert submarine cable, É, joining: 0° 18´·4N., 6° 44´·9E.
0° 16´·4N., 6° 48´·1E.
and
1° 24´·6S., 5° 38´·5E.
1° 22´·6S., 5° 40´·9E.

Chart 3327 (INT 2811) [ previous update 5752/18 ] WGS84 DATUM


Insert submarine cable, É, joining: 0° 18´·4N., 6° 45´·5E.
0° 18´·1N., 6° 46´·3E.
0° 16´·8N., 6° 47´·6E.
0° 16´·4N., 6° 48´·1E.

5714 WEST INDIES - Trinidad and Tobago - Platform.


Source: Trinidadian and Tobagan Notice 5/18

Chart 483 [ previous update 5648/18 ] WGS84 DATUM


Insert
¼{ Iguana 10° 18´·78N., 61° 50´·27W.

Chart 1044 [ previous update 5648/18 ] WGS84 DATUM


Insert
¼{ Iguana 10° 18´·8N., 61° 50´·3W.

Chart 1045 [ previous update 4903/18 ] WGS84 DATUM


Insert
¼{ Iguana 10° 18´·8N., 61° 50´·3W.

2.36
Wk49/18
II

5771* WEST INDIES - Wrecks.


Source: Marco Cesareo

Chart 583 [ previous update New Edition 23/08/2018 ] WGS84 DATUM


Insert
6&+ Wk 18° 12´·82N., 63° 05´·58W.

Chart 2047 [ previous update New Edition 29/03/2018 ] WGS84 DATUM


Replace
12", Wk with 6&+ Wk 18° 12´·82N., 63° 05´·58W.

Chart 2079 (Panel F, Crocus Bay and Road Bay) [ previous update New Edition 29/03/2018 ] WGS84 DATUM
Insert
6&+ Wk (a) 18° 12´·821N., 63° 05´·584W.
Delete
12!, Wk, close W of: (a) above

5746 CANADA - Nova Scotia - Obstruction.


Source: Canadian Notice 10/4013/18

Chart 4748 [ previous update 2024/18 ] NAD83 DATUM


Delete
+ ODAS, depth, 15 44° 03´·0N., 60° 35´·7W.

5749 CANADA - Saint Lawrence River - Depths.


Source: Canadian Notice 10/1220/18

Chart 4776 (panel, Pointe Noire) [ previous update New Edition 28/12/2017 ] NAD83 DATUM
Insert depth, 144 , and extend 15m contour N to enclose 50° 10´ 04.1"N., 66° 28´ 14.4"W.
depth, 195 , and extend 20m contour NE to enclose 50° 10´ 00.4"N., 66° 27´ 49.9"W.
depth, 19 , and extend 2m contour N to enclose 50° 09´ 48.5"N., 66° 27´ 55.8"W.
50° 09´ 56.1"N., 66° 28´ 32.3"W.

2.37
Wk49/18
II

5750 CANADA - Newfoundland and Labrador - Buoy. Breakwater. Light.


Source: Canadian Notice 10/4839/18

Chart 4739 (Panel, Come by Chance and/et Arnold’s Cove) [ previous update 4034/18 ] NAD83 DATUM
Insert
Jj Q R EA2 47° 45´ 31.7"N., 53° 59´ 36.5"W.
breakwater, single firm line, joining: 47° 45´ 26.7"N., 53° 59´ 28.0"W.
47° 45´ 27.8"N., 53° 59´ 29.0"W.
47° 45´ 30.4"N., 53° 59´ 29.5"W.
(a) 47° 45´ 31.3"N., 53° 59´ 28.3"W.
Move
ã{ Fl R, from:
47° 45´ 31.0"N., 53° 59´ 24.7"W.
to: (a) above

Chart 4739 [ previous update 4034/18 ] NAD83 DATUM


Insert
Jj Q R EA2 47° 45´·53N., 53° 59´·61W.
breakwater, single firm line, joining: 47° 45´·45N., 53° 59´·47W.
47° 45´·46N., 53° 59´·48W.
47° 45´·51N., 53° 59´·49W.
(a) 47° 45´·52N., 53° 59´·47W.
Move
ã{ Fl R, from: 47° 45´·52N., 53° 59´·41W.
to: (a) above

5754 CANADA - Saint Lawrence River - Light. Beacons.


Source: Canadian Notice 10/1236/18

Chart 4777 (Panel, Matane) [ previous update 4729/18 ] NAD83 DATUM


Insert
{
• Fl Y 5m (Priv)
48° 50´ 33.3"N., 67° 34´ 24.1"W.
K 48° 50´ 32.7"N., 67° 34´ 22.2"W.
48° 50´ 32.1"N., 67° 34´ 20.3"W.
48° 50´ 31.6"N., 67° 34´ 18.4"W.
48° 50´ 31.0"N., 67° 34´ 16.5"W.
48° 50´ 30.4"N., 67° 34´ 14.6"W.

5756 UNITED STATES OF AMERICA - East Coast - Obstruction.


Source: US Notice 44/11534/18

Chart 3688 [ previous update 5113/18 ] NAD83 DATUM


Insert
36, Obstn 34° 03´·23N., 77° 56´·34W.

2.38
Wk49/18
II

5765 UNITED STATES OF AMERICA - East Coast - NM Block. Maritime limit. Legends.
Source: US Coast Guard District 1 LNM 44/12337/18

Chart 3457 [ previous update 5313/18 ] NAD83 DATUM


Insert the accompanying block, centred on: 40° 39´·5N., 74° 12´·4W.
maritime limit, pecked line, joining: 40° 41´·87N., 74° 09´·02W.
40° 41´·93N., 74° 08´·98W.
legend, WEST, orientated NW/SE, centred on: 40° 41´·93N., 74° 09´·10W.
Amend legend to, PORT NEWARK INSHORE REACH EAST (see
Depth Table), centred on: 40° 41´·78N., 74° 08´·68W.

5806 UNITED STATES OF AMERICA - East Coast - NM Block. Dredged depths. Channel limit.
Source: US Coast Guard District 1 LNM 44/13270/18, 44/13272/18 and US Charts 13270 and 13272

Chart 1516 [ previous update 4273/18 ] NAD83 DATUM


Insert the accompanying block, centred on: 42° 19´·3N., 71° 00´·4W.
dredged depth, 13ft (2018), centred on: 42° 18´·27N., 71° 02´·55W.
Amend dredged depth to, 31 feet (2018), centred on: 42° 15´·07N., 70° 57´·17W.
dredged depth to, 31ft (2018), centred on: 42° 14´·83N., 70° 57´·63W.
dredged depth to, 28 feet (2018), centred on: 42° 14´·41N., 70° 58´·09W.
Delete dredged depth, 12ft (2009), centred on: 42° 18´·41N., 71° 02´·19W.

Chart 1528 [ previous update 3581/18 ] NAD83 DATUM


Insert limit of dredged channel, pecked line, joining: (a) 42° 19´·676N., 71° 00´·014W.
(b) 42° 19´·902N., 70° 59´·582W.
and
(c) 42° 19´·890N., 70° 59´·535W.
(d) 42° 19´·676N., 70° 59´·945W.
Delete charted detail within: (a)-(d) above
channel limit, pecked line, joining: (b) above
(c) above
Insert dredged depth, 17ft (2018) , centred on: 42° 19´·797N., 70° 59´·747W.

2.39
Wk49/18
II

5711(T)/18 SCOTLAND - East Coast - Buoy.


Source: Cromarty Firth Port Authority Notice 24/18
1. The yellow special purpose buoy in position 57° 41´·39N., 4° 00´·35W. has been amended to Fl.Y(5)12s
2. Former Notice 5337(T)/18 is cancelled.
(ETRS89 DATUM)

Charts affected - 223 - 1077 - 1889 (INT 1540)

5715(T)/18 ENGLAND - East Coast - Buoy.


Source: RPS Group plc
1. A special purpose buoy, Q(5)Y.20s, has been deployed, until further notice, in position 55° 08´·85N., 1° 25´·41W.
2. Mariners are advised to navigate with caution in the area.
(ETRS89 DATUM)

Chart affected - 156

5767(P)/18 ENGLAND - East Coast - Wells. Works.


Source: HSE
1. * Works are in progress to decommission the wells in the following positions:

53° 06´·04N., 2° 28´·65E.


52° 53´·96N., 2° 45´·12E.
2. Mariners are advised to navigate with caution in the area.
3. Charts will be updated when decommissioning works are complete.
4. Former Notice 4436(P)/18 is cancelled.
*Indicates new or revised entry
(WGS84 DATUM)

Charts affected - 1408 - 1503 (INT 1509) - 1504 (INT 1510) - 1631 (INT 1418)

5779(T)/18 SCOTLAND - North Coast - Scientific instrument.


Source: Jason McIlvenny, North Highland College
1. A yellow spherical Waverider buoy, Fl.4s, has been established in position 58° 35´·32N., 3° 45´·09W.
2. Mariners are advised to navigate with caution in the area.
(ETRS89 DATUM)

Chart affected - 1954 (INT 1601)

2.40
Wk49/18
II

5812(T)/18 FINLAND - South Coast - Buoyage.


Source: Finnish Notices 30/307(T)-309(T)/18
1. Yellow special light-buoys, Fl(5)Y.20s, have been established in the following positions:

Position Remarks
60° 08´·61N., 24° 53´·91E. ODAS
60° 08´·90N., 24° 51´·99E. ODAS
60° 07´·58N., 24° 53´·65E.
(WGS84 DATUM)

Charts affected - 2218 (INT 1159) - 3818 (INT 1250)

5751(P)/18 NORTH SEA - German Sector - Depths. Dredged area.


Source: German Chart 44
1. Depths less than charted exist within the Elbe and Cuxhaven. The most significant are as follows:

Depth Position
18·9m 53° 59´·43N., 8° 18´·58E.
11·7m 53° 57´·90N., 8° 31´·75E.
11·6m 53° 53´·55N., 8° 41´·52E.
12·7m 53° 53´·23N., 8° 42´·58E.
13·8m 53° 53´·00N., 8° 42´·72E.
15·6m 53° 52´·87N., 8° 42´·85E.
3·3m 53° 52´·28N., 8° 44´·12E.
2. Berth 9.4, in position 53° 50´·73N., 8° 45´·34E., has been dredged to 10,6m
3. These changes will be included in New Chart DE44 to be published 10 January 2019 and the next New Edition of Chart
8072.
(WGS84 DATUM)

Charts affected - 3619 (INT 1452) - 8072

5810(T)/18 NETHERLANDS - Buoy.


Source: Netherlands Notice 45/386(T)/18
1. A North cardinal light-buoy, Q ZINK N, has been deployed in position 53° 18´·47N., 5° 01´·58E. until further notice.
(WGS84 DATUM)

Chart affected - 1457 (INT 1464)

5803(T)/18 PORTUGAL - South Coast - Scientific instrument.


Source: Portuguese Notice 10/250(T)/18
1. A scientific instrument has been temporarily anchored in position 37° 00´·99N., 8° 45´·50W., at a depth of between 53m
and 25m.
2. Mariners are requested to remain 0.2M clear of the instrument
(WGS84 DATUM)

Charts affected - 89 - 3636

2.41
Wk49/18
II

5805(P)/18 SPAIN - West Coast - Depths. Maintained channel. Alongside depths.


Source: Spanish Notices 44/358-360/18
1. The charted maintained area, depth 9m, in the approaches to Vilagarcía de Arousa, between positions
42° 35´·907N., 8° 47´·963W. and 42° 35´·963N., 8° 46´·612W., is no longer in existence.
2. The charted alongside maintained areas within the port of Vilagarcía de Arousa no longer exist. Many alongside depths have
changed.
3. The most significant depth changes are as follows:

Depth Position
7·9m 42° 36´·069N., 8° 46´·659W.
4·7m 42° 35´·701N., 8° 46´·450W.
8·6m 42° 36´·054N., 8° 47´·056W.
4. Mariners are advised to navigate with caution in the area and consult the local port authorities for the latest depth
information.
5. These changes will be included in a New Edition of Chart 1762 to be published 10 January 2019. Chart 1764 will be updated
when full details are known.
(WGS84 DATUM)

Charts affected - 1762 - 1764

5809(T)/18 PORTUGAL - South Coast - Wreck.


Source: Portuguese Notice 10/252(T)/18
1. A dangerous wreck exists in position 36° 59´·44N., 7° 47´·32W.
2. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Charts affected - 91 (INT 1812) - 93

5785(P)/18 UKRAINE - Depths. Buoyage. Dredged areas.


Source: ENC UA6T3702 and Ukrainian Notice 40/489/18
1. Numerous changes have taken place within the port of Berdyans’k and its approaches. The most significant of these are
listed below.
2. *The least depths in the Podkhodnyy Kanal between positions 46° 36´·64N., 36° 35´·82E. and 46° 44´·89N., 36° 46´·17E.
are as follows:

Left Edge of Channel Centre of Channel Right Edge of Channel


7·0m 7·5m 6·6m
3. Changes have taken place to the limit of the 7·3m (2012) dredged area centred on position 46° 44´·87N., 36° 46´·49E. The
extent of the charted limit has significantly reduced in some places.
4. West cardinal buoys in positions 46° 44´·93N., 36° 46´·79E. and 46° 44´·85N., 36° 46´·68E. have been removed.
5. The 3·9m (2009) dredged area centred on position 46° 45´·17N., 36° 46´·45E. has been replaced by a 4·2m (2013) dredged
area.
6. Mariners are advised to consult the local port authority for the latest information.
7. These and other changes will be included in a New Edition of Chart 3302 to be published 29 November 2018.
8. *Chart 3302 will be updated by NM for item 2 above following New Edition publication on 29 November 2018.
9. Former Notice 5028(P)/18 is cancelled
*Indicates new or revised entry.
(WGS84 DATUM)

Chart affected - 3302

2.42
Wk49/18
II

5800(T)/18 UKRAINE - Buoyage. Dredged area.


Source: Ukrainian Notices 31/386(T)/18, 40/487(T)/18 and 40/488/18
1. Dredging works are taking place, until 31 December 2018, on and in the vicinity of a line joining the following positions:

46° 19´·125N., 30° 40´·567E.


46° 18´·800N., 30° 42´·000E.
2. The following buoys have been temporarily withdrawn:

Designation Characteristic Position


*No 1 Fl.G.3s 46° 18´·968N., 30° 41´·546E.
*No 2 Fl.R.3s 46° 18´·866N., 30° 41´·492E.
No 3 Fl.G.3s 46° 19´·047N., 30° 41´·116E.
No 4 Fl.R.3s 46° 18´·966N., 30° 41´·077E.
3. Mariners are advised to navigate with caution in the area.
4. Former Notice 4591(T)/18 is cancelled.
* Indicates new or revised entry
(WGS84 DATUM)

Chart affected - 2243

5808(T)/18 CROATIA - Measuring instrument. Buoy.


Source: Croatian Notice 10/1(T)/18
1. A measuring instrument, marked by a special buoy, Fl(5)Y.20s , has been established in position 45° 03´·9N., 13° 27´·5E.
(WGS84 DATUM)

Charts affected - 201 - 1461

5748(P)/18 UNITED ARAB EMIRATES - Harbour limit. Legends. Anchorage area.


Source: Umm Al Quwain Harbour Master
1.

Update Feature Position


Insert harbour limit, pecked line, joining: (a) 25° 34´·18N., 55° 32´·89E.
(b) 25° 39´·00N., 55° 30´·00E.
(c) 25° 39´·52N., 55° 31´·28E.
and
25° 39´·52N., 55° 35´·74E.
25° 39´·00N., 55° 36´·00E.
legend, Umm Al Quwain Port Limit, along NE side of: (a)-(b) above
legend, Umm Al Quwain Port Limit, along SE side of: (b)-(c) above
Delete limit of anchorage area, pecked line, joining: 25° 39´·00N., 55° 34´·50E.
25° 37´·70N., 55° 35´·20E.
25° 37´·00N., 55° 34´·00E.
25° 38´·00N., 55° 33´·20E.

Chart affected - 8191

2.43
Wk49/18
II

5794(T)/18 INDIA - West Coast - Obstructions. Scientific instruments.


Source: Indian Notices 9/80(T)/17 and 20/163(T)/18
1. Underwater Acoustic Doppler Current Profiler (ADCP) moorings are deployed in the following positions:

Mooring Position Depth of ADCP (m) Largest scale chart


OMD9 20° 00´·69N., 69° 14´·30E. 160, 335, 690, 1044 IN253
*OMD11 20° 00´·53N., 69° 14´·25E. 154, 280, 580 IN253
*OJD2 17° 31´·55N., 71° 07´·29E. 150, 500 IN293
OGD12 15° 09´·97N., 72° 44´·65E. 144, 300, 654, 960 IN293
*OGD14 15° 09´·93N., 72° 44´·73E. 160, 289, 641 IN293
OGS12 15° 13´·99N., 72° 58´·91E. 161 1509
OGSV2 15° 12´·88N., 72° 56´·77E. 191 IN293
OGSV1 15° 11´·94N., 73° 00´·28E. 154 1509
OBD4 13° 36´·21N., 73° 13´·74E. 190, 360, 860 1509
OBS6 13° 52´·69N., 73° 24´·49E. 186 1509
*OOD1 22° 15´·79N., 67° 28´·42E. 145, 500, 855 1465
*OUD2 12° 29´·93N., 74° 02´·38E. 170, 337, 683 IN258
OKD9 9° 02´·86N., 75° 26´·10E. 190, 370, 870 IN259
*OKD11 9° 02´·85N., 75° 26´·05E. 142, 297,802 IN221
KKD7 6° 57´·57N., 77° 23´·51E. 190, 365, 863 1587
*KKD9 6° 57´·57N., 77° 23´·51E. 158, 513, 1018 1587
2. All vessels are to maintain a safe distance from these moorings and exercise caution in the vicinity.
3. Former Notice 4484(T)/18 is cancelled.
* Indicates new or revised entry
(WGS84 DATUM)

Charts affected - 39 - 707 - 709 - 828 - 1465 (INT 7318) - 1509 - 1587 - 2738 - IN 22 (INT 752) - IN 221 - IN 253
(INT 7328) - IN 258 (INT 7348) - IN 259 (INT 7356) - IN 292 (INT 7021) - IN 293 (INT 7022)

5706(P)/18 GULF OF THAILAND - Submarine cables.


Source: UKHO
1. Submarine cables have been laid joining the following positions:

11° 14´·1N., 101° 09´·5E.


10° 57´·5N., 101° 12´·9E.
10° 16´·8N., 101° 28´·3E.
9° 05´·5N., 101° 35´·3E.
8° 48´·6N., 101° 45´·4E.
8° 44´·8N., 101° 45´·4E.
8° 35´·9N., 101° 38´·8E.
8° 30´·9N., 101° 25´·8E.
8° 30´·9N., 101° 19´·3E.
and
9° 41´·7N., 101° 31´·8E.
9° 41´·6N., 101° 24´·5E.
2. These changes will be included in a New Edition of Chart 66 to be published 29 November 2018.
3. Chart 3963 will be updated by Notice to Mariners.
(WGS84 DATUM)

Chart affected - 66

2.44
Wk49/18
II

5731(T)/18 VIETNAM - Wreck.


Source: VMS-North Notice 214(T)/18
1. A wreck exists in position 20° 42´·30N., 107° 05´·53E.
2. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Charts affected - 1965 - 3875

5699(T)/18 JAPAN - Honshu- - Fish trap.


Source: Japanese Notice 45/5562(T)/18
1. A stationary net set has been established, until 31 August 2023, within an area bounded by the following positions:

34° 39´ 51·6"N., 131° 38´ 13·0"E.


34° 39´ 46·3"N., 131° 38´ 31·7"E.
34° 40´ 16·7"N., 131° 38´ 27·0"E.
34° 40´ 16·7"N., 131° 38´ 03·1"E.
34° 40´ 07·8"N., 131° 38´ 03·1"E.
2. Former Notice 5263(T)/16 is cancelled.
(WGS84 DATUM)

Chart affected - JP 149

5700(T)/18 JAPAN - Seto Naikai - Works.


Source: Japanese Notice 45/5567(T)/18
1. Submarine power cable laying and removal works are taking place, until 17 March 2019, on and in the vicinity of a line
joining the following positions:

34° 18´ 27"N., 133° 32´ 11"E.


34° 20´ 43"N., 133° 31´ 38"E.
34° 20´ 48"N., 133° 31´ 23"E.
(WGS84 DATUM)

Charts affected - JP 137B - JP 153

5701(T)/18 JAPAN - Seto Naikai - Depth.


Source: Japanese Notice 45/5568(T)/18
1. A depth of 8m exists in position 34° 15´·29N., 133° 06´·31E.
(WGS84 DATUM)

Charts affected - JP 153 - JP 1108

2.45
Wk49/18
II

5702(T)/18 JAPAN - Seto Naikai - Vertical clearance.


Source: Japanese Notice 45/5569(T)/18
1. The vertical clearance of Oshima O-hashi Bridge, in position 33° 57´·50N., 132° 11´·10E. is 4m less than charted daily
between 2000 and 0700, until 20 December 2018 and 15 February to 29 March 2019.
(WGS84 DATUM)

Charts affected - JP 142 - JP 1102 - JP 1108

5703(T)/18 JAPAN - Seto Naikai - Works. Vertical clearance.


Source: Japanese Notice 45/5570(T)/18
1. The vertical clearance of Kanmon Bridge may be reduced by up to 5m, due to maintenance works.
2. The works are taking place daily between 0900 and 1730, until 12 December 2018, on and in the vicinity of a line joining
the following positions:

33° 57´ 37"N., 130° 57´ 42"E.


33° 57´ 48"N., 130° 57´ 20"E.
(WGS84 DATUM)

Charts affected - JP 135 - JP 1262 - JP 1263

5704(T)/18 JAPAN - Kyu- shu- - Dredging area.


Source: Japanese Notice 45/5571(T)/18
1. Dredging works are taking place, until 15 March 2019, within an area bounded by the following positions:

33° 36´ 11·1"N., 130° 23´ 38·8"E.


33° 36´ 16·0"N., 130° 23´ 42·7"E.
33° 36´ 23·6"N., 130° 23´ 38·1"E.
33° 36´ 25·9"N., 130° 23´ 43·6"E.
33° 36´ 19·0"N., 130° 23´ 47·8"E.
(WGS84 DATUM)

Chart affected - JP 1227

5811(P)/18 KOREA - East Coast - Fish haven.


Source: Korean Notice 44/931/18
1. A fish haven, depth 16m, exists in position 35° 38´·64N., 129° 28´·06E.
2. Mariners are advised to navigate with caution in the area.
3. This change will be included in a New Edition of Chart 3666 to be published 13 December 2018.
(WGS84 DATUM)

Chart affected - 3666 (INT 5251)

2.46
Wk49/18
II

5813(P)/18 KOREA - West Coast - Depths. Wreck.


Source: Korean Notice 44/924/18
1. Shoal depths have been identified west of the Sindo Fairway as follows:

Depth (m) Position


48 36° 57´·37N., 126° 00´·66E.
14 36° 50´·92N., 125° 57´·87E.
2. The wreck in position 36° 58´·07N., 126° 01´·91E. has been resurveyed to a least depth of 46m.
3. Mariners are advised to navigate with caution in the area.
4. These changes will be included in a New Edition of Chart 1258 to be published 13 December 2018.
(WGS84 DATUM)

Chart affected - 1258

5713(T)/18 AUSTRALIA - Western Australia - Wreck.


Source: Australian Notice 22/989(T)/18
1. A stranded wreck exists in position 20° 39´·60S., 116° 37´·83E.
2. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Charts affected - Aus 57 - Aus 58

5725(T)/18 AUSTRALIA - Queensland - Depth.


Source: Australian Notice 22/974(T)/18
1. Shoaling, with a least depth of 1·7m, exists in position 26° 40´·76S., 153° 07´·92E.
2. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Chart affected - Aus 235

5729(T)/18 AUSTRALIA - Queensland - Works.


Source: Australian Notice 22/976(T)/18
1. Vessel, B lack Panther, and barge, PMG 183W, are conducting works to establish an artificial reef in the vicinity of position
27° 24´·17S., 153° 29´·69E.
2. The barge has deployed four anchors. Vessels will display appropriate lights and shapes, and will monitor VHF Ch 16.
3. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Charts affected - Aus 236 - Aus 814

2.47
Wk49/18
II

5732(T)/18 AUSTRALIA - Queensland - Obstruction.


Source: Australian Notice 22/971(T)/18
1. An obstruction with least depth 4.9m, exists in position 27° 26´·81S., 153° 04´·68E.
2. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Chart affected - Aus 238

5734(T)/18 AUSTRALIA - Queensland - Buoyage.


Source: Australian Notice 22/972(T)/18
1. *Light-buoys, Fl.Y.5s, exist in the following positions:

21° 05´·54S., 149° 14´·49E.


21° 10´·35S., 149° 15´·68E.
21° 19´·05S., 149° 18´·74E.
21° 24´·90S., 149° 20´·12E.
2. Former Notice 4720(T)/18 is cancelled.
* Indicates new or revised entry.
(WGS84 DATUM)

Charts affected - Aus 249 - Aus 250

5735(T)/18 AUSTRALIA - Western Australia - Scientific instruments. Buoyage.


Source: Australian Notice 22/988(T)/18
1. Subsurface scientific instruments and buoyage have been established in the following positions:

Position Remarks
18° 41´·37S., 118° 44´·51E. 6m below surface
*18° 50´·39S., 118° 51´·89E. special pillar light-buoy, Q(5)Y.20s
*18° 50´·40S., 118° 51´·50E. 6m below surface
*18° 50´·66S., 118° 51´·78E. 6m below surface
18° 50´·78S., 118° 51´·50E. special spherical light-buoy, Q(5)Y.20s
*19° 02´·03S., 118° 43´·74E. 81m below surface
19° 14´·74S., 118° 43´·15E. 71m below surface
19° 31´·14S., 118° 43´·80E. 31m below surface
2. Former Notice 5440(T)/17 is cancelled.
* Indicates new or revised entry.
(WGS84 DATUM)

Charts affected - Aus 325 - Aus 326 - Aus 739

5707(T)/18 NEW ZEALAND - South Island - Works.


Source: New Zealand Notice 22/140(T)/18
1. Until further notice, aids to navigation installation works are underway within Lyttelton Harbour
(43° 36´·61S., 172° 46´·07E.)
2. The works will be undertaken by a crane mounted on the barge Geronimo with attendant tug Rosco (call sign ZMF7771).
3. During the works and repositioning, the barge will be restricted in its ability to manoeuvre. Mariners are advised to maintain
a minimum closest approach and no wake zone of 200m from the barge.

2.48
Wk49/18
II
5707(T)/18 NEW ZEALAND - South Island - Works. (continued)
4. All vessels will maintain a listening watch on VHF channel 12 and 16.
5. Mariners are advised to exercise caution when navigating in the area.
(WGS84 DATUM)

Chart affected - NZ 6321

5740(P)/18 PANAMA - Panama Canal - Anchorage area. Buoyage. Obstructions. Depths.


Source: ENC PA5CP001
1. A new Small Craft anchorage area has been established, bounded by the following positions:

9° 22´·264N., 79° 56´·606W.


9° 22´·263N., 79° 56´·517W.
9° 21´·617N., 79° 56´·517W.
9° 21´·621N., 79° 56´·499W.
9° 20´·648N., 79° 56´·502W.
9° 20´·648N., 79° 56´·611W.
2. Special purpose light-buoys, Fl.Y.2s, have been established in the following positions:

9° 22´·264N., 79° 56´·606W.


9° 22´·263N., 79° 56´·517W.
9° 21´·455N., 79° 56´·499W.
9° 21´·456N., 79° 56´·608W.
9° 20´·648N., 79° 56´·502W.
9° 20´·648N., 79° 56´·611W.
3. A green pillar light-buoy, Oc.G.5s ’1’, has been established in position 9° 20´·969N., 79° 54´·247W.
4. Numerous obstructions exist within an area bounded by the following positions:

9° 20´·812N., 79° 55´·038W.


9° 20´·377N., 79° 55´·032W.
9° 20´·385N., 79° 55´·058W.
9° 20´·812N., 79° 55´·062W.
5. Depths less than charted exist within Bahía Shelter. The most significant are as follows:

Depth Position
4·9m 9° 21´·161N., 79° 56´·614W.
2·4m 9° 21´·570N., 79° 56´·440W.
4·1m 9° 21´·582N., 79° 56´·313W.
4·5m 9° 21´·637N., 79° 56´·188W.
7·6m 9° 21´·730N., 79° 56´·170W.
7m 9° 21´·699N., 79° 56´·388W.
8·5m 9° 22´·207N., 79° 56´·538W.
6. Mariners are advised to navigate with caution in the area.
7. These changes will be included in the next New Edition of Chart CP1.
(WGS84 DATUM)

Chart affected - CP 1

2.49
Wk49/18
To accompany Notice to Mariners 5758/18

On Chart 3434

DEPTHS
Depths deeper than charted have been
reported in the vicinity. Consult the port
authorities for further information.

To accompany Notice to Mariners 5775/2018

On Chart IN 22

CHART IN259: POSITIONS


To agree with the larger scale chart IN259 which is referred to WGS84 Datum,
positions read from chart IN22 must be adjusted by 0·08 minutes
NORTHWARD and 0·05 minutes WESTWARD.

To accompany Notice to Mariners 5775/2018

On Chart IN 22

CHART IN258: POSITIONS


To agree with the larger scale chart IN258 which is referred to WGS84 Datum,
positions read from chart IN22 must be adjusted by 0·07 minutes
NORTHWARD and 0·05 minutes WESTWARD.

To accompany Notice to Mariners 5775/2018

On Chart IN 293

CHART IN258: POSITIONS


To agree with the larger scale chart IN258 which is referred to WGS84 Datum,
positions read from chart IN293 must be adjusted by 0·07 minutes
NORTHWARD and 0·05 minutes WESTWARD.

To accompany Notice to Mariners 5775/2018

On Chart 1509

CHARTS IN217 AND IN258: POSITIONS


To agree with the larger scale chart IN217 and
the adjoining chart IN258 which are referred to
WGS84 Datum, positions read from chart
1509 must be adjusted by 0·07 minutes
NORTHWARD and 0·05 minutes
WESTWARD.

Wk49/18
To accompany Notice to Mariners 5775/2018

On Chart 1509

CHART IN216: POSITIONS


To agree with the larger scale chart IN216
which is referred to WGS84 Datum, positions
read from chart 1509 must be adjusted by 0·07
minutes NORTHWARD and 0·04 minutes
WESTWARD.

To accompany Notice to Mariners 5775/2018

On Chart 1566

CHART IN259: POSITIONS


To agree with the adjoining chart IN259 which
is referred to WGS84 Datum, positions read
from chart 1566 must be adjusted by 0·09
minutes NORTHWARD and 0·05 minutes
WESTWARD.

To accompany Notice to Mariners 5775/2018

On Chart 1566

CHARTS IN220, IN221 AND IN262:


POSITIONS
To agree with the larger scale charts IN220
and IN221 and the adjoining chart IN262
which are referred to WGS84 Datum, positions
read from chart 1566 must be adjusted by 0·09
minutes NORTHWARD and 0·06 minutes
WESTWARD.

To accompany Notice to Mariners 5775/2018

On Chart 2738

POSITIONS
Positions on chart 2738 differ from those on
other charts of this area by varying amounts;
positions should be transferred by bearing and
distance from common charted objects, not by
latitude and longitude.

To accompany Notice to Mariners 5798/2018

On Chart 2234

CHART 3302: POSITIONS


To agree with the larger scale chart 3302
which is referred to WGS84 Datum, positions
read from chart 2234 must be adjusted by 0·01
minutes SOUTHWARD and 0·09 minutes
WESTWARD.

Wk49/18
To accompany Notice to Mariners 5712/18

On Chart 1587

SUBMARINE CABLES
Mariners are advised not to anchor or trawl in
the vicinity of submarine cables.

To accompany Notice to Mariners 5791/18

On Chart 595

AREAS TO BE AVOIDED
(4°35´·34N 3°08´·40W)
(4°32´·10N 2°54´·60W)
(4°28´·14N 2°33´·23W)
The areas indicated should be avoided, with
the exception of ships authorised by the
Ghana Maritime Authority.

To accompany Notice to Mariners 5791/18

On Chart 1383

AREA TO BE AVOIDED
(4°35´·34N 3°08´·40W)
(4°32´·10N 2°54´·60W)
(4°28´·14N 2°33´·23W)
To avoid the risk of pollution and damage to
the environment, this area has been
designated an Area to be Avoided. All vessels
carrying dangerous or toxic cargoes, with the
exception of those authorised by the Ghana
Maritime Authority, should avoid the area.
These areas are IMO-adopted.

To accompany Notice to Mariners 5792/18

On Chart 655

SUBMARINE CABLES
Mariners are advised not to anchor or trawl in
the vicinity of submarine cables.

To accompany Notice to Mariners 5792/18

On Chart 1024

SUBMARINE CABLES
Mariners are advised not to anchor or trawl in
the vicinity of submarine cables.

Wk49/18
To accompany Notice to Mariners 5792/18

On Chart 1026

SUBMARINE CABLES
Mariners are advised not to anchor or trawl in
the vicinity of submarine cables.

To accompany Notice to Mariners 5796/18

On Chart 3236

SUBMARINE CABLES
Mariners are advised not to anchor or trawl in
the vicinity of submarine cables

Wk49/18
To accompany Notice to Mariners 5718/18. Image Size (mm) 85.8 by 53.7

Wk49/18
To accompany Notice to Mariners 5718/18. Image Size (mm) 86.5 by 90.2

Wk49/18
To accompany Notice to Mariners 5720/18. Image Size (mm) 91.7 by 129.2

Wk49/18
To accompany Notice to Mariners 5720/18. Image Size (mm) 82.3 by 115.7

Wk49/18
To accompany Notice to Mariners 5724/18. Image Size (mm) 134.2 by 85.5

Wk49/18
To accompany Notice to Mariners 5733/18. Image Size (mm) 102 by 132.5

Wk49/18
To accompany Notice to Mariners 5758/18. Image Size (mm) 156.1 by 121.3

Wk49/18
To accompany Notice to Mariners 5761/18. Image Size (mm) 117.1 by 150.9

Wk49/18
To accompany Notice to Mariners 5761/18. Image Size (mm) 91.8 by 124.3

Wk49/18
To accompany Notice to Mariners 5765/18. Image Size (mm) 147.7 by 169.7

Wk49/18
To accompany Notice to Mariners 5768/18. Image Size (mm) 108.7 by 66.1

Wk49/18
To accompany Notice to Mariners 5774/18. Image Size (mm) 160 by 168.4

Wk49/18
To accompany Notice to Mariners 5783/18. Image Size (mm) 167 by 144.4

Wk49/18
To accompany Notice to Mariners 5791/18. Image Size (mm) 75.5 by 84

Wk49/18
To accompany Notice to Mariners 5791/18. Image Size (mm) 65.5 by 74.8

Wk49/18
To accompany Notice to Mariners 5806/18. Image Size (mm) 97.9 by 130.8

Wk49/18
III

NAVIGATIONAL WARNINGS
See The Mariner’s Handbook (2016 Edition). It is recommended that the warnings reprinted below should be kept in a file or
book, followed by subsequent weekly reprints. Only the most convenient ADMIRALTY Chart is quoted. All warnings issued
within the previous 42 days are broadcast via SafetyNET and/or NAVTEX.
The complete texts of all in-force NAVAREA I warnings, including those which are no longer being broadcast, are
available from www.admiralty.co.uk/RNW. Additionally, a quarterly cumulative list of the complete text of all in-force
NAVAREA I Warnings is included in Section III of the Weekly NM Bulletin in Weeks 1, 13, 26 and 39 each year.
Alternatively, these may be requested by e-mail from NAVAREA I Co-ordinator at: navwarnings@btconnect.com
The RNW web page also contains a link to the IHO website which allows direct access to all the other NAVAREA
Co-ordinators around the world who have made their NAVAREA warnings available on the web.
----------------------------------------------------------------------------------------------------------------------------------------------------------
Weekly Edition 49, 6 December 2018 (published on the UKHO website 26 November 2018).
----------------------------------------------------------------------------------------------------------------------------------------------------------
Navarea I (NE Atlantic) Weekly Edition 49
The following NAVAREA I warnings were in force at 260500 UTC Nov 18.

2017 series: 163.


2018 series: 125 149 153 154 162 163

160 Cancelled. Cancel 151/18.

161 Cancelled. Cancel 157/18.

162 1. Navarea I Warnings in force at 231000 UTC Nov 18. 2. Cancel 158/18.

163 1. RIGLIST. Correct at 260500 UTC Nov 18.

Southern North Sea: 51N to 55N


52-15.0N 002-30.5E GMS Endurance 6101 ACP East Anglia One Windfarm
53-00.6N 002-11.1E Seafox 4 ACP Leman Gas Field
53-14.0N 003-14.5E 590021
53-21.4N 002-02.4E Ensco 92 ACP North Valiant Gas Field
53-32.4N 002-00.9E Paragon B391 ACP Audrey Gas Field
53-36.8N 001-31.6E Ensco 122 ACP Barque Gas Field
53-42.2N 001-09.0E Seafox 1 ACP West Sole Gas Field
NEW 53-43.3N 001-53.4E Seajacks Leviathan ACP Saturn Gas Field
53-49.4N 004-03.1E Paragon C20051 ACP L4-PN
53-56.4N 002-44.8E Noble Hans Deul ACP Chiswick Gas Field
54-37.7N 002-20.2E Ensco 101

3.1 Wk49/18
III

North Sea: 55N to 60N, East of 5W


55-24.0N 003-48.7E Maersk Resolute ACP A12
55-28.1N 005-08.1E Noble Sam Turner ACP Dan Oil Field
55-43.4N 004-48.0E Maersk Guardian ACP Tyra Gas Field
56-16.8N 003-24.0E Maersk Reacher ACP Valhall Oil Field
56-30.7N 003-54.8E Rowan Viking
56-43.5N 002-12.5E Ensco 120 ACP Jasmine Gas Field
56-50.2N 001-50.9E Wilphoenix
56-58.0N 001-52.2E Rowan Gorilla 5 ACP Franklin Gas Field
57-00.8N 001-50.4E Noble Sam Hartley ACP Elgin Gas Field
57-04.3N 003-03.8E Maersk Interceptor
57-06.9N 002-50.6E Safe Scandinavia ACP Ula Oil Field
57-10.7N 001-06.6E Prospector 5
57-11.7N 001-54.8E Maersk Highlander ACP u/c Pierce Oil Field Westward
57-48.6N 000-58.3W Maersk Innovator ACP Buzzard Oil and Gas Field.
57-48.9N 004-32.1E Rowan Stavanger ACP Yme Oil Field
57-58.2N 000-53.7E Paul B Loyd Jnr
58-01.7N 001-42.9E Rowan Gorilla 7
58-21.8N 001-32.9E Deepsea Atlantic
58-34.3N 001-41.8E Maersk Integrator ACP Gina Krog under construction
59-02.2N 002-13.5E Maersk Intrepid
59-27.0N 001-37.2E Ocean Patriot
59-34.9N 001-39.3E Ocean Valiant
59-35.2N 001-03.2E Safe Boreas ACP u/c Mariner Oil Field
59-35.4N 001-03.4E Noble Lloyd Noble ACP u/c Mariner Oil Field
NEW 59-55.9N 001-15.1E Transocean Leader

Norwegian Sea: 60N to 65N, East of 5W


60-20.2N 004-02.1W Deepsea Aberdeen
NEW Scapa Flow Safe Caledonia
60-48.0N 003-26.5E Songa Endurance
60-54.9N 003-31.2E Songa Equinox
60-55.8N 003-39.8E COSL Promoter
60-55.9N 002-14.1W Stena Don
61-02.0N 001-07.8E Paragon MSS1
61-08.9N 003-17.0E Deepsea Bergen
61-17.6N 001-28.3E Transocean 712
63-55.0N 007-18.0E Leiv Eiriksson
64-35.8N 006-51.3E Scarabeo 8
64-48.5N 006-26.9E West Phoenix
NEW 64-52.0N 006-50.3E Transocean Enabler
64-53.4N 007-04.3E Songa Encourage

South and West Coasts of the British Isles.


53-38.8N 003-28.7W Irish Sea Pioneer ACP Hamilton North Gas Field
NOTES:
A. Rigs are protected by a 500 metre safety zone.
B. ACP - Adjacent to Charted Platform; u/c - under construction
C. For Rigs located North of 65N, East of 5W, refer to Navarea XIX Warnings or visit www.navarea-xix.no

2. Cancel 159/18.

Wk49/18 3.2
IV

[49/18]
UPDATES TO ADMIRALTY SAILING DIRECTIONS

NP7 South America Pilot Volume 3 (2018 Edition) Paragraph 6.360 1--4 Replace by:
1 Molo Sur (3335·45S 7137·29W) is 772 m in
length with a least depth alongside of 155 m. Details
Chile -- Puerto San Antonio — Berth draught of the berths as follow:
Berth Max Max Principal use
204 No length/beam displacement
(tonnes)
Paragraph 6.348 1 lines 1--4 Replace by:
1 363 m 149 000 Containers,
484 m liquids.
1 See 6.360.
2 337 m 106 000 Containers,
Chilean Notice 9/79/18 [NP7--No 1--Wk 49/18] 428 m liquids.
3 253 m 46 703 Containers,
322 m liquids.
Chile -- Puerto San Antonio — Prohibited areas; Maximum draught allowed is 14 m with a UKC of
outer anchorage; pilotage 10% of the minimum sounding for vessels using berth
No 1 and 149 m with an UKC of 06 m S of bitt No 18
204--205 and for berths Nos 2 and 3.
2 Muelle Costanera (3335·45S 7137·05W) is
Paragraph 6.351 1 Replace by: 700 m in length and has two berths (C1 and C2) with
depths alongside from 146 to 150 m.
1 Vessels awaiting entry anchor in 28 m, sand and Maximum dimensions: length 367 m, beam 482 m,
mud, in a circular area centred 1¼ miles W of the displacement 163 000 tonnes.
head of Molo Sur (333517S 713744W). Maximum draught: 132 m, with an UKC of 10% of
the minimum sounding (bitt Nos 1 to 11) and 135 m,
Paragraph 6.352 1 Replace by: with an UKC of 10% of the minimum sounding (bitt
Nos 11 to 35).
1 Pilotage. Compulsory and available 24 hours. The 3 Terminal Espigón (3335·20S 7137·05W) has a
pilot boarding area is about 1¼ miles WNW of Molo total berthing space of about 560 m with four berths
Sur Light (333517S 713744W). Vessels must and facilities for containers, general and liquid cargo.
approach the Pilot Waiting Area at a speed not Depths alongside from 68 to 12 m. One mooring buoy
exceeding 4 kn. Vessels more than 300 m in length is available for berth No 4. Details of berths as
must wait for the pilot 1½ miles W of the breakwater. follows:
If the state of the weather prevents the pilot leaving
harbour, vessels of less than 100 m in length may Berth Max Max Notes
No length/beam displacement
enter harbour for embarkation. See ADMIRALTY List
(tonnes)
of Radio Signals Volume 6(7).
4--5 237 m 55 600
After Paragraph 6.352 Insert: 322 m
6--7 190 or 225 m 45 000 190 m LOA
322 m berthing on
Prohibited areas
port, 225 m
6.352a LOA on
1 Anchoring and fishing are prohibited within an area starboard.
lying W of the entrance, bounded by the parallels
333450S and 333517S and the meridian Maximum draught for berth Nos 4 and 5 is 1139 m
713900W. with an UKC of 06 m. Maximum draught for berth
Nos 6 and 7 is from 52 to 77 m with an UKC of
06 m.
Chilean Notice 9/79/18 [NP7--No 2--Wk 49/18] Minimum distance between vessels alongside is
20 m.
4 Muelle Panul (3334·94S 7137·13W) – Berth
Chile -- Puerto San Antonio — Moorings; berths No 8 is a T--shaped pier 77 m in length (186 m with
dolphins) with a depth alongside of 128 m. Two
205--206 mooring buoys are available.
Maximum dimensions: length 230 m, beam 323 m,
Paragraph 6.359 Replace by: displacement 60 000 tonnes (50 000 tonnes if using
the E dolphin).
Maximum draught allowed is 11 m (UKC 18 m) in
Spare waves up to 1 m high and 103 m (UKC of 25 m) in
6.359 waves up to 2 m high.

4.1 Wk49/18
IV

5 Muelle Policarpo Toro (3334·96S 7137·32W) – No Position Designation Remarks


Berth No 9 is 62 m in length with a depth alongside of
118 m. Hoses, pipelines, and three buoys are
3 6A 115949S Fishing vessels A submarine
available. 770867W pipleine is laid
on the S
Maximum dimensions: length 190 m, beam 322 m,
border
draught 10 m, displacement 30 000 tonnes.
6B 120018S Fishing vessels
Chilean Notice 9/79/18 [NP7--No 3--Wk 49/18] 770912W
4 7 115948S Nuclear
Chile -- Bahia Chiquinata -- Punta Gruesa — 771060W powered
Prohibited area vessels and any
vessel carrying
258 or holding
radioactive
After Paragraph 8.159 1 line 4 Insert: material
Prohibited area. Anchoring and fishing is prohibited 5 8 120057S Tankers Oil and A stranded
within an area surrounding Punta Gruesa (202179S 771132W Gas and wreck,
701094W). hazardous surrounded by
cargoes a restricted
Chilean Notice 9/82/18 [NP7--No 4--Wk 49/18] area radius
165 m marked
by an isolated
Chile -- Bahia Chiquinata -- Punta Gruesa — danger buoy,
Prohibited area and a
dangerous
260 wreck lie in the
E part
After Paragraph 8.177 1 line 9 Insert:
6 9 120210S Pilot waiting
Anchoring is also prohibited within the area 771090W area
surrounding Punta Gruesa (see 8.162).
10 120100S Vessels
Chilean Notice 9/82/18 [NP7--No 5--Wk 49/18] 770890W awaiting
disposal
11 115948S Security,
Peru -- Callao – Ensenada de Chorrillos —
Anchorage 771207W Provisioning
and Quarantine
291 7 12 120124S Fuel loading/ A dangerous
771292W unloading and wreck lies near
After Paragraph 9.218 4 line 3 Insert: lightening the centre of
the area
A naval anchorage lies at 120883S 770256W.
A 120391S Yacht Club
Peru Notice 9/93/18 [NP7--No 6--Wk 49/18] 770995W
B 120375S Recreational
Peru -- Callao — Anchorages 770996W Vessels
8 C 120384S La Punta Yacht
291--292 770982W Club
Paragraph 9.215 Replace by: A 120373S Marine School
770973W
1 Designated anchorages exist, for different classes
of vessels, centred as follows: B 120365S Hydrographic Three wrecks
770950W Vessels and two
No Position Designation Remarks mooring buoys
1 120153S Merchant lie in the area
771151W vessels 9 A 120328S Fishing Vessels
2 120151S Fishing, Mining, A wreck lies in 770929W
771009W Factory Vessels S part B 120340S Harbour
2 3 120233S Fishing vessels Three 770922W Vessels
770949W dangerous C 120349S Tour Vessels
wrecks lie in 770918W
the area
D 120377S Small Craft
4 120176S Harbour vessels 770927W
770942W
5 120074S Laid up vessels
770998W Peru Notice 9/82/18 [NP7--No 7--Wk 49/18]

Wk49/18 4.2
IV

Peru – Puerto Chancay — Anchorages NP20 Baltic Pilot Volume 3 (2016 Edition)
299
Sweden -- Approaches to Luleå -- Sandön —
After Paragraph 10.28 1 line 4 Insert: Directions; sector light
Outer Anchorages exist for different classes of 478
vessel in designated anchorages as follows:
Merchant vessels (113437S 771737W) in Paragraph 11.155 3 line 1 Replace by:
depths of about 20 m,
2 Vessels awaiting a Pilot (113445S 771696W) 3 The alignment (3085) of these lights and the white
in depths of about 16 m, sector (3082–3087) of Björnöhällan sector light
Small craft and fishing vessels over 30 gt (653118N 221960E) leads through...
(113430S 771689W) in depths of 12 to 15 m,
Small craft and fishing vessels under 30 gt Swedish Notice 729/13580/18
(113500S 771642W) in depths of about 5 m. [NP20--No 115--Wk 49/18]
3 The merchant vessel and the vessels awaiting a
Pilot anchorages lie close to the prohibited anchorage
area below. NP24 Black Sea and Sea of Azov Pilot
(2017 Edition)
Peru Notice 9/77/18 [NP7--No 8--Wk 49/18]
Turkey -- Black Sea -- West of Istanbul —
Peru – Puerto Chancay — Berths Port installation

300 162

Paragraph 10.31 1 line 9 Replace by: After Paragraph 4.17 1 line 7 Insert:
The pier is damaged and is no longer in use.
Istanbul Airport (New) Fuel Supply Terminal
Peru Notice 9/76/18 [NP7--No 9--Wk 49/18]
General information
4.17a
1 Position and function. Istanbul Airport (New) Fuel
NP11 Arctic Pilot Volume 2 (2018 Edition)
Supply Terminal (411880N 284733E) is a harbour
on the N coast of Turkey, 12 miles WNW of Dalyan
Greenland -- Kong Christian IX Land -- Burnu. The terminal allows direct delivery of fuel by
Kap Gustav Holm — Directions; shoal sea to the airport.
Port limits. The facility lies within Istanbul Port
322 Authority jurisdiction (2.287).
Paragraph 12.176 4 line 5 Replace by: Directions
4.17b
...Karra, thence:
1 Entry. The harbour is entered from the NW
Clear of a shoal (663508N 335866W), reported
between the N and E breakwaters, with lit beacons
(2018), with a depth of 10 m.
(lateral) at their seaward ends. The terminal lies inside
Danish Notice 45/871/18 [NP11--No 3--Wk 49/18] the E breakwater.
Basins and berths
4.17c
NP13 Australia Pilot Volume 1 (2017 Edition) 1 Alongside berths. There are two berths; the
largest 320 m long with a depth of 175 m can
accommodate vessels up to 100 000 dwt.
Western Australia -- Cambridge Gulf --
Wyndham Wharf — Directions; light buoys
Turkish Notice 44/214/18 [NP24--No 55--Wk 49/18]
168

Paragraph 4.171 1 Replace by: NP30 China Sea Pilot Volume 1 (2018 Edition)
1 From a position E of Pender Point, the track leads
generally S through Main Channel between Roe Bank Malaysia -- East coast -- Kuantan Port —
and the E side of Middle Ground. The track then Anchorages; pilotage
continues SE between an unnamed bank (152031S
1280655E), the SE extremity of which is marked by 96
Mangrove Light Buoy (E cardinal), and the drying Paragraph 3.61 1 line 6 Replace by:
bank which lies up to 4½ cables off the E shoreline.
...mud, is good. Deep water, special activity, and ISPS
Australian Notice 23/1023/18 holding anchorages lie to the N of the outer fairway light
[NP13--No 30--Wk 49/18] buoy. However, the anchorages are exposed...

4.3 Wk49/18
IV

Paragraph 3.62 1 lines 2--4 Replace by: NP32B China Sea Pilot Volume 4 (2018 Edition)
...of the outer Fairway Light Buoy (35573N 1033305E)
and in the approach channel in position 35630N China -- Bo Hai -- Laizhou Wan — Anchorage
1032865E. In bad weather, pilots may board small
vessels inside the harbour. 129

Malaysian Notice 10/230/18 [NP30--No 33--Wk 49/18] Paragraph 4.87 2 line 1 Replace by:
2 There is anchorage for vessels up to 5 000 dwt
centred on position 372658N 1191994E.
Vietnam -- South coast -- Can Tho — Depths
A temporary lightering anchorage is centred on...
159 Chinese Notice 45/1968/18 [NP32B--No 76--Wk 49/18]
Paragraph 5.47 3 lines 3--5 Replace by:
NP43 South and East Coasts of Korea, East
Between Nos 0 and 8 Light Buoys 21 m (2018)
Coast of Siberia and Sea of Okhotsk Pilot
Between Nos 8 and 10 Light Buoys 12 m (2018) (2018 Edition)
Between Nos 10 and 16 Light Buoys 24 m (2018)

South Korea -- South coast -- Geomundo —


Vietnamese Notice 222/2018 [NP30--No 34--Wk 49/18] Vertical clearance

98
Vietnam -- Gulf of Tonkin -- Archipel des Fai Tsi
Long — Directions; light Paragraph 2.104 6 lines 1--3 Replace by:
6 Vertical clearance. The N entrance to Tonae Hae
216 is spanned by overhead power cables with a least
vertical clearance of 26 m, and a bridge (340339N
After Paragraph 6.180 1 line 3 Insert:
1271812E) with a vertical clearance of 22 m.
Den Co To Light (205996N 1074545E) (yellow
4--sided concrete tower on a building, 16 m in South Korean Notice 46/997/18
height). [NP43--No 42--Wk 49/18]

Vietnamese Notice 224/2018 [NP30--No 35--Wk 49/18]


NP46 Mediterranean Pilot Volume 2
(2018 Edition)
Vietnam -- Gulf of Tonkin -- Archipel des Fai Tsi
Long — Directions; light
France -- South coast -- Gulf of Lions -- Golfe
218 d’Aigues Mortes — Seaplane operating area

After Paragraph 6.196 1 line 7 Insert: 67

Den Co To Light (205996N 1074545E) (6.180) After Paragraph 2.96 1 line 3 Insert:

Vietnamese Notice 224/2018 [NP30--No 36--Wk 49/18] Seaplane operating area


2.96a
1 Golfe d’Aigues Mortes (2.95) is used by seaplanes
to draw water for fighting forest fires. The S limit of
NP32A China Sea Pilot Volume 3 (2018 Edition) the seaplane operating area is approximately 4329N.

French Notice 46/81/18 [NP46--No 19--Wk 49/18]


China – Shantou Gang — Arrival information;
pilotage
France -- South coast -- Gulf of Lions --
Golfe de Fos — Seaplane operating area
130
71
Paragraph 4.47 1 lines 3--4 including existing Section IV
Week 11/18 Replace by: After Paragraph 2.130 3 Insert:
...(231700N 1165400E), No 2 Pilot boarding position 4 Caution. Golfe de Fos is used by seaplanes to
(231527N 1165084E) and within No 1 and No 2 draw water for fighting forest fires. The S limit of the
Anchorages (4.46). seaplane operating area is approximately 4320N.

BA Chart 1793/18 [NP32A--No 86--Wk 49/18] French Notice 46/81/18 [NP46--No 20--Wk 49/18]

Wk49/18 4.4
IV

NP49 Mediterranean Pilot Volume 5 Oman -- Muscaò - JazØrat Muscaò —


(2018 Edition) Directions; position
82
Lebanon -- Sel’ Ata -- Ra’s Kubbº — Shoal Paragraph 3.101 1 line 2 For (33734N 583596E) Read
(233734N 583596E)
229
H102 Maersk Supply Service [NP63--No 33--Wk 49/18]
Paragraph 7.104 3 lines 5--6 Replace by:
...which is steep--to and surmounted by a tower. A United Arab Emirates -- Dubai — Anchorage
depth 10 m shoaler than charted has been
reported (2018) 6½ cables W of the cape. 157
Thence: Paragraph 7.128 2 lines 1--3 Delete
H102 [NP49--No 9--Wk 49/18]
BA Chart 3414 [NP63--No 29--Wk 49/18]

NP54 North Sea (West) Pilot (2018 Edition) NP67 West Coasts of Spain and Portugal Pilot
(2018 Edition)
England -- River Humber -- Skitter Channel —
Light float Spain -- West coast -- Puerto de Vigo —
Prohibited area; general layout
174 113
Paragraph 7.93 1 line 7 Replace by: After Paragraph 4.151 5 line 5 Insert:
...(starboard hand) (534253N 02629W). Entry is prohibited to an area surrounding the
abandoned ore loading berth (4217·25N 839·23W),
BA Chart 3497 [NP54--No 17--Wk 49/18] 3 cables ENE of Punta de Rande.
Paragraph 4.153 2 lines 4--6 Replace by:
...industries, along with a shipyard and slipways.
NP63 Persian Gulf Pilot (2018 Edition)
Spanish Notice 45/373/18 [NP67--No 4--Wk 49/18]

Oman -- Muscaò - JazØrat Muscaò —


Directions; position NP70 West Indies Pilot Volume 1
(2018 Edition)
62

Paragraph 2.12 1 line 11 For (33734N 583596E) Read United States of America -- East coast -- Florida --
Port Canaveral — Depths
(233734N 583596E)
123
H102 Maersk Supply Service [NP63--No 30--Wk 49/18] Paragraph 5.37 1 lines 1--7 Replace by:
1 Project depths:
Oman -- Muscaò - JazØrat Muscaò — Cut--1A, 1B, Cut--1, Cut--2 14 m (46 ft)
Directions; position
Cut--2 (44), Cut--3 134 m (44 ft)
77 Middle Turning Basin Access 107 m (35 ft)
Channel
Paragraph 3.63 2 line 17 For (33734N 583596E) Read
(233734N 583596E) West Access Channel 131 m (43 ft)
West Turning Basin Lower 107 m (35 ft)
H102 Maersk Supply Service [NP63--No 31--Wk 49/18]
US Chart 11478 [NP70--No 1--Wk 49/18]

Oman -- Muscaò - JazØrat Muscaò — United States of America -- East coast -- Florida --
Directions; position Port Canaveral — Traffic Regulations

79 124
Paragraph 5.43 2 line 2 For East Read Trident
Paragraph 3.82 1 line 3 For (33734N 583596E) Read
(233734N 583596E)
Paragraph 5.43 2 line 13 For East Read Trident

H102 Maersk Supply Service [NP63--No 32--Wk 49/18] US Chart 11478 [NP70--No 2--Wk 49/18]

4.5 Wk49/18
IV

United States of America -- East coast -- Florida -- Jamaica -- South coast -- Portland Bight —
Port Canaveral — General layout; Old Harbour LNG Terminal
directions; basins

125 256

Paragraph 5.47 1 lines 1--6 Replace by: After Paragraph 10.165 1 line 2 Insert:
1 An E--W channel, consisting of Cut--2, Cut--3,
Middle Turning Basin Access Channel, West Access
Channel, West Turning Basin Lower and the Old Harbour LNG Terminal
Canaveral Barge Canal connects the Atlantic Ocean
with the Intracoastal Waterway (1.40). The city of General information
Canaveral stands on the S side of the channel; on the 10.165a
N side lie Trident, Middle and West Basins. 1 Position and function. Old Harbour LNG Terminal
(175068N 770698W) is a LNG reception facility
Paragraph 5.51 1 line 8 For Outer Reach Read Cut--1A, serving Old Harbour Power Station.
Cut--1B and Cut--1
Arrival information
Paragraph 5.51 2 line 2 For Outer Reach Channel Read 10.165b
Cut--1B 1 Pilotage is compulsory.

Paragraph 5.51 3--4 Replace by: Basins and berths


3 The alignment (2698) of these lights leads through 10.165c
Cut--2, Cut--2 (44), Cut--3, Middle Turning Basin 1 Berth. The terminal is an offshore structure in
Access Channel, West Access Channel and West depths of 15 m with the FSRU Golar Freeze acting as
Turning Basin Lower, marked by light buoys and light floating storage. LNG bunkering from the facility is
beacons, passing S of Trident Basin, Middle Basin planned (2018).
and West Basin.
Trident Basin Leading Lights: New Fortress Energy [NP70--No 4--Wk 49/18]
Front light (red rectangle, white stripe, on framework
tower) (282516N 803589W).
4 Rear light (similar structure) (1¾ cables from Jamaica -- South Coast -- Portland Bight —
front light). Anchorage
The alignment (3261) of these lights leads into
Trident Basin.
257
From the W side of Middle Basin, the Canaveral
Barge Canal runs past West Basin to join the
Intracoastal Waterway in Banana River passing S of Paragraph 10.175 2 line 3 Replace by:
the West Access Channel.
...of fine grey sand over mud, clear of a pipeline that
Paragraph 5.52 1 line 1 For East Read Trident transverses the bay. Care must be taken to...

US Charts 11478; 11481 [NP70--No 3--Wk 49/18] New Fortress Energy [NP70--No 5--Wk 49/18]

Wk49/18 4.6
V

UPDATES TO ADMIRALTY LIST OF LIGHTS AND FOG SIGNALS

NP74, Vol A Edition 2018/19. Weekly Edition No. 49, Dated 06 December 2018.
Last Updates: Weekly Edition No. 47, dated 22 November 2018.

A2657·21 - Middlehaven Bridge. North 54 34·75 N FG 2 1 Metal post


Side. Outer 1 13·20 W
(GB:THPA)
* * * * * * * *

A2657·22 - Middlehaven Bridge. North 54 34·75 N FG 2 1 Metal post


Side. Inner 1 13·22 W
(GB:THPA)
* * * * * * * *

A2657·23 - Middlehaven Bridge. 54 34·74 N FR 2 1 Metal post


Central Pier. Inner 1 13·22 W
(GB:THPA)
* * * * * * * *

A2657·24 - Middlehaven Bridge. 54 34·74 N FR 2 1 Metal post


Central Pier. Outer 1 13·20 W
(GB:THPA)
* * * * * * * *

WEST COAST. SOUTH SOUND


A6335 - Doolin Bay. Doolin Pier. 53 00·93 N 2 F G(vert) 5 3
Pier Light 9 24·39 W
* * * * * * * *

A6335·1 - Doolin Bay. Doolin Pier. 53 00·91 N Oc W 3s 6 3 Red % on metal post


Ldg Lts 125·8°. Front 9 24·31 W
* * * * * * * *

A6335·2 - Doolin Bay. Doolin Pier. 53 00·90 N Oc W 3s 8 3 Red + on metal post


Ldg Lts 125·8°. Rear. 32m 9 24·29 W
from front
* * * * * * * *

NP75, Vol B Edition 2018/19. Weekly Edition No. 49, Dated 06 December 2018.
Last Updates: Weekly Edition No. 48, dated 29 November 2018.

BORKUM RIFFGRUND 2 WIND FARM


B1046·2 -S 53 54·98 N Oc(3)Y 16s .. 5 Wind turbine
6 29·34 E
* * * * * * * *

B1046·4 - SE 53 55·93 N Oc(3)Y 16s .. 5 Wind turbine


6 36·23 E
* * * * * * * *

BORKUM RIFFGRUND 1 WIND FARM


B1046·6 - SE 53 56·43 N Oc(3)Y 16s .. 5 Wind turbine
6 37·02 E
* * * * * * * *

B1046·8 -E 53 57·64 N Oc(3)Y 16s .. 5 Wind turbine


6 37·02 E
* * * * * * * *

5.1 Wk49/18
V

NP75, Vol B Edition 2018/19 continued.

BORKUM RIFFGRUND 2 WIND FARM


B1047 -E 53 58·45 N Oc(3)Y 16s .. 5 Wind turbine
6 37·02 E
* * * * * * * *

B1047·2 - NE 53 59·26 N Oc(3)Y 16s .. 5 Wind turbine


6 37·02 E
* * * * * * * *

B1047·4 -W 53 58·04 N Oc(3)Y 16s .. 5 Wind turbine


6 25·45 E
* * * * * * * *

B1047·6 - NW 53 59·24 N Oc(3)Y 16s .. 5 Wind turbine


6 25·36 E
* * * * * * * *

ALPHA VENTUS WIND FARM


B1047·8 - SE 54 00·02 N Oc(3)Y 16s .. 5 Wind turbine
6 37·19 E
* * * * * * * *

B1048 - NE 54 01·30 N Oc(3)Y 16s .. 5 Wind turbine


6 37·10 E
* * * * * * * *

MERKUR OFFSHORE WIND FARM


B1048·2 -E 54 02·18 N Fl Y 4s .. 5 Wind turbine
6 37·13 E
* * * * * * * *

B1048·4 -E 54 02·61 N Oc(3)Y 16s .. 5 Wind turbine


6 37·13 E
* * * * * * * *

TRIANEL WINDPARK BORKUM WIND FARM


B1048·6 -W 54 03·68 N Oc(3)Y 16s .. 5 Wind turbine
6 25·03 E
* * * * * * * *

MERKUR OFFSHORE WIND FARM


B1048·8 - NE 54 05·15 N Fl Y 4s .. 5 Wind turbine
6 33·86 E
* * * * * * * *

B1049 -N 54 05·35 N Oc(3)Y 16s .. 5 Wind turbine


6 33·11 E
* * * * * * * *

TRIANEL WINDPARK BORKUM WIND FARM


B1049·2 -N 54 05·29 N Oc(3)Y 16s .. 5 Wind turbine
6 27·41 E
* * * * * * * *

B1049·4 - NW 54 05·25 N Oc(3)Y 16s .. 5 Wind turbine Other wind turbines exist in this area,
6 24·94 E some marked by lights and fog signals
* * * * * * * *

DIE ELBE. NORD-OSTEE-KANAL (KIEL CANAL)


B1436 - Brunsbüttel. New outer 53 53·25 N 2 F G(vert) 10 7 Pile G275·5°-089°(173·5°).
DE, 4003, 310090 harbour. Mole (Mole 3). Pile 9 08·07 E 9 2m apart
----- .. Iso W 2s 17
* * * * * * * *

5.2 Wk49/18
Wk49/18
V

NP75, Vol B Edition 2018/19 continued.

B1848·715 - Munk S. No 91 55 30·24 N Fl(3)Y 10s 10 5 Wind turbine (fl 1, ec 1) x 2, fl 1, ec 5.


DK, , 152J 7 52·57 E TE 2018
--- .. Racon .. .. .. ALRS Vol 2 Station 55840
*

B1848·72 - Munk S. No 61 55 30·22 N Fl(3)Y 10s 10 5 Wind turbine (fl 1, ec 1) x 2, fl 1, ec 5.


DK, , 152H 7 50·98 E TE 2018
*

B1848·725 - Munk S. No 31 55 30·21 N Fl(3)Y 10s 10 5 Wind turbine (fl 1, ec 1) x 2, fl 1, ec 5.


DK, , 152F 7 49·38 E TE 2018
*

B1848·73 - Munk S. No 1 55 30·19 N Fl(3)Y 10s 10 5 Wind turbine (fl 1, ec 1) x 2, fl 1, ec 5.


DK, , 152B 7 47·78 E TE 2018
*

B1848·735 - Munk S. No 3 55 29·59 N Fl(3)Y 10s 10 5 Wind turbine (fl 1, ec 1) x 2, fl 1, ec 5.


DK, , 152C 7 47·93 E TE 2018
*

B1848·74 - Munk S. No 6 55 28·70 N Fl(3)Y 10s 10 5 Wind turbine (fl 1, ec 1) x 2, fl 1, ec 5.


DK, , 152D 7 48·15 E TE 2018
*

B1848·745 - Munk S. No 8 55 28·10 N Fl(3)Y 10s 10 5 Wind turbine (fl 1, ec 1) x 2, fl 1, ec 5.


DK, , 152E 7 48·30 E Y270°-170°(260°).
TE 2018
--- .. Racon .. .. .. ALRS Vol 2 Station 55830
*

B1848·75 - Munk S. No 38 55 28·12 N Fl(3)Y 10s 10 5 Wind turbine (fl 1, ec 1) x 2, fl 1, ec 5.


DK, , 152G 7 49·90 E TE 2018
*

B1848·755 - Munk S. No 68 55 28·13 N Fl(3)Y 10s 10 5 Wind turbine (fl 1, ec 1) x 2, fl 1, ec 5.


DK, , 152I 7 51·49 E TE 2018
*

B1848·76 - Munk S. No 98 55 28·15 N Fl(3)Y 10s 10 5 Wind turbine (fl 1, ec 1) x 2, fl 1, ec 5.


DK, , 152M 7 53·08 E TE 2018
*

B1848·765 - Munk S. No 96 55 28·74 N Fl(3)Y 10s 10 5 Wind turbine (fl 1, ec 1) x 2, fl 1, ec 5.


DK, , 152L 7 52·93 E TE 2018
*

B1848·77 - Munk S. No 93 55 29·64 N Fl(3)Y 10s 10 5 Wind turbine (fl 1, ec 1) x 2, fl 1, ec 5.


DK, , 152K 7 52·72 E TE 2018
*

HVALER
B2260·3 Remove from list; deleted

HVALER
B2261 Remove from list; deleted

B2262 - Utgårdskilen 59 04·28 N Oc WRG 6s 5 W4·5 Tripod G009·2°-030·4°(21·2°),


NO, , 011700 10 51·95 E R 3 6 W030·4°-041·4°(11°),
G2·8 R041·4°-183·4°(142°),
G183·4°-194·2°(10·8°)
*

5.3 Wk49/18
V

NP76, Vol C Edition 2018/19. Weekly Edition No. 49, Dated 06 December 2018.
Last Updates: Weekly Edition No. 47, dated 22 November 2018.

C0724 - Östra. Lts in line 032·5°. 56 53·37 N QW 12 9 Red % on mast


Front 12 28·48 E
* *

C0726 - Västra. Lts in line 032·5°. 56 53·36 N QW 12 9 Red % on mast


Front 12 28·52 E
* *

GULF OF GDAŃSK. NOWY PORT - GDAŃSK


C3072·5 Remove from list; deleted

C5736 - Björnöhällan. Ldg Lts 65 31·18 N Iso R 3s 10 11 Orange % on white Vis on leading line only.
308·5°. Front 22 19·60 E tower Shown 24 hours
---- .. Dir WRG .. .. .. F G306·7°-307·7°(1°).
Al WG307·7°-308·2°(0·5°).
F W308·2°-308·7°(0·5°).
Al WR308·7°-309·2°(0·5°).
F R309·2°-310·2°(1°)
* * * * * * * *

C6505·5 - Sankgrundet 59 25·95 N Fl Y 4s .. 1 .. Occas


18 38·70 E
* * * * * * * *

C7130 - Vinökråkan 57 30·80 N Fl WRG 3s 7 W 7 White concrete G181°-273·3°(92·3°),


16 44·10 E R 5 tower, red band, W273·3°-275·4°(2·1°),
G 4 black base R275·4°-305°(29·6°),
7 G305°-349°(44°).
Floodlit
-- .. Racon .. .. .. ALRS Vol 2 Station 62740
* *

C7132 - Strupö Ljungskär 57 30·81 N Fl(2)WRG 6s 13 W 8 White concrete G255°-271·6°(16·6°),


16 46·26 E R 6 tower, black base W271·6°-290·7°(19·1°),
G 5 9 R290·7°-312°(21·3°),
G312°-344°(32°), R344°-356°(12°),
G356°-068°(72°), R068°-099°(31°)
*

EAST COAST. KALMARSUND


C7421 Remove from list; deleted

EAST COAST. KALMARSUND


C7421·05 Remove from list; deleted

EAST COAST. KALMARSUND


C7421·1 Remove from list; deleted

EAST COAST. KALMARSUND


C7421·11 Remove from list; deleted

EAST COAST. KALMARSUND


C7421·14 Remove from list; deleted

EAST COAST. KALMARSUND


C7421·18 Remove from list; deleted

EAST COAST. KALMARSUND


C7421·2 Remove from list; deleted

5.4 Wk49/18
Wk49/18
V

NP77, Vol D Edition 2018/19. Weekly Edition No. 49, Dated 06 December 2018.
Last Updates: Weekly Edition No. 48, dated 29 November 2018.

D1590 - Puerto de Lastres. 43 30·92 N Fl(3)R 9s 7 3 Round concrete tower (fl 0·5, ec 1·5) x 2, fl 0·5, ec 4·5.
ES, I, 01695 Secondary Breakwater. Head 5 15·96 W 4 TE 2018
*

NORTH-WEST COAST. RÍA DE PONTEVEDRA


D1850 - Bajo Picamillo 42 24·26 N Fl G 5s 10 8 Green and white fl 0·5
ES, I, 04560 8 53·45 W tower
13
-- .. AIS .. .. .. MMSI No 992241103
*

SOUTH COAST
D2420 - Punta Carnero 36 04·62 N Fl(4)WR 20s 42 W16 Round masonry (fl 1·5, ec 2) x 3, fl 1·5, ec 8.
ES, II, 20110 5 25·58 W R13 tower and white W018°-325°(307°), R325°-018°(53°)
building over Bajos La Perla and Las Bajas.
19 TE 2018
-- .. AIS .. .. .. MMSI No 992242148
*

D2601 Cap Hadid 31 41·79 N Fl(2)W 15s 48 20 Framework tower TE 2018


FR, LC, 19600 9 39·93 W 30
*

PORT D'AGADIR
D2611 - Grande Jetée. Head 30 24·98 N Fl R 5s 12 5 Square tower, Red R167°-347°(180°)
FR, LC, 20100 9 37·86 W stripe
ES, I, 13710 7
* * * * * * * *

D2612 - Jetée Sud-Est. Head 30 25·08 N Fl G 5s 12 5 Green structure on a


FR, LC, 20120 9 37·75 W White shelter
5
* * * * * *

D2612·3 - Marina. S Breakwater. 30 25·14 N Fl R 5s 11 5 White pylon, red top


FR, LC, 20130 Head 9 37·04 W 6
* * * * * *

D2612·4 - Marina. N Breakwater. 30 25·24 N Fl G 5s


FR, LC, 20130 Head 9 37·02 W
* * *

D2613·2 - Port D'Anza. E Jetty. Head 30 25·31 N Fl G 4s 16 5 White pylon, green


FR, LC, 20070 9 38·39 W top
9
* * * *

D2613·4 - Port D'Anza. Fishing 30 25·40 N Fl R 4s 10 5 Red pylon


FR, LC, 20085 Harbour. NW Jetty 9 38·30 W 8
* * * * * * * *

D2628·6 Cabo Bojador. Harbour. E 26 06·85 N Fl G 5s 13 3 Pylon


FR, LC, 21080 Breakwater. Head 14 29·72 W
ES, I, 13887 * * * *

ILHA DE SÃO MIGUEL


D2640 - Ponta do Arnel 37 49·45 N Fl(2)W 10s 65 19 White tower, red Aeromarine.
PT, I, 702 25 08·14 W cupola and building Vis 157°-355°(198°)
15
* * *

D2640·65 - Porto da Povoação. E Mole. 37 44·67 N Oc G 4s 6 6 White tower, green ec 1·5


PT, I, 704 Head 25 14·84 W bands
*

5.5 Wk49/18
V

NP78, Vol E Edition 2018/19. Weekly Edition No. 49, Dated 06 December 2018.
Last Updates: Weekly Edition No. 48, dated 29 November 2018.

E0199·945 - N Entrance. Auxiliary 39 27·68 N Fl Y 5s 5 1 Yellow round post fl 0·5


ES, II, 26058·1 Dock. W Corner 0 19·11 W 3
*

E0199·96 - N Entrance. Approach 39 27·69 N Fl(2)G 7s 5 1 Green round post fl 0·5, ec 1·5, fl 0·5, ec 4·5
ES, II, 26058·2 Channel. N Side. No 1 0 19·32 W 3
*

E0440·25 - W Breakwater. Elbow 41 33·35 N Fl(3)R 10s 6 3 Lantern (fl 0·5, ec 1·5) x 2, fl 0·5, ec 5·5
ES, II, 30626 2 30·23 E
*

E2057 - Il-Bajja tal-Mellieha. 35 58·31 N Fl(2)W 5s 3 2 .. TE 2018


IT, , 3330 Mellieha Rock 14 21·52 E
*

E6506 Phare de Ras el Hamra. 36 58·05 N Fl W 5s 143 29 Grey square tower, fl 0·4.
DZ, , 4200 Cape de Garde 7 47·01 E white dwelling Signal station. Operates in emergency
26 mode Fl(4)20s20M
*

E6784·61 Al Hoceïma. Muelle de 35 15·12 N Oc G 6s 46 6 Green , white post,


ES, II, 72731 Ribera. 2nd Ldg Lts 330°. 3 55·35 W on white tower
Rear. 140m from front 5
*

NP79, Vol F Edition 2018/19. Weekly Edition No. 49, Dated 06 December 2018.
Last Updates: Weekly Edition No. 48, dated 29 November 2018.

F1740 - Malang Papan 1 24·10 N Fl G 5s 6 5 Green % on green


103 59·34 E post, concrete base
4
* * * * * * * *

F1744 - Loyang. Dir Lt 131° 1 22·97 N Dir Fl(2)WRG 6 W10 Red mast on red piles Fl(2) G128°-129°(1°).
(SG:MPA) 103 57·92 E 10s R 8 Fl(2) W129°-133°(4°).
G 8 Fl(2) R133°-135°(2°)
* * * * * * * *

F2063·801 Amurang. Megah Jaya Prima 1 10·77 N Fl W 10s 15 10 White beacon fl 1


ID, , 5371 Lestari. No 1 124 22·83 E 10
(ID)
* * * * * * * *

F2063·802 Amurang. Megah Jaya Prima 1 10·80 N Fl G 3s 10 6 Green % on green fl 1


ID, , 5371·1 Lestari. No 2 124 22·85 E beacon
(ID) 7
* * * * * * * *

F2063·803 Amurang. Megah Jaya Prima 1 10·60 N Fl R 4s 10 6 Red round beacon fl 1


ID, , 5371·2 Lestari. No 3 124 22·90 E 7
(ID)
* * * * * * * *

F2063·804 Amurang. Megah Jaya Prima 1 10·68 N Fl Y 4s 9 6 Yellow × on yellow fl 1


ID, , 5371·3 Lestari. No 4 124 22·92 E beacon
(ID) 7
* * * * * * * *

5.6 Wk49/18
V

NP79, Vol F Edition 2018/19 continued.

F2063·805 Amurang. Megah Jaya Prima 1 10·75 N Fl Y 4s 9 6 Yellow × on yellow fl 1


ID, , 5371·4 Lestari. No 5 124 22·88 E beacon
(ID) 7
* * * * * * * *

F2602 - Pisngi. Tayabas River 13 53·78 N Fl W 5s .. 10 White concrete tower W294°-027°(93°)


PH, , 0076 entrance. W Side 121 36·15 E 9
(PH:CG)
*

F2628 - Hamilo Point 14 10·30 N Fl(3)W 10s .. . . White tower Private


PH, , 0838 (PH:CG) 120 34·62 E
* * * * * * * *

F2757 Mauban. Malazor Point 14 12·25 N Fl W 5s .. 10 Concrete structure


PH, , 0113 (PH:CG) 121 45·21 E
*

F3010 Ko Kut 11 34·10 N Fl W 10s 206 10 White metal fl 1·5


TH, , 125 102 35·23 E framework tower
16
*

NP80, Vol G Edition 2018/19. Weekly Edition No. 49, Dated 06 December 2018.
Last Updates: Weekly Edition No. 48, dated 29 November 2018.

G0861·4 - Mitre-Mareógrafo 34 24·81 S Fl(5)Y 13s 8 5 Yellow × on pile (fl 0·5, ec 0·5) x 4, fl 0·5, ec 8·5.
AR, H211, 438·1 58 26·23 W Tide Gauge
-- .. AIS .. .. .. MMSI No 997011078
* * * * * * * *

G0861·5 Toma Shell 34 38·60 S Fl(5)Y 20s 4 3·5 Yellow framework (fl 0·5, ec 0·5) x 4, fl 0·5, ec 15·5
AR, H211, 232 58 18·99 W tower
* * * * * * * *

BAÍA ENGANO. RÍO CHUBUT


G1076 - Puerto Rawson. Punta del 43 22·30 S Fl W 9s 34 8 Black tower, white fl 0·7
AR, H212, 1286 Faro 65 02·80 W bands
11
*

BAHÍA FERROL. PUERTO CHIMBOTE


G2087·75 Remove from list; deleted

G2104 Remove from list; deleted

G2120 Remove from list; deleted

COLUMBIA RIVER
G4665·3 Remove from list; deleted

5.7 Wk49/18
V

NP82, Vol J Edition 2017/18. Weekly Edition No. 49, Dated 06 December 2018.
Last Updates: Weekly Edition No. 48, dated 29 November 2018.

J2192·2 - Wye River. No 1W 38 49·97 N Fl G 2·5s 5 4 Green & on pile


US, II, 26110 76 12·63 W
* * * * * * * *

GULF OF CAMPECHE. TÚXPAN AND APPROACHES. RÍO TUXPÁN


J4259·265 - Darsena de Ciaboga. No 4 20 56·81 N Fl Y 2s 8 5 Yellow round metal Reported 2018
97 21·10 W tower
3
* * * * * * * *

J6144·2 - Zarzurro Bay (Sapzurro 8 39·47 N Fl W 3s 11 10 Red tower, white fl 0·3


CO, C, 58 East) 77 21·39 W bands
5
* *

J6229·51 - Dir Lt 122°. E7 11 00·61 N Iso WRG 5s 16 8 Red and white tower R118·5°-121·5°(3°),
CO, C, 217 74 46·01 W 23 W121·5°-122·5°(1°),
G122·5°-125·5°(3°)
* *

ISLA LA ORCHILA
J6425·7 - Farallón 11 48·98 N Fl(2)W 6s 4 5 Black #on black
(VE) 66 12·72 W post, red band
* * * * * * * *

NP83, Vol K Edition 2018/19. Weekly Edition No. 49, Dated 06 December 2018.
Last Updates: Weekly Edition No. 48, dated 29 November 2018.

WIDE BAY HARBOUR


K2916 - Hook Point 25 47·03 S Fl W 3s .. 9 White tower fl 1
153 04·73 E
* * * * * * * *

K4289·5 - North Stake. Front. 43 36·80 S FG 6 5 % on green beacon (P) 2019


Starboard No 31 172 42·82 E 6
* * * * * * * *

K4289·6 - North Stake. Rear. 43 36·88 S FG 6 5 % on green beacon (P) 2019


Starboard No 33. 0·52M 172 42·12 E 6
from front
* * * * * * * *

K4290·05 - South Stake. Front. Port No 43 36·91 S FR 6 5 & on red beacon (P) 2019
36 172 42·85 E 6
* * * * * * * *

K4290·06 - South Stake. Rear. Port No 43 36·98 S FR 6 5 Red & on red beacon (P) 2019
38. 0·52M from front 172 42·14 E 6
* * * * * * * *

K4295 - Naval Point. North Turn 43 36·55 S FR 12 9 % on white beacon (P) 2019
Off Ldg Lts. Front. No 21 172 42·89 E 12
----- .. By day .. 1 .. (P) 2019
* * * * * * * *

K4295·1 - Naval Point. North Turn 43 36·55 S FR 8 9 + on white beacon (P) 2019
Off Ldg Lts. Rear. No 23 172 42·88 E 8
----- .. By day .. 1 .. (P) 2019
* * * * * * * *

5.8 Wk49/18
V

NP83, Vol K Edition 2018/19 continued.

K4303 - Purau Bay. Ldg Lts. Front. 43 36·81 S FW 8 6 Orange U on white (P) 2019
No 40 172 46·45 E tower
8
* * * * * * * *

K4303·1 - Purau Bay. Ldg Lts. Rear. 43 37·13 S Iso W 4s 18 7 Orange U on white (P) 2019
No 42 172 45·64 E tower
18
* * * * * * * *

NP84, Vol L Edition 2018/19. Weekly Edition No. 49, Dated 06 December 2018.
Last Updates: Weekly Edition No. 48, dated 29 November 2018.

L4406·5 - Toftir. Mole. Head 62 05·51 N Fl G 3s 7 4 Grey mast fl 0·75.


DK, , 6672 (DK) 6 44·60 W 2 Shown 15/7 to 1/6. Floodlit. TE;
replaced by starboard lateral buoy
Q G close NW during works in
progress (T) 2018
*

NP85, Vol M Edition 2018/19. Weekly Edition No. 49, Dated 06 December 2018.
Last Updates: Weekly Edition No. 48, dated 29 November 2018.

INCHEON HANG
M4179·3 - Yeongjong (Yeongjongdo) 37 31·35 N Fl(4)Y 8s 9 3 Yellow round steel
KR, 410, 3636·4 Bridge 126 32·66 E post
1
* * * * * * * *

INCHEON HANG
M4179·4 - Yeongjong (Yeongjongdo) 37 31·33 N Fl(4)Y 8s 10 3 Yellow round steel
KR, 410, 3636·1 Bridge 126 32·62 E post
1
* * * * * * * *

INCHEON HANG
M4179·5 - Yeongjong (Yeongjongdo) 37 31·39 N Fl(4)Y 8s 2 3 Yellow round steel
KR, 410, 3636·2 Bridge 126 32·59 E post
1
* * * * * * * *

INCHEON HANG
M4179·6 - Yeongjong (Yeongjongdo) 37 31·41 N Fl(4)Y 8s 2 3 Yellow round steel
KR, 410, 3636·3 Bridge 126 32·62 E post
1
* * * * * * * *

M4185·34 Boryeong Hang 36 24·61 N Fl(4)Y 8s 13 8 Yellow post


KR, 410, 3279·10 126 29·20 E 6
* * * * * * * *

5.9 Wk49/18
V

NP85, Vol M Edition 2018/19 continued.

M4265·6 Iho Hang 33 30·33 N Fl R 4s 12 9 Red round metal TE 2018


KR, 410, 2679·7 126 27·63 E tower
9
- .. FW 9 .. .. Floodlight; illuminates unlit Iho Hang
beacon in direction 157°
*

M4313 - Noryang Sudo Bridge. Left. 34 56·70 N FG 26 7 Green &


KR, 410, 2302 L2, L3 127 52·33 E
- - Centre. C2, C3 .. FW 26 6 White v, red stripes
- - Right. R2, R3 .. FR 26 7 Red %
- - Piers. P1, P2, P3, P4 .. FY 26 6
- - S1, S2, S3, S5, S7, S9, .. FY 26 6
S10, S12, S14, S16, S17, S18
* * * *

M4330·48 Sandaldo. Bridge. C1, C2 34 49·62 N Iso W 4s 23 7


128 32·28 E
- - L1, L2 .. Iso G 4s 21 7
- - R1, R2 .. Iso R 4s 25 7
- - P1-P12 & S1-S12 .. Iso Y 4s .. 7
* * * * * * * *

MASAN HANG
M4348·4 - Machangdaegyo Bridge. 35 09·79 N Fl W 4s 65 7 White , red stripes
KR, 410, 2107·1 C1, C2 128 35·67 E
- - L1, L2 .. Fl G 4s 65 7 Green &
- - R1, R2 .. Fl R 4s 65 7 Red %
- - P1-P8. P11-P16, P21-26 .. Fl Y 4s 65 6 Piers
- - P9, P10, P17, P18, P19, .. Fl Y 4s 6 6
P20, P27, P28
* * * * * * * *

M4350·8 Jeodo-Jungjukdo Bridge. C1, 35 00·90 N Iso W 4s 57 7 White , red stripes


KR, 410, 2075·1 C2 128 45·23 E
- L1, L2 .. Iso G 4s 57 7 Green &
- R1, R2 .. Iso R 4s 57 8 Red %
- P1-P26 .. Iso Y 4s 3 8
- S1-S22 .. Iso Y 4s 57 7
* * * * * * * *

M4415 Ganggu Hang. N 36 21·35 N Fl R 5s 17 10 Red metal pipe TE 2018


KR, 410, 1298 Breakwater. Head 129 23·57 E 11
*

M5080 Remove from list; deleted

HARIMA NADA. IKURO SHIMA


M5736·55 - Iwakuro Jima Bashi. 34 24·17 N FG 46 3 .. G045°-111°(66°)
JP, 411, 4057·4 Bridge. L1 133 48·52 E
*

M5920 - Hokkoguchi. N Harbour. 34 39·10 N FFl G 3s 8 F 5 White tower


JP, 411, 3600 Entrance Breakwater. Head 135 24·85 E Fl 2
* * * *

MIKAWA WAN. CHITA HANTO. OKINO SHIMA


M6159·5 - Okino Shima 34 42·00 N Mo(A)G 8s 8 5 Green & on concrete
JP, 411, 2619 136 58·65 E column
7
* *

NIIGATA KO
M7110 Remove from list; deleted

5.10 Wk49/18
V

NP85, Vol M Edition 2018/19 continued.

TOYAMA WAN. FUSHIKI TOYAMA KO. SHINMINATO. SHINMINATO KU


M7151·6 Remove from list; deleted

NP86, Vol N Edition 2018/19. Weekly Edition No. 49, Dated 06 December 2018.
Last Updates: Weekly Edition No. 47, dated 22 November 2018.

N4962·5 Airport. Main Breakwater. 41 18·84 N Fl R 3s 12 2 White round tower, fl 1


TR, , 10637 Head 28 47·32 E red band
8
--- .. AIS .. .. .. MMSI No 992711552
* * * * * * * *

N4962·6 Airport. Second Breakwater 41 18·78 N Fl G 3s 11 2 White round tower, fl 1


TR, , 10637·5 28 47·05 E green band
7
* * * * * * * *

NP87, Vol P Edition 2018/19. Weekly Edition No. 49, Dated 06 December 2018.
Last Updates: Weekly Edition No. 48, dated 29 November 2018.

ANPU GANG
P3319·84 - Baoya Shi 21 27·49 N Fl(2)W 5s 9 3 Black # on black
CN, G103, 4876·5 109 48·45 E beacon, red band
* * * * * * * *

P3682·425 - Sanmen Nuclear Power 29 06·41 N Mo(C)Y 12s 9 4 Yellow × on pile In sync
CN, G102, 2627·61 Station. No 1 121 38·90 E 4
* * * * * * * *

P3682·4251 - Sanmen Nuclear Power 29 06·51 N Mo(C)Y 12s 9 4 Yellow × on pile In sync
CN, G102, 2627·62 Station. No 2 121 38·90 E 4
* * * * * * * *

P3682·4252 - Sanmen Nuclear Power 29 06·61 N Mo(C)Y 12s 9 4 Yellow × on pile In sync
CN, G102, 2627·63 Station. No 3 121 38·84 E 4
* * * * * * * *

P3682·4253 - Sanmen Nuclear Power 29 06·66 N Mo(C)Y 12s 9 4 Yellow × on pile In sync
CN, G102, 2627·64 Station. No 4 121 38·77 E 4
* * * * * * * *

P3682·4254 - Sanmen Nuclear Power 29 06·67 N Mo(C)Y 12s 9 4 Yellow × on pile In sync
CN, G102, 2627·65 Station. No 5 121 38·73 E 4
* * * * * * * *

P3682·4255 - Sanmen Nuclear Power 29 06·63 N Mo(C)Y 12s 9 4 Yellow × on pile In sync
CN, G102, 2627·66 Station. No 6 121 38·65 E 4
* * * * * * * *

P3797·751 - Binhai Beiqu Wind Farm. 34 31·46 N Mo(C)Y 12s 12 5 Yellow × on yellow
CN, G102, 2054·2 No H10 120 28·46 E pile
1
--- .. AIS .. .. .. MMSI No 999412182
* * * * * * * *

5.11 Wk49/18
V

NP87, Vol P Edition 2018/19 continued.

P3797·752 - Binhai Beiqu Wind Farm. 34 27·19 N Mo(C)Y 12s 12 5 Yellow × on yellow
CN, G102, 2054·24 No H14 120 22·20 E pile
1
--- .. AIS .. .. .. MMSI No 999412183
* * * * * * * *

P3797·753 - Binhai Beiqu Wind Farm. 34 30·64 N Mo(C)Y 12s 12 5 Yellow × on yellow Other identical lights mark the wind
CN, G102, 2054·28 No H18 120 15·13 E pile farm limits
1
--- .. AIS .. .. .. MMSI No 999412184
* * * * * * * *

P3906·238 - Laizhou Wan Offshore 37 21·39 N Mo(U)W 15s 19 8 .. 3 Identical light beacons mark the
CN, G101, 1433·3 Wind Tower Warning. No 4 119 29·62 E wind tower
--- .. Racon .. .. .. ALRS Vol 2 Station 82191.55
* * * * * * * *

BOHAI WAN
P3906·406 Remove from list; deleted

5.12 Wk49/18
VI

UPDATES TO ADMIRALTY LIST OF RADIO SIGNALS


Weekly Edition No. 49 dated 06 December 2018

The ADMIRALTY List of Radio Signals diagrams included in the paper version of the weekly Notice to Mariners (Section
VI) are printed in black and white. If required, a colour version of these diagrams can be downloaded from
www.admiralty.co.uk/maritime-safety-information. To obtain the colour versions select View and download NMs – select
Weekly – select Year – select Week – go to Selected Week Content – select File (for example:
NP286(3)–WK01–14–PAGE149_Week01_2018.pdf)

VOLUME 1, NP281(1), 2018/19


Published Wk 44/18
(Last Updates: Weekly Edition No. 44 dated 01 November 2018)

POLLUTION REPORTING

PAGE 199, PORTUGAL.


POLLUTION REPORTING.
Delete section and replace by:

POLLUTION REPORTING
COORDINATION CONTACT POINT: Maritime Rescue Cordination Centre
Telephone: +351 210 984450 Fax: +351 214 401954
Mobile: +351 912 000322 (Mobile)
Email: comar.dir@marinha.pt

NATIONAL COMPETENT AUTHORITY: Direção-Geral da Autoridade Maritima/Direção de combate à Poluição do Mar


Telephone: +351 210 984050 Fax: +351 213 424137
Email: dgam.poluicao@amn.pt
Website: www.amn.pt/dcpm

OPERATIONAL CONTACT POINT (24 Hours/7 Days): Direção-Geral da Autoridade Maritima/Direção de combate à Poluição do Mar
Telephone: +351 917 592700 Fax: +351 211 938459
Email: dgam.poluicao@amn.pt
Website: www.amn.pt/dcpm

PROCEDURE:
The Master or other person having charge of any ship involved in an incident is required to report the details of the incident and, if requested, submit a written
MARPOL pollution report. If this cannot be done, the owner, charterer, manager, or operator of the vessel, or their agent is responsible for reporting the incident. The
report should be made to the LOCAL OPERATIONAL CONTACT POINT, or other POC if the first cannot be reached.

The report should include the following:


1 Port.
2 Date and time.
3 Position (coordinates).
4 Pollution source identification.
5 Type of incident/accident that caused the spill.
6 Substance spilled.
7 Estimated quantity.
8 Substance characteristics (viscosity).
9 Type of spill.
10 Wind (Beaufort Scale).
11 Wave and Swell (Douglas Sea Scale).
12 Rain.
13 Source of information (people identification).
14 Observations of the spot.
15 Samples collected.
16 Other relevant information (assistance and salvage measures).

Remarks: For further details on radio communication - see Maritime Radio Stations section.

MRSC Funchal correspondence (RSDRA2018000285132) 49/18

Wk49/18
6.1
6.1
VI
VI

MARITIME RADIO STATIONS

PAGE 227, SPAIN (Mediterranean Coast).


MALAGA.
Delete entry

Spanish Radioseñales 2017 edition (RSDRA2017000192767) 49/18

VOLUME 2, NP282(1), 2018/19


Published Wk 13/18
(Last Updates: Weekly Edition No. 47 dated 22 November 2018)

AUTOMATIC IDENTIFICATION SYSTEM (AIS)

PAGE 84, FRANCE (Atlantic Coast), below Le Grand Charpentier Lt.


Insert:

Les Grands Cardinaux Lt 47°19′·27N 2°50′·10W 992271025 Real 21

French Bulletin 41/18 (RSDRA2018000249739) 49/18

VOLUME 2, NP282(2), 2018/19


Published Wk 13/18
(Last Updates: Weekly Edition No. 48 dated 29 November 2018)

AUTOMATIC IDENTIFICATION SYSTEM (AIS)

PAGE 94, ARGENTINA, below Rio de la Plata 4.


Insert:

Rio de la Plata Green Lt Bn KM 8.0 34°47′·80S 57°51′·50W 997011027 Real

(former update 35/18)


Argentine Hydrographic Office correspondence (RSDRA2018000287014) 49/18

PAGE 94, ARGENTINA, below Río de la Plata Lt Buoy Km 213.


Insert:

Rio de la Plata Red Lt Bn KM 8.0 34°47′·75S 57°51′·66W 997011028 Real

Argentine Hydrographic Office correspondence (RSDRA2018000287014) 49/18

PAGE 94, AUSTRALIA.


Broome Entrance Point Lt Buoy.
Delete entry

Australian Notice 23/1019/18 (RSDRA2018000286156) 49/18

PAGE 94, AUSTRALIA.


Channel Rock Lt Bn.
Delete entry

Australian Notice 23/1019/18 (RSDRA2018000286156) 49/18

PAGE 128, CHINA, below QZ Ding Xianzhizhong Lt Buoy No 8.


Insert:

QZ Dingxian Zhi Zhong Lt Buoy No


20°12′·74N 110°14′·70E 994131787 Broadcasts every 3 minutes Real
7

(former update 39/18)


Chinese Notice 45/1978/18 (RSDRA2018000280521) 49/18

Wk49/18
6.2
6.2
VI
VI

PAGE 128, CHINA, below QZ Dingxian Zhijing Lt Buoy No 1.


Insert:

QZ Dingxian Zhijing Lt Buoy No 3 20°09′·24N 110°06′·26E 994131786 Broadcasts every 3 minutes Real

QZ Hai Xia Si Bu Lt Buoy No 23 20°06′·58N 109°48′·50E 994131789 Broadcasts every 3 minutes Real

(former update 20/18)


Chinese Notice 45/1978/18 (RSDRA2018000280521) 49/18

PAGE 134, CHINA, below Wangpan Yang Lt Buoy K106.


Insert:

Wantong 158 Wreck 23°18′·09N 117°07′·21E 994136763 Broadcasts every 3 minutes Virtual

Chinese Notice 45/1973/18 (RSDRA2018000280521) 49/18

PAGE 150, KOREA, SOUTH, below Busan New Port Entrance Lt Buoy.
Insert:

Busan New Port Lt Bn A 35°04′·06N 128°47′·38E 994401632 Broadcasts every 3 minutes Real

Korean Notice 44/935/18 (RSDRA2018000274783) 49/18

PAGE 182, UNITED STATES (Atlantic Coast).


Delaware River Channel Wreck WR62 Lt Buoy.
Delete entry

(former update 46/18)


NOAA Bulletin 13/11/18 (RSDRA2018000283548) 49/18

VOLUME 3, NP283(1), 2018/19


Published Wk 49/18
First updates in Wk 49/18
The 2017/18 edition is cancelled

RECORD OF UPDATES

PAGE ii, NEW EDITION, First Updates.


Insert:

This edition was published in Wk 49/18


First updates issued in Wk 49/18

UKHO 49/18

RADIO WEATHER SERVICES AND NAVIGATIONAL WARNINGS

PAGE 72, CANARIAS, ISLAS (Spain).


LAS PALMAS.
Delete entry and replace by:

LAS PALMAS
Control Centre: 28°09′·44N 15°24′·85W
Arrecife (Lanzarote MF)
A 1644 RT (MF) Puerto del Rosario 28°32′·62N 13°52′·68W
Las Palmas (Gran Canaria MF)
A 1689 RT (MF) Las Mesas 28°28′·97N 16°16′·17W
Tarifa (Southern Spain MF)
B 1656 RT (MF) Huelva 37°12′·42N 7°01′·20W
Continued on next page

6.3
6.3 Wk49/18
VI
VI

CANARIAS, ISLAS (Spain)


LAS PALMAS (Continued)
Fuerteventura
C Ch 22 VHF Fuerteventura (Gran Montaña) 28°24′·41N 14°02′·68W
Gomera
C Ch 24 VHF Gomera 28°04′·98N 17°07′·10W
Gran Canaria
C Ch 26 VHF Las Palma 27°57′·52N 15°33′·49W
Hierro
Ch 23 Hierro (Tiñor) 27°47′·65N 17°56′·17W
C VHF
Ch 02 La Restinga 27°38′·62N 17°58′·75W
La Palma
Ch 60 Garafía 28°49′·15N 17°55′·28W
C VHF
Ch 20 La Palma 28°38′·89N 17°49′·55W
Lanzarote
Ch 25 Orzola 29°13′·01N 13°28′·70W
C VHF
Ch 03 Yaiza 28°55′·12N 13°47′·04W
Tenerife
C Ch 27 VHF Tenerife (Igueque) 28°18′·40N 16°30′·15W
Tarifa (Southern Spain)
Ch 26 Málaga 36°29′·22N 5°12′·38W
D
Ch 81 Motril 36°49′·02N 3°24′·36W
Ch 28 VHF Cádiz 36°38′·18N 6°09′·09W
E Ch 26 Huelva 37°12′·42N 7°01′·20W
Ch 83 Tarifa 36°07′·52N 5°45′·80W
Diagrams pages 71, 194, 195, 196 and 197
Weather Bulletins
A: 1040 1603 2233 Storm warnings, general synopsis and forecasts for Atlantic sea areas south of 35°N.
B: 0903 1503 2303 Storm warnings, general synopsis and forecasts for Atlantic sea areas north of 30°N, as well as Mediterranean sea areas Alboran
and Palos.
C: 0340 1340 1903 Weather bulletins for coastal areas of the Canary Islands.
D: 0200 1115 1633 Weather bulletins for coastal areas of the western Mediterranean.
E: 0200 1115 1633 Weather bulletins for coastal areas of south-western Spain.
Navigational Warnings
A: 0633 2110 Navigational Warnings for Atlantic sea areas south of 35°N, including coastal areas of the Canary Islands.
B: 0840 2003 Navigational Warnings for sea area Cabo Trafalgar to 4°W.
C: 0340 1903 Navigational Warnings for coastal areas of the Canary Islands.
D: 0200 1633 Navigational Warnings for coastal areas of the western Mediterranean.
E: 0200 1633 Navigational Warnings for coastal areas of south-western Spain.

DGMM correspondence (RSDRA2018000251425) 49/18

PAGE 76, CROATIA.


DUBROVNIK, Navigational Warnings table, row 2.
Delete row and replace by:

On receipt then 0320 0820


Current weather warnings in Croatian and English.
1520

Plovput correspondence (RSDRA2018000277325) 49/18

PAGE 76, CROATIA.


RIJEKA, Navigational Warnings table, row 2.
Delete row and replace by:

On receipt then 0230 0730


Current weather warnings in Croatian and English.
1430

Plovput correspondence (RSDRA2018000277325) 49/18

Wk49/18 6.4
6.4
VI
VI

PAGE 76, CROATIA.


SPLIT, Navigational Warnings table, row 2.
Delete row and replace by:

On receipt then 0300 0800


Current weather warnings in Croatian and English.
1500

Plovput correspondence (RSDRA2018000277325) 49/18

PAGE 182, ROMANIA.


CONSTANŢA.
Delete entry and replace by:

CONSTANŢA (YQI)
Control Centre: 44°06′·18N 28°37′·49E
A 2748 RT (MF) Constanţa Radio
44°06′·18N 28°37′·49E
Agigea
Enisala 44°51′·64N 28°50′·64E
Mahmudia 45°05′·25N 29°04′·23E
B Ch 12 24 25 VHF
Sfintu Gheorghe 44°53′·95N 29°36′·18E
Sulina 45°08′·88N 29°45′·55E
Tuzla 43°59′·45N 28°39′·98E
Weather Bulletins
A: 0733 1333 1933
24 hour weather forecast for Western Black Sea in Romanian and English.
B: 0703 1303 1903
Navigational Warnings
A: On receipt then 0733
1033 1333 1633 1933
Gale and Navigational Warnings in English.
B: On receipt then 0703
1003 1303 1603 1903
NOTE(S): After prior announcement on 2187·5 kHz DSC and VHF Ch 70 DSC.

Romanian Hydrographic Office correspondence (RSDRA2018000272624) 49/18

PAGE 203, SWEDEN, FIRING PRACTICE AREAS, diagram, SWEDEN, NORTHERN BALTIC SEA, FIRING PRACTICE
AREAS.
Delete diagram.

Swedish Bulletin 724/18 (RSDRA2018000253694) 49/18

PAGE 204, SWEDEN, FIRING PRACTICE AREAS, diagram, SWEDEN, SOUTHERN BALTIC SEA, FIRING PRACTICE
AREAS.
Delete diagram.

Swedish Bulletin 724/18 (RSDRA2018000253694) 49/18

ICE REPORTS

PAGE 307, NETHERLANDS, Rijkswaterstaat contact details.


Delete and replace by:

Rijkswaterstaat
Tel: +31 88 7985000
Fax: +31 88 7985005
e-mail: wmcn-waterkamer@rws.nl
Website: www.vaarweginformatie.nl

Rijkswaterstaat correspondence (RSDRA2018000267882) 49/18

6.5
6.5 Wk49/18
VI
VI

VOLUME 5, NP285, 2018/19


Published Wk 29/18
(Last Updates: Weekly Edition No. 48 dated 29 November 2018)

VHF DSC, LIST OF COAST STATIONS FOR SEA AREA A1

PAGES 133 and 134, NAVAREA III, SPAIN (Mediterranean Coast).


MALAGA.
Delete entry

Spanish Radioseñales 2017 edition (RSDRA2017000192767) 49/18

MF DSC, LIST OF COAST STATIONS FOR SEA AREA A2

PAGE 156, NAVAREA III, SPAIN (Mediterranean Coast).


MALAGA.
Delete entry

Spanish Radioseñales 2017 edition (RSDRA2017000192767) 49/18

Wk49/18 6.6
6.6
VI
VI

VOLUME 6, PART 1, NP 286(1), 2018/19 (a) ETA at Lt buoy DI


(b) LOA
Published Wk 17/18 (c) Draught
–––––––––––––––––– (d) Pilot requested or not (vessels less than 50m LOA)
(2) Vessels should contact the Hr Mr on VHF Ch 12 on arrival in Dieppe Roads. A
(Last Updates: Weekly Edition No. 45 dated 8 November 2018) continuous listening watch should be maintained on VHF until berthed.
PAGES 65 & 66, FRANCE (Atlantic and English Channel Coasts),
SHOM Radiosignaux 93.1 Ed. 2018, (RSDRA2018000280314), 49/18
DIEPPE.
Delete entry and replace by:
––––––––––––––––––––––––––––––
DIEPPE 49°56′N 1°05′E
UNCTAD LOCODE: FR DPE VOLUME 6, PART 4, NP 286(4), 2018/19

Pilots Published Wk 37/18

AREA: ––––––––––––––––––
The compulsory pilotage area extends to 4 n miles off the port entrance. (Last Updates: Weekly Edition No. 48 dated 29 November 2018)
NOTE: PAGE 243, MALAYSIA, KUANTAN, Pilots, PROCEDURE, section (2).
Pilotage is provided by LA SEINE. Delete and replace by:
CONTACT DETAILS:
(2) Pilot boards in the following positions:
Rouen Office (a) 3°55′·95N 103°33′·05E
Call: Pilote Dieppe (b) 3°56′·30N 103°28′·65E (3 n miles SE of Tanjong Gelang Lt)
VHF Channel: Ch 12 (c) Bad weather: Small vessels may be boarded inside the harbour
Telephone: +33(0)2 32102401
Fax: +33(0)2 32102409 Malaysian Notice 10/230/18, (RSDRA2018000281890), 49/18
E-mail: piloterouen@pilote-seine.fr
Website: www.pilote-seine.fr ––––––––––––––––––––––––––––––
HOURS: 2h before to 1h after HW (When a vessel is expected)
PROCEDURE:
(1) Pilotage is compulsory for the following:
(a) All vessels carrying hydrocarbons or dangerous substances
(b) Other vessels of 50m LOA or over
(2) Pilotage is not compulsory for vessels under 50m LOA and not transporting
dangerous substances provided they are equipped with VHF.
(3) Notice of ETA: Vessels must send ETA to the Rouen Pilot Office at least 24h
before arrival and at least 5h before arrival in Dieppe Roads stating:
(a) ETA at Dieppe Roads
(b) Draught
(c) Ability to manoeuvre (in particular the operating state of the thruster)
(4) Vessels should contact the Pilot Station at least 3h before ETA stating any delay
over 2h or inability to make the tide.
(5) On departure, vessels must request a Pilot from the Rouen Pilot Office by telex or
fax after obtaining permission from the port 3h in advance (before 1800 LT for intended
departure between 2100 LT and 0600 LT the next day).
(6) Pilot boards in position 49°57′·24N 1°01′·03E (or between 1 to 2 n miles from the
jetties).
Port
CONTACT DETAILS:
Hr Mr
Call: Dieppe Port
VHF Channel: Ch 12
Telephone: +33(0)2 35841055
Fax: +33(0)2 35061256
E-mail: ddtm-dml-capd@seine-maritime.gouv.fr
ddtm-capdieppe-vigie@seine-maritime.gouv.fr (H24)
Website: www.portdedieppe.fr
HOURS: H24
PROCEDURE:
(1) Notice of ETA: Vessels should contact the Hr Mr 24h before arrival at Lt buoy DI
(49°57′·06N 1°01′·23E) stating:

continued on next column

1
Wk49/18
6.7
VII

UPDATES TO MISCELLANEOUS ADMIRALTY NAUTICAL PUBLICATIONS

There are no updates to miscellaneous Nautical Publications this week

7.1
Wk49/18
VIII

ADMIRALTY DIGITAL SERVICES

1. ENC / ECDIS and AVCS

a) Safety Notice

For a graphical way to establish that the ECDIS is correctly displaying the new symbols introduced in IHO S-52 Presentation Library
Edition 4.0 the mariner can check ECDIS Chart 1. ECDIS Chart 1 is a legend of the entire set of symbols that may be used within an
ENC and is installed on all type-approved ECDIS systems. See iho.int for further information.

ECDIS operating with Edition 3.4 of the IHO Presentation Library


From 1st September 2017, ECDIS Systems are required to use Presentation Library edition 4.0. Vessels using previous editions must
upgrade as soon as possible to maintain compliance. The IHO Check Dataset is not required for Presentation Library 4.0.

b) ENCs temporarily withdrawn from AVCS


To review a cumulative list of ENCs temporarily withdrawn from AVCS, please visit the ‘Updates’ tab on:
admiralty.co.uk/AVCS

C1615372 Boshashanjiao Maodi Pinghai Wan. The issue that caused this ENC to be withdrawn has now been resolved and it was made
available to purchase again in AVCS from week 41/2018

EA200001 and EA200002 South China Sea. Withdrawn in week 23/2017 as instructed by ENC producer authority due to numerous
pending updates. New Editions will be released at the earliest opportunity, but no timescale has been provided. Full chart coverage of
the area is available from other ENCs in AVCS and ADMIRALTY paper charts.

c) ENC Readme.txt file


The README.TXT file located within the ENC_ROOT folder on the latest AVCS discs contains important safety related information
relating to the use of ENCs in ECDIS. The file is also available on the support tab at admiralty.co.uk/avcs.

This file is updated on a regular basis and should be consulted to ensure that all related issues are taken into consideration.

d) Temporary & Preliminary Notices to Mariners (T&P NMs) in ENCs

The use of T&P NM information is considered an essential part of keeping navigational charts up to date.

The latest confirmed status of T&P NM information in the ENCs that are available in ADMIRALTY services is shown in the ENC-
T&P-NM-Status.pdf file in the INFO folder on the service media and at: admiralty.co.uk/ENC-TP-NMs

Important changes to ADMIRALTY Information Overlay (AIO)

From week 35/2018 (30th August), AIO only shows ADMIRALTY paper T&Ps where they are not already included in the ENCs.

Most countries now include temporary information in their ENCs

The new content is available when the AIO disc is loaded into ECDIS in the normal way. Further guidance can be found in the INFO
folder on AIO discs.

2. ADMIRALTY Products Supporting Digital Navigation


i. ADMIRALTY ENC and ECDIS Maintenance Record (NP133C). This publication is designed to hold paper records on ENC
and ECDIS maintenance to assist information management and support inspections. Please note that V2.0 is the current
edition.

ii. ADMIRALTY Guide to ENC Symbols Used in ECDIS (NP5012). A companion to the ADMIRALTY Guide to Symbols and
Abbreviations Used on Paper Charts, NP5011. The 2nd edition of NP5012 includes the changes highlighted in the new S-52
standards and the new presentation library 4.0.

iii. ADMIRALTY Guide to the Practical Use of ENCs (NP231). Supports ECDIS training on the interpretation and use of ENC
data.

8.1
Wk 49/18
VIII

iv. ADMIRALTY Guide to ECDIS Implementation, Policy and Procedures (NP232). Provides clear guidance for any individual
or organisation responsible for the introduction of ECDIS, in particular those involved in the development of detailed ECDIS
operating procedures.

v. ADMIRALTY Port Approach Guides. Information from a range of official ADMIRALTY charts and publications on one
chart, helping bridge crews to plan for particular approaches and to support Master Pilot Exchange. Expanding coverage of
some of the world's most complex approaches, including Antwerp, Rotterdam and the Panama Canal. More information is
available at admiralty.co.uk/port-approach-guides

3. ADMIRALTY Digital Publications (ADP)


ADP V19 will be released on 10 December 2018 and will be available on the ADP Weekly Update DVD from Week 50 onward.

From 1 January 2019 the UKHO will only support ADP V18 and V19. Users of older versions of ADP should upgrade to a
supported version of ADP before this date as ADMIRALTY Total Tide is no longer updated annually. ADP V18 and V19 allow
users to receive tidal updates as they are made available each week.

ADMIRALTY TotalTide (ATT): German Tidal Stations predicted on LAT


The TotalTide application computes predictions for all German tidal stations based on Lowest Astronomical Tide (LAT).
Mariners using charts which refer to Mean Low Water Springs (MLWS) in German waters, must deduct 0.5m from all predicted tidal
heights for these ports before applying them to the depths on those charts to determine the correct predicted depth of water. This advice
will also be contained in the ‘Notes’ tab on the Prediction Windows in TotalTide for each German tidal station.
For information: Ensure that Activation Key Requests and Update Data Requests for ADP are sent to ADPMailGateway@ukho.gov.uk

4. Status of ADMIRALTY Digital Services

Update status table

Product Last issue date/Week Reissue Date/Week


i. ADMIRALTY Vector Chart Service (AVCS) Base CD 6 December 2018 - 49 31 January 2019 - 05
ii. ADMIRALTY Information Overlay (AIO) CD which contains
22 November 2018 - 47
both the base data and the latest updates
iii. ADMIRALTY Raster Chart Service (ARCS) Regional disc 1 19 July 2018 - 29 07 February 2019 - 06
ADMIRALTY Raster Chart Service (ARCS) Regional disc 2 24 May 2018 - 21 24 January 2019 - 04
ADMIRALTY Raster Chart Service (ARCS) Regional disc 3 27 September 2018- 39
ADMIRALTY Raster Chart Service (ARCS) Regional disc 4 28 June 2018 - 26
ADMIRALTY Raster Chart Service (ARCS) Regional disc 5 29 November 2018 - 48
ADMIRALTY Raster Chart Service (ARCS) Regional disc 6 2 August 2018 - 31 21 February 2019 - 08
ADMIRALTY Raster Chart Service (ARCS) Regional disc 7 18 October 2018 - 42
ADMIRALTY Raster Chart Service (ARCS) Regional disc 8 06 September 2018 - 36
ADMIRALTY Raster Chart Service (ARCS) Regional disc 9 10 May 2018 - 19 13 December 2018 - 50
ADMIRALTY Raster Chart Service (ARCS) Regional disc 10 1 November 2018 - 44
23 August 2018 – 34
ADMIRALTY Raster Chart Service (ARCS) Regional disc 11 Small-scale Planning
Charts

ADMIRALTY Vector Chart Service (AVCS) DVDs and ADMIRALTY Information Overlay (AIO) CDs are issued
weekly and contain all base and update data available at the time of issue.

8.2
Wk 49/18
VIII

5. Supported ADMIRALTY Software Versions

Product Supported Versions


ADP 17, 18
ADMIRALTY e-Reader 1.3
ADMIRALTY Planning Station 3.4
ADMIRALTY gateway 4.2, 4.4
NavPac and Compact Data 3.4, 4.0

If you are using an older version which is not supported, you should contact your Chart Agent to upgrade to the latest
version as soon as possible.

8.3
Wk 49/18
HYDROGRAPHIC NOTE FOR PORT
H.102A
INFORMATION (V7.0 Jan 2013)
(To accompany Form H.102)

Reporting Port Information affecting ADMIRALTY Products

NAME OF PORT

APPROXIMATE POSITION Latitude Longitude

GENERAL REMARKS
Principal activities and trade.
Latest population figures and date.

Number of ships or tonnage handled per


year.

Maximum size of vessel handled.

Copy of Port Handbook (if available).

ANCHORAGES
Designation, depths, holding ground,
shelter afforded.

PILOTAGE
Authority for requests.

Embark position.

Regulations.

DIRECTIONS
Entry and berthing information.

Tidal streams.

Navigational aids.

TUGS
Number available.

WHARVES
Names, numbers or positions & lengths.

Depths alongside.

CARGO HANDLING
Containers, lighters, Ro-Ro etc.

REPAIRS
Hull, machinery and underwater.

Shipyards.

Docking or slipping facilities.


(Give size of vessels handled or
dimensions)

Divers.
HYDROGRAPHIC NOTE FOR PORT
H.102A
INFORMATION (V7.0 Jan 2013)
(To accompany Form H.102)

RESCUE AND DISTRESS


Salvage, Lifeboat, Coastguard, etc.

SUPPLIES
Fuel.
(with type, quantities and methods of
delivery)

Fresh water.
(with method of delivery and rate of
supply)

Provisions.

SERVICES
Medical.

Ship Sanitation.

Garbage and slops.

Ship chandlery, tank cleaning, compass


adjustment, hull painting.

COMMUNICATIONS
Nearest airport or airfield.

Port radio and information service. (with


frequencies and hours of operating)

PORT AUTHORITY
Designation, address, telephone, e-mail
address and website.

VIEWS
Photographs (where permitted) of the
approaches, leading marks, the entrance
to the harbour etc.

ADDITIONAL DETAILS

NOTES:

1. Form H.I02A lists the information required for ADMIRALTY Sailing Directions and has been designed to help the
sender and the recipient. The sections should be used as an aide-memoir, being used or followed closely,
whenever appropriate. Where there is insufficient space on the form an additional sheet should be used.

2. Reports which cannot be confirmed or are lacking in certain details should not be withheld. Shortcomings
should be stressed and any firm expectation of being able to check the information on a succeeding voyage should
be mentioned.
HYDROGRAPHIC NOTE FOR
GNSS OBSERVATIONS AGAINST CORRESPONDING BRITISH ADMIRALTY H.102B
(V7.0 Jan 2014)
CHART POSITIONS
(To accompany Form H.102)

Chart/ENC in use
(SEE NOTE 3a) Latitude/Longitude of position read Latitude/Longitude of position read from Additional
Time/Date of
Edition Date & from Chart/ECDIS GNSS Receiver (on WGS84) Information/Remarks
Observation Number /
NM / ENC (SEE NOTE 3b) (SEE NOTE 3c) (SEE NOTE 3d)
ENC
update status
HYDROGRAPHIC NOTE FOR
GNSS OBSERVATIONS AGAINST CORRESPONDING BRITISH ADMIRALTY H.102B
(V7.0 Jan 2014)
CHART POSITIONS
(To accompany Form H.102)

NOTES:
1. This form is designed to assist in the reporting of observed differences between WGS84 datum and the geodetic datum of British
ADMIRALTY Charts by mariners, including yachtsmen and should be submitted as an accompaniment to Form H.102 (full instructions
for the rendering of data are on Form H.102). Where there is insufficient space on the form an additional sheet should be used.

2. Objective of GNSS Data Collection

The UK Hydrographic Office would appreciate the reporting of Global Navigation Satellite Systems (GNSS) positions, referenced to WGS84 datum, at
identifiable locations or features on British ADMIRALTY Charts. Such observations could be used to calculate positional shifts between WGS84 datum and the
geodetic datum for those British ADMIRALTY Charts which it has not yet been possible to compute the appropriate shifts. These would be incorporated in future
new editions or new charts and promulgated by Preliminary Notices to Mariners in the interim.

It is unrealistic to expect that a series of reported WGS84 positions relating to a given chart will enable it to be referenced to that datum with the accuracy
required for geodetic purposes. Nevertheless, this provides adequate accuracy for general navigation, considering the practical limits to the precision of 0.2mm
(probably the best possible under ideal conditions – vessel alongside, good light, sharp dividers etc), this represents 10 metres on the ground at a chart scale of
1:50.000.

It is clear that users prefer to have some indication of the magnitude and direction of the positional shift, together with an assessment of its likely accuracy,
rather than be informed that a definitive answer cannot be formulated. Consequently, where a WGS84 version has not yet been produced, many charts now
carry approximate shifts relating WGS84 datum to the geodetic datum of the chart. Further observations may enable these values to be refined with greater
confidence.

3. Details required

a. It is essential that the chart number, edition date and its correctional state (latest NM) are stated. For ENCs, please state the ENC name and latest
update applied.

b. Position (to 2 decimal places of a minute) of observation point, using chart graticule or, if ungraduated, relative position by bearing/distance from
prominent charted features (navigation lights, trig. points, church spires etc.).

c. Position (to 2 decimal places of a minute) of observation point, using GNSS Receiver. Confirm that GNSS positions are referenced to WGS84 datum.

d. Include GNSS receiver model and aerial type (if known). Also of interest: values of PDOP, HDOP or GDOP displayed (indications of theoretical
quality of position fixing depending upon the distribution of satellites overhead) and any other comments.
HYDROGRAPHIC NOTE – H.102 INSTRUCTIONS (V9.0 Dec 2017)
1. Mariners are requested to notify the United Kingdom Hydrographic Office (UKHO) when new or suspected dangers to
navigation are discovered, changes observed in aids to navigation, or corrections to publications are seen to be necessary.
Mariners can also report any ENC display issues experienced. The Mariner's Handbook (NP100) Chapter 4 gives general
instructions. The provisions of international and national laws should be complied with when forwarding such reports.
2. Accurate position or knowledge of positional error is of great importance. Where latitude and longitude have been used to
specifically position the details of a report, a full description of the method used to obtain the position should be given. Where
possible the position should be fixed by GPS or Astronomical Observations. A full description of the method, equipment,
time, estimated error and datum (where applicable) used should be given. Where the position has been recorded from a
smart phone or tablet, this is to be specifically mentioned. When position is defined by sextant angles or bearings (true or
magnetic to be specified), more than two should be used to provide a redundancy check. Where position is derived from
Electronic Position Fixing (e.g. LORAN C) or distances observed by radar, the raw readings of the system in use should be
quoted wherever possible. Where position is derived after the event, from other observations and / or Dead Reckoning, the
methodology of deriving the position should be included.
3. Paper Charts: A cutting from the largest scale chart is often the best medium for forwarding details, the alterations and
additions being shown thereon in red. When requested, a new copy will be sent in replacement of a chart that has been
used to forward information, or when extensive observations have involved defacement of the observer's chart. If it is
preferred to show the amendments on a tracing of the largest scale chart (rather than on the chart itself) these should be in
red as above, but adequate details from the chart must be traced in black ink to enable the amendments to be fitted correctly.
4. ENCs: A screen shot of the largest scale usage band ENC with the alterations and additions being shown thereon in red.
If it is to report an issue with the display of an ENC, a screen shot of the affected ENC should be sent along with details of
the ECDIS make, model or age and version in use at the time.
5. When soundings are obtained The Mariner's Handbook (NP100) should where possible be consulted. It is important to
ensure that full details of the method of collection are included with the report. This should include but not limited to:
(a) Make, model and type of echo sounder used.
(b) Whether the echo sounder is set to register depths below the surface or below the keel; in the latter case the vessel's
draught should be given.
(c) Time, date and time zone should be given in order that corrections for the height of the tide may be made where
necessary, or a statement made as to what corrections for tide have already been made.
(d) Where larger amounts of bathymetric data have been gathered, only those areas where a significant difference to
the current chart or ENC should be specifically mentioned on the H102. The full data set may also be sent in, with
an additional note added to this effect. If no significant differences are noted, the bathymetric data may still be of
use, and sent in accordingly. Where full data sets are included, a note as to the data owner and their willingness for
the data to be incorporated into charts and ENCs included.
6. For Echo Sounders that use electronic ‘range gating’, care should be taken that the correct range scale and
appropriate gate width are in use. Older electro-mechanical echo sounders frequently record signals from echoes
received back after one or more rotations of the stylus have been completed. Thus, with a set whose maximum range is
500m, an echo recorded at 50m may be from depths of 50m, 550m or even 1050m. Soundings recorded beyond the set's
nominal range can usually be recognised by the following:
(a) the trace being weaker than normal for the depth recorded;
(b) the trace passing through the transmission line;
(c) the feathery nature of the trace.
As a check that apparently shoal soundings are not due to echoes received beyond the set's nominal range,
soundings should be continued until reasonable agreement with charted soundings is reached. However,
soundings received after one or more rotations of the stylus can still be useful and should be submitted if they
show significant differences from charted depths.
7. Reports which cannot be confirmed or are lacking in certain details should not be withheld. Shortcomings should
be stressed and any firm expectation of being able to check the information on a succeeding voyage should be mentioned.
8. Reports of shoal soundings, uncharted dangers and aids to navigation out of order should, at the mariner's discretion, also
be made by radio to the nearest coast radio station. The draught of modern tankers is such that any uncharted depth under
30 metres or 15 fathoms may be of sufficient importance to justify a radio message.
9. Changes to Port Information should be forwarded on Form H.102A and any GPS/Chart Datum observations should be
forwarded on Form H.102B together with Form H.102. Where there is insufficient space on the forms additional sheets
should be used.
10. Reports on ocean currents, magnetic variations and other marine observations should be made in accordance with
The Mariner's Handbook (NP100) Chapter 4 with forms also available at admiralty.co.uk/MSI.
Note. - An acknowledgement or receipt will be sent and the information then used to the best advantage which may mean
immediate action or inclusion in a revision in due course; for these purposes, the UKHO may make reproductions of any
material supplied. When a Notice to Mariners is issued, the sender's ship or name is quoted as authority unless (as
sometimes happens) the information is also received from other authorities or the sender states that they do not want to
be named by using the appropriate tick box on the form. An explanation of the use made of contributions from all parts of
the world would be too great a task and a further communication should only be expected when the information is of
outstanding value or has unusual features.
Hydrographic Note – H.102
Reporting information affecting ADMIRALTY Maritime Products & Services

For emergency information affecting safety of life at sea forward to: navwarnings@btconnect.com
Or alternatively contact T: +44 (0)1823 353448 (direct line) F: +44 (0)1823 322352
For new information affecting all ADMIRALTY Charts and Publications forward to: sdr@ukho.gov.uk
This form H.102 and instructions are available online: admiralty.co.uk/msi

Date Ref. number


Name of ship or sender IMO number
Address and general locality

E-mail / Tel / Fax of sender

Subject

Position
Latitude Longitude
(see Instruction 2)

GPS Datum Accuracy

ADMIRALTY Charts affected Edition

Latest Weekly Edition of


Notices to Mariners (NMs) held
Replacement copy of chart number IS / IS NOT required
(see Instruction 3)
ENCs affected

Latest update disk applied Week:

Make, model and or age of ECDIS if


applicable
Publications affected
(e-NP / DP number, edition number)
Date of latest supplement/update,
page & Light List number etc.
Details of anomaly / observation:

Name of observer / reporter

H.102A submitted Yes No H.102B submitted Yes No

Tick box if not willing to be named as source of this information

Alternatively use our H-Note App located here:


admiralty.co.uk/H-note