You are on page 1of 15

Getting Started with a Mac

For businesses with a Windows Server

This document, a quick guide designed to help you integrate a Mac into
your environment, is geared toward businesses with a Microsoft server
product such as Small Business Server 2003 or 2008. Please refer to the
Getting Started with a Mac for Businesses without a Server for tips on how
to add a Mac to your environment if your business does not have a
Windows server.
Table of Contents
Integrating a Mac into Your Business 3

Setting Up Your New Mac 3

Connecting to the Internet 4

Setting Up Your Mac to Connect to the Server (connecting to Active Directory) 5

Sharing Files 10

Email 11

Calendars and Contacts 12

1ÓEG2TQFWEVKXKV[#RRNKECVKQPU  

Mobile Access to Your Network 12

Security 13

Printers 14

Instant Messaging 14

Collaboration 14

Backup 15

Summary 15

Additional Resources 15

Getting Started with a Mac For businesses with a Windows Server 2


Integrating a Mac into Your Business
Integrating a Mac into your business is an easy process and can be accomplished in just a few simple steps. Microsoft Small
Business Server 2003 or 2008 uses Active Directory to create accounts and provide shared services. If Active Directory is not
used in your environment, many of the instructions described in this guide may still apply; however, you may need to do
UQOGCFFKVKQPCNEQP°IWTCVKQP0QVGVJCVHQTHWNNWUGQH/KETQUQHV'ZEJCPIGUWRRQTVKP/CE15:X5PQY.GQRCTF
/KETQUQHV'ZEJCPIG5GTXGTKUTGSWKTGFQP[QWT9KPFQYUUGTXGT

This guide will walk you through the following simple steps so that you can easily take full advantage of your new system:

1. Set up your new Mac.


2. Connect to the Internet.
3. Integrate with your directory service.
 5JCTG°NGUCPFRTKPVGTU
5. Set up and support your email, calendar, and contacts.
 5GCONGUUN[YQTMYKVJQVJGTRTQFWEVKXKV[CRRNKECVKQPU

Setting Up Your New Mac


Before you start, you will need to gather the following information from
your Windows server:

† 9KPFQYUUGTXGTQT#EVKXG&KTGEVQT[
#& FQOCKPPCOG
GZCORNGEQO
† +2#FFTGUUQH[QWTUGTXGT
† #FOKPKUVTCVQT¨UWUGTPCOGCPFRCUUYQTFQP[QWTUGTXGTQT#&FQOCKP

Setting up a new Mac for a business with a Microsoft-based server is essentially


the same as setting up a Mac for personal use. It requires the following steps:

1. Turn on your Mac, and then follow the simple, on-screen instructions. For more instructions about migrating
As part of those instructions, you will be given the option to transfer data [QWT2%DCUGF°NGUXKUKV
from another Mac system. However, if your previous machine is a PC, it will UWRRQTVCRRNGEQOMD*6
DGGCUKGTVQOKITCVG[QWT°NGUNCVGT

2. Important: If you plan to connect this Mac to the Windows server, it is


KORQTVCPVVQETGCVGVJG°TUVCEEQWPVWUKPICPCOGVJCVKUFKÒGTGPVHTQO[QWT
UGTXGTQT#EVKXG&KTGEVQT[CEEQWPVPCOG6JGGZCORNGUFGUETKDGFDGNQYWUG
the name “Mac Admin” as the initial account name on the machine. You will
create a second account later that will be used to connect to the server
for everyday business use.

Getting Started with a Mac For businesses with a Windows Server 3


 6JG°TUVCEEQWPVQP[QWT/CEYKNNDGCPCFOKP
HQTCFOKPKUVTCVQT CEEQWPVD[FGHCWNV7UKPICPCFOKPCEEQWPV[QWECP
make changes to the system, including adding new accounts, adding software applications, limiting rights for other
accounts, and more. Many people create just one account on their system. If your business would like to retain the ability to
CEEGUUGXGT[U[UVGOVJGPCIQQF°TUVUVGRKUVQETGCVGCIGPGTCNCFOKPCEEQWPVQPGXGT[/CEVQDGEQPVTQNNGFD[VJGDWUK-
PGUUQYPGTQÓEGOCPCIGTCFOKPKUVTCVQTQTVGEJPKECNRGTUQP;QWECPCNYC[UETGCVGCFFKVKQPCNCFOKPCEEQWPVUCPFQVJGT
types of accounts at a later time. This admin account will not be tied into the Microsoft server, and it will not use
Active Directory.

4. Once you have created the initial Mac Admin account, you will be asked to create an account photo and ensure that
the date and time are correct. If the date, time zone, or time is incorrect, then you may encounter problems later when
connecting to the network.

You should now be able to access and use your new Mac, however you will not yet be able to log in to the
Microsoft network and server.

Connecting to the Internet


Using a wired network
If you want to connect to the Internet using a wired Ethernet network, simply (QTOQTGJGNRQPVJKUQTCP[
connect an Ethernet cable from your router or other Internet connection device /CEKUUWGUGG
to your Mac. YYYCRRNGEQOUWRRQTVSWKEMCUUKUV

Using a wireless network


%QPPGEVKPIVQCYKTGNGUUPGVYQTMKUSWKEMCPFGCU[#RRNG¨UKPFWUVT[UVCPFCTF
YKTGNGUUPGVYQTMKPIVGEJPQNQI[#KT2QTVKUDWKNVKPVQ#RRNG¨UHWNNNKPGQH
notebooks as well as the iMac.* You can easily add an 802.11 wireless card to a Mac
Pro computer. Your Mac will automatically connect to available wireless networks.
6QEQPPGEVVQCYKTGNGUUPGVYQTMHQTVJG°TUVVKOGWUGVJGHQNNQYKPIUKORNGUVGRU

1. From the menu bar, choose the Apple icon, and select System Preferences.
Then choose Network.

2. Select AirPort in the list of network connection services, then choose a wireless net-
work from the Network Name pull-down menu. If you are prompted for a password,
enter it. If the network you want to join is not in the list (it may be hidden from
public view), choose Other, then enter the network name and password.

 %JGEMVJGDQZ¥5JQY#KT2QTVUVCVWUKPOGPWDCT¦UQKVYKNNDGGCUKGTVQSWKEMN[
verify your wireless status and join new networks if you are traveling or in
new locations.

Once you have connected to a wireless network, the Mac will automatically (QTOQTGJGNRQPVJKUQTCP[
rejoin that network. You should now be able to launch a web browser and /CEKUUWGEJGEM
connect to the Internet. A working network connection will be required to YYYCRRNGEQOUWRRQTVSWKEMCUUKUV
move forward, so ensure that your connection is working properly.
* Wireless Internet access requires a base station or other wireless access point and Internet access;
fees may apply. Some ISPs are not currently compatible with Air2ort.

Getting Started with a Mac For businesses with a Windows Server 4


Setting Up Your Mac to Connect to the Server
(connecting to Active Directory)
1PEGVJGKPKVKCNUGVWRKUEQORNGVG[QWYKNNDGDTQWIJVVQ[QWT/CE15:FGUMVQR;QWYKNNPGGFVQVCMGCHGYOQTGOQOGPVUVQ
EQORNGVG[QWTEQP°IWTCVKQPVQCNNQY[QWVQNQIKPVQVJG9KPFQYUUGTXGTWUKPI[QWT#EVKXG&KTGEVQT[CEEQWPV

Make sure that the Windows server administrator has created an account for you on the server. Administrators can create
an account just as they would for any other PC used within the organization. This account will be referred to as your Active
Directory account, and you will need to know its username and password. This account name may be the same as that which
was used on a previous Windows computer, or it may be an entirely new user name.

1. Go to the System Preferences application. To get there, you can either click the System Preferences icon in the Dock,
or choose System Preferences from the Apple menu. Then select the Accounts icon at the bottom left of the System
Preferences window.

 %NKEMVJG.QIKP1RVKQPUKEQP

Getting Started with a Mac For businesses with a Windows Server 5


 6QVJGTKIJVQHVJG.QIKP1RVKQPUKEQPENKEMVJG,QKPDWVVQPHQT0GVYQTM#EEQWPV5GTXGTU

 6JKUYKNNDTKPIWRCVGZV°GNFVJCVCNNQYU[QWVQGPVGT[QWT#EVKXG&KTGEVQT[FQOCKPPCOG-GGRKPOKPFVJCV
VJKUKUPQVVJGHWNNPCOGQHVJGUGTXGTHQTGZCORNG¥UGTXGTGZCORNGEQO¦+VKULWUVVJGFQOCKPRCTVQHVJGPCOG

HQTGZCORNG¥GZCORNGEQO¦ 

 'PVGT[QWT5GTXGT#FOKPKUVTCVQT¨U#EVKXG&KTGEVQT[WUGTPCOG
VJKUGZCORNGWUGU¥#FOKPKUVTCVQT¦ CPFRCUUYQTF6JKUYKNNLQKP
[QWT/CEVQ[QWTUGTXGT¨U#EVKXG&KTGEVQT[FQOCKPCPFCNNQY[QWVQETGCVGCPCEEQWPVQP[QWT/CEVJCVVKGUVQ[QWTUGTXGT¨U
Active Directory domain.

Getting Started with a Mac For businesses with a Windows Server 


 1PEG[QWJCXGGPVGTGF[QWT5GTXGT#FOKPKUVTCVQT¨U#EVKXG&KTGEVQT[WUGTPCOGCPFRCUUYQTFENKEMVJG1RGP&KTGEVQT[
Utility button. The following screen will appear:

 +PVJG&KTGEVQT[7VKNKV[YKPFQYENKEMVJG.QEMKEQPQPVJGDQVVQONGHVCPFVJGPGPVGT[QWTMac Admin user name


and password. This will unlock your Mac so you can make a change.

 &QWDNGENKEMVJG#EVKXG&KTGEVQT[GPVT[KPVJGNKUVVQDTKPIWRVJGHQNNQYKPIYKPFQY

 %NKEMVJGVTKCPINGPGZVVQ5JQY#FXCPEGF1RVKQPUVQFKURNC[OQTGQRVKQPU

Getting Started with a Mac For businesses with a Windows Server 


 7PFGTVJG7UGT'ZRGTKGPEGRCPGENKEMVJG%TGCVGOQDKNGCEEQWPVCVNQIKPDQZCPFFGUGNGEVVJG4GSWKTGEQP°TOCVKQPDQZ

It should appear as follows:

 %NKEM1-VQUCXG[QWTEJCPIGUCPFVJGPENKEMQP#RRN[KPVJG&KTGEVQT[7VKNKV[YKPFQY

11. Now log out of the Mac AdminCEEQWPVD[EJQQUKPI.QI1WVMac Admin from the Apple menu.

12. After the system logs out of Mac Admin, a login screen will present two options: an icon for the
Mac Admin account and an Other icon.

Getting Started with a Mac For businesses with a Windows Server 8


13. Click the Other icon, and enter your Active Directory account username and password from the account on your Windows
server or Active Directory domain. For the purposes of this guide, the Active Directory account name used will be “AD User.”

Congratulations! You are now logged in as the “AD User” Active Directory account. The account has been synced with the
Windows server and the Active Directory domain so that your Mac system is now fully integrated into your Windows network.
Your password will be kept up to date across the various systems, and you will have access to all the services that you would be
able to access from a Windows PC.

-GGRKPOKPFVJCVCNNQH[QWT°NGUYKNNTGUKFGQPVJGNQECNJCTFFTKXGQP[QWT/CEPQVQPVJG9KPFQYUUGTXGT

Getting Started with a Mac For businesses with a Windows Server 9


For Additional Help

Sharing Files
6JG/CEECPKPUVCPVN[WUGFQEZNURFHLRICPFOCP[QVJGTEQOOQP°NGV[RGU
GXGPKHVJG°NGYCUETGCVGFQPC9KPFQYUU[UVGO+PCOKZGFGPXKTQPOGPVVJGTG
CTGOWNVKRNGQRVKQPUHQTGZEJCPIKPINCTIG°NGUDCEMCPFHQTVJDGVYGGP/CECPF
PC systems. USB or FireWire storage devices and Flash-memory devices with
/CEQT2%IGPGTCVGF°NGUECPEQPPGEVFKTGEVN[VQGKVJGTC/CEQT2%HQTVYQYC[
GZEJCPIG9KVJCPQRVKECNFTKXG[QWT/CEECPDWTP%&CPF&8&FKUEUHQTWUGQP
Mac systems, Windows-based PCs, and other types of computers.

5JCTKPI°NGUQPVJGUGTXGT
Now that you are connected to the server using your server or Active Directory
account, you should be able to see all the shared folders on the server that your
account has permission to access.

1. Click the Finder icon in your Dock. This will bring up a Finder window. On the
left-hand sidebar of the Finder window, under the Shared divider, you should
see any Windows server or machine on your network. Choose one that has a
°NGUJCTGQPKV

 ;QWUJQWNFPQYUGGVJGHQNFGTUCPF°NGUKPVJCVUJCTGFHQNFGT

 +H[QWFQP¨VUGGVJGUGTXGTKPVJGUKFGDCTCTGCVJGPUGNGEV)QHTQOVJG(KPFGT
menu, and then Connect to Server. Type in “smb://10.0.0.1” but substitute your
UGTXGT¨UCEVWCN+2CFFTGUUHQT

5JCTKPI°NGUDGVYGGPU[UVGOUYKVJQWVVJGUGTXGT
6JGOQUVUKORNGYC[VQUJCTG°NGUDGVYGGPVYQWUGTUYJQCTGDQVJCWVJQTK\GF
QPVJGUGTXGTKUVQWUGCUJCTGFHQNFGTQPVJGUGTXGT;QWECPCNUQGZEJCPIG°NGU
back and forth between Mac and Windows systems on the same network that is
WUGFVQCEEGUUVJG+PVGTPGV;QWECPCNUQGZEJCPIG°NGUDCEMCPFHQTVJDGVYGGP
Mac and Windows systems on the same network used to access the Internet.

%QORWVGTUVJCVGPCDNG°NGUJCTKPICWVQOCVKECNN[UJQYWRKPVJG5JCTGF Step-by-step instructions for setting up


UGEVKQPQHVJG(KPFGTUKFGDCTCNNQYKPI[QWVQDTQYUG°NGUCPFHQNFGTU[QW (KNG5JCTKPIDGVYGGPVYQEQORWVGTU
have permission to view. QPCPGVYQTMCTGCV
UWRRQTVCRRNGEQOMD*6

Getting Started with a Mac For businesses with a Windows Server 10


For Additional Help

'OCKN
The Mail application is included with every Mac. Mail supports common email 5GGVJG/CKNNGUUQPWPFGT9QTMKPI
standards including POP3 and IMAP. If you have more than one email account, 2NC[KPICV
you can easily add all of your accounts to Mail and access everything from one YYYCRRNGEQOUWRRQTVOCE
EGPVTCNRNCEG9JGP[QWNCWPEJ/CKNHQTVJG°TUVVKOGKVYKNNFKURNC[VJG/CKN5GVWR
(QTUWRRQTVKPHQTOCVKQPUGG
Assistant to walk you through this process. If you use an Internet-based service
YYYCRRNGEQOUWRRQTVOCKN
UWEJCU;CJQQ)QQING#1.QTQVJGTUVJGP[QWECPCEEGUUVJQUGGOCKNUGTXKEGU
using the Safari web browser, also included with every Mac.

7UKPI/KETQUQHV'ZEJCPIGQP[QWTUGTXGTHQTGOCKN
9KVJVJGKPVTQFWEVKQPQH5PQY.GQRCTF/CE15:KUVJGQPN[QRGTCVKPIU[UVGO
YKVJDWKNVKPUWRRQTVHQT/KETQUQHV'ZEJCPIG5GTXGT6QCEEGUU'ZEJCPIG
UGTXKEGUUWEJCUGOCKNECNGPFCTKPXKVCVKQPUCPF)NQDCN#FFTGUU.KUVU[QWECP
GCUKN[WUG/CKNK%CNCPF#FFTGUU$QQM+H[QWWUG'ZEJCPIGHQTGOCKNCPF[QWT
UGTXGTKUTWPPKPI'ZEJCPIG5GTXGTVJGP[QWECPCNUQWUG/CKNVQCEEGUU[QWT
'ZEJCPIGGOCKNCEEQWPV

 .CWPEJVJG/CKNCRRNKECVKQPQP[QWT/CE0QVGVJCVKVKUDGUVVQFQVJKUYJKNG
[QWCTGQP[QWTQÓEGPGVYQTMVJG°TUVVKOGDGHQTGCVVGORVKPIVQFQKVHTQO
another location.

 +HVJKUKUVJG°TUVVKOG[QWJCXGWUGF/CKN[QWYKNNDGCUMGFVQETGCVGCPGY For step-by-step instructions and more


account. If you already have another Mail account set up, you can add an UWRRQTVVQUGVWR[QWT/CEVQYQTM
additional account from the Mail Preferences menu. This will allow you to YKVJ/KETQUQHV'ZEJCPIG5GTXGTUGG
see all your email in one place. UWRRQTVCRRNGEQOMD*6

 9JGP[QWCTGETGCVKPIVJGPGY/CKNCEEQWPVV[RGKP[QWT'ZEJCPIGGOCKN
CFFTGUUCPFRCUUYQTFKPVJGFKCNQIDQZCPFEJGEMVJGDQZVQCWVQOCVK-
ECNN[UGVWR[QWTQVJGTCRRNKECVKQPU+HVJG'ZEJCPIG#WVQFKUEQXGT[HGCVWTGKU
enabled on your server, then Mail will use Autodiscovery to populate all the
RGTVKPGPVKPHQTOCVKQPHTQOVJGUGTXGTCPFEQP°IWTG[QWTUGVVKPIUUQVJCV[QW
can start using your applications right away. Once this has been completed,
[QWTGOCKNYKNNUJQYWR;QWECPNCWPEJK%CNVJG/CE15:ECNGPFCTKPI
CRRNKECVKQPCPF#FFTGUU$QQMVJG/CE15:EQPVCEVCRRNKECVKQPCPFJCXG
HWNNCEEGUUVQ[QWTCRRQKPVOGPVUCPFEQPVCEVUHTQO[QWT'ZEJCPIGUGTXGT

As an alternative, Microsoft also makes the Entourage application, which provides


CEEGUUVQ'ZEJCPIG5GTXGTQTITGCVGTHQTGOCKN

Using Microsoft Exchange Hosted Services


+H[QWWUGCJQUVGFQTQWVUQWTEGF/KETQUQHV'ZEJCPIGUGTXKEGHQTGOCKNCPF 5GG[QWTGOCKNUGTXKEGRTQXKFGT
ECNGPFCTKPI[QWOC[CNUQDGCDNGVQWUG/CKNVQCEEGUU[QWT'ZEJCPIGGOCKN HQTOQTGFGVCKNU
CEEQWPVKHVJGGOCKNRTQXKFGTKUTWPPKPI'ZEJCPIG5GTXGT

Getting Started with a Mac For businesses with a Windows Server 11


For Additional Help

Calendars and Contacts


With iCal, you can create as many separate calendars as you need—one for work 5GGVJGK%CNNGUUQPWPFGT
and one for home. iCal can sync with Google and Yahoo! calendars as well as 9QTMKPI2NC[KPICV
import from many other calendar applications. Microsoft and other software YYYCRRNGEQOUWRRQTVOCE
QT
companies also make other calendar applications that run on the Mac. If you use
YYYCRRNGEQOUWRRQTVKECN
/KETQUQHV'ZEJCPIGVJGRTGXKQWUGOCKNUGEVKQPFGUETKDGUVJGXCTKQWUQRVKQPUHQT
EQPPGEVKPIK%CNQTQVJGTRTQFWEVUVQ[QWT'ZEJCPIGECNGPFCTU

Address Book makes it simple to manage your contacts and organize them into 5GGVJG#FFTGUU$QQMNGUUQPWPFGT
groups. Address Book can sync and import contacts from Internet services such as 9QTMKPI2NC[KPICV
Google Calendar, as well as many other programs. YYYCRRNGEQOUWRRQTVOCE

1ÓEG2TQFWEVKXKV[#RRNKECVKQPU
6JG/CETWPU/KETQUQHV1ÓEGCRRNKECVKQPUKPENWFKPI9QTF'ZEGN (QTOQTGKPHQTOCVKQPUGG
CPF2QYGT2QKPV+VCNUQTWPUK9QTM#RRNG¨URTQFWEVKXKV[UWKVGVJCVKPENWFGU YYYCRRNGEQOOCEQUZEQORCVKDKNKV[
2CIGU§0WODGTU§CPF-G[PQVG§¤CNNVQJGNR[QWRTQFWEGFQEWOGPVU
spreadsheets, and presentations. iWork can read and write documents
WUKPIVJG/KETQUQHV1ÓEGHQTOCVUQ[QWTFQEWOGPVUCTGGCUKN[EQORCVKDNG*

6JG/CEECPKPUVCPVN[YQTMYKVJFQEZNURFHLRICPFOCP[QVJGTEQOOQP°NG
V[RGUGXGPKHVJG°NGYCUETGCVGFQPC9KPFQYUU[UVGO2&(UWRRQTVKUDWKNVKPVQ
VJGEQTGQHVJG/CE15:QRGTCVKPIU[UVGOUQVJCV[QWECPETGCVGXKGYCPF
annotate PDF documents without the need to purchase additional software.
 /KETQUQHV1ÓEGCPFK9QTMCTGUQNFUGRCTCVGN[

Mobile Access to Your Network


/KETQUQHV¨UUGTXGTRTQFWEVUQÒGTUGXGTCNQRVKQPUHQTCEEGUUKPIGOCKN°NGUCPF For more information about
DWUKPGUUCRRNKECVKQPUYJGP[QWCTGQWVUKFG[QWTQÓEGPGVYQTM7UKPI5CHCTKQT JQYVQCEEGUUGOCKNWUKPI
QVJGTDTQYUGTUQPVJG/CE[QWECPWUG/KETQUQHV1ÓEG1WVNQQM9GD#EEGUU 1WVNQQM9GD#EEGUUUGG
QÓEGOKETQUQHVEQOGPWU
VQCEEGUU[QWT/KETQUQHV'ZEJCPIG5GTXGTOCKNDQZHTQOCP[EQORWVGTYKVJCP
QWVNQQM*#CURZ
+PVGTPGVEQPPGEVKQP;QWECPCNUQWUG[QWT/CEYKVJ/KETQUQHV¨U4GOQVG9GD
QT
9QTMRNCEGVQCEEGUU°NGUCPFCRRNKECVKQPUQP[QWTUGTXGTYJGP[QWCTGPQVKP
YYYOKETQUQHVEQOOCE
VJGQÓEG

+H[QWPGGFVQWUGCPCRRNKECVKQPQPC2%[QWECPWUG/KETQUQHV¨U4GOQVG
Desktop application. This will allow you to share the screen of the PCs on
your network that have remote access turned on.

Getting Started with a Mac For businesses with a Windows Server 12


For Additional Help

5GEWTKV[
/CE15:FQGUP¨VIGV2%XKTWUGUCPFKVUDWKNVKPFGHGPUGUJGNRRTQVGEV[QW 5GGOQTGFGVCKNUCDQWV/CE15:
from other malware without the hassle of constant alerts and sweeps. UGEWTKV[CV
Some users may choose to purchase and install additional antivirus tools. YYYCRRNGEQOOCEQUZUGEWTKV[

/CE15:CNUQOCMGUUCHGIWCTFKPIETKVKECNFCVCGCU[5GEWTG'ORV[6TCUJGPUWTGU
FGNGVGFEQP°FGPVKCN°NGUCTGRGTOCPGPVN[TGOQXGFHTQOVJGU[UVGOCPFDWKNVKP
UGEWTGGPET[RVKQPVQQNUNKMG(KNG8CWNVCPF5GEWTG8KTVWCN/GOQT[MGGR°NGUCPF
personal data automatically protected. With do-it-yourself encryption capabilities
WUKPIVJG&KUM7VKNKV[VQQNWUGTUECPGCUKN[RCUUYQTFRTQVGEVCP[°NGUVJG[EJQQUG
using Advanced Encryption Standards, the cryptology standard that the federal
government recommends to secure information.

7UKPICXKTVWCNRTKXCVGPGVYQTMVQUGEWTGN[CEEGUU[QWT
UGTXGTTGOQVGN[
8KTVWCNRTKXCVGPGVYQTM
820 CEEGUUGPCDNGU[QWVQVCMGCFXCPVCIGQHPGVYQTM (QTUVGRD[UVGRKPUVTWEVKQPUUGG
UGTXKEGUYJKNG[QWCTGQÒUKVGCPFKVUKOWNVCPGQWUN[RTGXGPVUCEEGUUD[WPCWVJQT- FQEUKPHQCRRNGEQOCTVKENG
K\GFKPFKXKFWCNU/CE15:UWRRQTVUUVCPFCTFUDCUGF.62QXGT+25GE2262 JVON!RCVJ/CEGPJVON
CPF%KUEQ820RTQVQEQNUVQRTQXKFGGPET[RVGF820EQPPGEVKQPUYKVJCDWKNVKP
820ENKGPV

6QUGVWR820CEEGUU[QWYKNNPGGFVQGPVGTEQP°IWTCVKQPUGVVKPIUKPVQVJG
Network preferences tool in System Preferences. These settings include the
820UGTXGTCFFTGUUCEEQWPVPCOGCPFCP[CWVJGPVKECVKQPUGVVKPIUUWEJCU
VJGRCUUYQTFQTEGTVK°ECVGRTQXKFGFD[VJGPGVYQTMCFOKPKUVTCVQT

7UKPI(KNG8CWNVVQGPET[RV[QWTFCVC
;QWECPRTGXGPVQVJGTUHTQOUGGKPIQTEQR[KPI[QWT°NGUD[WUKPI(KNG8CWNV (QTUVGRD[UVGRKPUVTWEVKQPUUGG
VQGPET[RVVJG°NGUKP[QWTJQOGHQNFGT6JGFCVCKP[QWTJQOGHQNFGTKU FQEUKPHQCRRNGEQOCTVKENG
encoded, which means that your information is secure if your computer JVON!RCVJ/CEGPJVON
KUNQUVQTUVQNGP(KNG8CWNVWUGUVJGNCVGUVIQXGTPOGPVCRRTQXGFGPET[RVKQP
standard, the Advanced Encryption Standard with 128-bit keys (AES-128).
+H[QWUVQTGUGPUKVKXGKPHQTOCVKQP[QWUJQWNFEQPUKFGTWUKPI(KNG8CWNV

9JGP[QWVWTPQP(KNG8CWNV[QWCNUQUGVCOCUVGTRCUUYQTFVJCV[QWQTCPCFOKP-
KUVTCVQTECPWUGKH[QWHQTIGV[QWTTGIWNCTNQIKPRCUUYQTF9CTPKPI&QP¨VHQTIGV
[QWTOCUVGTRCUUYQTF+H[QWVWTPQP(KNG8CWNVCPFVJGPHQTIGVDQVJ[QWTNQIKP
RCUUYQTFCPF[QWTOCUVGTRCUUYQTF[QWYQP¨VDGCDNGVQNQIKPVQ[QWTCEEQWPV
CPF[QWT°NGUCPFUGVVKPIUYKNNDGNQUV

Getting Started with a Mac For businesses with a Windows Server 13


For Additional Help

2TKPVGTU
/CEU[UVGOUNGV[QWEQPPGEVCPFUJCTGFGXKEGUUWEJCURTKPVGTUCPFGZVGTPCN 5GGVJG%QPPGEV;QWT2TKPVGTNGUUQPCV
UVQTCIGFGXKEGU/CE15:EQOGUYKVJUQHVYCTGFTKXGTUHQTOCP[VJKTFRCTV[ YYYCRRNGEQOUWRRQTVOCE
printers, so you can simply connect to a USB printer and the print queue will connect
automatically be created. You can also connect to printers that are shared from
other PC or Mac systems or printers attached directly to the network.

Instant Messaging
K%JCVVJGKPUVCPVOGUUCIKPICRRNKECVKQPDWKNVKPVQ/CE15:NGVU[QWVGZV See the K%JCVNGUUQPWPFGT9QTMKPI
CWFKQQTXKFGQEJCVQXGTVJG+PVGTPGVYKVJQWVCEETWKPICP[VGZVOGUUCIKPI 2NC[KPICV
long distance, or video streaming charges.* You can chat one on one or set up YYYCRRNGEQOUWRRQTVOCE

a multi-person chat.

To use iChat, all you need is access to the Internet and one of the following
CEEQWPVU/QDKNG/G#+/
#1.+PUVCPV/GUUGPIGT )QQINGKPUVCPVOGUUCIKPI
QT,CDDGT9JGP[QW°TUVNCWPEJK%JCVKVYKNNDTKPIWRCPCUUKUVCPVVQJGNRUGV
up your account.

Along with iChat, Yahoo! Messenger and Microsoft Messenger for Mac are also
CXCKNCDNGHQTVJG/CE+H[QWJCXGC/KETQUQHV1ÓEG%QNNCDQTCVKQP5GTXGT
1%5 
[QWECPCNUQFQYPNQCFCEQR[QH/KETQUQHV¨U/GUUGPIGTHQT/CECRRNKECVKQP
allowing you to communicate through chat with the other members of your
workgroup from your Mac.
* Broadband Internet access is required. Fees may apply.

Collaboration
If you use an online collaboration solution such as Google Apps, you can get For more information about Microsoft
access to their services on your Mac by simply using Safari or another browser. &QEWOGPV%QPPGEVKQPHQT/CEUGG
YYYOKETQUQHVEQOOCEKVRTQU
If you use Microsoft SharePoint Server on your Microsoft server, you can
access the documents on SharePoint using your Safari browser. Microsoft
&QEWOGPV%QPPGEVKQPHQT/CERTQXKFGU1ÓEGHQT/CEWUGTUYKVJGCUKGT
FQYPNQCFKPICPFWRNQCFKPIECRCDKNKVKGUVQCPFHTQO5JCTG2QKPVCPF.KXG
Workspace. Microsoft Document Connection for Mac is available for free as
RCTVQH1ÓEGHQT/CE52

Getting Started with a Mac For businesses with a Windows Server 14


For Additional Help

Backup
Time Machine lets you automatically back up your entire system. It keeps an 5GGVJG6KOG/CEJKPGNGUUQPWPFGT
WRVQFCVGEQR[QHGXGT[VJKPIQP[QWT/CE¤U[UVGO°NGUFQEWOGPVUGOCKN 9QTMKPI2NC[KPICV
FKIKVCNRJQVQUOWUKEOQXKGU68UJQYUCPFOQTG;QWECPGCUKN[IQ¥DCEMKPVKOG¦ YYYCRRNGEQOUWRRQTVOCE
VQTGUVQTG°NGUKHPGGFGF6KOG/CEJKPGYQTMUYKVJ[QWT/CECPFCPGZVGTPCNJCTF
drive.*,WUVEQPPGEVVJGFTKXGCUUKIPKVVQ6KOG/CEJKPGCPFKVYKNNCWVQOCVKECNN[
back up your entire Mac.
 'ZVGTPCNJCTFFTKXGKUUQNFUGRCTCVGN[

5WOOCT[
#FFKPIC/CEVQ[QWTDWUKPGUUKUGCU[/CEU[UVGOUYQTMITGCVGXGPKPCOKZGFGPXKTQPOGPVQH/CECPF9KPFQYUDCUGF
computers. This guide provides a summary of how to get a Mac system to work within a business environment that uses
/KETQUQHV5OCNN$WUKPGUU5GTXGT
5$5 QTQPGQH/KETQUQHV¨UQVJGTUGTXGTRTQFWEVU

#RRNGQÒGTUCXCTKGV[QHQRVKQPUVQJGNR[QWUGNGEVRWTEJCUGFGXGNQRUGTXKEGCPFYQTMYKVJ#RRNGRTQFWEVU#RRNG#WVJQTK\GF
4GUGNNGTUCPFKPFGRGPFGPV#RRNG5QNWVKQP2TQXKFGTUECPFGNKXGTCYKFGXCTKGV[QHUGTXKEGUVCKNQTGFVQ[QWTQTICPK\CVKQP¨UPGGFU
;QWECPICKPURGEKCNK\GFGZRGTVKUGCPFJGNR¤TCPIKPIHTQORTGCPFRQUVUCNGUUWRRQTVVGEJPKECNGZRGTVKUGVTCKPKPIKPUVCNNCVKQP
CPFKPVGITCVKQPUGTXKEGUCPFOQTG¤HTQOCP#RRNG#WVJQTK\GF4GUGNNGTCPF5QNWVKQP2TQXKFGT%JQQUGVJGQPGVJCV¨UTKIJV
for you.

Additional Resources
Following are some recommended websites that were highlighted throughout this guide:

Getting Started with a Mac www.apple.com/support/mac101


3WKEM#UUKUVCPEGQP[QWT/CE www.apple.com/support/quickassist
Switching to Mac from Windows www.apple.com/support/switch101
/CE15:5WRRQTV3WGUVKQPU www.apple.com/support/snowleopard
1XGTCNN#RRNG5WRRQTV www.apple.com/support

Several other websites with video tips and tutorials are available on Apple.com:

Mac Basics YYYCRRNGEQO°PFQWVJQYOCE


#FXCPEGF$WUKPGUU7UGT6KRU www.apple.com/business/theater

Help is also available from within your applications by selecting Help in the menu bar, then by choosing the Help option
for that application.
TM and © 2010 Apple Inc. All rights reserved. Other product and company names mentioned herein may be trademarks of their respective companies. Mention of third-party products is for
information purposes only and constitutes neither an endorsement nor a warranty. Apple assumes no responsibility with regard to the selection, performance or use of these vendors or
RTQFWEVU8GTUKQP

Getting Started with a Mac For businesses with a Windows Server 15