You are on page 1of 19

SEQUENCE BACTERIORHODOPSIN

AQITGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLSMLLGYGLTMVPFGGEQNPIYWARYADWLFTTPLLLLDLA

NUMBER PEMISAHAN NILAI HIDROPOBICITY RANGE 3 RANGE 5


1 A 1.8 0.9333333333 0.34
2 Q -3.5 0.1 -0.92
3 I 4.5 1.1333333333 -0.54
4 T -0.7 -1.8666666667 -2.14
5 G -0.4 -2.1666666667 -2.18
6 R -4.5 -3.2 -1.2
7 P -1.6 -2 -0.48
8 E -3.5 0.0333333333 0.6
9 W -0.9 0.9 1.66
10 I 4.5 2.4666666667 2.6
11 W -0.9 1.5666666667 1.62
12 L 3.8 3.1333333333 1.66
13 A 1.8 1.7333333333 1.26
14 L 3.8 0.9 1.66
15 G -0.4 0.2333333333 1.28
16 T -0.7 1.6333333333 1.28
17 A 1.8 2.5 2.18
18 L 3.8 1.7666666667 1.74
19 M 1.9 1.7666666667 0.84
20 G -0.4 1 1.22
21 L 3.8 0.9 1.04
22 G -0.4 0.9 0.84
23 T -0.7 0.6 1.68
24 L 3.8 1.7666666667 2.66
25 Y -1.3 1.7666666667 1.12
26 F 2.8 3.6 1.3
27 L 3.8 1.3666666667 1.12
28 V 4.2 -0.0333333333 0.28
29 K -3.9 -0.8 0.28
30 G -0.4 0.3666666667 0.9
31 M 1.9 1.9 0.28
32 G -0.4 1 -0.42
33 V 4.2 -0.0333333333 -1.04

34 S -0.8 -1.9666666667 -1.52


35 D -3.5 -2.8666666667 -2.14
36 P -1.6 -1.1 -2.22
37 D -3.5 -1.8666666667 -1.34
38 A 1.8 -2 -0.9
39 K -3.9 -1.6666666667 -0.9
40 K -3.9 -0.8 0.78
41 F 2.8 1.1 1.42
42 Y -1.3 1.6666666667 0.72
43 A 1.8 1.8666666667 1.74
44 I 4.5 1.0333333333 2.22
45 T -0.7 0.8 1
46 T -0.7 2.4333333333 1.5
47 L 3.8 2.1333333333 2.54
48 V 4.2 1.4666666667 2.14
49 P -1.6 1.5666666667 1.86
50 A 1.8 2.7 2.04
51 I 4.5 3.0333333333 2.06
52 A 1.8 1.3 0.9
53 F 2.8 1.3333333333 1.3
54 T -0.7 -0.0333333333 0.58
55 M 1.9 1.4666666667 1.1
56 Y -1.3 0.5666666667 1.48
57 L 3.8 1.6333333333 2.5
58 S -0.8 1.6333333333 1.66
59 M 1.9 3.1666666667 1.56
60 L 3.8 2.4 1.1
61 L 3.8 0.7 1.1
62 G -0.4 -0.7 0.2
63 Y -1.3 0.7 0.66
64 G -0.4 0.9 1.76
65 L 3.8 1.6666666667 1.52
66 T -0.7 1.8 1.32
67 M 1.9 1.5 1.38
68 V 4.2 1.8 0.92
69 P -1.6 0.2666666667 -0.62
70 F 2.8 0.6666666667 -1
71 G -0.4 -1.4333333333 -2.26
72 G -0.4 -2.4666666667 -2.5
73 E -3.5 -3.5 -1.52
74 Q -3.5 -2.8666666667 -1.08
75 N -3.5 -0.2 -0.56
76 P -1.6 0.5333333333 0.5
77 I 4.5 0.7666666667 -0.08
78 Y -1.3 -0.1333333333 -1.24
79 W -0.9 -1.2 -0.62
80 A 1.8 -1.3333333333 -1.14
81 R -4.5 -1.3333333333 -1.68
82 Y -1.3 -1 -0.02
83 A 1.8 -0.8666666667 0.8
84 D -3.5 -0.2 0.3
85 W -0.9 1.9 0.86
86 L 3.8 1.9666666667 0.72
87 F 2.8 0.4666666667 0.72
88 T -0.7 -1 0.92
89 T -0.7 0.5 1.82
90 P -1.6 2 2.72
91 L 3.8 3.8 2.34
92 L 3.8 3.8 2.34
93 L 3.8 1.3666666667 1.94
94 L 3.8 1.3666666667 1.94
95 D -3.5 0.7 1.94
96 L 3.8 3.1333333333 3.48
97 A 1.8 3.1333333333 2.02
98 L 3.8 3.9333333333 2.02
99 L 3.8 1.5 0.56
100 V 4.2 0.8333333333 -0.9
101 D -3.5 -1.7333333333 -1.82
102 A 1.8 -1.7333333333 -1.26
103 D -3.5 -2.4666666667 -0.72
104 Q -3.5 -1.5333333333 0.74
105 G -0.4 1.1333333333 1.8
106 T -0.7 2.5333333333 2.64
107 I 4.5 3.3666666667 3.62
108 L 3.8 3.1333333333 2.64
109 A 1.8 3.2666666667 2.24
110 L 3.8 2.5333333333 1.18
111 V 4.2 1.8666666667 0.34
112 G -0.4 -0.7 0.4
113 A 1.8 -0.7 0.86
114 D -3.5 0.2 1.4
115 G -0.4 2 2.02
116 I 4.5 3.6333333333 1.96
117 M 1.9 2 0.98
118 I 4.5 1.1333333333 1.36
119 G -0.4 -0.5 1.3
120 T -0.7 0.9 1.3
121 G -0.4 2.5333333333 1.8
122 L 3.8 2.5333333333 2.64
123 V 4.2 1.8666666667 1.74
124 G -0.4 1.7333333333 0.12
125 A 1.8 1.6333333333 1.04
126 L 3.8 -0.2666666667 0.42
127 T -0.7 -0.1333333333 -0.5
128 K -3.9 -0.3333333333 -0.62
129 V 4.2 0.7 -0.74
130 Y -1.3 -1.1333333333 -1.02
131 S -0.8 -2.2 0.08
132 Y -1.3 -1 0.06
133 R -4.5 0.8333333333 0.14
134 F 2.8 2.0333333333 1.4
135 V 4.2 0.8 1.74
136 W -0.9 0 0.74
137 W -0.9 1.8 0.78
138 A 1.8 1.8333333333 1.32
139 I 4.5 1 1.32
140 S -0.8 0.1 0.8
141 T -0.7 0.9666666667 1.72
142 A 1.8 1.8333333333 1.6
143 A 1.8 2.5 2.14
144 M 1.9 1.4666666667 2.54
145 L 3.8 2.3333333333 1.9
146 Y -1.3 2.3333333333 1.98
147 I 4.5 2.3333333333 3
148 L 3.8 2.2333333333 2.66
149 Y -1.3 2.2333333333 2.46
150 V 4.2 3.6 2.64
151 L 3.8 3.1333333333 2.36
152 F 2.8 1.7333333333 1.46
153 F 2.8 1.7333333333 0.74
154 G -0.4 0.5666666667 -0.6
155 F 2.8 0.4333333333 -0.16
156 T -0.7 -1.8 -1.42
157 S -0.8 -0.9666666667 -1.44
158 K -3.9 -1.8666666667 -0.9
159 A 1.8 -0.8333333333 -1.02
160 E -3.5 -0.8 -1.7
161 S -0.8 -1.1333333333 -1.7
162 M 1.9 -1.4 -0.7
163 R -4.5 -3.2 -0.72
164 P -1.6 -0.3 0.02
165 E -3.5 0.8333333333 0.2
166 V 4.2 1.7333333333 1.46
167 A 1.8 0.1 -0.16
168 S -0.8 0.4333333333 0.32
169 T -0.7 -0.6 1.24
170 F 2.8 1.0333333333 0.48
171 K -3.9 1.3666666667 -0.78
172 V 4.2 1.1666666667 0.84
173 L 3.8 -1.4 -0.14
174 R -4.5 -1.2666666667 -0.06
175 N -3.5 0 1.68
176 V 4.2 2.5666666667 3.14
177 T -0.7 2.5666666667 2.12
178 V 4.2 4.0666666667 2.1
179 V 4.2 2.3666666667 1.62
180 L 3.8 0.7 0.52
181 W -0.9 0.0333333333 -0.56
182 S -0.8 -0.1 0.46
183 A 1.8 -0.3666666667 1.46
184 Y -1.3 0.4333333333 0.92
185 P -1.6 2.2666666667 1.94
186 V 4.2 2.5 3.16
187 V 4.2 2.3666666667 2.24
188 W -0.9 2.4666666667 1.24
189 L 3.8 2.6333333333 0.72
190 I 4.5 1.1 -0.12
191 G -0.4 -1.5666666667 -0.66
192 S -0.8 -1.5666666667 -0.66
193 E -3.5 -0.7 0.4
194 G -0.4 0.3333333333 1.94
195 A 1.8 1.9666666667 1.7
196 G -0.4 2.7666666667 2.1
197 I 4.5 2.3666666667 1.48
198 V 4.2 2.1333333333 1.48
199 P -1.6 -0.4333333333 -0.06
200 L 3.8 1.6 0.12
201 N -3.5 -0.8333333333 0.12
202 I 4.5 0.1 1.58
203 E -3.5 -0.1333333333 1.24
204 T -0.7 2.3 2.32
205 L 3.8 3.4666666667 3.3
206 L 3.8 2.8333333333 3.3
207 F 2.8 2.9666666667 1.84
208 M 1.9 3.3 2.12
209 V 4.2 1.5 1.58
210 L 3.8 1.5 1.1
211 D -3.5 -0.0333333333 -0.44
212 V 4.2 1.7333333333 1.1
213 S -0.8 -0.9666666667 0.18
214 A 1.8 0.7 0.9
215 K -3.9 -0.0333333333 0.46
216 V 4.2 2.2 2
217 G -0.4 0.6666666667 2.06
218 F 2.8 2.0666666667 2.9
219 G -0.4 2.6333333333 3.1
220 L 3.8 4.0333333333 2.28
221 I 4.5 4.0333333333 1.36
222 L 3.8 1.0333333333 -0.44
223 L 3.8 -0.5 -0.84
224 R -4.5 -3.2666666667 -0.7
225 S -0.8 -1.1666666667 0.76
226 R -4.5 0.6 0.84
227 A 1.8 3.0333333333 1.04
228 I 4.5 2.3 1.04
229 F 2.8 -0.3666666667 -0.56
230 G -0.4 -0.7 -0.76
231 E -3.5 -1.7333333333 -1
232 A 1.8 0.0333333333 -1
233 E -3.5 -1.1 -1.68
234 A 1.8 -1.1 -1.14
235 P -1.6 -2.2333333333 -1.14
236 E -3.5 -1.9666666667 -0.9
237 P -1.6 -0.2 -0.9
238 S -0.8 0.2 -0.66
239 A 1.8 -0.7 -0.14
240 G -0.4 -1.4333333333 -0.14
241 D -3.5 -0.7 0.3
242 G -0.4 1.0666666667 0.86
243 A 1.8 1.8 0.78
244 A 1.8 0.9666666667 0.525
245 A 1.8 0.1 0.1
246 T -0.7 -0.75 -0.75
247 S -0.8 -0.8 -0.8
MVPFGGEQNPIYWARYADWLFTTPLLLLDLALLVDADQGTILALVGADGIMIGTGLVGALTKVYSYRFVWWAISTAAMLYILYVLFFGFTSKAESMRPEVASTFKVLR

RANGE 19
0.5578947368 NILAI HIDROPOBICITY
0.4421052632 5
0.8263157895
4
0.5684210526
3
0.5684210526
0.7894736842 2

0.9578947368 1
1.1894736842 0
1 11 21 31 41 51 61 71 81 91 01 11 21 31 41 51 61 71 81 91 01 11 21 31 41
1.5736842105 -1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2
1.8421052632 -2
1.4 -3
1.4263157895
-4
1.3263157895
-5
1.2105263158
1.2315789474
1.2105263158 RANGE 5
1.0631578947 4
0.8842105263
0.5 3
0.4947368421
2
0.3105263158
-0.0947368421 1
0.0736842105
0
0.0421052632 1 11 21 31 41 51 61 71 81 91 01 11 21 31 41 51 61 71 81 91 01 11 21 31 41
1 1 1 1 1 1 1 1 1 1 2 2 2 2 2
-0.0631578947 -1
0.2421052632
0.0578947368 -2
-0.1789473684
-3
-0.2
0.2263157895
0.1631578947
0.1578947368
0.4157894737

0.2894736842 Nama : Mardhah Sastri utami


0.4789473684 NPM : 183112620120117
0.6263157895
0.8105263158
0.9263157895
1.0315789474
1.1947368421
1.5
1.5526315789
1.8210526316
1.7052631579
1.4
1.4157894737
1.6526315789
1.4157894737
1.2947368421
1.6
1.4210526316
1.3315789474
1.2157894737
1.0473684211
0.9
0.6157894737
0.5
0.2157894737
0.4947368421
0.3263157895
0.0789473684
-0.0263157895
-0.2421052632
-0.2421052632
-0.1263157895
-0.5105263158
-0.5210526316
-0.4210526316
-0.4947368421
-0.4473684211
-0.6315789474
-0.6947368421
-0.4736842105
-0.0894736842
0.2947368421
0.6789473684
0.5789473684
0.5421052632
0.7052631579
0.9526315789
1.0578947368
1.5157894737
1.4
1.4
1.4
1.2631578947
1.0421052632
0.8578947368
1.1315789474
1.3684210526
1.5473684211
1.5473684211
1.5684210526
1.3473684211
1.2421052632
1.2421052632
1.0210526316
1.1631578947
1.0631578947
1.1
0.8578947368
1.0052631579
0.8894736842
1.2736842105
1.6789473684
1.6789473684
1.8105263158
1.7736842105
1.5368421053
1.2368421053
1.2578947368
0.9684210526
0.9473684211
0.7842105263
0.7315789474
0.9
0.8842105263
0.7368421053
0.4526315789
0.5684210526
0.8421052632
0.8210526316
0.5842105263
0.4578947368
0.5736842105
0.5789473684
0.5789473684
0.5473684211
0.9894736842
0.9684210526
0.9684210526
1.2315789474
1.5
1.8842105263
1.8842105263
1.6421052632
1.8368421053
1.8473684211
1.7105263158
1.2684210526
1.4052631579
1.2578947368
1.1210526316
1.1263157895
0.7894736842
0.5052631579
0.3894736842
0.3736842105
0.2684210526
0.2947368421
0.0368421053
-0.0157894737
-0.3684210526
-0.2947368421
-0.0736842105
-0.4578947368
-0.6052631579
-0.3421052632
-0.1736842105
-0.0473684211
0.3578947368
0.6
0.4526315789
0.6473684211
0.8263157895
0.9421052632
0.6368421053
0.7631578947
1.0263157895
1.0157894737
1.0684210526
1.5105263158
1.2684210526
1.0263157895
1.0789473684
1.2421052632
1.1157894737
1.1315789474
1.1473684211
1.1473684211
0.8631578947
1.1105263158
0.9684210526
1.1105263158
0.9947368421
1.0421052632
1.0210526316
1
1.1947368421
1.0947368421
1.0789473684
1.3
1.1578947368
1.5631578947
1.5421052632
1.5421052632
1.3578947368
1.3421052632
1.1
1.3315789474
1.1105263158
1.4947368421
1.4947368421
1.8789473684
2.1157894737
1.6789473684
1.4368421053
1.0526315789
1.0473684211
1.0631578947
1.0105263158
1.1736842105
0.7684210526
0.9052631579
0.6263157895
0.9263157895
0.6210526316
0.4578947368
0.2263157895
0.2052631579
0.1
-0.1578947368
-0.5421052632
-0.7631578947
-0.4315789474
-0.2947368421
0.0368421053
-0.0947368421
-0.3736842105
-0.55
-0.5588235294
-0.375
-0.52
-0.3071428571
-0.4692307692
-0.375
-0.0909090909
0.06
0.1555555556
-0.05
0
0.5833333333
0.78
0.525
0.1
-0.75
-0.8
VLFFGFTSKAESMRPEVASTFKVLRNVTVVLWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSRAIFGEAEAPEPSAGDGAAATS

RANGE 3
5

11 221 231 241 0


1 11 21 31 41 51 61 71 81 91 01 11 21 31 41 51 61 71 81 91 01 11 21 31 41
-1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2

-2

-3

-4

RANGE 19
2.5

1.5

0.5
11 221 231 241
0
1 11 21 31 41 51 61 71 81 91 01 11 21 31 41 51 61 71 81 91 01 11 21 31 41
1 1 1 1 1 1 1 1 1 1 2 2 2 2 2
-0.5

-1
EAPEPSAGDGAAATS
Residue Type kdHydrophobicitya

I 4.5
V 4.2
L 3.8
F 2.8
C 2.5
M 1.9
A 1.8
G -0.4
T -0.7
S -0.8
W -0.9
Y -1.3
P -1.6
H -3.2
E -3.5
Q -3.5
D -3.5
N -3.5
K -3.9
R -4.5