You are on page 1of 228

$TQVJGT.

CUGT2TKPVGT
5'48+%'/#07#.

/1&'.*.0

4GCFVJKUOCPWCNVJQTQWIJN[DGHQTGOCKPVGPCPEGYQTM
-GGRVJKUOCPWCNKPCEQPXGPKGPVRNCEGHQTSWKEMCPFGCU[TGHGTGPEGCVCNNVKOGU

/C[
2.240
l%QR[TKIJV$TQVJGT
#NNTKIJVUTGUGTXGF
0QRCTVQHVJKURWDNKECVKQPOC[DGTGRTQFWEGFKPCP[HQTOQTD[CP[OGCPUYKVJQWVRGTOKUUKQP
KPYTKVKPIHTQOVJGRWDNKUJGT
5RGEKHKECVKQPUCTGUWDLGEVVQEJCPIGYKVJQWVPQVKEG

6TCFGOCTMU
6JGDTQVJGTNQIQKUCTGIKUVGTGFVTCFGOCTMQH$TQVJGT+PFWUVTKGU.VF
#RRNGVJG#RRNG.QIQCPF/CEKPVQUJCTGVTCFGOCTMUTGIKUVGTGFKPVJG7PKVGF5VCVGUCPF
QVJGTEQWPVTKGUCPF6TWG6[RGKUCVTCFGOCTMQH#RRNGEQORWVGT+PE
'RUQPKUCTGIKUVGTGFVTCFGOCTMCPF(:CPF(:CTGVTCFGOCTMUQH5GKMQ'RUQP
%QTRQTCVKQP
*GYNGVV2CEMCTFKUCTGIKUVGTGFVTCFGOCTMCPF*2.CUGT,GVKUCVTCFGOCTMQH*GYNGVV2CEMCTF
%QORCP[
+$/+$/2%CPF2TQRTKPVGTCTGTGIKUVGTGFVTCFGOCTMUQH+PVGTPCVKQPCN$WUKPGUU/CEJKPGU
%QTRQTCVKQP
/KETQUQHVCPF/5&15CTGTGIKUVGTGFVTCFGOCTMUQH/KETQUQHV%QTRQTCVKQP
9KPFQYUKUCTGIKUVGTGFVTCFGOCTMQH/KETQUQHV%QTRQTCVKQPKPVJG75CPFQVJGTEQWPVTKGU
24'(#%'

24'(#%'
6JKUUGTXKEGOCPWCNEQPVCKPUDCUKEKPHQTOCVKQPTGSWKTGFHQTCHVGTUCNGUUGTXKEGQHVJGNCUGT
RTKPVGT
JGTGKPCHVGTTGHGTTGFVQCUVJKUOCEJKPGQTVJGRTKPVGT 6JKUKPHQTOCVKQPKUXKVCNVQVJG
UGTXKEGVGEJPKEKCPVQOCKPVCKPVJGJKIJRTKPVKPISWCNKV[CPFRGTHQTOCPEGQHVJGRTKPVGT
6JKUUGTXKEGOCPWCNEQXGTUVJG*.0RTKPVGTU
6JKUOCPWCNEQPUKUVUQHVJGHQNNQYKPIEJCRVGTU

%*#26'4 )'0'4#.
(GCVWTGUURGEKHKECVKQPUGVE

%*#26'4 +056#..#6+10#0&$#5+%12'4#6+10
+PUVCNNCVKQPEQPFKVKQPU+PUVCNNCVKQPRTQEGFWTGUDCUKEQRGTCVKQPQHVJGRTKPVGT
GVE

%*#26'4 6*'14;1(12'4#6+10
$CUKEQRGTCVKQPQHVJGOGEJCPKECNU[UVGOVJGGNGEVTKECNU[UVGOCPFVJG
GNGEVTKECNEKTEWKVUCPFVJGKTVKOKPIKPHQTOCVKQP

%*#26'4 &+5#55'/$.;#0&4'#55'/$.;
2TQEGFWTGUHQTFKUCUUGODNKPICPFTGCUUGODNKPIVJGOGEJCPKECNU[UVGO

%*#26'4 /#+06'0#0%'
2GTKQFKECNTGRNCEGOGPVURCTVUEQPUWOCDNGRCTVUGVE

%*#26'4 6417$.'5*116+0)
4GHGTGPEGXCNWGUCPFCFLWUVOGPVUVTQWDNGUJQQVKPIKOCIGFGHGEVU
VTQWDNGUJQQVKPIOCNHWPEVKQPUGVE

#22'0&+%'5 5GTKCN0QFGUETKRVKQPU&TWONKHGRCIGEQWPVGT&KCOGVGTEKTEWOHGTGPEG
QHTQNNGTU%QPPGEVKQPFKCITCOU2%$EKTEWKVFKCITCOUGVE

+PHQTOCVKQPKPVJKUOCPWCNKUUWDLGEVVQEJCPIGFWGVQKORTQXGOGPVQTTGFGUKIPQHVJGRTQFWEV
#NNTGNGXCPVKPHQTOCVKQPKPUWEJECUGUYKNNDGUWRRNKGFKPUGTXKEGKPHQTOCVKQPDWNNGVKPU

6GEJPKECN+PHQTOCVKQP 
#VJQTQWIJWPFGTUVCPFKPIQHVJKURTKPVGTDCUGFQPKPHQTOCVKQPKPVJKUUGTXKEGOCPWCNCPF
UGTXKEGKPHQTOCVKQPDWNNGVKPUKUTGSWKTGFHQTOCKPVCKPKPIKVURTKPVSWCNKV[RGTHQTOCPEGCPFHQT
KORTQXKPIVJGRTCEVKECNCDKNKV[VQHKPFVJGECWUGQHRTQDNGOU

K
6#$.'1(%106'065

6#$.'1(%106'065

4')7.#6+10XKK

5#('6;+0(14/#6+10KZ

%*#26'4 )'0'4#.  


 ('#674'5 
 18'48+'9 
 52'%+(+%#6+105
 2TKPVKPI  
 (WPEVKQPU 
 'NGEVTKECNCPF/GEJCPKECN  
 0GVYQTM
HQT*.0QPN[  
 2CRGT 
 (GGFCDNGRCRGT 
 2CRGTECUUGVVGECRCEKV[ 
 2TKPVFGNKXGT[  
 2TKPVKPI#TGC 
 'HHGEVKXGRTKPVKPICTGC  
 2TKPVIWCTCPVGGFCTGC  

%*#26'4 +056#..#6+10#0&$#5+%12'4#6+10  


 %10&+6+1054'37+4'&(14+056#..#6+10
 2QYGT5WRRN[  
 'PXKTQPOGPV  
s
 5[UVGO4GSWKTGOGPVUHQT$TQVJGT2TKPVGT5QNWVKQPHQT9KPFQYU  
 702#%-+0) 
 +056#..6*'24+06'4 
 (QT#NN7UGTU  
 +PUVCNNVJGFTWOWPKVCUUGODN[  
 .QCFRCRGT 
 2TKPVCVGUVRCIG 
s 
 (QT2CTCNNGNKPVGTHCEGECDNGWUGTU
HQT9KPFQYU 7UGTU   
s
 (QT75$+PVGTHCEGECDNGWUGTU
HQT9KPFQYU 7UGTU  
 +PUVCNNVJGFTKXGT%QPPGEVVJGRTKPVGTVQ[QWT2% 
s
 5GVVKPIVJG2%RTKPVGTRQTV
HQT9KPFQYU 7UGTU1PN[  
s
 (QT75$+PVGTHCEGECDNGWUGTU
HQT/CEKPVQUJ 7UGTU  
s
+PUVCNNVJGFTKXGT%QPPGEVVJGRTKPVGTVQ[QWT/CEKPVQUJ  
 (QT0GVYQTM7UGTU  
 +PUVCNNKPIVJG&TKXGTHQT0GVYQTM7UGTU 
s
HQT9KPFQYU WUGTUQPN[  
s
HQT/CEKPVQUJ WUGTUQPN[  

 2#2'4*#0&.+0) 
 .QCF2CRGTKPVQVJG2CRGT%CUUGVVG  

KK
6#$.'1(%106'065

 .QCF2CRGT/CPWCNN[  


 2TKPVKPIQP2NCKP2CRGTHTQOVJG/CPWCN(GGF5NQV  
 2TKPVKPIQP6JKEMGT2CRGTCPF%CTF5VQEM 
 2TKPVKPI'PXGNQRGU  
 2TKPVKPIQP6TCPURCTGPEKGU  
 2TKPVKPIQP6TCPURCTGPEKGUHTQOVJG2CRGT%CUUGVVG  
 2TKPVKPIQP6TCPURCTGPEKGUHTQOVJG/CPWCN(GGF5NQV 
 6YQ5KFG2TKPVKPI
/CPWCN&WRNGZKPI   
 6QRTKPVQPDQVJUKFGUQHVJGRCRGTHTQOVJGRCRGTECUUGVVG  
 6QRTKPVQPDQVJUKFGUQHVJGRCRGTHTQOVJGOCPWCNHGGFUNQV 

 %10641.2#0'.12'4#6+10
 4GCF[
2CRGT .'&+PFKECVKQPU 
 &CVC
6QPGT .'&+PFKECVKQPU 
 &TWO.'&+PFKECVKQPU  
 #NCTO.'&+PFKECVKQPU 
 %QPVTQN2CPGN$WVVQP1RGTCVKQPU  
 1VJGT%QPVTQN(GCVWTGU  
 5NGGROQFG 
 6GUVRTKPVOQFG  

 0'6914-$1#4&12'4#6+10
(14*.010.; 
 2TGRCTKPIVJG$4PGV$QCTF 
 %QPPGEVVJG'VJGTPGVECDNG  
 +PUVCNNVJG$4#FOKPRTQHGUUKQPCNEQPHKIWTCVKQPWVKNKV[
HQT9KPFQYU/G06
WUGTUQPN[  
 2TKPVEQPHKIWTCVKQPRCIG 
 (WPEVKQPU 
 .'&HWPEVKQPU  
 (CEVQT[FGHCWNVUGVVKPI  

%*#26'4 6*'14;1(12'4#6+10  


 '.'%6410+%5 
 )GPGTCN$NQEM&KCITCO  
 /CKP2%$$NQEM&KCITCO 
 /CKP2%$  
 #5+% 
 41/ 
 (NCUJ41/ 
 &4#/  
 1RVKQPCN4#/ 
 2%+DWU  
 ''241/  
 4GUGVEKTEWKV  
 'PIKPG+1  
 'PIKPG2%$ 
 $4PGV2%$
HQT*.0QPN[  
 2QYGT5WRRN[  
 .QYXQNVCIG2QYGT5WRRN[  
 *KIJXQNVCIG2QYGT5WRRN[ 

 /'%*#0+%5 

KKK
6#$.'1(%106'065

 1XGTXKGYQH2TKPVKPI/GEJCPKUO 


 2CRGT6TCPUHGT  
 2CRGTUWRRN[  
 2CRGTTGIKUVTCVKQP  
 2CRGTGLGEV 
 5GPUQTU  
 %QXGTUGPUQTU#CPF$  
 6QPGTUGPUQT 
 &TWO7PKV  
 2JQVQUGPUKVKXGFTWO  
 2TKOCT[EJCTIGT  
 6TCPUHGTTQNNGT  
 %NGCPGT  
 6QPGT%CTVTKFIG  
 2TKPV2TQEGUU 
 %JCTIKPI  
 'ZRQUWTGUVCIG 
 &GXGNQRKPI 
 6TCPUHGT  
 (KZKPIUVCIG  

%*#26'4 &+5#55'/$.;#0&4'#55'/$.; 


 5#('6;24'%#76+105 
 &+5#55'/$.;(.19 
 &+5#55'/$.;241%'&74'
 #%%QTF  
 &TWO7PKV  
 2CRGT%CUUGVVG  
 0GVYQTM$QCTF
HQT*.0QPN[  
 5+//
HQT*.0  
 (TQPV%QXGT  
 6QR%QXGT  
 /CKP%QXGT  
 .CUGT7PKV 
 &TKXG7PKV  
 (KZKPI7PKV  
 $CUG2NCVG  
 /CKP2%$#55; 
 .QYGT6TC[4GNC[2%$#55;
HQT*.0QPN[  
 .QYXQNVCIG2QYGT5WRRN[2%$#55; 
 'PIKPG2%$#55;*KIJXQNVCIG2QYGT5WRRN[2%$#55; 
 2CPGN2%$#55;  
 5QNGPQKF#55; 
 (CP/QVQT#55;  
 6QPGT5GPUQT2%$#55;
.KIJV'OKUUKQP  
 6QPGT5GPUQT2%$#55;
.KIJV4GEGRVKQP  
 2CRGT2KEMWR4QNNGT#55; 
 2CRGT(GGF4QNNGT#55; 

KX
6#$.'1(%106'065

1WVGT%JWVG  


 2#%-+0) 

X
6#$.'1(%106'065

%*#26'4 2'4+1&+%/#+06'0#0%' 


 %1057/#$.'2#465
 &TWO7PKV  
 6QPGT%CTVTKFIG  
 2'4+1&+%#.4'2.#%'/'062#465
 2'4+1&+%#.%.'#0+0)
 %NGCPKPIVJG2TKPVGT'ZVGTKQT  
 %NGCPKPIVJG&TWO7PKV  
 %NGCPKPIVJG5ECPPGT9KPFQY  
 %NGCPKPIVJG'NGEVTKECN6GTOKPCNU 
 /6$(/664

%*#26'4 6417$.'5*116+0)  


 +0641&7%6+10 
 +PKVKCN%JGEM 
 9CTPKPIUHQT/CKPVGPCPEG9QTM 
 +FGPVKH[VJG2TQDNGO  
 12'4#614%#..55'48+%'%#..5 
 1RGTCVQT%CNNU  
 5GTXKEG%CNNU  
 '4414/'55#)'5
 'TTQT/GUUCIGUKPVJG5VCVWU/QPKVQT 
 'TTQT/GUUCIG2TKPVQWVU  
 2#2'4241$.'/5
 2CRGT.QCF2TQDNGOU  
 2CRGT,COU  
 %NGCTKPIVJGLCOOGFRCRGT 
 %CWUGUEQWPVGTOGCUWTGU 
 2CRGT(GGFKPI2TQDNGOU  
 51(69#4'5'66+0)241$.'/5 
 /#.(70%6+105 
 +/#)'&'('%65 
 +OCIG&GHGEV'ZCORNGU  
 6TQWDNGUJQQVKPI+OCIG&GHGEV  
 .QECVKQPQH)TQWPFKPI%QPVCEVU 
 &TWOWPKV  
 2TKPVGTDQF[RCRGTECUUGVVG  

 +0%144'%624+06176 
 0'6914-241$.'/
(14*.010.; 
 +PUVCNNCVKQP2TQDNGO 
 +PVGTOKVVGPV2TQDNGO  
 6%2+26TQWDNGUJQQVKPI 
 70+:6TQWDNGUJQQVKPI 
 9KPFQYU06.#05GTXGT
6%2+2 6TQWDNGUJQQVKPI  
 9KPFQYU/G2GGTVQ2GGT2TKPV
.24 6TQWDNGUJQQVKPI 

XK
6#$.'1(%106'065

 9KPFQYU/G
QTNCVGT 2GGTVQ2GGT
*2,GV#FOKP%QORCVKDNG/GVJQF 6TQWDNGUJQQVKPI
 9KPFQYU/G062GGTVQ2GGT2TKPV
0GV$+15 6TQWDNGUJQQVKPI 
 +PVGTPGV2TKPV
6%2+2 6TQWDNGUJQQVKPI 
 0QXGNN0GVYCTG6TQWDNGUJQQVKPI  
 #RRNG6CNM6TQWDNGUJQQVKPI  
 #RRNG6%2+22TKPVKPI
5[UVGOQTNCVGT  
 9GD$TQYUGT6TQWDNGUJQQVKPI
6%2+2  
 +052'%6+10/1&' 
 6GUV2TKPV/QFG 
 +PURGEVKQP/QFG 

#22'0&+%'5
 5'4+#.01&'5%4+26+105  #
 &+#/'6'4%+4%7/('4'0%'1(41..'45 #
 24+0652''&59+6*8#4+1755'66+0)5 #
 *1961-019&47/70+6.+('2#)'%1706'4 #
 *196175'6*'5'.(&+#)0156+%5611.5  #
 084#/&'(#7.68#.7'  #
 2#2'4%#55'66'+0(14/#6+10
(14'7412'10.;  #
 %100'%6+10&+#)4#/*. #
 %100'%6+10&+#)4#/*.  #
 %100'%6+10&+#)4#/*.0  #
 /#+02%$%+4%7+6&+#)4#/*.
  #
 /#+02%$%+4%7+6&+#)4#/*.
  #
 /#+02%$%+4%7+6&+#)4#/*.0
  #
 /#+02%$%+4%7+6&+#)4#/*.0
  #
 /#+02%$%+4%7+6&+#)4#/*.0
  #
 /#+02%$%+4%7+6&+#)4#/*.0
  #
 /#+02%$%+4%7+6&+#)4#/*.0
  #
# '0)+0'2%$%+4%7+6&+#)4#/
1.&  #
$ '0)+0'2%$%+4%7+6&+#)4#/
0'9  #
 0'6914-$1#4&%+4%7+6&+#)4#/ #
 .1981.6#)'219'45722.;2%$%+4%7+6&+#)4#/
8  #
 .1981.6#)'219'45722.;2%$%+4%7+6&+#)4#/
8  #
# *+)*81.6#)'219'45722.;2%$%+4%7+6&+#)4#/
1.&  #
$ *+)*81.6#)'219'45722.;2%$%+4%7+6&+#)4#/
0'9  #
&+(('4'0%'5$'69''01.&0'98'45+1051(*825'0)+0'2%$ #

+0&':

XKK
4')7.#6+10

4')7.#6+10
.#5'45#('6;
8/1&'.10.;
6JKURTKPVGTKUEGTVKHKGFCUC%NCUU+NCUGTRTQFWEVWPFGTVJG75&GRCTVOGPVQH*GCNVJCPF
*WOCP5GTXKEGU
&**5 4CFKCVKQP2GTHQTOCPEG5VCPFCTFCEEQTFKPIVQVJG4CFKCVKQP
%QPVTQNHQT*GCNVJCPF5CHGV[#EVQH6JKUOGCPUVJCVVJGRTKPVGTFQGUPQVRTQFWEG
JC\CTFQWUNCUGTTCFKCVKQP
5KPEGTCFKCVKQPGOKVVGFKPUKFGVJGRTKPVGTKUEQORNGVGN[EQPHKPGFYKVJKPVJGRTQVGEVKXG
JQWUKPICPFGZVGTPCNEQXGTUVJGNCUGTDGCOECPPQVGUECRGHQTOVJGOCEJKPGFWTKPICP[
RJCUGQHWUGTQRGTCVKQP

(&#4')7.#6+105
8/1&'.10.;
6JG75(QQFCPF&TWI#FOKPKUVTCVKQP
(&# JCUKORNGOGPVGFTGIWNCVKQPUHQTNCUGT
RTQFWEVUOCPWHCEVWTGFQPCPFCHVGT#WIWUV%QORNKCPEGKUOCPFCVQT[HQT
RTQFWEVUOCTMGVGFKPVJG7PKVGF5VCVGU1PGQHVJGHQNNQYKPINCDGNUQPVJGDCEMQHVJG
RTKPVGTKPFKECVGUEQORNKCPEGYKVJVJG(&#TGIWNCVKQPUCPFOWUVDGCVVCEJGFVQNCUGT
RTQFWEVUOCTMGVGFKPVJG7PKVGF5VCVGU
6JGNCDGNHQT,CRCPGUGOCPWHCEVWTGFRTQFWEVU
/#07(#%674'& -
$416*'4+0&7564+'5.6&
0CGUJKTQEJQ/K\WJQMW0CIQ[C
,CRCP
6JKURTQFWEVEQORNKGUYKVJ(&#TCFKCVKQPRGTHQTOCPEG
UVCPFCTFU%(45WDEJCRVGT,

6JGNCDGNHQT%JKPGUGOCPWHCEVWTGFRTQFWEVU
/#07(#%674'& %
$416*'4%QTRQTCVKQP
#UKC .VF
5JGP\GP$WLK0CP.KPI(CEVQT[
)QNF)CTFGP+PF0CP.KPI8KNNCIG$WLK4QPI)CPI
5JGP\GP%*+0#
6JKURTQFWEVEQORNKGUYKVJ(&#TCFKCVKQPRGTHQTOCPEG
UVCPFCTFU%(45WDEJCRVGT,

%CWVKQP
7UGQHEQPVTQNUCFLWUVOGPVUQTRGTHQTOCPEGQHRTQEGFWTGUQVJGTVJCPVJQUGURGEKHKGFKP
VJKUOCPWCNOC[TGUWNVKPJC\CTFQWUTCFKCVKQPGZRQUWTG

XKKK
4')7.#6+10

+'%
8/1&'.10.;
6JKURTKPVGTKUC%NCUU+NCUGTRTQFWEVCUFGHKPGFKP+'%URGEKHKECVKQPU6JGNCDGN
UJQYPDGNQYKUCVVCEJGFKPEQWPVTKGUYJGTGTGSWKTGF

CLASS 1 LASER PRODUCT


APPAREIL LASER DE CLASSE 1
LASER KLASSE 1 PRODUKT

6JKURTKPVGTJCUCNCUGTFKQFGYJKEJGOKVUKPXKUKDNGNCUGTTCFKCVKQPKPVJG.CUGT7PKV6JG
.CUGT7PKVUJQWNFPQVDGQRGPGFYKVJQWVFKUEQPPGEVKPIVJGVYQEQPPGEVQTUEQPPGEVGFYKVJ
VJG#%RQYGTUWRRN[CPFNCUGTWPKV5KPEGVJGXCTKCDNGTGUKUVQTKPVJGNCUGTWPKVKUCFLWUVGF
KPCEEQTFCPEGYKVJVJGUVCPFCTFUPGXGTVQWEJKV
%CWVKQP
7UGQHEQPVTQNUCFLWUVOGPVUQTRGTHQTOCPEGQHRTQEGFWTGUQVJGTVJCPVJQUGURGEKHKGFKP
VJKUOCPWCNOC[TGUWNVKPJC\CTFQWUTCFKCVKQPGZRQUWTG

(QT(KPNCPFCPF5YGFGP
.71-#0.#5'4.#+6'
-.#55.#5'4#22#4#6
8CTQKVWU.CKVVGGPM¼[VV¼OKPGPOWWNNCMWKPV¼UU¼M¼[VVÑQJLGGUUCOCKPKVWNNCVCXCNNCUCCVVCC
CNVKUVCCM¼[VV¼L¼PVWTXCNNKUWWUNWQMCP[NKVV¼X¼NNGP¼M[O¼VVÑO¼NNGNCUGTU¼VGKN[NNG
8CTPKPIŌ1OCRRCTCVGPCPX¼PFUR¾CPPCVU¼VV¼PKFGPPC$TWMUCPXKUPKPIURGEKHKEGTCVU
MCPCPX¼PFCTGPWVU¼VVCUHÑTQU[PNKINCUGTUVT¾NPKPIUQOÑXGTUMTKFGTIT¼PUGPHÑTNCUGTMNCUU


KZ
5#('6;+0(14/#6+10

5#('6;+0(14/#6+10
%#76+10(14.#5'4241&7%6
9#40*+09'+5(74.#5'4&47%-'4
%#76+10 9JGPVJGOCEJKPGFWTKPIUGTXKEKPIKUQRGTCVGFYKVJVJGEQXGTQRGPVJG
TGIWNCVKQPUQH8$)CPFVJGRGTHQTOCPEGKPUVTWEVKQPUHQT8$)CTG
XCNKF
%#76+10 +PECUGQHCP[VTQWDNGYKVJVJGNCUGTWPKVTGRNCEGVJGNCUGTWPKVKVUGNH6Q
RTGXGPVFKTGEVGZRQUWTGVQVJGNCUGTDGCOFQPQVVT[VQQRGPVJGGPENQUWTG
QHVJGNCUGTWPKV
#%*670) +O(CNNGXQP5VÑTWPIGPFGT.CUGTGKPJGKVOW²FKGUGGTUGV\VYGTFGP&CU
)GJ¼WUGFGT.CUGTGKPJGKVFCTHPKEJVIGÑHHPGVYGTFGPFCUQPUV
.CUGTUVTCJNGPCWUVTGVGPMÑPPGP

.QECVKQPQHVJGNCUGTDGCOYKPFQY

#&&+6+10#.+0(14/#6+10
9JGPUGTXKEKPIVJGQRVKECNU[UVGOQHVJGRTKPVGTDGECTGHWNPQVVQRNCEGCUETGYFTKXGTQT
QVJGTTGHNGEVKXGQDLGEVKPVJGRCVJQHVJGNCUGTDGCO$GUWTGVQVCMGQHHCP[RGTUQPCN
CEEGUUQTKGUUWEJCUYCVEJGUCPFTKPIUDGHQTGYQTMKPIQPVJGRTKPVGT#TGHNGEVGFDGCO
VJQWIJKPXKUKDNGECPRGTOCPGPVN[FCOCIGVJGG[GU
5KPEGVJGDGCOKUKPXKUKDNGVJGHQNNQYKPIECWVKQPNCDGNKUCVVCEJGFQPVJGNCUGTWPKV

INVISIBLE LASER RADIATION WHEN OPEN AND INTERLOCK DEFEATED.


CAUTION AVOID DIRECT EXPOSURE TO BEAM. CLASS 3B LASER PRODUCT.

USYNLIG LASER STRÅLING NÅR KABINETLÅGET STÅR ÅBENT.


ADVARSEL UNGDÅ DIREKTE UDSÆTTELSE FOR STRÅLING. KLASSE 3B LASER.

OSYNLIG LASERSTRÅLNING NÄR DENNA DEL ÄR ÖPPNAD OCH SPÄRRAR


VARNING ÄR URKOPPLADE. STRÅLEN ÄR FARLIG. KLASS 3B LASER APPARAT.

AVATTAESSA JA SUOJALUKITUS OHITETTAESSA OLET ALTTIINA


VARO! NÄKYMÄTTÖMÄLLE LASERSÄTEILYLLE. ÄLÄ KATSO SÄTEESEEN. LUOKAN
3B LASERLAITE.

USYNLIG LASERSTRÅLING.UNNGÅ DIREKTE KONTAKT MED LASERENHETEN


ADVARSEL NÅR TOPPDEKSELET ER ÅPENT. KLASSE 3B LASERPRODUKT.

RADIATIONS LASER INVISIBLES QUANDOUVERT ET VERROUILLAGE ENLEVE.


ATTENTION EVITER EXPOSITIONS DIRECTES AU FAISCEAU. PRODUIT LASER CLASSE 3B.

UNSICHTBARE LASERSTRAHLUNG WENN ABDECKUNG


VORSICHT GEÖFFENT UND SICHERHEITSVERRIEGELUNG
ÜBERBRÜCKT. NICHT DEM STRAHL AUSSETZEN.
SICHERHEITSKLASSE 3B.

RADIACIÓN LASER INVISIBLE CUANDO SE ABRE


ATENCIÓN LA TAPA Y EL INTERRUPTOR INTERNO ESTÁ
ATASCADO. EVITE LA EXPOSICIÓN DIRECTA
DE LOS OJOS. PRODUCTO LASER CLASE 3B.

Z
5#('6;+0(14/#6+10

&'(+0+6+1051(9#40+0)5%#76+105#0&016'5
6JGHQNNQYKPIEQPXGPVKQPUCTGWUGFKPVJKUUGTXKEGOCPWCN

9#40+0)
+PFKECVGUYCTPKPIUVJCVOWUVDGQDUGTXGFVQRTGXGPVRQUUKDNGRGTUQPCNKPLWT[

! %#76+10
+PFKECVGUECWVKQPUVJCVOWUVDGQDUGTXGFVQUGTXKEGVJGRTKPVGTRTQRGTN[QTRTGXGPVFCOCIG
VQVJGRTKPVGT

016'
+PFKECVGUPQVGUCPFWUGHWNVKRUVQTGOGODGTYJGPUGTXKEKPIVJGRTKPVGT

.KUVGFDGNQYCTGVJGXCTKQWUMKPFUQHő9#40+0)ŒOGUUCIGUKPENWFGFKPVJKUOCPWCN

9#40+0)
#NYC[UVWTPQHHVJGRQYGTUYKVEJCPFWPRNWIVJGRQYGTEQTFHTQOVJGRQYGTQWVNGV
DGHQTGCEEGUUKPICP[RCTVUKPUKFGVJGRTKPVGT

9#40+0)
5QOGRCTVUKPUKFGVJGRTKPVGTCTGGZVTGOGN[JQVKOOGFKCVGN[CHVGTVJGRTKPVGTKUWUGF
9JGPQRGPKPIVJGHTQPVEQXGTQTTGCTEQXGTVQCEEGUUCP[RCTVUKPUKFGVJGRTKPVGT
PGXGTVQWEJVJGTGFEQNQTGFRCTVUUJQYPKPVJGHQNNQYKPIHKIWTGU

9#40+0)
+H[QWCPCN[\GOCNHWPEVKQPUYKVJVJGRQYGTRNWIKPUGTVGFKPVQVJGRQYGTQWVNGV
URGEKCNECWVKQPUJQWNFDGGZGTEKUGFGXGPKHVJGRQYGTUYKVEJKU1((DGECWUGKVKUC
UKPINGRQNGUYKVEJ

ZK
CHAPTER 1 GENERAL

CHAPTER 1 GENERAL

1. FEATURES

This printer has the following features;

High Resolution and Fast Print Speed


<HL-1230>
True 600 x 600 dots per inch (dpi) (GDI mode) and true 300 x 300 dots per inch (dpi) (GDI
mode) with microfine toner and up to 12 pages per minute (ppm) print speed (A4 or Letter
paper).
<HL-1440>
True 1200 x 600 dots per inch (dpi) for graphics and 600 x 600 dots per inch (dpi) (GDI mode)
and true 300 x 300 dots per inch (dpi) (PCL mode) with microfine toner . Up to 14 pages per
minute (ppm) print speed (A4 )and up to 15 pages per minute (ppm) print speed (Letter
paper).
<HL-1450/1470N>
True 600 x 600 , 300 x 300 dots per inch (dpi) and 1200 x 600 dots per inch (dpi) for graphics
with microfine toner Up to 14 pages per minute (ppm) print speed (A4)and up to 15 pages per
minute (ppm) print speed (Letter paper).Versatile Paper Handling
The printer loads paper automatically from the paper cassette. The paper cassette can hold
A4, letter, B5, Executive A5 and A6 sizes of paper. The manual feed slot allows manual paper
loading sheet by sheet so you can use a variety of types and sizes of paper.

Front Operation
Basic operation of the printer can be controlled from the front panel.

Enhanced Printing Performance and User-Friendly Operation for Windows


The dedicated printer driver for Microsoft Windows 95/98/Me, and Windows NT 4.0/2000
are available on the CD-ROM supplied with your printer. You can easily install them into your
Windows system using our installer program. The driver supports our unique compression
mode to enhance printing speed in Windows applications and allows you to choose various
printer settings including toner save mode, custom paper size, sleep mode, gray scale
adjustment, resolution, water mark and many layout functions. You can easily setup these
print options through the Printer Setup Menu.

Printer Status Monitor with Bi-directional Parallel Interface


The printer driver can monitor the status of your printer using bi-directional parallel
communications. IEEE-1284 bi-directional parallel printer cable is recommended.
The printer status monitor program can show the current status of your printer. If an error
occurs, the printer status monitor will appear to let you know what to correct. If you have turned
on the interactive Help ( Windows 95/98/Me only) you can get visual guidance on your PC
screen on the actions in the event of certain printer errors.

Quick Print Setup


The Quick Print Setup is a convenient utility to allow you to make changes to frequently used
driver settings easily without having to open the printer properties selection box every time. It
is launched automatically into the task tray when this printer driver is selected. You can
change the settings by clicking on the icon with the right mouse button.

1-1
CHAPTER 1 GENERAL

Enhanced Memory Management


The printer provides its own data compression technology in its printer hardware and the
supplied printer driver software, which can automatically compress graphic data and font data
efficiently into the printer’s memory. You can avoid memory errors and print most full page 600
dpi graphic and text data, including large fonts, with the standard printer memory.

USB Interface (for Windows 98/Me/2000, iMac and Power Macintosh G3 using USB with
HL-1440/1450/1470N only)
The printer can be connected using the Universal Serial Bus (USB) interface to a PC or Mac
which has a USB interface. Drivers that allow you to use the USB port are provided on the CD-
ROM supplied with the printer.

Remote Printer Console Program for DOS (for HL-1440/1450/1470N only)


The utility program, Remote Printer Console (RPC), is available on the CD-ROM supplied with
your printer. When you operate your computer in a DOS (Disk Operating System)
environment, this program allows you to easily change the default settings of the printer such
as fonts, page setup and emulations.
This program also provides a status monitor program, which is a Terminate-and-Stay Resident
(TSR) program. It can monitor the printer status while running in the background and report
the current status or errors on your computer screen.

Popular Printer Emulation Support (for HL-1440/1450/1470N only)


These printers support the following printer emulation modes;
The HL-1440 supports HP LaserJet IIP.The HL-1450/1470N supports HP LaserJet 6P (PCL6),
PostScript Level2 language emulation (Brother BR-Script Level 2), Epson FX-850 and IBM
Proprinter XL.
.
When you use DOS application software or Windows version 3.0 or earlier, you can use any
of these emulations to operate the HL-1450/1470N printers. The printers also support auto-
emulation switching between HP, Brother BR-Script 2 and Epson or HP, BR-Script 2 and IBM.
If you want to set the printer emulation, you can do it using the Remote Printer Console
Program.

High Resolution Control & Advanced Photoscale Technology (for HL-1450/1470N only)
High Resolution Control (HRC) technology provides clear and crisp printouts. Use this function
to get smooth text print quality.
Advanced Photoscale Technology (APT) enables the printer to print graphics in 256
grayscales, producing nearly photographic quality. Use this function when you want to print
photographic images.

Environment-Friendly
<Economy Printing Mode>
This feature will cut your printing cost by saving toner. It is useful for obtaining draft copies for
proof-reading. You can select the economy modes through the Windows printer driver
supplied with your printer.
<Sleep Mode (Power Save Mode)>
Sleep mode automatically reduces power consumption when the printer is not in use for a
certain period of time. The printer consumes less than 5W (HL-1230), 6W (HL-1440/1450) or
12W (HL-1470N) when in sleep mode.
<Low Running Cost>
Since the toner cartridge is separate from the drum unit, you need to replace only the toner
cartridge after around 3,000 pages for the standard cartridge and around 6,000 pages for the
optional high-capacity cartridge, which is both cost effective and ecologically friendly.

1-2
CHAPTER 1 GENERAL

Bar Code Print (for HL-1450/1470N only)


The printer can print the following 11 types of bar codes;
• Code 39 • US-PostNet • EAN-8
• Code 128 • ISBN • EAN-13
• Interleaved 2 of 5 • UPC-A • EAN-128
• Codabar • UPC-E

Network Feature (for HL-1470N only)


The Brother printer has built in multi protocol network capability as standard. This allows
multiple host computers to share the printer on a 10/100Mbit Ethernet network. Any users can
print their jobs as if the printer was directly connected to their computer. Users on Windows®
®
95/98/Me, Windows NT4.0/2000 , UNIX, Novell, Apple Macintosh, LAN server and OS/2 Warp
server computer simultaneously can access this printer. For further information, see the
Network User’s Guide supplied with the printer.

1-3
CHAPTER 1 GENERAL

2. OVERVIEW

<Front View>
Output tray

Tray extension flap

Control panel

Front cover

Manual feed paper guides


Manual feed slot
Paper indicator
Paper cassette

Fig. 1-1

<Rear View>

HL-1230/1440

Rear cover

USB interface connector


(for HL-1440 only)

Parallel interface connector


Power switch
AC power inlet

Fig. 1-2

HL-1450/1470N

Network interface
(for HL-1470N only)

Network board
Rear cover (for HL-1470N only)

Modular jack for 10/100BASE TX


Lower Tray Unit LFA TEST

USB interface
connector

Parallel interface Network port LED Test button


connector Power switch
AC power inlet

Fig. 1-3

1-4
CHAPTER 1 GENERAL

3. SPECIFICATIONS

3.1 Printing
Print method Electrophotography by semiconductor laser beam scanning

Laser Wave length: 780 nm


Output: 5mW max

Resolution HL-1230: 600 x 600 dots/inch,300 x 300 dots/inch


( for Windows )

HL-1440: 1200(H) x 600(V) dots/inch


(for Windows DIB graphics and Machintosh for
graphics)
600 x 600 dots/inch,300 x 300 dots/inch (for
Windows and Machintosh)
300 x 300 dots/inch (under DOS)

HL-1450: 1200(H) x 600(V) dots/inch


(for Windows DIB graphics and Machintosh for
graphics)
600 x 600 dots/inch,300 x 300 dots/inch
(for Windows and Machintosh)
600 x 600 dots/inch (under DOS)
600 x 600 dots/inch ,300 x 300 dots/inch(for HRC)

HL-1470N: 1200(H) x 600(V) dots/inch (for Windows DIB


graphics and Machintosh for graphics)
600 x 600 dots/inch,300 x 300 dots/inch
(for Windows and Machintosh)
600 x 600 dots/inch (for DOS)
600 x 600 dots/inch ,300 x 300 dots/inch(for HRC)

Print quality Normal printing mode


Economy printing mode
Print speed HL-1230: Up to 12 pages/minute

HL-1440/1450/1470N: Up to 14 pages/minute*
(when loading A4 from the paper cassette.)
Up to 15 pages/minute
(when loading letter-size paper from the paper cassette.)

Warm-up Max. 25 seconds at 23°C (73.4°F)

First print 15 seconds


(when loading A4 or Letter-size paper from the paper cassette.)

Print media Toner cartridge


Life expectancy: 3,000 pages/cartridge (Standard cartridge)
6,000 pages/cartridge (High-capacity cartridge)
(when printing A4 or Letter-size paper at 5% print coverage)

Developer Drum unit

1-5
CHAPTER 1 GENERAL

Life expectancy: 20,000 pages/drum unit

*NOTE:
Print speed varies depending on the paper size or media type. For details, refer to APPENDIX
3 ‘PRINT SPEEDS WITH VARIOUS SETTINGS’.

1-6
CHAPTER 1 GENERAL

PR2002059

3.2 Functions
CPU HL-1230/1440: MB86833 66MHz
HL-1450/1470N: MB86832 66MHz

Emulation HL-1230: Brother Printing Solution for Windows


HL-1440: Brother Printing Solution for Windows
HP LaserJet IIP (PCL level 4)

HL-1450/1470N:Brother Printing Solution for Windows


Automatic emulation selection among HP LaserJet 6P
(PCL level 6), Brother BR-Script Level 2, EPSON FX-
850 or IBM Proprinter XL

Printer driver <PCL Driver>


• Windows 95/98/Me, Windows NT 4.0/2000 driver, supporting
Brother Native Compression mode
• Windows 95/98/Me driver, supporting bi-directional capacity
<PS Driver>
PPD file driver for Windows 95/98/Me and Windows NT 4.0/2000
driver (for HL-1450/1470N )
<Others>
• iMac, Power Macintosh G3 with USB printer driver (for HL-
1440/1450/1470N only)
Interface • Bi-directional parallel
• Universal Serial Bus (USB) (for HL-1440/1450/1470N only)

• 10/100 BaseTX Ethernet network interface (for HL-1470N only)

Memory HL-1230 No memory expansion is possible


HL-1440: 2.0 Mbytes of standard memory and a slot for
optional additional memory
Expandable up to 34 Mbytes by installing an
industry standard SIMM for HL-1440
HL-1450/1470N: 4.0 Mbytes of standard memory plus a standard
4.0 Mbytes SIMM.
Expandable up to 36 Mbytes by
Exchanging the industry
standard SIMM
Control panel 1 button and 4 LEDs

Diagnostics Self-diagnostic program

*NOTE:
The SIMM must have the following specifications;
Type: 72 pin (Both EDO RAM and Fast page mode DRAM can be used.)
Access time: 60 nsec - 80 nsec
Capacity: 1, 2, 4, 8, 16, 32 Mbyte
(Although the 64 Mbyte SIMM can be installed, only 32 Mbyte is effective.)
Height: 25.4 mm (1.00 inches) or less
Output: 32 bit or 36 bit (independent of parity)

1-7
CHAPTER 1 GENERAL

3.3 Electrical and Mechanical


Power source U.S.A. and Canada: AC 110 to 120V, 50 Hz/60 Hz
Europe and Australia: AC 220 to 240V, 50 Hz/60 Hz

Power consumption Printing (peak)*: 940 W or less


(Under 25°C / 77°F) Printing (average): 340 W or less
Standing by: 70 W or less
Sleep*: 5 W or less (HL-1230)
6 W or less (HL-1440/1450)
12 W or less (HL-1470N)

Noise Printing: 50 dB A or less


Standing by: Silent

Temperature Operating: 10 to 32.5°C (50 to 90.5°F)


Non operating: 0 to 40°C (38 to 104°F)
Storage: -20 to 40°C (-4 to 104°F)

Humidity Operating: 20 to 80% (non condensing)


Storage: 10 to 85% (non condensing)

Dimensions A4 paper cassette installed: 360 x 370 x 235 mm


(W x D x H) (14.2 x 14.6 x 9.3 inches)
Legal paper cassette installed: 360 x 430 x 235 mm
(14.2 x 16.9 x 9.3 inches)
A4 lower paper cassette installed: 360 x 370 x 345 mm
(HL-1450/1470N only) (14.2 x 14.6 x 13.6 inches)
Legal lower paper cassette installed: 360 x 430 x 345 mm
(HL-1450/1470N only) (14.2 x 16.9 x 13.6 inches)

Weight Approx. 9.2 kg (20.3 lb.) including the drum unit.


Approx. 12.7 kg (27.9 lb.) including the drum unit and Lower Tray unit.

*NOTE:
• The peak figure of power consumption is worked out when the halogen heater lamp is
turned ON.
• The peak figure of power consumption is worked out excluding inrush current value.
• The peak figure of power consumption is a reference value and should be used internally at
Brother offices only.
• The power consumption figure quoted for sleep mode is when the fan has stopped.

1-8
CHAPTER 1 GENERAL

3.4 Network (for HL-1470N only ,Option for HL-1230/1440/1450 )


Type / Speed 10/100 Base TX Ethernet
Auto speed detection

Protocols • HL-1230/1440/1450
• TCP/IP,IPX/SPX,NetBEUI,DLC/LLC,DEC LAT,Banyan
VINES
• HL-1470N
• TCP/IP,AppleTalk,PIPX/SPX,DLC/LLC

Management • Web Based Management


• BRAdmin Professional Windows based management utility
• TELNET and Netware Command Console
• SNMP/MIB II
• HP JetAdmin / Web JetAdmin compatible

Firmware update 2MB flash ROM. Use BRAdmin Professional when upgrading print
server software or BOOTP, TFTP PUT/GET or IPX for Netware.
Supplied software • BRAdmin Professional management utility (for Windows
95/98/Me/NT 4.0/2000)
• Port driver for Windows 95/98/Me/NT 4.0/2000
LPR port driver (for Windows 95/98/Me only)
NetBIOS port driver
SMTP port driver

1-9
CHAPTER 1 GENERAL

3.5 Paper
3.5.1 Feedable paper
(1) Type & size
Feeding source Paper type Paper size
Paper cassette Normal paper A4, Letter, B5 (ISO), A5, A6, Executive, Legal*
Transparencies
Manual feed slot Normal paper A4, Letter, B5 (JIS/ISO), A5, A6, Executive, Legal
70-216 x 116-356 mm
(2.75-8.5 x 4.57-14 inches)
Envelopes DL, C5, COM10, Monarch, B5 (ISO)

Labels A4, Letter


Transparencies A4, Letter
Other sizes 70-216 x 116-356 mm (2.75-8.5 x 4.57-14 inches)
Optional lower Normal paper A4, Letter, B5 (ISO), A5, Executive, Legal*
paper cassette Transparencies
(HL-1450/1470N only)
*NOTE:
Legal-size paper can be printed with the standard paper cassette or the optional lower cassette
for the US and Canada models only.
Other paper specifications
<Paper Cassette>
Cut sheet
2
Basis weight 60 to 105 g/m (16 to 28 lb.)
Caliper 0.08 to 0.13 mm (0.003 to 0.005 in.)
Moisture content 4% to 6% by weight

<Manual Feed Slot>


Cut sheet Envelope
2 2
Basis weight 60 to 161 g/m (16 to 43 lb.) 75 to 90 g/m (20 to 24 lb.)
single thickness
Caliper 0.08 to 0.2 mm (0.003 to 0.008 in.) 0.084 to 0.14 mm (0.003 to 0.005 in.)
single thickness
Moisture content 4% to 6% by weight 4% to 6% by weight

(3) Recommended paper


2
• Letter: Xerox 4200 (75 g/m )
2
• A4: Xerox 80 Premier Paper (80 g/m )
• Label: Avery laser label or equivalent
• Transparency: 3M CG3300 or equivalent

! CAUTION:
When you are choosing print media, be sure to follow the information given below to prevent
any paper jams, print quality problems or printer damage;
• It is recommended to use long-grained paper for the best print quality. If short-grained
paper is being used, it might be the cause of paper jams.
• Use neutral paper. Do not use acid paper to avoid any damage to the drum unit.

1-10
CHAPTER 1 GENERAL

• Avoid using coated paper such as vinyl coated paper.


• Avoid using preprinted or highly textured paper.
• It is recommended to use labels or transparencies which are designed for use in laser
printers.
• Avoid feeding labels with the carrier sheet exposed, or the printer will be damaged.
• Before loading paper with holes such as organizer sheets, be sure to fan the stack well.
• Do not use organizer sheets that are stuck together. The glue that is used might caused
damaged to the printer.
• When printing on the back of pre-printed paper, if the paper is curled, be sure to straighten
the paper as much as possible.
• Different types of paper should not be loaded at the same time in the paper cassette to
avoid any paper jams or misfeeds.

1-11
CHAPTER 1 GENERAL

3.5.2 Paper cassette capacity


(1) Maximum load height
Paper cassette:
<Normal paper> Up to 27mm (1.06 inches) in height
2
(250 sheets of 80 g/m A4/Letter paper)
<Transparencies> 10 sheets

(2) Paper feed conditions

Type Weight Cassette Manual feed


(1 sheet)
2 !
60 to 105 g/m
(250 sheet) !
Normal paper (cut sheet)
2
161 g/m ✕ !
Labels ✕ !
Special paper (cut sheet) Envelopes ✕ !
Organizers ✕ !

3.5.3 Print delivery


(1) Output tray stacking
2
capacity: Maximum 150 sheets (80 g/m )
face-down only
(2) Straight paper path output at the rear of the printer
capacity: 1 sheet **Thicker paper printing is recommended.
face-up only
NOTE:
• When using the straight paper path feed and the rear output method for thicker paper
printing, lift up the rear cover at the rear of the printer.
• Face-down: Delivery with the printed face of the paper downwards.
Face-up: Delivery with the printed face of the paper upwards.

1-12
CHAPTER 1 GENERAL

3.6 Printing Area


3.6.1 Effective printing area
The effective printing area means the area within which the printing of all the data received
without any omissions can be guaranteed.

(1) Supported by the engine (2) Supported by the emulation

208mm

25 25
4.23mm 2,400 (80 characters)

NOTE:
• The units in the above figure are dot size
based on 300 dpi resolution.
• 25 dots at both sides is for italic characters.

4.23mm

3.6.2 Print guaranteed area

A
F
E C E

B D

The values above vary depending on the paper size. For details, see the table on the next
page.

1-13
CHAPTER 1 GENERAL

The table below shows the print guaranteed areas for each paper size.

Size A B C D E F
210.0 mm 297.0 mm 203.2 mm 288.5 mm 3.4 mm 4.23 mm
A4 8.27” 11.69” 8.0” 11.36” 0.13” 0.17”
(2,480 dots) (3,507 dots) (2,400 dots) (3,407 dots) (40 dots) (50 dots)
215.9 mm 279.4 mm 203.2 mm 270.9 mm 6.35 mm
Letter 8.5” 11.0” 8.0” 10.67” 0.25” "
(2,550 dots) (3,300 dots) (2,400 dots) (3,200 dots) (75 dots)
215.9 mm 355.6 mm 203.2 mm 347.1 mm
Legal 8.5” 14.0” 8.0” 13.67” " "
(2,550 dots) (4,200 dots) (2,400 dots) (4,100 dots)
176.0 mm 250.0 mm 164.0 mm 241.5 mm
B 5 (ISO) 6.93” 9.84” 6.46” 9.5” " "
(2,078 dots) (2,952 dots) (1,936 dots) (2,852 dots)
184.15 mm 266.7 mm 175.7 mm 258.2 mm 6.35 mm
Executive 7.25” 10.5” 6.92” 10.17” 0.25” "
(2,175 dots) (3,150 dots) (2,025 dots) (3,050 dots) (75 dots)
148.5 mm 210.0 mm 136.5 mm 201.5 mm 6.01 mm
A5 5.85” 8.27” 5.37” 7.93” 0.24” "
(1,754 dots) (2,480 dots) (1,612 dots) (2,380 dots) (71 dots)
105.0 mm 148.5 mm 93.0 mm 140.0 mm
A6 4.13” 5.85” 3.66” 5.51” " "
(1,240 dots) (1,754 dots) (1,098 dots) (1,654 dots)
69.85 mm 116.0 mm 56.2 mm 107.5 mm 6.35 mm
Organizer
(J size)
2.75” 4.57” 2.21” 4.23” 0.25” "
(825 dots) (1,370 dots) (675 dots) (1,270 dots) (75 dots)
95.25 mm 171.45 mm 86.78 mm 162.98 mm
Organizer
(K size)
3.75” 6.75” 3.42” 6.42” " "
(1,125 dots) (2,025 dots) (975 dots) (1,925 dots)
139.7 mm 215.9 mm 131.23 mm 207.43 mm
Organizer
(L size)
5.5” 8.5” 5.17” 8.17” " "
(1,650 dots) (2,550 dots) (1,500 dots) (2,450 dots)
104.78 mm 241.3 mm 92.11 mm 232.8 mm
COM10 4.125” 9.5” 3.63” 9.16” " "
(1,237 dots) (2,850 dots) (1,087 dots) (2,750 dots)
98.43 mm 190.5 mm 85.7 mm 182.0 mm
MONARCH 3.875” 7.5” 3.37” 7.16” " "
(1,162 dots) (2,250 dots) (1,012 dots) (2,150 dots)
162 mm 229 mm 150.0 mm 220.5 mm 6.01 mm
C5 6.38” 9.01” 5.9” 8.68” 0.24” "
(1,913 dots) (2,704 dots) (1,771 dots) (2,604 dots) (71 dots)
110 mm 220 mm 98.0 mm 211.5 mm
DL 4.33” 8.66” 3.86” 8.33” " "
(1,299 dots) (2,598 dots) (1,157 dots) (2,498 dots)

NOTE:
• The paper sizes indicated here should conform to the nominal dimensions specified by JIS.
• A4 paper must accommodate 80 characters printed in pica pitch (203.2 mm).
• The dot size is based on 300 dpi resolution.
• Organizer is not supported by any printer emulations (commands).

1-14
%*#26'4+056#..#6+10#0&$#5+%12'4#6+10

%*#26'4+056#..#6+10#0&$#5+%12'4#6+10

 %10&+6+1054'37+4'&(14+056#..#6+10

 2QYGT5WRRN[
• 6JGUQWTEGXQNVCIGOWUVUVC[YKVJKPvQHVJGTCVGFXQNVCIGUJQYPQPVJGTCVKPIRNCVG
• 6JGRQYGTEQTFKPENWFKPIGZVGPUKQPUUJQWNFPQVGZEGGFOGVGTU
HGGV 
• &QPQUJCTGVJGUCOGRQYGTEKTEWKVYKVJQVJGTJKIJRQYGTCRRNKCPEGURCTVKEWNCTN[CPCKT
EQPFKVKQPGTEQRKGTQTUJTGFFGT+HKVKUWPCXQKFCDNGVJCV[QWOWUVWUGVJGRTKPVGTYKVJVJGUG
CRRNKCPEGUKVKUTGEQOOGPFGFVJCV[QWWUGCPKUQNCVKQPVTCPUHQTOGTQTCJKIJHTGSWGPE[
PQKUGHKNVGT
• 7UGCXQNVCIGTGIWNCVQTKHVJGRQYGTUQWTEGKUPQVUVCDNG

 'PXKTQPOGPV
• 6JGRTKPVGTUJQWNFDGKPUVCNNGFPGCTCRQYGTQWVNGVYJKEJKUGCUKN[CEEGUUKDNG
• 6JGTQQOVGORGTCVWTGKUOCKPVCKPGFDGVYGGPu%CPFu%6JGTGNCVKXGJWOKFKV[KU
OCKPVCKPGFDGVYGGPCPF
• 6JGRTKPVGTUJQWNFDGWUGFKPCYGNNXGPVKNCVKQPTQQO
• 2NCEGVJGRTKPVGTQPCHNCVJQTK\QPVCNUWTHCEG
• -GGRVJGRTKPVGTENGCP&QPQVRNCEGVJGRTKPVGTKPCFWUV[RNCEG
• &QPQVRNCEGVJGRTKPVGTYJGTGVJGXGPVKNCVKQPJQNGQHVJGRTKPVGTKUDNQEMGF-GGR
CRRTQZKOCVGN[OO
KPEJGU DGVYGGPVJGXGPVKNCVKQPJQNGCPFVJGYCNN
• &QPQVRNCEGVJGRTKPVGTYJGTGKVKUGZRQUGFVQFKTGEVUWPNKIJV7UGCDNKPFQTCJGCX[
EWTVCKPVQRTQVGEVVJGRTKPVGTHTQOFKTGEVUWPNKIJVYJGPVJGRTKPVGTKUWPCXQKFCDN[UGVWRPGCT
CYKPFQY
• &QPQVRNCEGVJGRTKPVGTPGCTFGXKEGUVJCVEQPVCKPOCIPGVUQTIGPGTCVGOCIPGVKEHKGNFU
• &QPQVUWDLGEVVJGRTKPVGTVQUVTQPIRJ[UKECNUJQEMUQTXKDTCVKQPU
• &QPQVGZRQUGVJGRTKPVGTVQQRGPHNCOGUQTUCNV[QTEQTTQUKXGICUUGU
• &QPQVRNCEGQDLGEVUQPVQRQHVJGRTKPVGT
• &QPQVRNCEGVJGRTKPVGTPGCTCPCKTEQPFKVKQPGT
• -GGRVJGRTKPVGTJQTK\QPVCNYJGPECTT[KPI
• &QPQVEQXGTVJGUNQVUKPVJGUKFGEQXGT

 5[UVGO4GSWKTGOGPVUHQT$TQVJGT2TKPVGT5QNWVKQPHQT9KPFQYU
%JGEMVJGHQNNQYKPIU[UVGOTGSWKTGOGPVUVQUGVWRCPFQRGTCVGVJGRTKPVGTWUKPI$TQVJGT
2TKPVKPI5QNWVKQPHQT9KPFQYU
• +$/2%QTEQORCVKDNGYKVJ5:QTJKIJGTOKETQRTQEGUUQT
• /$QHURCEGCXCKNCDNGQP[QWTJCTFFKUMHQTVJGRTKPVGTFTKXGTCPFCNNHQPVU
• 9KPFQYU/GQT9KPFQYU06


%*#26'4+056#..#6+10#0&$#5+%12'4#6+10

 702#%-+0)

9JGPWPRCEMKPIVJGRTKPVGTEJGEMVQUGGVJCVCNNQHVJGHQNNQYKPIEQORQPGPVUCTGKPENWFGFKP
VJGECTVQP

Printer

Paper cassettle

Drum unit Documents


(with Toner cartridge included)

CD-ROM AC cord

(KI

016'
%QORQPGPVUOC[XCT[FGRGPFKPIQPVJGEQWPVT[


%*#26'4+056#..#6+10#0&$#5+%12'4#6+10

 +056#..6*'24+06'4

+ORNGOGPVCVKQPQHJCTFYCTGUGVWRCPFFTKXGTKPUVCNNCVKQPVQWUGVJGRTKPVGT
(KTUVN[KFGPVKH[VJG1RGTCVKPI5[UVGOQP[QWTEQORWVGT
9KPFQYU/G9KPFQYU06
QT/CEKPVQUJ 6JGPRWTEJCUGVJGCRRTQRTKCVGKPVGTHCEGECDNG
RCTCNNGNQT75$QT
PGVYQTM HQT[QWTEQORWVGT75$KPVGTHCEGQRVKQPKUPQVCXCKNCDNGQP*.RTKPVGT
6JGKPUVCNNCVKQPRTQITCOUHQTVJGJCTFYCTGUGVWRCPFFTKXGTKPUVCNNCVKQPCTGEQPVCKPGFQPVJG
UWRRNKGF%&41/

 (QT#NN7UGTU

(QT9KPFQYUs7UGTU


 6WTPQP[QWT2%RQYGT%NQUGCNNVJGCRRNKECVKQPUTWPPKPIQP[QWT2%

 +PUGTVVJGUWRRNKGF%&41/KPVQVJG%&41/FTKXG

 6JGQRGPKPIUETGGPYKNNCRRGCTCWVQOCVKECNN[KP9KPFQYU/GCPF06

 %NKEMVJGOQFGNPWODGTQH[QWTRTKPVGT5GNGEVVJGCRRTQRTKCVGNCPIWCIG

 %NKEMVJGKPKVKCNUGVWRKEQP

 6JGKPKVKCN5GVWRKPUVTWEVKQPUYKNNCRRGCTQPVJGFKURNC[ 
016'
• +HVJGQRGPKPIUETGGPFQGUPQVCRRGCT
%NKEM5VCTVCPFUGNGEV4WP6JGPV[RGD:\START.EXEKPVJGEQOOCPFNKPGDQZCPFENKEM1-

+H[QWT%&41/FTKXGKUPQV&V[RGVJGEQTTGEVFTKXGNGVVGTKPUVGCFQHőDŒ

(QT/CEKPVQUJs7UGTU


 6WTPQP[QWT2%RQYGT%NQUGCNNVJGCRRNKECVKQPUTWPPKPIQP[QWT2%

 +PUGTVVJGUWRRNKGF%&41/KPVQVJG%&41/FTKXG

 &QWDNGENKEMVJG+PKVKCN5GVWRKEQP

 %NKEMVJGOQFGNPWODGTQH[QWTRTKPVGT5GNGEVVJGCRRTQRTKCVGNCPIWCIG

 %NKEMVJGKPKVKCNUGVWRKEQP

 6JGKPKVKCN5GVWRKPUVTWEVKQPUYKNNCRRGCTQPVJGFKURNC[

 +PUVCNNVJGFTWOWPKVCUUGODN[

 1RGPVJGHTQPVEQXGT

 7PRCEMVJGFTWOWPKVCUUGODN[CPF
TGOQXGVJGRTQVGEVKXGRCTV

 4QEMKVHTQOUKFGVQUKFGQTVKOGUVQ
FKUVTKDWVGVJGVQPGTGXGPN[KPUKFGVJG
CUUGODN[
(KI

(KI


 +PUVCNNVJGFTWOWPKVKPVQVJGRTKPVGTCPFENQUGVJGHTQPVEQXGT


%*#26'4+056#..#6+10#0&$#5+%12'4#6+10

 .QCFRCRGTKPVJGRCRGTECUUGVVG

 2WNNVJGRCRGTECUUGVVGEQORNGVGN[QWVQHVJGRTKPVGT

 5NKFGVJGCFLWUVGTUVQVJGRCRGTUK\G[QW
YCPVWPVKNVJG[UPCRKPVQCUNQV
(KI

(KI


 .QCFRCRGTKPVQVJGRCRGTECUUGVVG
%JGEMVJCVRCRGTKUHNCVRNCEGF
(KI
2CRGTUJQWNFDGNQCFGFDGNQYVJG
OCZKOWORCRGTOCTM

 4GKPUVCNNVJGRCRGTECUUGVVGKPVQVJG
RTKPVGT

(KI

 2TKPVCVGUVRCIG

 /CMGUWTGVJGRTKPVGTRQYGTUYKVEJKU
1((%QPPGEVVJG#%RQYGTEQTFVQVJG
RTKPVGT&1016EQPPGEVVJGKPVGTHCEG
ECDNG

 2NWIVJG#%RQYGTEQTFKPVQCP#%QWVNGV
CPFVJGPVWTP10VJGRQYGTUYKVEJ
(KI


 #HVGTVJGRTKPVGTJCUHKPKUJGFYCTPKPIWR
VJG)TGGP4'#&;.'&YKNNEJCPIGHTQO
$NKPMKPIVQ.KV'ZVGPFVJGVTC[GZVGPUKQP
HNCR
 #%RQYGTEQTF

 2TGUUVJG%QPVQTNRCPGNDWVVQP6JG
RTKPVGTRTKPVUCVGUVRCIG%JGEMVJCVVJG
VGUVRCIGJCURTKPVGFEQTTGEVN[
5''
016' (KI

016'
6JKUHWPEVKQPKUCXCKNCDNGQPN[YJGPVJGKPVGTHCEGECDNGKUPQVEQPPGEVGF


%*#26'4+056#..#6+10#0&$#5+%12'4#6+10

(QT2CTCNNGNKPVGTHCEGECDNGWUGTU
HQT9KPFQYUs7UGTU

(QNNQYVJGUVGRUDGNQYQPN[CHVGTEQORNGVKPIUVGRUVJTQWIJVQCDQXG

%QPPGEVVJGRTKPVGTVQ[QWT2%+PUVCNNVJGRTKPVGTFTKXGT 


 %NKEMŒ%QPPGEVVJGKPVGTHCEGECDNGKPUVCNNVJGFTKXGTWVKNKVKGU

 5GNGEVVJGRCTCNNGNKPVGTHCEGECDNG*.WUGTUYKNNPQVUGGVJKUUETGGP

 6WTPQHHVJGRTKPVGTRQYGTUYKVEJ

 %QPPGEVVJGKPVGTHCEGECDNGVQVJGEQORWVGTVJGPEQPPGEVKVVQVJGRTKPVGT

 6WTPQPVJGRTKPVGTRQYGTUYKVEJ

 (QNNQYVJGKPUVTWEVKQPUQPVJGUETGGP

 %NKEMVJG0GZVDWVVQPVJGPVJG(KPKUJDWVVQP6JGUGVWRKUPQYEQORNGVG 

(QT75$KPVGTHCEGECDNGWUGTU
HQT9KPFQYUs7UGTU

+PUVCNNVJGFTKXGT%QPPGEVVJGRTKPVGTVQ[QWT2%

 %NKEMő%QPPGEVVJGKPVGTHCEGECDNGKPUVCNNVJGFTKXGTWVKNKVKGU

 5GNGEVVJG75$ECDNG
(QT*.0

 (QNNQYVJGKPUVTWEVKQPQPVJGUETGGP

 %NKEMVJG0GZVDWVVQP

 /CMGUWTGVJGRTKPVGTRQYGTUYKVEJKU10

 %QPPGEVVJG75$KPVGTHCEGECDNGVQVJG2%CPFVJGPEQPPGEVKVVQVJGRTKPVGT%NKEMVJG
0GZVDWVVQP

 %NKEMVJG(KPKUJDWVVQP

(QT9KPFQYU/GWUGTU6JGUGVWRKUPQYEQORNGVG
(QT9KPFQYUWUGTU4GHGTVQVJGPGZVUGEVKQP 5GVVKPIVJG2%RTKPVGTRQTV

 5GVVKPIVJG2%RTKPVGTRQTV
HQT9KPFQYUs7UGTUQPN[


 #HVGTVJG2%JCUTGUVCTVGFENKEM5VCTV5GVVKPICPF2TKPVGTU

 5GNGEVVJG$TQVJGT*.0UGTKGUKEQP

 %NKEMVJG(KNGOGPWCPFVJGPUGNGEV5GVCU&GHCWNVRTKPVGT

 6JGUGVWRKUPQYEQORNGVG



%*#26'4+056#..#6+10#0&$#5+%12'4#6+10

(QT75$KPVGTHCEGECDNGWUGTU
HQT/CEKPVQUJs7UGTU

s
+PUVCNNVJGFTKXGT%QPPGEVVJGRTKPVGTVQ[QWT/CEKPVQUJ


 %NKEMő%QPPGEVVJGKPVGTHCEGECDNGKPUVCNNVJG
FTKXGTWVKNKVKGUŒ

 +HVJGUETGGPCRRGCTU5GNGEV75$ECDNG
*.
0 

 (QNNQYVJGKPUVTWEVKQPQPVJGUETGGPCPFTGUVCTV
s
VJG/CEKPVQUJ 

 /CMGUWTGVJGRTKPVGTRQYGTUYKVEJKU10
%QPPGEVVJG75$KPVGTHCEGECDNGVQVJG
s
/CEKPVQUJ CPFVJGPEQPPGEVKVVQVJGRTKPVGT
s

 1RGPVJG%JQQUGTHTQOVJG#RRNG OGPWQPVJG
s
/CEKPVQUJ 

 %NKEMVJG*.0KEQPCPFUGNGEVKV
6JGUGVWRKUPQYEQORNGVG



(QT0GVYQTM7UGTU

016'
(QTEQPPGEVKPIVJGRTKPVGTVQCPGVYQTMKVKUTGEQOOGPFGFVQEQPVCEV[QWTU[UVGO
CFOKPKUVTCVQTRTKQTVQKPUVCNNCVKQP
• (QTVJGCFOKPKUVTCVQT%QPHKIWTGVJGRTKPVGTTGHGTTKPIVQVJGHQNNQYKPIKPUVTWEVKQP
• (QTKPUVCNNKPIVJGFTKXGTQPVJG2%TGHGTVQVJGHQNNQYKPIKPUVTWEVKQPUQPEGVJGCFOKPKUVTCVQT
JCUEQPHKIWTGFVJGRTKPVGT


%*#26'4+056#..#6+10#0&$#5+%12'4#6+10

(QTVJGCFOKPKUVTCVQT
+PUVCNNVJG$4#FOKP2TQHGUUKQPCN%QPHKIWTCVKQPWVKNKV[
6JG$4#FOKP2TQHGUUKQPNCNUQHVYCTGRTQXKFGUUQRJKUVKECVGFPGVYQTMCPFRTKPVGTOCPCIGOGPV
ECRCDKNKVKGUHQT$TQVJGTCPFPQP$TQVJGTRTQFWEVU$[KFGPVKH[KPIRQVGPVKCNRTQDNGOUDGHQTGVJG[
CTKUGCPFD[CFFTGUUKPIKORQTVCPV+6TGSWKTGOGPVUUWEJCUUVTGCONKPGFRTKPVGTEQPHKIWTCVKQP
OCUUEQPHKIWTCVKQPCPFGPVGTRTKUGYKFGWRITCFGUVJG$4#FOKP2TQHGUUKQPCNUQHVYCTGRNC[U
CPKORQTVCPVTQNGKPRTKPVGTPGVYQTMOCPCIGOGPV


 +PUGTVVJG%&41/

 5GNGEVVJG*.0OQFGNDWVVQPCPFVJGPUGNGEVVJGCRRTQRTKCVGNCPIWCIG

 %NKEMVJG+PUVCNN5QHVYCTGKEQP

 5GNGEV$4#FOKP2TQHGUUKQPCN+PUGTVVJG$4#FOKP2TQHGUUKQPCNWVKNKV[TGHGTTKPIVQVJGQP
UETGGPKPUVTWEVKQPU

&TKXGT&GRNQ[OGPV9K\CTF
6JG&TKXGT&GRNQ[OGPV9K\CTFECPDGWUGFVQJGNRYKVJVJGKPUVCNNCVKQPQHNQECNN[QTPGVYQTM
EQPPGEVGF$TQVJGTRTKPVGTU+VECPCNUQETGCVGUGNHTWPPKPIGZGEWVCDNGHKNGUVJCVCWVQOCVGVJG
KPUVCNNCVKQPCPFEQPHKIWTCVKQPQH$TQVJGTRTKPVGTFTKXGTUQPVQNQECNN[QTPGVYQTMEQPPGEVGF
9KPFQYUU[UVGOU

6QCEEGUUVJG&TKXGT&GRNQ[OGPV9K\CTF

 +PUGTVVJG%&41/UWRRNKGFYKVJVJGRTKPVGT

 %NKEMVJG+PUVCNN5QHVYCTGKEQPCPFUGNGEVVJG0GVYQTM2TKPVGT&TKXGT9K\CTF


2TKPVEQPHKIWTCVKQPRCIG
6QRTKPVCEQPHKIWTCVKQPRCIGWUGCHKPGDCNNRQKPVRGPVQJQNFFQYPVJG0GVYQTM6GUV$WVVQP
HQTNGUUVJCPUGEQPFU

(CEVQT[FGHCWNVUGVVKPI
6QTGUGVVJGRTKPVUGTXGTDCEMVQKVUFGHCWNVHCEVQT[UGVVKPIU
TGUGVVKPICNNKPHQTOCVKQPUWEJCU
VJGRCUUYQTFCPF+2CFFTGUUKPHQTOCVKQP WUGCHKPGDCNNRQKPVRGPVQJQNFFQYPVJG0GVYQTM
6GUV$WVVQPHQTOQTGVJCPUGEQPFU


%*#26'4+056#..#6+10#0&$#5+%12'4#6+10

+PUVCNNKPIVJG&TKXGTHQT0GVYQTM7UGTU
$GHQTG[QWEQPVKPWGGPUWTGVJCVVJGCFOKPKUVTCVQTJCUEQPHKIWTGFVJGPGVYQTMRTKPVGTUGVVKPI
EQTTGEVN[(QNNQYVJGUVGRUKPVJG3WKEM5GVWR)WKFGDGHQTGRTQEGGFKPI 

(QT9KPFQYUWUGTUQPN[

%QPPGEVVJGRTKPVGTVQVJG0GVYQTM+PUVCNNVJGFTKXGT


 %NKEMVJGő%QPPGEVVJGKPVGTHCEGECDNGKPVGTHCEGECDNGKPUVCNNVJGFTKXGT
WVKNKVKGU

 5GNGEVVJG0GVYQTMECDNG

 6WTPQHHVJGRTKPVGTRQYGTUYKVEJ

 %QPPGEVVJGECDNGVQVJGRTKPVGTCPFVJGPEQPPGEVKVVQCHTGGRQTVQPVJGJWD

 6WTPQPVJGRTKPVGTRQYGTUYKVEJ

 (QNNQYVJGKPUVTWEVKQPUQPVJGUETGGP

 %NKEMVJG0GZVDWVVQP

 5GNGEVVJGő0GVYQTM5JCTGF2TKPVGTŒQTVJGő$TQVJGT2GGTVQ2GGT0GVYQTM2TKPVGTŒCPF
VJGPENKEMVJG0GZVDWVVQP

(QT0GVYQTMUJCTGFRTKPVGTWUGTU
5GNGEVVJGCRRTQRTKCVGRTKPVGT3WGWGQTő5JCTGPCOGŒ

 5GNGEVVJGEWTTGPVRTKPVGTŏUSWGWGCPFVJGPENKEMVJG1-DWVVQP

 1PEGVJGCRRTQRTKCVGSWGWGKUURGEKHKGFVJGRTKPVGTFTKXGTYKNNDGKPUVCNNGF
6JGUGVWRKUPQYEQORNGVG

(QT$TQVJGT2GGTVQ2GGTPGVYQTMRTKPVGTWUGTU
.24TGEQOOGPFGF2GGTVQ2GGT
RTKPVKPIOGVJQF 
%QPHKIWTKPIVJG.24RQTV
(QT9KPFQYU/GWUGTU

 5GNGEVő.24
4GEQOOGPFGF ŒCPFVJGPENKEMVJG0':6DWVVQP

 'PVGTCWPKSWGRQTVPCOG
GZ$.2 CPFVJGPENKEMVJG1-DWVVQP

 5RGEKH[VJGRTKPVGTŏU+2CFFTGUU
QTENKEMVJG$TQYUGDWVVQPVQUGGCNKUVQHRTKPVGTU CPF
ENKEMVJG1-DWVVQP

 %NKEMVJG(KPKUJDWVVQPCPFTGUVCTVVJG2%#HVGTVJG2%JCUTGUVCTVGFUGVWRKUEQORNGVG


(QT9KPFQYU06WUGTUQPN[

 5GNGEVŒ.24
4GEQOOGPFGF ŒCPFVJGPENKEMVJG0':6DWVVQP
016'
+HVJGHQNNQYKPIUETGGPCRRGCTUKPUGTVVJG9KPFQYU06%&41/KPVQVJG%&41/FTKXG

 'PVGTVJGRTKPVGTŏU+&#FFTGUUCPFVJGSWGWGPCOG$+0#4;A2VJGPENKEMVJG1-
DWVVQP%NKEMVJG(KPKUJDWVVQPCPFTGUVCTVVJG2%#HVGTVJG2%JCUTGUVCTVGFUGVWRKU
EQORNGVG


%*#26'4+056#..#6+10#0&$#5+%12'4#6+10

(QT9KPFQYUWUGTUQPN[

 5GNGEVŒ.24
4GEQOOGPFGF ŒCPFVJGPENKEMVJG0GZVDWVVQP

 %NKEMVJG0GZVDWVVQP

 'PVGTVJGRTKPVGTŏU+2#FFTGUUCPFCWPKSWGRQTVPCOGVJGPENKEMVJG0GZVDWVVQP

 %NKEMVJG(KPKUJDWVVQPCPFTGUVCTVVJG2%#HVGTVJG2%JCUTGUVCTVGFUGVWRKUEQORNGVG

(QT$TQVJGT2GGTVQ2GGTPGVYQTMRTKPVGTWUGTU
0GV$+15 
%QPHKIWTKPIVJG0GV$+15RQTV

 5GNGEV0GV$+15CPFVJGPENKEMVJG0GZVDWVVQP

 'PVGTCWPKSWGRQTVPCOG
GZ$06 CPFVJGPENKEMVJG1-DWVVQP

 'PVGTVJGRCVJPCOG
QTENKEMVJG$TQYUGŗDWVVQPVQUGGCNKUVQHRTKPVGTŏU CPFVJGP
ENKEMVJG1-DWVVQP

 %NKEMVJG(KPKUJDWVVQPCPFTGUVCTVVJG2%#HVGTVJG2%JCUTGUVCTVGFUGVWRKU
EQORNGVG 

(QT/CEKPVQUJWUGTUQPN[

%QPPGEVVJGRTKPVGTVQVJG/CEKPVQUJ+PUVCNNVJG$45ETKRV22&HKNG

 %NKEMVJGő%QPPGEVVJGKPVGTHCEGECDNGKPUVCNNVJGFTKXGTWVKNKVKGU

 5GNGEVVJG0GVYQTMECDNG

 6WTPQHHVJGRTKPVGTRQYGTUYKVEJ

 %QPPGEVVJGECDNGVQVJGRTKPVGTCPFVJGPEQPPGEVKVVQCHTGGRQTVQP[QWTJWD

 6WTPQPVJGRTKPVGTUYKVEJ

 (QNNQYVJGKPUVTWEVKQPQPVJGUETGGP

 1RGPVJG%JQQUGTHTQOVJG#RRNGOGPWQPVJG/CEKPVQUJ

 %NKEMVJG.CUGT9TKVGT KEQP
5GNGEVVJG\QPG[QWTGSWKTGVQWUGHTQOVJG#RRNG6CNM


\QPGUNKUV

 5GNGEVVJGCRRTQRTKCVGRTKPVUGTXGTCPFVJGPENKEMVJG%TGCVGDWVVQP6JGUGVWRKUPQY
EQORNGVG

+HVJG#RRNG.CUGTYTKVGT&TKXGTKUPQVKPUVCNNGFQP[QWTU[UVGO[QWECPFQYPNQCFKVHTQO


JVVRYYYCRRNGEQO


%*#26'4+056#..#6+10#0&$#5+%12'4#6+10

 2#2'4*#0&.+0)

6JGRTKPVGTRTQXKFGUVYQV[RGUQHRCRGTNQCFKPIOGVJQFRCRGTECUUGVVGCPFOCPWCNHGGFUNQV

 .QCF2CRGTKPVQVJG2CRGT%CUUGVVG
;QWECPNQCFRNCKPRCRGTDQPFRCRGTTGE[ENGFRCRGTCPFVTCPURCTGPEKGUKPVQVJGRCRGT
ECUUGVVG+H[QWNQCFRCRGTKPVQVJGRCRGTECUUGVVGVJGRTKPVGTCWVQOCVKECNN[HGGFURCRGTUJGGV
D[UJGGVCPFGLGEVUVJGRTKPVGFRCIGKPVQVJGQWVRWVVTC[
(QTVJGFGVCKNUQPECUUGVVGNQCFKPITGHGTVQ5WDUGEVKQPŎ.QCF2CRGTŏKPVJKUEJCRVGTCPF
5WDUGEVKQPŎ2CRGTŏKP%*#26'4

 .QCF2CRGT/CPWCNN[
;QWECPHGGFGPXGNQRGUCPFNCDGNUCUYGNNCURNCKPRCRGTDQPFRCRGTTGE[ENGFRCRGTCPF
VTCPURCTGPEKGUKPVQVJGOCPWCNHGGFUNQV
(QTFGVCKNUQPHGGFCDNGRCRGTUGG5WDUGEVKQP
Ŏ2CRGTŏKP%*#26'4
9JGPWUKPIVJGOCPWCNHGGFUNQVHQNNQYVJGUVGRUDGNQY

 5GNGEVVJGOCPWCNHGGFOQFGKPVJGRTKPVGTFTKXGTCPFUGPFVJGRTKPVFCVCVQVJGRTKPVGT
016'
#Ŏ012#2'4ŏOGUUCIGKUUJQYPKPVJGUVCVWUOQPKVQTWPVKNCUJGGVQHRCRGTKUKPUGTVGFKPVQ
VJGOCPWCNHGGFUNQV


 5GVVJGYKFVJQHVJGOCPWCNHGGFUNQVRCRGT
IWKFGUWUKPIDQVJJCPFUVQVJGRCRGTYKFVJVQDG
WUGF
(KI

(KI


 +PUGTVVJGRCRGTKPVQVJGOCPWCNHGGFUNQVYKVJ
DQVJJCPFUWPVKNVJGHTQPVGFIGQHVJGRCRGT
VQWEJGUVJGRCRGTHGGFTQNNGT

 *QNFVJGRCRGTKPVJKURQUKVKQPWPVKNVJGRTKPVGT
HGGFUVJGRCRGTCUJQTVFKUVCPEGVJGPNGVIQQH
VJGRCRGT
(KI

(KI


 #HVGTVJGRTKPVGTGLGEVUVJGRTKPVGFRCIGKPUGTVVJGPGZVUJGGVQHRCRGTCUKPVJGRTGXKQWU
UVGR6JGRTKPVGTYKNNYCKVWPVKN[QWKPUGTVVJGPGZVUJGGVQHRCRGT4GRGCVVJKUCUPGEGUUCT[
HQTVJGPWODGTQHRCIGU[QWPGGFVQRTKPV

016'
+VKUTGEQOOGPFGFVQTGOQXGRTKPVGFRCIGUKOOGFKCVGN[CHVGTRTKPVKPIKHVJGQWVRWVVTC[
GZVGPUKQPHNCRKUPQVGZVGPFGF


%*#26'4+056#..#6+10#0&$#5+%12'4#6+10

6JGRTKPVGTJCUCUVTCKIJVRCRGTRCVJHTQOVJGOCPWCNHGGFUNQVVQVJGTGCTQHVJGRTKPVGTYJGP
VJGTGCTEQXGTKUNKHVGFWR7UGVJKURCRGTHGGFCPFQWVRWVOGVJQFYJGPRTKPVKPIQPVJKEMGT
RCRGTQTECTF

 5GNGEVVJGOCPWCNHGGFOQFGKPVJGRTKPVGT
FTKXGT

 .KHVWRVJGTGCTEQXGTCVVJGTGCTQHVJGRTKPVGT

(KI

 5GPFVJGRTKPVFCVCVQVJGRTKPVGT

 (QNNQY5VGRU
 VQ
 KPVJGRTGXKQWURCIGVQ
NQCFRCRGT

 %NQUGVJGTGCTEQXGTQHVJGRTKPVGT
(KI

! %#76+10
4GOQXGGCEJUJGGVKOOGFKCVGN[CHVGTRTKPVKPI5VCEMKPIVJGUJGGVUOC[ECWUGEWTNQTOGFKC
HGGFLCOU
 2TKPVKPIQP2NCKP2CRGTHTQOVJG/CPWCN(GGF5NQV

016'
6JGRTKPVGTVWTPUVJG/CPWCN(GGFOQFGQPCWVQOCVKECNN[YJGP[QWKPUGTVRCRGTKPVQVJG
OCPWCNHGGFUNQV


 5GNGEVVJG2CRGT5K\G/GFKC6[RGCPF2CRGT5QWTEGGVEKPVJGRTKPVGTFTKXGT
/GFKC6[RG2NCKPRCRGT
2CRGT5QWTEG
(KTUV2CIG/CPWCN
1VJGT2CIGU5COGCU(KTUV2CIG


 5GPFVJGRTKPVFCVCVQVJGRTKPVGT

016'
#Ŏ012#2'4ŏOGUUCIGKUUJQYPKPVJG5VCVWU/QPKVQTCPFEQPVTQNRCPGN.'&UWPVKN[QW
KPUGTVCUJGGVQHRCRGTKPVQVJGOCPWCNHGGFUNQV


 7UKPIDQVJJCPFUKPUGTVVJGRCRGTKPVQVJGOCPWCNHGGFUNQVWPVKNVJGHTQPVGFIGQHVJG
RCRGTVQWEJGUVJGRCRGTHGGFTQNNGT*QNFVJGRCRGTKPVJKURQUKVKQPWPVKNVJGRTKPVGT
CWVQOCVKECNN[HGGFUVJGRCRGTKPCUJQTVFKUVCPEGCPFVJGPNGVIQQHVJGRCRGT

016'
+PUGTVVJGRCRGTKPVQVJGOCPWCNHGGFUNQVYKVJVJGUKFGVQDGRTKPVGF
DNCPMUKFG HCEGWR


 #HVGTVJGRTKPVGTGLGEVUVJGRTKPVGFRCIGKPUGTVVJGPGZVUJGGVQHRCRGTCUKP5VGR
CDQXG6JGRTKPVGTYKNNYCKVWPVKN[QWKPUGTVVJGPGZVUJGGVQHRCRGT4GRGCVVJKUCUPGEGUUCT[
HQTVJGPWODGTQHRCIGU[QWPGGFVQRTKPV


%*#26'4+056#..#6+10#0&$#5+%12'4#6+10

 2TKPVKPIQP6JKEMGT2CRGTCPF%CTF5VQEM

9JGPVJGTGCTEQXGTKUNKHVGFWRVJGRTKPVGTJCUCUVTCKIJVRCRGTRCVJHTQOVJGOCPWCNHGGFUNQV
VQVJGTGCTQHVJGRTKPVGT7UGVJKURCRGTHGGFCPFQWVRWVOGVJQFYJGP[QWYCPVVQRTKPVQP
VJKEMGTRCRGTQTECTFUVQEM


 5GNGEVVJG2CRGT5K\G/GFKC6[RGCPF2CRGT5QWTEGGVEKPVJGRTKPVGTFTKXGT
/GFKC6[RG6JKEMRCRGTQT6JKEMGTRCRGT
2CRGT5QWTEG
(KTUV2CIG/CPWCN
1VJGT2CIGU5COGCU(KTUV2CIG 


 1RGPVJGTGCTEQXGT

 5GPFVJGRTKPVFCVCVQVJGRTKPVGT

016'
#Ŏ012#2'4ŏOGUUCIGKUUJQYPKPVJG5VCVWU/QPKVQTCPFEQPVTQNRCPGN.'&UWPVKN[QWKPUGTV
CUJGGVQHRCRGTKPVQVJGOCPWCNHGGFUNQV


 7UKPIDQVJJCPFUUGVVJGYKFVJQHVJGOCPWCNHGGFRCRGTIWKFGUVQVJGRCRGTYKFVJ[QW
YCPVVQWUG

 7UKPIDQVJJCPFUKPUGTVVJGRCRGTKPVQVJGOCPWCNHGGFUNQVWPVKNVJGHTQPVGFIGQHVJG
RCRGTVQWEJGUVJGRCRGTHGGNTQNNGT*QNFVJGRCRGTKPVJKURQUKVKQPWPVKNVJGRTKPVGT
CWVQOCVKECNN[HGGFUVJGRCRGTKPCUJQTVFKUVCPEGCPFVJGPNGVIQQHVJGRCRGT

 #HVGTVJGRTKPVGTGLGEVUVJGRTKPVGFRCIGVJGRTKPVGTYKNNYCKVHQT[QWVQKPUGTVVJGPGZVUJGGV
QHRCRGT4GRGCV5VGRHQTGCEJRCIG[QWYCPVVQRTKPV

 %NQUGVJGTGCTEQXGT 

! %#76+10
4GOQXGGCEJUJGGVKOOGFKCVGN[CHVGTRTKPVKPI5VCEMKPIVJGUJGGVUOC[ECWUGVJGRCRGTVQ
EWTNQTOGFKCHGGFLCOU




%*#26'4+056#..#6+10#0&$#5+%12'4#6+10

 2TKPVKPI'PXGNQRGU

6JGRTKPVGTJCUCUVTCKIJVRCRGTRCVJHTQOVJGOCPWCNHGGFUNQVVQVJGTGCTQHVJGRTKPVGT7UG
VJKURCRGTHGGFCPFQWVRWVOGVJQFYJGP[QWYCPVVQRTKPVGPXGNQRGU
016'
6JGRTKPVGTVWTPUVJG/CPWCN(GGFOQFGQPCWVQOCVKECNN[YJGP[QWKPUGTVRCRGTKPVQVJG
OCPWCNHGGFUNQV


 5GNGEVVJG2CRGT5K\G/GFKC6[RGCPF2CRGT5QWTEGGVEKPVJGRTKPVGTFTKXGT
/GFKC6[RG6JKEMGT2CRGT
2CRGT5QWTEG
(KTUV2CIG/CPWCN


 1RGPVJGTGCTEQXGT

 5GPFVJGRTKPVFCVC

 7UKPIDQVJJCPFUUGVVJGYKFVJQHVJGOCPWCNHGGFRCRGTIWKFGUVQVJGGPXGNQRGYKFVJ

 7UKPIDQVJJCPFUKPUGTVVJGGPXGNQRGKPVQVJGOCPWCNHGGFUNQVWPKVVJGHTQPVGFIGQHVJG
GPXGNQRGVQWEJGUVJGRCRGTHGGFTQNNGT*QNFVJGGPXGNQRGKPVJKURQUKVKQPWPVKNVJGRTKPVGT
CWVQOCVKECNN[HGGFUKVKPCUJQTVFKUVCPEGCPFVJGPNGVIQQHVJGGPXGNQRG

016'
+PUGTVVJGGPXGNQRGKPVQVJGOCPWCNHGGFUNQVYKVJVJGUKFGVQDGRTKPVGFHCEGWR


 #HVGTVJGRTKPVGTGLGEVUVJGRTKPVGFGPXGNQRGVJGRTKPVGTYKNNYCKVWPVKN[QWKPUGTVVJGPGZV
GPXGNQRG4GRGCV5VGRHQTGCEJGPXGNQRG[QWYCPVVQRTKPV

 #HVGT[QWHKPKUJVJGRTKPVLQDENQUGVJGTGCTEQXGT








%*#26'4+056#..#6+10#0&$#5+%12'4#6+10

'PXGNQRG6[RGUVQ#XQKF 

• 'PXGNQRGUVJCVCTGFCOCIGFEWTNGFYTKPMNGFQTKTTGIWNCTN[UJCRGF
• 'PXGNQRGUVJCVCTGGZVTGOGN[UJKP[QTJKIJN[VGZVWTGF
• 'PXGNQRGUYKVJENCURUUPCRUQTVKGUVTKPIU
• 'PXGNQRGUYKVJUGNHCFJGUKXGENQUWTGU
• 'PXGNQRGUQHDCII[EQPUVTWEVKQP
• 'PXGNQRGUVJCVCTGPQVUJCTRN[ETGCUGF
• 'ODQUUGFGPXGNQRGU
• 'PXGNQRGUVJCVYGTGRTGXKQWUN[RTKPVGFD[CNCUGTRTKPVGT
• 'PXGNQRGUVJCVCTGRTGRTKPVGFQPVJGKPUKFG
• 'PXGNQRGUVJCVECPPQVDGCTTCPIGFWPKHQTON[YJGPRNCEGFKPCRKNG
• 'PXGNQRGUEQPUVTWEVGFYKVJRCRGTVJCVGZEGGFUVJGRCRGTYGKIJVURGEKHKECVKQPUHQTVJG
RTKPVGT
• 2QQTN[OCPWHCEVWTGFGPXGNQRGUYKVJGFIGUVJCVCTGPQVUVTCKIJVQTEQPUKUVGPVN[USWCTG
• 'PXGNQRGUYKVJVTCPURCTGPVYKPFQYUJQNGUEWVQWVUQTRGTHQTCVKQPU

75'1(6*''08'.12'6;2'5.+56'&#$18'/#;%#75'&#/#)'61;174
24+06'457%*&#/#)'+5016%18'4'&70&'4#0;9#44#06;145'48+%'
#)4''/'06

016'
$GHQTGRTKPVKPIGPXGNQRGU[QWOWUVHCPVJGUVCEMQHGPXGNQRGUYGNNVQCXQKFRCRGTLCOUCPF
OKUHGGFU 
&QPQVRTKPVGPXGNQRGUWUKPIOCPWCNFWRNGZRTKPVKPI
(QTEQTTGEVRTKPVKPI[QWOWUVUGNGEVVJGUCOGRCRGTUK\GHTQOYKVJKP[QWTUQHVYCTGCRRNKECVKQP
CUVJGRCRGTKPVJGVTC[


%*#26'4+056#..#6+10#0&$#5+%12'4#6+10

2TKPVKPIQP6TCPURCTGPEKGU

;QWECPRTKPVQPVTCPURCTGPEKGUHTQOVJGRCRGTECUUGVVGQTOCPWCNHGGFUNQV

2TKPVKPIQP6TCPURCTGPEKGUHTQOVJG2CRGT%CUUGVVG
016'
&QPQVNQCFOQTGVJCPUJGGVUQHVTCPURCTGPEKGUKPVJGRCRGTECUUGVVG 


 5GNGEVVJG2CRGT5K\G/GFKC6[RGCPF2CRGT5QWTEGGVEKPVJGRTKPVGTFTKXGT
/GFKC6[RG6TCPURCTGPEKGU
2CRGT5QWTEG
(KTUV2CIG6TC[
1VJGT2CIGU6TC[


 2WNNVJGRCRGTECUUGVVGEQORNGVGN[QWVQHVJGRTKPVGT

 #FLWUVVJGRCRGTIWKFGUCVVJGTKIJVCPFTGCTQHVJGRCRGTECUUGVVGVQOCVEJVJG
VTCPURCTGPE[UK\G[QWYCPVVQNQCF/CMGUWTGVJCVVJGVKRUQHVJGRCRGTIWKFGUHKVKPVQVJG
UNQVUEQTTGEVN[

 .QCFVTCPURCTGPEKGUKPVJGRCRGTECUUGVVG/CMGUWTGVJG[CTGHNCVKPVJGECUUGVVGCVCNN
HQWTEQTPGTU

 +PUVCNNVJGRCRGTECUUGVVGKPVJGRTKPVGT/CMGUWTGKVKUKPUGTVGFHWNN[KPVQVJGRTKPVGT

016'
'ZVGPFVJGQWVRWVVTC[GZVGPUKQPHNCRVQRTGXGPVRTKPVQWVUHTQOUNKFKPIQHHVJGHCEGFQYPQWVRWV
VTC[

! %#76+10
4GOQXGUJGGVUKOOGFKCVGN[GURGEKCNN[YJGP[QWWUGVTCPURCTGPEKGU

 5GPFVJGRTKPVFCVCVQVJGRTKPVGT

2TKPVKPIQP6TCPURCTGPEKGUHTQOVJG/CPWCN(GGF5NQV

9JGPVJGTGCTEQXGTKUNKHVGFWRVJGRTKPVGTJCUCUVTCKIJVRCRGTRCVJHTQOVJGOCPWCNHGGFUNQV
VQVJGTGCTQHVJGRTKPVGT


 5GNGEVVJG2CRGT5K\G/GFKC6[RGCPF2CRGT5QWTEGGVEKPVJGRTKPVGTFTKXGT
/GFKCV[RG6TCPURCTGPEKGU
2CRGT5QWTEG
(KTUV2CIG/CPWCN


 1RGPVJGTGCTEQXGT


%*#26'4+056#..#6+10#0&$#5+%12'4#6+10


 5GPFVJGRTKPVFCVC

 7UKPIDQVJJCPFUUNKFGVJGOCPWCNHGGFRCRGTIWKFGUVQVJGVTCPURCTGPE[YKFVJ

 7UKPIDQVJJCPFUKPUGTVVJGVTCPURCTGPE[KPVQVJGOCPWCNHGGFUNQVWPVKNKVUHTQPVGFIG
VQWEJGUVJGRCRGTHGGFTQNNGT*QNFVJGVTCPURCTGPE[KPVJKURQUKVKQPWPVKNVJGRTKPVGT
CWVQOCVKECNN[HGGFUKVKPCUJQTVFKUVCPEGCPFVJGPNGVIQQHVJGVTCPURCTGPE[

 #HVGTVJGRTKPVGTGLGEVUVJGRTKPVGFVTCPURCTGPE[VJGRTKPVGTYKNNYCKVWPVKN[QWKPUGTVVJGPGZV
VTCPURCTGPE[4GRGCV5VGRHQTGCEJVTCPURCTGPE[[QWYCPVVQRTKPV

 #HVGT[QWHKPKUJVJGRTKPVLQDENQUGVJGTGCTEQXGT 



 6YQ5KFG2TKPVKPI
/CPWCN&WRNGZKPI
6JGUWRRNKGFRTKPVGTFTKXGTCNNQYU[QWVQFQOCPWCNFWRNGZRTKPVKPI
9JGPWUKPIVJGOCPWCNFWRNGZHWPEVKQPPQVGVJGHQNNQYKPIKPHQTOCVKQP

! %#76+10
• +HVJGRCRGTKUVQQVJKPKVOC[ECWUGYTKPMNKPI
• +HRCRGTKUEWTNGFUVTCKIJVGPKVCPFVJGPUGVKVKPVQVJGRCRGTECUUGVVG
• 6JGRCRGTV[RGUJQWNFDGRNCKPRCRGT&QPQVWUGDQPFRCRGT
• 9JGPUGVVKPIRCRGTKPVQVJGRCRGTECUUGVVGGORV[VJGECUUGVVGHKTUVVJGPKPUGTVVJGRTKPVGF
RCRGTQPN[RTKPVGFUKFGHCEGWR
&QPQVCFFVJGRTKPVGFRCRGTQPVQVJGVQRQHVJGWPRTKPVGF
RCRGTUVCEM
• +HVJGRCRGTKUPQVHGGFKPIEQTTGEVN[VJGRCRGTOKIJVDGEWTNGF4GOQXGVJGRCRGTCPF
UVTCKIJVGPKV





 6QRTKPVQPDQVJUKFGUQHVJGRCRGTHTQOVJGRCRGTECUUGVVG

 5GNGEVVJGTGSWKTGFOCPWCNFWRNGZRTKPVKPIOQFGHTQOVJGRTKPVGTFTKXGT

 6JGRTKPVGTYKNNCWVQOCVKECNN[RTKPVCNNVJGGXGPPWODGTGFRCIGUQPQPGUKFGQHVJGRCRGT
HKTUV

 4GOQXGVJGRTKPVGFGXGPPWODGTGFRCIGUHTQOVJGQWVRWVVTC[

 4GKPUGTVVJGOKPVQVJGRCRGTECUUGVVGNQCFKPI
VJGRCRGTYKVJVJGUKFGVQDGRTKPVGF
DNCPMUKFG
HCEGFQYPCPFVJGVQRGFIGVQYCTF[QW(QNNQY
VJGKPUVTWEVKQPUQPVJGEQORWVGTUETGGP
(KI


 6JGRTKPVGTYKNNPQYCWVQOCVKECNN[RTKPVCNNVJG
QFFRCIGUQPVJGTGXGTUGUKFGQHVJGRCRGT

(KI


%*#26'4+056#..#6+10#0&$#5+%12'4#6+10

 6QRTKPVQPDQVJUKFGUQHVJGRCRGTHTQOVJGOCPWCNHGGFUNQV

! %#76+10
• $GHQTGTGKPUGTVKPIVJGUJGGVUUVTCKIJVGPVJGOQTRCRGTHGGFGTTQTUYKNNQEEWT
• 6JGWUGQHXGT[VJKPQTXGT[VJKEMRCRGTKUPQVTGEQOOGPFGF
• 9JGPVJGOCPWCNFWRNGZHWPEVKQPKUWUGFKVKURQUUKDNGVJCVRCRGTLCOUOC[QEEWTQTRTKPV
SWCNKV[OC[PQVDGUCVKUHCEVQT[


 5GNGEVVJGTGSWKTGFOCPWCNFWRNGZRTKPVKPIOQFGCPFOCPWCNHGGFOQFGHTQOVJGFTKXGT

 7UKPIDQVJJCPFUKPUGTVVJGRCRGTKPVQVJGOCPWCNHGGFUNQVYKVJVJGUKFGVQDGRTKPVGF
HKTUVHCEKPIWRYCTFU(QNNQYVJGKPUVTWEVKQPUQPVJGEQORWVGTUETGGP

 4GRGCVCEVKQP
 WPVKN[QWJCXGRTKPVGFCNNVJGGXGPPWODGTGFRCIGU

 4GOQXGVJGRTKPVGFGXGPPWODGTGFRCIGUHTQOVJGQWVRWVVTC[

 4GKPUGTVVJGOKPQTFGTKPVQVJGOCPWCNHGGFUNQV
NQCFKPIVJGRCRGTYKVJVJGUKFGVQDGRTKPVGF

DNCPMUKFG HCEGWRCPFVJGVQRGFIGVQYCTFU
VJGRTKPVGT(QNNQYVJGKPUVTWEVKQPUQPVJG
EQORWVGTUETGGP
(KI

 4GRGCVCEVKQP
 WPVKN[QWJCXGRTKPVGFCNNVJG
QFFPWODGTGFRCIGUQPVJGTGXGTUGUKFGQHVJG
RCRGT

(KI


%*#26'4+056#..#6+10#0&$#5+%12'4#6+10

 %10641.2#0'.12'4#6+10

6JGTGCTGHQWT.'&UCPFCDWVVQPQPVJGEQPVTQNRCPGN6JG.'&UKPFKECVGVJGRTKPVGTUVCVWU
CPFRTGUUKPIVJGDWVVQPGPCDNGUUGXGTCNHWPEVKQPUKPVJGRTKPVGT

Drum

Ready
.'&U Paper
Alarm
Toner
Data

%QPVTQN2CPGN$WVVQP

(KI

 4GCF[
2CRGT .'&+PFKECVKQPU
6JG4GCF[.'&KPFKECVGUVJGEWTTGPVUVCVWUQHVJGRTKPVGT
.'& 2TKPVGTUVCVWU
1(( 6JGRQYGTUYKVEJKUQHHQTVJGRTKPVGTKUKPUNGGROQFG
+HVJGRTKPVGTKUKPUNGGROQFGKVYKNNYCMGWRCWVQOCVKECNN[YJGPKV
TGEGKXGUFCVCQTYJGP[QWRTGUUVJGEQPVTQNRCPGNDWVVQP
$NKPMKPI $NKPMKPICVUGEQPFKPVGTXCNU
6JGRTKPVGTKUYCTOKPIWR
$NKPMKPICVUGEQPFUKPVGTXCNU
6JGRTKPVGTKUEQQNKPIFQYPCPFUVQRURTKPVKPIWPVKNVJGKPVGTPCN
VGORGTCVWTGQHVJGRTKPVGTNQYGTU
10 6JGRTKPVGTKUTGCF[VQRTKPV

6JKU.'&CNUQYQTMUCUVJG2CRGT.'&YKVJVJG#NCTO.'&6JG[DNKPMUKOWNVCPGQWUN[VQ
KPFKECVGCRCRGTGTTQT5GG5WDUGEVKQPŎ1RGTCVQT%CNNUŏKP%*#26'4HQTFGVCKNU
'TTQT #EVKQP
2CRGTLCO %NGCTVJGRCRGTLCOCPFRTGUUVJGRCPGNDWVVQPKHVJGRTKPVGT
FQGUPQVCWVQOCVKECNN[TGUWOGRTKPVKPI
0QRCRGT .QCFRCRGTKPVJGRTKPVGTCPFRTGUUVJGRCPGNDWVVQP
/KUHGGF 4GKPUVCNNVJGRCRGTCPFRTGUUVJGRCPGNDWVVQP


%*#26'4+056#..#6+10#0&$#5+%12'4#6+10

 &CVC
6QPGT .'&+PFKECVKQPU
6JG&CVC.'&KPFKECVGUVJGEWTTGPVUVCVWUQHVJGRTKPVFCVCRTQEGUU
.'& 2TKPVGTUVCVWU
1(( 6JGRTKPVGTJCUPQRTKPVFCVC
$NKPMKPI 6JGRTKPVGTKUTGEGKXKPIFCVCHTQOVJGEQORWVGTQTVJGRTKPVGTKU
RTQEGUUKPIFCVCKPOGOQT[
10 2TKPVFCVCTGOCKPUKPVJGRTKPVGTOGOQT[+HVJG&CVC.'&KUQPHQTC
NQPIRGTKQFQHVKOGCPFPQVJKPIJCURTKPVGF[QWPGGFVQRTGUUVJG
DWVVQPVQRTKPVVJGTGOCKPKPIFCVC

6JKU.'&CNUQYQTMUCUVJG6QPGT.'&YKVJVJG#NCTO.'&6JG[DNKPMQT10VQKPFKECVGC
VQPGTGTTQT5GGCNUQ5WDUGEVKQPŎ1RGTCVQT%CNNUŏKP%*#26'4HQTFGVCKNU
'TTQT #EVKQP
6QPGTNQY +PFKECVGUVJCVVJGVQPGTECTVTKFIGKUPGCTN[GORV[2WTEJCUGC
PGYVQPGTECTVTKFIGTGCF[HQTYJGPVJGŎ6QPGTGORV[ŏGTTQTKU
KPFKECVGF
$NKPMKPIGXGT[UGEQPFU
6QPGTGORV[ 4GRNCEGVJGVQPGTECTVTKFIGYKVJCPGYQPG
10

 &TWO.'&+PFKECVKQPU
6JG&TWO.'&KPFKECVGUVJGFTWOWPKVKUPGCTN[CVVJGGPFQHKVUNKHG
.'& 2TKPVGTUVCVWU
1(( 6JGFTWOWPKVECPDGWUGF
10 6JGFTWOWPKVKUPGCTN[CVVJGGPFQHKVUNKHG+VKUTGEQOOGPFGFVQ
QDVCKPCPGYFTWOWPKVVQTGRNCEGVJGEWTTGPVQPG

 #NCTO.'&+PFKECVKQPU
6JG#NCTO.'&DNKPMU
YKVJPQQVJGT.'&U VQKPFKECVGCRTKPVGTGTTQTUVCVWUUWEJCUőEQXGT
QRGPŒQTőOGOQT[HWNNŒ
+HCP[QVJGTGTTQTQEEWTUVJGRTKPVGTKPFKECVGUVJGGTTQTD[DNKPMKPIVJG#NCTO.'&YKVJCPQVJGT
.'&QTD[RTKPVKPICPGTTQTTGRQTV4GHGTVQ5WDUGEVKQPŎ5GTXKEG%CNNUŏKP%*#26'4


%*#26'4+056#..#6+10#0&$#5+%12'4#6+10

 %QPVTQN2CPGN$WVVQP1RGTCVKQPU
6JGEQPVTQNRCPGNDWVVQPKUWUGFHQTVJGHQNNQYKPIRWTRQUGUFGRGPFKPIQPVJGUKVWCVKQP
1RGTCVKQP &GUETKRVKQP
%CPEGNRTKPVKPI +HVJGDWVVQPKURTGUUGFFWTKPIRTKPVKPIVJGRTKPVGTKOOGFKCVGN[UVQRU
RTKPVKPICPFGLGEVUVJGRCRGT
9CMGWR +HVJGRTKPVGTKUKPUNGGROQFGRTGUUKPIVJGDWVVQPYCMGUKVWRKPVQVJG
TGCF[UVCVWU+VYKNNVCMGWRVQUGEQPFUHQTVJGRTKPVGTVQIQKPVQVJG
TGCF[UVCVWU
(QTOHGGF +HVJG&CVC.'&KUQPRTGUUVJGDWVVQP6JGRTKPVGTRTKPVUCP[FCVC
TGOCKPKPIKPVJGRTKPVGTOGOQT[
'TTQTTGEQXGT[ +HCPGTTQTQEEWTUVJGRTKPVGTYKNNTGEQXGTHTQOUQOGGTTQTUCWVQOCVKECNN[
+HVJGGTTQTFQGUPQVENGCTCWVQOCVKECNN[RTGUUVJGDWVVQPVQENGCTVJGGTTQT
CPFEQPVKPWGRTKPVGTQRGTCVKQP
4GRTKPVHWPEVKQP ;QWECPTGRTKPVCRTKPVLQDYKVJQWVUGPFKPIKVHTQOVJGEQORWVGTCICKP
9JGP[QWRTGUUVJGDWVVQPYKVJVJG&CVC.'&QHHVJGRTKPVGTTGRTKPVUVJG
NCUVLQD[QWRTKPVGFKHVJGYJQNGLQDECPDGMGRVKPRTKPVGTOGOQT[+HVJG
RTKPVLQDKUVQQNCTIGQTVJGTGKUKPUWHHKEKGPVOGOQT[VJGNCUVRCIGQPN[YKNN
DGTGRTKPVGF

 1VJGT%QPVTQN(GCVWTGU
6JGRTKPVGTJCUVJGHQNNQYKPIWUGHWNHGCVWTGU
 5NGGROQFG
9JGPVJGRTKPVGTFQGUPQVTGEGKXGFCVCHQTCEGTVCKPRGTKQFQHVKOG
VKOGQWV KVGPVGTUUNGGR
OQFG6JGFGHCWNVVKOGQWVKUOKPWVGUCPFKVKUCWVQOCVKECNN[CFLWUVGFVQVJGOQUVUWKVCDNG
VKOGQWVUGVVKPIFGRGPFKPIQPVJGHTGSWGPE[QH[QWTRTKPVGTWUG
+PVGNNKIGPV5NGGR/QFG 
9JKNGVJGRTKPVGTKUKPUNGGROQFGCNNVJG.'&UCTGQHHCPFKVKUCUKHKVYCUVWTPGFQHHDWVVJG
RTKPVGTECPUVKNNTGEGKXGFCVCHTQOVJGEQORWVGT4GEGKXKPICRTKPVHKNGQTFQEWOGPV
CWVQOCVKECNN[YCMGUWRVJGRTKPVGTVQUVCTVRTKPVKPI2TGUUKPIVJGDWVVQPCNUQYCMGUWRVJG
RTKPVGT

016'
• 9JGPVJGRTKPVGTIQGUKPVQUNGGROQFGVJGHCPYKNNPQVUVQRWPVKNVJGRTKPVGTGPIKPGJCU
EQQNGFFQYP6JGHCPTWPPKPIVKOGXCTKGUFGRGPFKPIQPVJGUNGGROQFGVKOGQWVDGECWUG
VJGHCPTWPPKPIEQPFKVKQPUCTGFGHKPGFCUHQNNQYU
 6JGHCPTWPUHQTOKPWVGUYJGPGXGTRTKPVKPIHKPKUJGU
 6JGHCPTWPUYJKNGVJGRTKPVGTKUKPTGCF[UVCVWU
 6JGHCPTWPUHQTCVNGCUVOKPWVGUCHVGTVJGRTKPVGTIQGUKPVQUNGGROQFG

':+HVJGVKOGQWVKUOKPWVGUVJGHCPYKNNDGTWPPKPIHQTOKPWVGUCHVGTVJGRTKPVGTIQGUKPVQ
UNGGROQFG
• 5NGGROQFGCNNQYUVJGRTKPVGPIKPGVQEQQNUQVJGVGORGTCVWTGQHVJGTQQOCPFJQYNQPI
VJGRTKPVGTJCUDGGPKPUNGGROQFGCHHGEVUVJGYCTOWRVKOG6JKUYCTOWRVKOGECPVCMG
WRVQUGEQPFU6JG4GCF[.'&DNKPMUVQKPFKECVGVJCVVJGRTKPVGTKUYCTOKPIWR
• ;QWECPEJCPIGVJGVKOGQWVHQTVJGUNGGROQFGYKVJVJGUWRRNKGFRTKPVGTFTKXGT
CNNOQFGNU 
6JGVKOGQWVUGVVKPIKUKPVJGTCPIGQHVQOKPWVGU4GHGTVQVJG*GNRUGEVKQPKPVJG
RTKPVGTFTKXGTHQTOQTGKPHQTOCVKQPCDQWVVJGUNGGROQFGUGVVKPI


%*#26'4+056#..#6+10#0&$#5+%12'4#6+10

 6GUVRTKPVOQFG
6JGRTKPVGTKPEQTRQTCVGUXCTKQWUVGUVRTKPVOQFGU6JGRTKPVGTGPVGTUKPVQGCEJVGUVRTKPVOQFG
D[RCPGNDWVVQPQRGTCVKQP
(QTFGVCKNUQPVGUVRTKPVOQFGUGG5WDUGEVKQPŎ6GUV2TKPV/QFGŏKP%*#26'4


%*#26'4+056#..#6+10#0&$#5+%12'4#6+10

 0'6914-$1#4&12'4#6+10
(14*.010.;

6JGPGVYQTMDQCTFKPUVCNNGFKPVJGDCEMQHVJGRTKPVGTCNNQYU[QWVQUJCTGVJGRTKPVGTQPC
PGVYQTM

 2TGRCTKPIVJG$4PGV$QCTF
 %QPPGEVVJG'VJGTPGVECDNG

 6WTPQHHVJGRTKPVGTRQYGT

 %QPPGEVQPGGPFQHVJG'VJGTPGV Hub

ECDNGVQVJG$CUG6:RQTVQH
VJG*.0

 %QPPGEVVJGQVJGTGPFQH[QWT
'VJGTPGVECDNGVQCHTGGRQTVQP
[QWT'VJGTPGVJWD
(KI


 6WTPQPVJGRTKPVGTRQYGT

 +PUVCNNVJG$4#FOKPRTQHGUUKQPCNEQPHKIWTCVKQPWVKNKV[
HQT9KPFQYU/G06
WUGTUQPN[
016'
+H[QWWUGCPQVJGTQRGTCVKPIU[UVGOTGHGTVQVJG0GVYQTM7UGTŏU)WKFGQPVJGUWRRNKGF%&
41/


 +PUGTVVJGUWRRNKGF%&41/KPVQ[QWT%&41/FTKXG

 5GNGEVVJG*.0OQFGNDWVVQPCPFVJGPUGNGEVVJG
CRRTQRTKCVGNCPIWCIG

 %NKEMVJG+PUVCNN5QHVYCTGKEQP

 5GNGEV$4#FOKPRTQHGUUKQPCN+PUVCNNVJG$4#FOKP2TQHGUUKQPCN
WVKNKV[TGHGTTKPIVQVJGQPUETGGPKPUVTWEVKQPU 


%*#26'4+056#..#6+10#0&$#5+%12'4#6+10

 2TKPVEQPHKIWTCVKQPRCIG
2TGUUVJG0GVYQTM6GUVDWVVQPHQTNGUUVJCPUGEQPFUVQRTKPVCEQPHKIWTCVKQPRCIG

6'56DWVVQP

(KI

 (WPEVKQPU
 .'&HWPEVKQPU

L-LED F-LED A-LED


(green) (orange) (green)

(KI

..'&
ITGGP .KPMCEVKXKV[
6JKU.'&KUQPKHVJGTGKUCXCNKFEQPPGEVKQPVQVJGPGVYQTM
GKVJGT$CUG6QT$CUG6: +V
KUQHHKHPQPGVYQTMKUFGVGEVGF

(.'&
QTCPIG (CUV'VJGTPGV
6JKU.'&YKNNDGQPKHVJGRTKPVUGTXGTKUEQPPGEVGFVQC$CUG6:(CUV'VJGTPGVPGVYQTM+V
KUQHHKHVJGRTKPVUGTXGTKUEQPPGEVGFVQC$CUG6PGVYQTM

#.'&
ITGGP 6TCPUOKUUKQPCEVKXKV[
6JKU.'&YKNNDNKPMCUVJGRTKPVUGTXGTTGEGKXGUQTVTCPUOKVUFCVC

 (CEVQT[FGHCWNVUGVVKPI
+H[QWYKUJVQTGUGVVJGRTKPVUGTXGTDCEMVQKVUFGHCWNVHCEVQT[UGVVKPIU
TGUGVVKPICNNKPHQTOCVKQP
UWEJCUVJGRCUUYQTFCPF+2CFFTGUUKPHQTOCVKQP JQNFFQYPVJG0GVYQTM6GUVDWVVQPHQT
OQTGVJCPUGEQPFU


CHAPTER 3 THEORY OF OPERATION

CHAPTER 3 THEORY OF OPERATION

1. ELECTRONICS

1.1 General Block Diagram


HL-1230/1440

Fig. 3-1 shows a general block diagram of the HL-1230/1440 printer.

Optional RAM (SIMM)


(max. 32Mbytes)
(HL-1440 only)

Control system

Expansion memory I/O


RAM 2MB
(HL-1440 only)

External device
Interface block
Low-voltage power

(HL-1230: Parallel)
supply block

Video control block (HL1440: Parallel/USB)

Engine control block


Operation block
(Control panel)

Drive block Paper tray unit


Laser unit
(DC motor)
High-voltage power

Paper cassette
supply block

Drum unit Manual feed

Transfer block

Fixing unit

Charging Paper dust


Drum cleaner block
block

Paper eject block


Fig. 3- 1
Developing
block Paper feed system

Toner cartridge

Image generation system

Fig. 3-1

3-1
CHAPTER 3 THEORY OF OPERATION

HL-1450
Fig. 3-2 shows a general block diagram of the HL-1450 printer.

Optional RAM (SIMM)


(max. 32Mbytes)

Control system
Expansion
RAM 4MB memory I/O

External device
Low-voltage power

Interface block
supply block

(Parallel/USB)
Video control block

Engine control block


Operation block
(Control panel)

Drive block Paper tray unit


Laser unit
High-voltage power

(DC motor)
Paper cassette
supply block

Drum unit Manual feed

Transfer block

Fixing unit
Charging Paper dust
Drum cleaner block
block

Paper eject block

Developing
block Paper feed system

Toner cartridge

Image generation system

Fig. 3-2

3-2
CHAPTER 3 THEORY OF OPERATION

HL-1470N
Fig. 3-3 shows a general block diagram of the HL-1470N printer.

Network board

External device
Optional RAM (SIMM) Ethernet
(max. 32Mbytes) 10/100 Base TX

Control system
Expansion
RAM 4MB memory I/O PCI bus

External device
Interface block
Low-voltage power

(Parallel / USB)
Video control block
supply block

Engine control block


Operation block
(Control panel)

Drive block Paper tray unit


Laser unit
High-voltage power

(DC motor)
supply block

Paper cassette

Drum unit Manual feed

Transfer block

Fixing unit
Charging Paper dust
Drum cleaner block
block

Paper eject block

Developing
block Paper feed system

Toner cartridge

Image generation system

Fig. 3-3

3-3
CHAPTER 3 THEORY OF OPERATION

1.2 Main PCB Block Diagram


HL-1230/1440

Fig. 3-4 shows the block diagram of the main PCB of the HL-1230/1440 printer.

A S I C

CPU Core
Reset Circuit Oscillator (33.33MHz)
(MB86833)

BUS INT

Address Decoder
Program + Font ROM DRAM Control
1.0 Mbytes

Timer

RAM
(2.0 Mbytes)

FIFO

Option RAM (SIMM)


CDCC Parallel I/O To PC
(max.32Mbytes)

(HL-1440 only)

USB I/O (HL-1440 only) To PC

Soft Support

EEPROM (128 8 bits) EEPROM I/O

Engine Control I/O

To Engine PCB

Fig. 3-4

3-4
CHAPTER 3 THEORY OF OPERATION

HL-1450
Fig. 3-5 shows the block diagram of the main PCB of the HL-1450 printer.

A S I C

CPU Core
Reset Circuit (MB86832) Oscillator (33.33MHz)
BUS INT

Address Decoder
Program + Font ROM DRAM Control
8.0 Mbytes

Timer

RAM
(4.0 Mbytes)

FIFO

Option RAM (SIMM)


(max. 32Mbytes) CDCC Parallel I/O To PC

USB I/O To PC

Soft Support

EEPROM (512 x 8 bits) EEPROM I/O

Engine Control I/O

To Engine PCB

Fig. 3-5

3-5
CHAPTER 3 THEORY OF OPERATION

HL-1470N
Fig. 3-6 shows the block diagram of the main PCB of the HL-1470N printer.

A S I C

CPU Core
Reset Circuit (MB86832) Oscillator (33.33MHz)
BUS INT

Address Decoder
Program + Font ROM DRAM Control
8.0 Mbytes

Timer

Flash ROM
(2.0 Mbytes)

FIFO

RAM
(4.0 Mbytes) CDCC Parallel I/O To PC

USB I/O To PC
Option RAM (SIMM)
(max. 32Mbytes)

Soft Support

EEPROM (8192 x 8 bits) EEPROM I/O

Engine Control I/O

To Engine PCB

To PC
Network Board PCI Bus Control
or Hub

Fig. 3-6

3-6
CHAPTER 3 THEORY OF OPERATION

1.3 Main PCB


For the entire circuit diagram of the main PCB, see Appendix 11 to 17.

1.3.1 ASIC

HL-1230/1440

A Fujitsu 32bit RISC CPU, MB86833 (SPARC lite) is built in the ASIC. While the CPU is driven
with a clock frequency of 33 MHz in the user logic block, it itself runs at 66 MHz, which is
generated by multiplying the source clock by two.
The functions of the interface block communication with external devices are described below;

(1) IEEE1284
Stores the data received from the PC into DRAM as controlled by the DMA controller. It is
applicable to both normal receiving and bi-directional communication (nibble mode, byte
mode, ECP mode).

(2) USB interface (for HL-1440 only)


Stores the data received from the PC into DRAM as controlled by the DMA controller. The
transmission speed is 12Mbps.

(3) Engine GA transfer circuit


Communicates with the engine GA by a full-duplex synchronous serial method. The
communication speed is 2Mbps.

Fig. 3-7

3-7
CHAPTER 3 THEORY OF OPERATION

HL-1450/1470N
A Fujitsu 32bit RISC CPU, MB86832 (SPARC lite) is built in the ASIC. While the CPU is driven
with a clock frequency of 33 MHz in the user logic block, it itself runs at 66 MHz, which is
generated by multiplying the source clock by two.
The functions of the interface block communication with external devices are described below;

(1) IEEE1284
Stores the data received from the PC into DRAM as controlled by the DMA controller. It is
applicable to both normal receiving and bi-directional communication (nibble mode, byte
mode, ECP mode).

(2) USB interface


Stores the data received from the PC into DRAM as controlled by the DMA controller. The
transmission speed is 12Mbps.

(3) Engine GA transfer circuit


Communicates with the engine GA by a full-duplex synchronous serial method. The
communication speed is 2Mbps.

(4) PCI interface (for HL1470N only)


Sends and receives the data to and from the Ethernet controller ‘AM79C973AKC’. It is PCI
specification revision 2.2 compliant.

3-8
CHAPTER 3 THEORY OF OPERATION

Fig. 3-8

3-9
CHAPTER 3 THEORY OF OPERATION

1.3.2 ROM

HL-1230/1440

An 8 Mbits ROM (x 16 bit) is fitted.

Fig. 3-9

HL-1450
Two 64 Mbits ROMs (x 32 bit) are fitted.

Fig. 3-10

3-10
CHAPTER 3 THEORY OF OPERATION

HL-1470N
Two 32 Mbits ROMs (x 16 bit) are fitted.

Fig. 3-11

3-11
CHAPTER 3 THEORY OF OPERATION

1.3.3 Flash ROM (for HL-1470N only)

HL-1470N

Two 8 Mbits flash ROMs (x 16 bit) are fitted.

Fig. 3-12

1.3.4 DRAM

HL-1230/1440

A 16M-bit DRAM (x 16 bits) is used as the RAM.

Fig. 3-13

3-12
CHAPTER 3 THEORY OF OPERATION

HL-1450/1470N

Two 16M-bit DRAMs (x 16 bits) are used as the RAM.

Fig. 3-14

3-13
CHAPTER 3 THEORY OF OPERATION

1.3.5 Optional RAM

HL-1440
A 32bit (72 pin) SIMM can be fitted as optional RAM. The main PCB has one slot and the
capacity of SIMM can be from 1 Mbyte to 32 Mbytes.

Fig. 3-15

3-14
CHAPTER 3 THEORY OF OPERATION

HL-1450/1470N
A 32bit (72 pin) SIMM can be fitted as optional RAM. The main PCB has one slot and the
capacity of SIMM can be from 1 Mbyte to 32 Mbytes.

Fig. 3-16

3-15
CHAPTER 3 THEORY OF OPERATION

1.3.6 PCI bus

HL-1470N

The interface of the PCI bus is PCI specification revision 2.2 compliant.

Fig. 3-17

3-16
CHAPTER 3 THEORY OF OPERATION

1.3.7 EEPROM

HL-1230/1440

The EEPROM is X24C01A type of two-wire method with a 128 x 8 bits configuration.

Fig. 3-18

HL-1450
The EEPROM is X24C04 type of two-wire method with a 512 x 8 bits configuration.

Fig. 3-19

HL-1470N

The EEPROM is X24C32 type of two-wire method with a 8192 x 8 bits configuration.

Fig. 3-20

1.3.8 Reset circuit

HL-1230/1440

The reset IC is a RN5VD42A. The reset voltage is 4.2V (typ.) and the LOW period of reset is
80ms (typ.)

Fig. 3-21

3-17
CHAPTER 3 THEORY OF OPERATION

HL-1450/1470N

The reset IC is a RN5VD42A. The reset voltage is 4.2V (typ.) and the LOW period of reset is
80ms (typ.)

Fig. 3-22

1.3.9 Engine I/O

HL-1230/1440

Fig. 3-22 shows the engine interface circuit. The interface with the engine PCB is by full-
duplex synchronous serial method.

Fig. 3-23

HL-1450/1470N
Fig. 3-23 shows the engine interface circuit. The interface with the engine PCB is by full-
duplex synchronous serial method.

Fig. 3-24

3-18
CHAPTER 3 THEORY OF OPERATION

1.4 Engine PCB


The gate array which transforms the serial signal from the main PCB into the parallel signal is
mounted on the engine PCB.
The engine PCB controls the following parts by using the transferred signal data;
• Main motor • Toner sensor
• Panel PCB • Cover sensor
• Fan motor • Front registration sensor
• Thermistor • Rear registration sensor
• Polygon motor • Upper paper cassette sensor (HL-1450/1470N only)
• Solenoid • Lower paper cassette registration sensor (HL-1450/1470N only)
• High-voltage power supply • Jam sensor

For the circuit diagram of the engine PCB, see Appendix 18.

1.5 BR-net PCB (for HL-1470N only)


The BR-net PCB is connected to the ASIC mounted on the main PCB through the PCI bus.
The Ethernet controller, AM79C973AKC is mounted on the BR-net PCB. The controller
incorporates the 10/100 Mbps physical interface which conforms to IEEE 802.3 and is
connected with the external Ethernet through the RJ-45 connector.
For the circuit diagram of the BR-net PCB, see Appendix 19.

3-19
CHAPTER 3 THEORY OF OPERATION

1.6 Power Supply


1.6.1 Low-voltage power supply
The power supply uses a switching regulation system to generate the regulated DC power
(+5V and +24V), which are converted from the AC line.
The regulated output and the production code of each power supply are listed below;
Regulated Output Production Code
+5V / 1.6 A 100V: MPW1555
+24V / 2.15 A 200V: MPW1455
For the circuit diagram of the low-voltage power supply PCB, see Appendix 20 or 21.

(Heater)

Thermal
Fuse Fuse

Lightning
Heater
Surge
Circuit
Absorber

Lamp

Feedback

Fuse

Line
Rectifier Oscillator
Filter

(Engin Circuit)

24V
24V
Regulation
Circuit

5V
5V
Regulation
Circuit

Fig. 3-25

3-20
CHAPTER 3 THEORY OF OPERATION

1.6.2 High-voltage power supply


The high-voltage power supply generates and outputs the voltages and currents for the
charging, development and transfer functions.
For the circuit diagram of the high-voltage power supply PCB, see Appendix 22.

R1
24VI Current
Regulator

B1

Transfer Roller
Voltage
Regulator Supply
Roller

Photosensitive
Drum
VR22
Development
Roller

Current
Regulator

Corona
Unit
B102 Q81

Voltage
Regulator

B101 Q101

GND

Voltage
Regulator

Z51 VR51

Fig. 3-26

3-21
CHAPTER 3 THEORY OF OPERATION

2. MECHANICS

2.1 Overview of Printing Mechanism

Second eject roller


Photosensitive drum Laser Unit
Corona wire Polygon mirror
Cleaner
Thermistor
Scanner motor
Heat roller
Development roller
Rear cover
Blade

Agitator

Jam sensor lever


Toner sensor
Supply roller

First eject roller Drum Unit


Paper feed roller

Rear coverFixing Unit


Ppaper pick-up roller
Fixing unit Eject sensor lever Pressure roller Transfer roller

Cassette pressure roller

Separation
pad

Paper Front registration


Pressure plate Paper Cassette Rear registration
sensor lever sensor lever
Fig. 3-27

3-22
CHAPTER 3 THEORY OF OPERATION

Laser Unit
Network Laser
Board Cover Sensor (B)
(HL-1470N) Polygon Motor

Drum Unit
Engine Primary Charger (Corona Wire)
Main PCB PCB
High- Primary Charger (Grid)
Front Registration
Sensor Voltage
Power Development Roller
Rear Registration Supply
Sensor PCB Supply Roller
Upper Paper
Low-Voltage Cassette Sensor Transfer Roller
Power Supply (HL-1450/1470N)
PCB
Lower Paper
Cassette
Registration Sensor
(HL-1450/1470N)

Fixing Unit Solenoid

Halogen Fan Motor


Heater
Lamp Main Motor

Toner Sensor PCB (light emission) Cover Sensor (A)

Toner Sensor PCB (light reception)

Thermistor (for Heat Roller)

Panel PCB

Jam Sensor PCB

Fig. 3-28

3-23
CHAPTER 3 THEORY OF OPERATION

2.2 Paper Transfer


2.2.1 Paper supply
The paper pick-up roller picks up one sheet of paper from the paper cassette every time it is
rotated and feeds it to the paper feed roller.
Pinch roller

Paper feed roller Paper pick-up roller

Front registration Pinch roller


sensor lever

Pressure plate Separation pad

Fig. 3-29

The paper is gripped between the paper pick-up roller and the separation pad and separated
into individual sheets.
The pick-up roller is directly connected to the clutch mechanism, whose rotation is stopped by
the stopper arm. When the pick-up solenoid is activated, the clutch mechanism is engaged by
the solenoid action and the paper pick-up roller is driven. The paper drawn out of the tray by
the pick-up roller pushes against the front registration sensor lever and the paper top
position/absence of paper is detected by sensing the motion of the lever.

2.2.2 Paper registration


After the paper top position is detected by the front registration sensor, the paper, separated
into individual sheets by the paper pick-up roller, is fed further for a specified time, and the
paper top position reaches the paper feed roller so that the paper skew is adjusted. Then, the
solenoid is turned off, the paper feed roller starts turning, and the paper is fed to the transfer
block in the drum unit.

Photosensitive drum

Paper feed roller

Transfer roller

Rear registration
sensor lever

Fig. 3-30

The rear registration sensor in the path from the feed roller to the transfer roller controls the
first print position on the paper.

3-24
CHAPTER 3 THEORY OF OPERATION

2.2.3 Paper eject


After the printing image on the photosensitive drum is transferred onto the paper, the paper is
fed to the fixing unit to fix unfixed toner onto the paper.
Afterwards, the paper is ejected from the fixing unit by the first eject roller in the fixing unit.
The eject sensor lever detects whether the paper is ejected correctly or not. And Eject actuator
2 protects from accordion jam in the fixing unit when the tip of the paper doesn’t eject from the
unit.
After the paper exits from the first eject roller, the paper is turned by the rear cover and ejected
face down into the top output tray through the second eject roller. If the rear cover is open, the
paper is ejected face up straight to the printer rear (straight paper path).

Second eject roller

Rear cover
Jam sensor lever

First eject roller


Eject sensor lever

Fig. 3-31

3-25
CHAPTER 3 THEORY OF OPERATION

2.3 Sensors
2.3.1 Cover sensors A and B
Detect opening and closing of the front cover.

Cover sensor (B)

Cover sensor (A)

Fig. 3-32

2.3.2 Toner sensor


Detects if there is toner in the toner cartridge. The toner sensor at the left side emits light
through the window on the left side of the toner cartridge, then the toner sensor at the right
side receives it when the toner is low. They also detect whether or not the drum unit is
installed. (The toner cartridge is installed in the drum unit.)

Toner sensor
(light reception)

Toner sensor
(light emission)

Fig. 3-33

3-26
CHAPTER 3 THEORY OF OPERATION

2.4 Drum Unit


2.4.1 Photosensitive drum
Generates the latent electrostatic image and develops the image on the drum surface.

2.4.2 Primary charger


Forms a uniform charge on the drum surface.
(1) Corona wire
Generates the ion charge on the drum.
(2) Grid
Spreads the ion charge evenly over the drum surface.

2.4.3 Transfer roller


Transfers the toner image to the paper from the drum surface.

2.4.4 Cleaner
Removes the paper dust or dirt on the surface of the photosensitive drum.

2.5 Toner Cartridge


Develops the electrostatic latent image on the photosensitive drum with toner and forms the
visible image.

3-27
CHAPTER 3 THEORY OF OPERATION

2.6 Print Process


2.6.1 Charging
The drum is charged to approximately 870V by an ion charge which is generated by the
primary charger. The charge is generated by ionization of the corona wire, which has a DC
bias from the high-voltage power supply applied to it. The flow of the ion charge is controlled
by the grid to ensure it is distributed evenly on the drum surface. The aluminum drum sleeve
in the photosensitive drum is grounded.

+ -
-
+ -
+ -- - Aluminum drum sleeve Photosensitive
+ - Organic Photoconductor layer Drum
++ - - - -
++ + +
870V
+ + Grid
+ +
Voltage + + +
Regulator +
+ ++
HVPS

Corona wire
Fig. 3-34

The primary charge uses a corona wire, but since the drum is positively charged, only less than
1/10 of the usual quantity of ozone is generated compared with the negatively charged drum.
The level of ozone expelled from the printer is therefore not harmful to the human body.
Applicable safety standards have been complied with.

2.6.2 Exposure stage


After the drum is positively charged, it is exposed to the light emitted from the laser unit.
Drum
Laser beam

Paper

Laser beam
f θ lens
Laser detector
Polygon mirror

Laser diode
Motor

Lens
Fig. 3-35

3-28
CHAPTER 3 THEORY OF OPERATION

The area exposed to the laser beam is the image to be printed. The surface potential of the
exposed area is reduced, forming the electrostatic image to be printed.

Surface Potential (V) 1 Cycle of drum 1 Primary charging

1 2 3 2 Laser beam exposure and developing


(a) (a) Unexposed area
+870 ( Non image area )
(b) Exposed area
( Image area )

+420 3 Transfer the image to paper


(b)
+200

Drum
Sleeve 0
Time

Fig. 3-36

2.6.3 Developing
Developing causes the toner to be attracted to the electrostatic image on the drum so as to
transform it into a visible image.
The developer consists of a non-magnetic toner. The development roller is made of
conductive rubber and the supply roller (which is also made of conductive sponge) rotate
against each other. The toner is charged and carried from the supply roller to the development
roller. The toner adheres to the development roller and is conveyed to the photosensitive drum
at an even thickness controlled by the blade. The toner is nipped between the development
roller and the drum and developed onto the latent image on the drum. The electrostatic field
between the drum and the development roller, which is DC-biased from the high-voltage power
supply, creates the electrostatic potential to attract toner particles from the development roller
to the latent image area on the drum surface.
Blade
Development roller

Corona wire

Photosensitive drum

Transfer roller
Supply roller

Fig. 3-37

3-29
CHAPTER 3 THEORY OF OPERATION

2.6.4 Transfer
(1) Transfer process
After the drum has been charged and exposed, and has received a developed image, the
toner formed is transferred onto the paper by applying a negative charge to the back of
the paper. The negative charge applied to the paper causes the positively charged toner
to leave the drum, and adhere to the paper. As a result, the image is visible on the paper.
(2) Cleaning process of transfer roller
If the toner is not transferred onto the paper perfectly it is possible that there may be
residual toner on the drum which will adhere to the transfer roller. The transfer voltage
changes to a positive voltage during non-printing rotation of the drum. Therefore the
transfer roller is cleaned by returning the positively charged toner adhering to the transfer
roller onto the photo-conductive drum.

2.6.5 Fixing stage


The image transferred to the paper by static electricity is fixed by heat and pressure when
passing through the heat roller and the pressure roller in the fixing unit. The thermistor keeps
the surface temperature of the heat roller constant by detecting the surface temperature of the
heat roller and turning on or off the halogen heater lamp.

Heat roller

Thermistor

First eject roller

Pressure roller

Fig. 3-38

3-30
%*#26'4&+5#55'/$.;#0&4'#55'/$.;

%*#26'4&+5#55'/$.;#0&4'#55'/$.;

 5#('6;24'%#76+105

6QCXQKFETGCVKPIUGEQPFCT[RTQDNGOUD[OKUJCPFNKPIHQNNQYVJGYCTPKPIUCPFRTGECWVKQPU
DGNQYFWTKPIOCKPVGPCPEGYQTM

9#40+0)

 #NYC[UVWTPQHHVJGRQYGTUYKVEJCPFWPRNWIVJGRQYGTEQTFHTQOVJGRQYGTQWVNGV
DGHQTGCEEGUUKPICP[RCTVUKPUKFGVJGRTKPVGT

 5QOGRCTVUKPUKFGVJGRTKPVGTCTGGZVTGOGN[JQVKOOGFKCVGN[CHVGTVJGRTKPVGTKU
WUGF9JGPQRGPKPIVJGHTQPVEQXGTQTTGCTEQXGTVQCEEGUUCP[RCTVUKPUKFGVJG
RTKPVGTPGXGTVQWEJVJGTGFEQNQTGFRCTVUUJQYPKPVJGHQNNQYKPIHKIWTGU

! %#76+10

 $GECTGHWNPQVVQNQUGUETGYUYCUJGTUQTQVJGTRCTVUTGOQXGF

 $GUWTGVQCRRN[ITGCUGVQVJGIGCTUCPFCRRNKECDNGRQUKVKQPUURGEKHKGFKPVJKUEJCRVGT

 9JGPWUKPIUQNFGTKPIKTQPUQTQVJGTJGCVIGPGTCVKPIVQQNUVCMGECTGPQVVQCEEKFGPVCNN[
FCOCIGRCTVUUWEJCUYKTGU2%$UCPFEQXGTU

 $GHQTGJCPFNKPICP[2%$UVQWEJCOGVCNRQTVKQPQHVJGGSWKROGPVVQFKUEJCTIGCP[UVCVKE
GNGEVTKEKV[EJCTIGQP[QWTDQF[QTVJGGNGEVTQPKERCTVUQTEQORQPGPVUOC[DGFCOCIGF

 9JGPVTCPURQTVKPI2%$UDGUWTGVQYTCRVJGOKPVJGEQTTGEVRTQVGEVKXGRCEMCIKPI

 $GUWTGVQTGRNCEGUGNHVCRRKPIUETGYUEQTTGEVN[KHTGOQXGF7PNGUUQVJGTYKUGURGEKHKGF
VKIJVGPUETGYUVQVJGHQNNQYKPIVQTSWGXCNWGU
6#26+6'$+0&QT%72$
/0yEO
/0yEO
6#26+6'%725
/0yEO
5%4'9
/0yEO
/0yEO

 9JGPEQPPGEVKPIQTFKUEQPPGEVKPIECDNGEQPPGEVQTUJQNFVJGEQPPGEVQTDQF[PQVVJG
ECDNGU+HVJGEQPPGEVQTJCUCNQEMTGNGCUGVJGEQPPGEVQTNQEMHKTUVVQTGNGCUGKV

 #HVGTCTGRCKTEJGEMPQVQPN[VJGTGRCKTGFRQTVKQPDWVCNUQCNNEQPPGEVQTU#NUQEJGEMVJCV
QVJGTTGNCVGFRQTVKQPUCTGHWPEVKQPKPIRTQRGTN[DGHQTGQRGTCVKQPCNEJGEMU


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

 &+5#55'/$.;(.19

1 AC CORD 12 BASE PLATE

PCBs
2 DRUM UNIT
14
13

MAIN PCB ASSY LOWER TRAY RELAY


3 PAPER CASSETTE PCB ASSY
(HL-1250/1270N only)
15

NETWORK BOARD LOW-VOLTAGE


4
(HL-1270N only) PS PCB ASSY

17
SIMM 16
5
(HL-1440/1450/1470N only) PANEL PCB ASSY
ENGINE PCB ASSY
/ HIGH-VOLTAGE
6 FRONT COVER PS PCB ASSY B
20
18
TONER SENSOR
7 TOP COVER PCB ASSY (emission) SOLENOID ASSY A
21 19
8 MAIN COVER TONER SENSOR FAN MOTOR ASSY
PCB ASSY (reception)

9 LASER UNIT 10 DRIVE UNIT 11 FIXING UNIT A


23 22

PAPER FEED PAPER PICK-UP


ROLLER ASSY ROLLER ASSY
B
24

OUTER CHUTE 1


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

 &+5#55'/$.;241%'&74'

 #%%QTF


 &KUEQPPGEVVJG#%EQTFHTQOVJGRTKPVGT#%KPNGV

2TKPVGT

#%EQTF
(KI

 &TWO7PKV


 1RGPVJGHTQPVEQXGTCPFTGOQXGVJGFTWOWPKVHTQOVJGRTKPVGT

&TWOWPKV

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

 2CRGT%CUUGVVG


 %NQUGVJGHTQPVEQXGTRWNNQWVVJGRCRGTECUUGVVGHTQOVJGRTKPVGTCPFTGOQXGVJGRCRGT
HTQOVJGECUUGVVG

(TQPVEQXGT

2CRGTECUUGVVG

(KI


 4GOQXGVJGUGRCTCVKQPRCFJQNFGT#55;D[RWNNKPIKVWRYCTFUVJGPTGOQXGVJG
UGRCTCVKQPRCFURTKPIHTQOVJGRCRGTECUUGVVG

5GRCTCVKQPRCFJQNFGT

2CRGTECUUGVVG 5GRCTCVKQPRCFURTKPI

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

016'
9JGPTGRNCEKPITGCUUGODNKPIVJGUGRCTCVKQPRCFJQNFGTTGOQXGVJGQNFITGCUGCPFCRRN[C
UWKVCDNGCOQWPVQHITGCUGTGHGTTKPIVQVJGHKIWTGDGNQY

2CRGTRKEMWRTQNNGT
2CRGTECUUGVVG

)TGCUG/QN[MQVG2)

TKEGITCKPUK\G

(KI

 6WTPVJGRCRGTECUUGVVGWRUKFGFQYPVJGPTGOQXGVJGECUUGVVGEQXGTHKNOD[RGGNKPIKV
ECTGHWNN[HTQOVJGWPFGTUKFGQHVJGECUUGVVG

 4GOQXGVJG/Z6CRVKVGUETGYCPFTGOQXGVJGRCRGTECUUGVVGEQXGTHTQOVJGHTQPVQH
VJGECUUGVVG

%CUUGVVGEQXGTHKNO
6CRVKVG614:RCP/Z

2CRGTECUUGVVG

2CRGTECUUGVVGEQXGT

(KI

016'
• 6JGEQXGTHKNOOWUVPQVDGTGWUGFCHVGTKVJCUDGGPTGOQXGF#NYC[UTGRNCEGKVYKVJCPGY
QPG
• 6JGUETGYUGEWTKPIVJGRCRGTECUUGVVGEQXGTKPFKECVGF4'&KPVJGHKIWTGCDQXGKUXGT[
URGEKCN9JGPFKUCUUGODNKPITGCUUGODNKPIVJGUETGY[QWPGGFCURGEKCNUETGYFTKXGT
4GHGTVQVJGRCTVUTGHGTGPEGNKUV


%*#26'4&+5#55'/$.;#0&4'#55'/$.;


 -GGRKPIVJGRCRGTECUUGVVGWRUKFGFQYPTGNGCUGVJGRTGUUWTGTQNNGTJQNFGTCUUGODN[
HTQOVJGECUUGVVGD[TGNGCUKPIVJGOGVCNOQWPVKPIRNCVGHTQOVJGRNCUVKETGVCKPKPIDQUU
7UGCHNCVUETGYFTKXGTVQRTGUUVJGOGVCNRNCVGHQTYCTFUWPVKNKVENGCTUVJGDQUUCPFVJGP
TGOQXGVJGRTGUUWTGTQNNGTJQNFGTCUUGODN[FQYPYCTFUHTQOVJGECUUGVVG

 4GOQXGVJGRTGUUWTGTQNNGTEQNNCT#55;HTQOVJGRTGUUWTGTQNNGTJQNFGTCUUGODN[

 4GOQXGVJGURQPIGJQNFGT#55;HTQOVJGJQNFGT6JGVYQURQPIGJQNFGTURTKPIUYKNN
CNUQEQOGQHH
2TGUUWTGTQNNGTEQNNCT#55;

5RQPIGJQNFGT#55;

5RQPIGJQNFGTURTKPIU

2TGUUWTGTQNNGTJQNFGT

2CRGTECUUGVVG

2TGUUWTGTQNNGTJQNFGT
(NCVUETGYFTKXGT

(KI


 -GGRKPIVJGRCRGTECUUGVVGWRUKFGFQYPTGOQXGVJGVYQ/Z6CRVKVGUETGYU

 7PJQQMVJGECVEJGUQHGCEJUKFGIWKFGVJGPRTGUUVJGNQEMNGXGTVQYCTFUVJGHTQPVQHVJG
ECUUGVVGVQTGNGCUGVJGRTGUUWTGRNCVG
6CRVKVGEWR/Z

5KFGIWKFGTCEM
6CRVKVGEWR/Z

2CRGTECUUGVVG

$CEMUKFG

5KFGIWKFG.

5VGR

.QEMNGXGT


ECVEJGU
5KFGIWKFG.
5KFGIWKFGTCEM

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;


 A6WTPVJGECUUGVVGVJGEQTTGEVYC[WRCPFUNKFGVJGVYQRCRGTIWKFGUVQVJGEGPVGTQHVJG
ECUUGVVG

 4GOQXGVJGUKFGIWKFGU.GHVCPF4KIJVHTQOVJGRCRGTECUUGVVG
5KFGIWKFG.

5KFGIWKFG4

2CRGTECUUGVVG

(KI


 7PJQQMVJGVYQECVEJGU
# QHVJGRTGUUWTGRNCVGYJKNGRWNNKPIVJGRNCUVKEHTCOGQWVYCTFU
VJGPWPJQQMVJGQVJGTVYQECVEJGU
$ QHVJGRNCVGYJKNGRWNNKPIVJGRNCUVKEHTCOGQWVYCTFU
VQTGOQXGVJGRTGUUWTGRNCVG#55;

 7PJQQMVJGRTGUUWTGRNCVGURTKPIHTQOVJGRNCUVKEJQQMVQTGOQXGVJGVYQRTGUUWTGRNCVG
URTKPIU

5VGR



ECVEJGU
#

2TGUUWTGRNCVG#55;

2CRGTECUUGVVG
5VGR



JQQM
2NCUVKEHTCOG

5VGR

2TGUUWTG

ECVEJ
$ RNCVGURTKPI

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

016'
9JGPTGCUUGODNKPIVJGRTGUUWTGRNCVG#55;GPUWTGVJCVVJGRCRGTKPFKECVQTCTOKUWPFGTVJG
RTGUUWTGRNCVG

! %#76+10
9JGPWPJQQMKPIVJGECVEJGUVQTGOQXGVJGRTGUUWTGRNCVGFQPQVDGPFVJGRTGUUWTGRNCVG
IGPVN[GCUGVJGRNCUVKEEQXGT+HVJGRTGUUWTGRNCVGKUFGHQTOGFRCRGTHGGFKPIRTQDNGOUOC[
QEEWT


 4GOQXGVJGTGNGCUGNGXGTGZVGPUKQPURTKPI

 7PJQQMVJGVYQECVEJGUCPFTQVCVGVJGNQEMNGXGTVQTGOQXGKVFQYPYCTFUHTQOVJG
ECUUGVVG

2CRGTECUUGVVG
4GNGCUGNGXGT
GZVGPUKQPURTKPI

.QEMNGXGT

(KI

016'
9JGPTGCUUGODNKPIVJGNQEMNGXGTKPUGTVKVWRYCTFUHTQOWPFGTPGCVJVJGECUUGVVGCPFTQVCVGKV
WPVKNVJGVYQECVEJGUNQEMKPVQRNCEG


 5NKFGVJGTGCTRCRGTIWKFGHWNN[HQTYCTFUKPVJGECUUGVVGCPFTGOQXGKVHTQOVJGUNQV

2CRGTECUUGVVG

4GCTRCRGTIWKFG

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;


 6WTPVJGECUUGVVGWRUKFGFQYPCPFTGOQXGVJGQPG/Z6CRVKVGUETGYVQTGOQXGVJG
UKFGIWKFGIGCT6JGPTGOQXGVJGQPGHTKEVKQPURTKPI

 4GOQXGVJGVYQUKFGIWKFGTCEMU

 4GOQXGVJGRCRGTKPFKECVQT

6CRVKVGEWR/Z

5KFGIWKFGIGCT

(TKEVKQPURTKPI

5KFGIWKFGTCEM



5KFGIWKFGTCEM

5VGR


➀ ➁

2CRGTKPFKECVQT

(KI

016'
• 9JGPTGCUUGODNKPIVJGUKFGIWKFGTCEMUVJG[UJQWNFDQVJDGCNKIPGFUQVJCVVJGYKFGGPF
QHVJGTCEMUCTGKPNKPGYKVJVJGKPUKFGGFIGQHVJGRCRGTIWKFGTGNGCUGUNQVUKPVJGECUUGVVG
DGHQTGTGHKVVKPIVJGURTKPICPFIGCT
• 9JGPTGRNCEKPITGCUUGODNKPIVJGRCRGTECUUGVVGTGOQXGVJGQNFITGCUGCPFCRRN[C
UWKVCDNGCOQWPVQHITGCUGQPVQDQVJUKFGUQHVJGRCRGTECUUGVVGTGHGTTKPIVQVJGHKIWTG
DGNQY

)TGCUG/QN[MQVG2) )TGCUG/QN[MQVG2)

UGUCOGUK\G
UGUCOGUK\G

2CRGTECUUGVVG

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

 0GVYQTM$QCTF
HQT*.0QPN[

 1RGPVJGTGCTEQXGT

 4GOQXGVJGVYQ/Z6CRVKVGUETGYUVQTGOQXGVJGCEEGUUEQXGT

4GCTEQXGT

#EEGUUEQXGT

6CRVKVGDKPF/Z

(KI


 4GOQXGVJGVYQ/Z6CRVKVGUETGYUUGEWTKPIVJGPGVYQTMDQCTF

 &KUEQPPGEVVJGEQPPGEVQTEQPPGEVGFYKVJVJGOCKP2%$CPFTGOQXGVJGPGVYQTMDQCTF

0GVYQTMDQCTF

6CRVKVGEWR/Z

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

 5+//
HQT*.0


 4GNGCUGVJGJQQMQPGKVJGTQHUNQVCPFVJGP5+//EQOGUQHHHQTYCTFU

5+//

(KI


 &KUEQPPGEV5+//HTQOUNQVD[RWNNKPIKVWRYCTFU

016'
• 9JGPEQPPGEVKPI5+//GPUWTGVJCVVJGPQVEJQH5+//RNCEGNGHVUKFGQPVJGUNQV



%*#26'4&+5#55'/$.;#0&4'#55'/$.;

(TQPV%QXGT

 1RGPVJGHTQPVEQXGT

 4GOQXGVJGHQWT/Z6CRVKVGUETGYUHTQOVJGOCKPEQXGT

6CRVKVGDKPF/Z

(TQPVEQXGT

/CKPEQXGT
6CRVKVGDKPF/Z

(KI


 2QUKVKQPVJGHTQPVEQXGTCVVJGCPINGQHFGITGGUCPFTGNGCUGVJGDQUUGUCVVJGTKIJVCPF
NGHVJCPFUKFGUCPFVJGNKPMCVVJGNGHVJCPFUKFG

 4GOQXGVJGHTQPVEQXGT

°


DQUU

DQUU


.KPM (TQPVEQXGT

5VGR
 ➂

(TQPVEQXGT
(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

 6QR%QXGT

 4GOQXGVJGVYQ/Z6CRVKVGUETGYUUGEWTKPIVJGVQREQXGT

 4GNGCUGVJGJQQMUQPGKVJGTUKFGQHVJGVQREQXGTHTQOVJGDQUUGUQPVJGOCKPEQXGTD[
RWNNKPIVJGVQREQXGTHQTYCTFU

6CRVKVGEWR/Z
6QREQXGT

5VGR



DQUU 6CRVKVGEWR/Z

(KI


 1RGPVJGTGCTEQXGTVJGPTGNGCUGVJGJQQMU
# CVVJGTKIJVCPFNGHVJCPFUKFGUQHVJGVQR
EQXGTYJKNGRWUJKPIVJGOVQYCTFUVJGUKFGQHVJGRTKPVGTHTQOVJGTGCT

 .KHVWRVJGVQREQXGTCPFTGNGCUGVJGJQQMU
$ CVVJGTKIJVCPFNGHVJCPFUKFGUQHVJGVQR
EQXGTVQTGOQXGVJGVQREQXGT

6QREQXGT


JQQM
$

4GCTEQXGT

5VGR



JQQM
#
JQQM
$

4GCTEQXGT

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;


 6WTPVJGVQREQXGTWRUKFGFQYPCPFTGOQXGVJGUGEQPFGLGEVTQNNGT#55;D[NKHVKPIVJG
OKFFNGQHVJGTQNNGTWRYCTFUWPVKNVJGTQNNGTTGNGCUGUHTQOVJGEQXGT

5GEQPFGLGEVTQNNGT#55;

6QREQXGT

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

 /CKP%QXGT

! %#76+10
$GUWTGVQYGCTCRCKTQHINQXGUYJGPJCPFNKPIVJGOCKPEQXGTUKPEGKVUUJCTRGFIGUOC[JWTV
[QW


 4GOQXGVJGVYQ/Z6CRVKVGUETGYUHTQOVJGTGCTQHVJGOCKPEQXGT

 4GNGCUGVJGJQQMUCVVJGTKIJVCPFNGHVJCPFVQRUKFGUQHVJGRTKPVGTVJGPYJKNGRWNNKPIVJG
EQXGTQWVYCTFUVQENGCTVJGRQYGTUQEMGVCPFUYKVEJNKHVWRVJGOCKPEQXGTVQTGOQXGKV
EQORNGVGYKVJVJGTGCTEQXGT
4GCTEQXGT


JQQM

5VGR

JQQM

6CRVKVGDKPF/Z

/CKPEQXGT

(KI


 $GPFVJGVTC[GZVGPUKQPHNCRWRYCTFUUNKIJVN[VQTGOQXGVJGVTC[GZVGPUKQPHNCR

6TC[GZVGPUKQPHNCR

/CKPEQXGT

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;


 4GNGCUGVJGTGCTEQXGTURTKPIU.GHVCPF4KIJVHTQOVJGJQQMUQPVJGOCKPEQXGT

 4GOQXGVJGTGCTEQXGTEQORNGVGYKVJVJGTGCTEQXGTURTKPIU.GHVCPF4KIJVHTQOVJGOCKP
EQXGT

 4GOQXGVJGHQWTRKPEJTQNNGTUCPFHQWTRKPEJTQNNGTURTKPIUD[OQXKPIVJGOVQVJGXGTVKECN
CPFVJGPTGOQXKPIVJGOD[NKHVKPIVJGOWRYCTFU

4GCTEQXGT
5VGR

2KPEJTQNNGT

2KPEJTQNNGT
URTKPI

4GCTEQXGT

5VGR


4GCTEQXGT
2KPEJTQNNGT URTKPI4.
/CKPEQXGT

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

 .CUGT7PKV

 4GOQXGVJGVJTGG/Z6CRVKVGUETGYU

 2WUJVJG2JCTPGUUEQXGTVQVJGTKIJVVQTGNGCUGKVHTQOVJGJQQMCPFTGOQXGVJG2
JCTPGUUEQXGT

 &KUEQPPGEVVJG.&JCTPGUUCPFVJGRQN[IQPOQVQTEQPPGEVQT

 6CMKPIECTGPQVVQVQWEJVJGNGPUCPFOKTTQTTGOQXGVJGNCUGTWPKV

.&JCTPGUU
6CRVKVGEWR/Z

2QN[IQPOQVQTJCTPGUU

6CRVKVGEWR/Z
.CUGTWPKV
6CRVKVGEWR/Z
2QN[IQPOQVQTJCTPGUU


JQQM

2JCTPGUU
EQXGT

(KI

! %#76+10
• 0GXGTVQWEJVJGTGHNGEVOKTTQTCPFNGPUKPUKFGVJGNCUGTWPKV+HVJGTGKUCP[FKTVQTFWUVQP
VJGOKTTQTQTNGPUDNQYKVQHHWUKPICPCKTIWP
• 0GXGTVQWEJVJGUECPPGTYKPFQYQPVJGRTKPVGTDQF[+HVJGTGKUCP[FKTVQTFWUVQPVJG
YKPFQYDNQYKVQHHWUKPICPCKTIWP+HENGCPKPIVJGWPFGTUKFGQHVJGUECPPGTYKPFQYYKRG
QHHFKTVQTFWUVYKVJUQHVENGCPRCRGT4GHGTVQUWDUGEVKQPŎ%NGCPKPIVJG5ECPPGT
9KPFQYŏKP%*#26'4

5ECPPGTYKPFQY
.CUGTWPKV 4GHNGEVOKTTQT 2TKPVGTDQF[

.GPU


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

 &TKXG7PKV

 2NCEGVJGRTKPVGTDQF[ECTGHWNN[QPKVUTKIJVJCPFUKFGUQVJCVVJGFTKXGWPKVKUCVVJGVQR

 4GOQXGVJGHKXG/Z6CRVKVGUETGYUUGEWTKPIVJGIGCTRNCVGCPFVJG)GCTRTGUUWTG
RNCVG

 &KUEQPPGEVVJGJGCVGTJCTPGUUEQPPGEVQTCPFTGNGCUGVJGRCPGN2%$JCTPGUUHTQOVJG
JQQMU

 %CTGHWNN[NKHVVJGFTKXGWPKVCPFYJKNGUWRRQTVKPIVJG2%$FKUEQPPGEVVJGOCKPOQVQT
EQPPGEVQT

 4GOQXGVJGFTKXGWPKV
)GCTRTGUUWTGRNCVG 6CRVKVGEWR
/Z
&TKXGWPKV
6CRVKVGEWR
/Z *GCVGTJCTPGUU
2CPGN2%$JCTPGUU 6CRVKVGEWR/Z
EQPPGEVQT
/CKPOQVQT
6CRVKVGEWR
/Z

56'2



JQQM
/CKPOQVQTEQPPGEVQT

6CRVKVGEWR/Z

(KI


 4GOQXGVJGHQWT/Z6CRVKVGUETGYUVQTGOQXGVJGOCKPOQVQT#55;HTQOVJGFTKXGWPKV

6CRVKVGEWR/Z
6CRVKVGEWR/Z

/CKPOQVQT#55;

&TKXGWPKV

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

016'
9JGPTGRNCEKPITGCUUGODNKPIVJGOCKPOQVQTTGOQXGVJGQNFITGCUGCPFCRRN[CUWKVCDNG
COQWPVQHITGCUGTGHGTTKPIVQVJGHKIWTGDGNQY

/CKPOQVQT#55;

)TGCUG/QN[MQVG2)

TKEGITCKPUK\G

(KI

 4GOQXGVJGFGXGNQROGPVLQKPVEQORNGVGYKVJVJGLQKPVURTKPIVJGPTGOQXGVJGNKPM

,QKPVURTKPI

&GXGNQROGPVLQKPV

.KPM

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

 (KZKPI7PKV

 4GOQXGVJGQPGDKPF$/Z6CRVKVGUETGYUGEWTKPIVJGLCOUGPUQT2%$

 4GOQXGVJGQPGDKPF$VKVGZUETGYHTQOVJG(7HTCOGWRRGT

 4GOQXGVJGLCOUGPUQT2%$#55;HTQOVJG(7HTCOGWRRGTD[NKHVKPIVJGUJWVVGTRCTV
QHVJGGLGEVCEVWCVQTUNKIJVN[

6CRVKVGDKPF$/Z
6CRVKVGEWR5/Z
,COUGPUQT2%$#55;
*GCVJCTPGUU )GCT )GCT
EQPPGEVQT

/CKPHTCOG

(KZKPIWPKV

*GCVGTJCTPGUU

(KI


 4QVCVGVJGGLGEVCEVWCVQTHTQOVJG(7HTCOGWRRGTCUUJQYPKPVJGHKIWTGDGNQY

 6WTPVJGTKIJVTKDWRYCTFUVJGPUNKFGVJGGLGEVCEVWCVQTVQVJGTKIJVWPVKNKVCNKIPUYKVJ
VJGUNQVKPVJG(7HTCOGWRRGTCPFVJGPTGOQXGVJGGLGEVCEVWCVQTD[RWNNKPIKVWRYCTFU

TKD

'LGEVCEVWCVQT

JQQM

(7HTCOGWRRGT

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

 2NCEGVJGOCKPHTCOGQPKVUDCUGUQVJCVVJGTGCTUKFGKUHCEKPI[QW

 2TGUUVJGVYQJQQMUKPYCTFUVQTGOQXGIGCT

 &KUEQPPGEVVJGVYQEQPPGEVQTUQHVJGJGCVGTJCTPGUUCPFTGNGCUGVJGJCTPGUUHTQOVJG
JQQMUQPVJGVQRQHVJGHKZKPIWPKV

 4GOQXGVJGQPG/Z6CRVKVGUETGYCPFVYQUJQWNFGTUETGYUUGEWTKPIVJGHKZKPIWPKV
VCMKPIECTGPQVVQNQUGVJGEQPVCEVURTKPIHKVVGFVQVJGHTQPVNGHVJCPF

016'
9JGPTGCUUGODNKPIVJGHKZKPIWPKVGPUWTG[QWFQPQVHQTIGVVQTGHKVIGCT

 .KHVWRVJGHKZKPIWPKVCPFOQXGKVVQYCTF[QWCPFVQVJGNGHVVQCNNQYVJGFTKXGIGCTVQENGCT 
VJGHTCOGCPFVJGPFKUEQPPGEVVJGVJGTOKUVQTEQPPGEVQTHTQOVJGGPIKPG2%$

 4GOQXGVJGHKZKPIWPKVHTQOVJGOCKPHTCOG

'PIKPG2%$

/CKPHTCOG
6JGTOKUVQTEQPPGEVQT

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

016'
9JGPTGCUUGODNKPIVJGHKZKPIWPKVCNKIPVJGHKZKPIWPKVHTCOGCVVJGFTKXGWPKVUKFGKPVQVJG
EQPECXGRCTVQHVJGOCKPHTCOG
(KZKPIWPKV

/CKPHTCOG
/CKPHTCOG


EQPECXKV[

(KZKPIWPKV

(KI


 4GOQXGVJGVJTGGDKPF$/:UETGYVQTGOQXGVJG(7HTQPVRCRGTIWKFGHTQOVJG
(7HTCOGCPFVJGPTGOQXGVJGVJTGG/:UETGYVQTGOQXGVJGUVCTYJGGNJQNFGT 
#55;HTQOVJG(7HTCOG



(KZKPIWPKV

5ETGYDKPF$/Z

5ETGYDKPF$/Z

5VCTYJGGNJQNFGT#55;

(7HTQPVRCRGTIWKFG (KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

 4GNGCUGVJGVJGTOKUVQTJCTPGUUHTQOVJGVJTGGJQQMUHTQOVJGNQYGTUKFGQH(7HTCOG

 4GOQXGVJGVYQEWR$/:6CRVKVGUETGYUHTQOVJGVQRQHVJG(7HTCOG

 4GNGCUGVJGVYQJQQMUCVVJGTKIJVCPFNGHVUKFGUUGEWTKPIVJG(7HTCOGWRRGTCPFVJG
(7HTCOGNQYGT

(KZKPIWPKV
6CRVKVGEWR$/Z 6JGTOKUVQT#55;JCTPGUU

6CRVKVGEWR$/Z

*QQM

*QQMU

*QQM
*QQM

6JGTOKUVQT#55;JCTPGUU

(KI

 4GOQXGVJG(7HTCOGNQYGTHTQOVJG(7HTCOGWRRGT


JQQM

(7HTCOGWRRGT


JQQM


JQQM


JQQM
(7HTCOGNQYGT


JQQM

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;


 4GOQXGVJGQPG/Z6CRVKVGUETGYUGEWTKPIVJGJCNQIGPNCOREQPPGEVQTRNCVGCVVJG
FTKXGWPKVUKFGQHVJGHKZKPIWPKVHTCOGCPFVJGPNQQUGPVJG/ZUETGYCVVJGQVJGTUKFG

 .KHVVJGTKIJVJCPFGPFQHVJGJGCVTQNNGT#55;CPFTGOQXGVJGJCNQIGPJGCVGTNCOR 
HTQOVJGJGCVTQNNGT#55;
*CNQIGPJGCVGTNCOR %QNQTGFUKFG
5ETGYEWR/Z 81TCPIG
*GCVTQNNGT#55; 8$NCEM

6CRVKVGRCP/Z

*CNQIGPNCOR
*GCVTQNNGT EQPPGEVQTRNCVG

*CNQIGPJGCVGTNCOR

(7HTCOGWRRGT

(KI

016'
9JGPTGCUUGODNKPIVJGJCNQIGPJGCVGTNCORGPUWTGVJCVVJGFKTGEVKQPQHVJGJCNQIGPJGCVGT
NCORKUEQTTGEVTGHGTTKPIVQVJGHKIWTGCDQXG

! %#76+10
• 0GXGTVQWEJVJGUWTHCEGQHVJGJCNQIGPJGCVGTNCOR
• 9JGPUGEWTKPIVJGUETGYVQCUUGODNGVJGJCNQIGPNCOREQPPGEVQTRNCVGGPUWTG[QWWUG
VJGRNCUVKELKICUUJQYPKPVJGHKIWTGDGNQYVQCXQKFFCOCIKPIVJGGFIGQHVJGJCNQIGP
JGCVGTNCOR
*CNQIGPNCOR
EQPPGEVQTRNCVG 5ETGYEWR/Z

*CNQIGPJGCVGTNCOR 2NCUVKELKI

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;


 .KHVCPFTGOQXGVJGJGCVTQNNGT#55;HTQOVJG(7HTCOGWRRGTCPFVJGPTGOQXGVJG
*4IGCTHTQOVJGJGCVTQNNGT#55;

 4GOQXGVJG*4DGCTKPIHTQOVJGNGHVJCPFGPFQHVJGJGCVTQNNGT#55;6QTGOQXG
VJGJGCVTQNNGT#55;HKTUVTGOQXGVJG*4TGVCKPKPITKPICVVJGIGCTUKFGVJGP
TGOQXGVJGJGCVTQNNGTYCUJGTCPFVJG*4DGCTKPIHTQOVJGJGCVTQNNGT

*4DGCTKPI

*GCVTQNNGT

)GCTUKFG

*4DGCTKPI
*GCVTQNNGTYCUJGT

*4IGCT

(KI

! %#76+10
0GXGTVQWEJVJGUWTHCEGQHVJGJGCVTQNNGT

016'
• 9JGPTGCUUGODNKPIVJGJGCVTQNNGTVQVJG(7HTCOGWRRGTRNCEGVJGVYQRTQLGEVKQPUCV
VJGTKIJVJCPFUKFGQHVJGTQNNGTQPVQVJGDQUUGUQPVJGHTCOGCUUJQYPKPVJGHKIWTGDGNQY

*4IGCT

2TQLGEVKQP
*4DGCTKPI

*GCVTQNNGT

DQUU

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

• 9JGPTGCUUGODNKPIVJG*4DGCTKPIYJKEJKUCUUGODNGFCVVJG*4IGCTUKFGHKZVJG
DGCTKPIQPVQVJGJGCVTQNNGTUQVJCVVJGGODQUUOGPVYJQUGVJKEMPGUUKUOOKUCVVJG
VQR

*4DGCTKPI
*4IGCT *GCVTQNNGT


GODQUUOGPV

(KI

• 9JGPTGCUUGODNKPIVJG*4DGCTKPIYJKEJKUCUUGODNGFCVVJG12215+6'5+&'QHVJG
*4IGCTUKFGHKZVJGDGCTKPIQPVQVJGJGCVTQNNGTUQVJCVVJGGODQUUOGPVYJQUG
VJKEMPGUUKUOOKUCVVJGDQVVQO
*4DGCTKPI

*GCVTQNNGT


GODQUUOGPVDQVVQOUKFG

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

• 9JGPTGCUUGODNKPIVJGJGCVTQNNGTVQVJG(7HTCOGWRRGTGPUWTG[QWFQPQVFCOCIG
VJGJGCVTQNNGTYKVJVJGVKRQHVJGUGRCTCVGENCY


VKRQHVJGUGRCTCVG
ENCY
*GCVTQNNGT


VKRQHVJGUGRCTCVG
ENCY

(7HTCOGWRRGT

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;


 4GOQXGVJGENGCPGT#55;'EQORNGVGYKVJVJGENGCPGTURTKPIHTQOVJG(7HTCOGD[
NKHVKPIKVWRYCTFUWPVKNVJGURTKPITGNGCUGUHTQOVJGHTCOG

%NGCPGT#55;'

%NGCPGTURTKPI

(7HTCOGWRRGT

(KI

016'
• 9JGPTGCUUGODNKPIVJGENGCPGT#55;'OCMGVJGENGCPGTURTKPIUJQTVGTD[RWUJKPIKV
KPVQVJG(7HTCOGYKVJVJGENGCPGT#55;'VJGPUNKFGVJGENGCPGT#55;'JQNK\QPVCNN[CPF
JQQMVJGJQQMQHVJGENGCPGT#55;'QPVQVJG(7HTCOG
• 9JGPTGCUUGODNKPIVJGJGCVTQNNGTWPNQEMVJGNQEMQHVJG(7HTCOGCHVGTVJGYJQNGWPKV
KUTGCUUGODNGF1VJGTYKUGVJGJGCVTQNNGTOC[UWUVCKPFCOCIGVQKVUUWTHCEG



%*#26'4&+5#55'/$.;#0&4'#55'/$.;


 4GOQXGVJGRTGUUWTGTQNNGTHTQOVJG(7HTCOGNQYGTD[IGPVN[NGXGTKPIVJGTKIJVJCPF
UKFGWRYCTFUVQTGNGCUGKVHTQOVJGDGCTKPICPFVJGPUNKFKPIKVVQVJGTKIJVVQTGOQXGKV

2TGUUWTGTQNNGT

(7HTCOGNQYGT

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;


 2TGUUVJG24DGCTKPIDQVJUKFGUQH(7HTCOGNQYGTKPYCTFUVQTGOQXGKVVJGPTGOQXGVJG
24URTKPI

 2KPEJVJG#RCTVQHUGRCTGVGENCYENGCPGTURTKPIYJKEJUGEWTKPIENGCPGTRKPEJTQNNGT
#55;VQTGOQXGKVHTQOVJG(7HTCOGNQYGTVJGPTGOQXGVJGENGCPGTRKPEJTQNNGT#55;

 2KPEJVJG$RCTVQHVJGVJGTOKUVQTENGCPGTURTKPIYJKEJUGEWTKPIENGCPGTRKPEJTQNNGT
#55;VQTGOQXGKVHTQOVJG(7HTCOGNQYGTVJGPTGOQXGVJGENGCPGTRKPEJTQNNGT#55;

(7 HTCOG NQYGT

%NGCPGTRKPEJTQNNGT#55; 6JGTOKUVQT 24DGCTKPI


ENGCPGTURTKPI

%NGCPGTRKPEJ
TQNNGT#55;
5GRCTCVGENCY
ENGCPGTURTKPI
ő#Œ 24URTKPI

24DGCTKPI
24URTKPI
ő$Œ
(KI

016'
• 9JGPTGCUUGODNKPIVJGENGCPGTRKPEJTQNNGT#55;QPVQVJG(7HTCOGCFLWUVYKVJVJGNGPIVJQH
DQVJUKFGUQHVJGTQNNGTCPFVJGYKFVJQHVJGDGCTKPI
• 'PUWTGVJCVVJGURTKPIKUUGCVGFEQTTGEVN[QPVQVJG(7HTCOGCPFRTGUUVJG#CPF$RCTVHKTON[VQ
CXQKFRTQVTWUKQPHTQOVJG(7HTCOG


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

 4GNGCUGVJGVJGTOKUVQTJCTPGUUHTQOVJGJQQMUQPVJG(7HTCOGWRRGTCPFVJGPTGOQXG 
VJGQPGDKPF$/Z6CRVKVGUETGYCPFTGOQXGVJGVJGTOKUVQT


JQQMU

6JGTOKUVQT #55;

(7HTCOGWRRGT

6CRVKVGDKPF$/Z

(KI

016'
9JGPTGCUUGODNKPIVJGVJGTOKUVQTVQVJG(7HTCOGWRRGTGPUWTGVJGFKTGEVKQPQHVJG
VJGTOKUVQTKUEQTTGEVTGHGTTKPIVQVJGHKIWTGDGNQY

(7HTCOGWRRGT
6JGTOKUVQT 6JGTOKUVQT

6CRVKVGDKPF$
/Z

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;


 4GOQXGVJG$/Z6CRVKVGUETGYVQTGOQXGVJGKFNGIGCT*

 5NKFGVJGGLGEVTQNNGT#55;VQVJGNGHVWPVKNVJGUNQVKPVJGGLGEVTQNNGT#55;CNKIPUYKVJVJG
UNQVKPVJGHTCOG

(7HTCOGWRRGT

'LGEVTQNNGT#55;
6CRVKVG$/Z

+FNGIGCT*

(KI


 4GOQXGVJGGLGEVRKPEJTQNNGTJQNFGT
. CPFGLGEVRKPEJTQNNGTJQNFGT
4 D[WPJQQMVJG
QPGRCTVQHJQQMHTQOTGXGTUGUKFGHTQOVJG(7HTCOGWRRGTCPFVJGPTGOQXGVJGGLGEV 
RKPEJURTKPI
'LGEVRKPEJTQNNGTU

'LGEVRKPEJTQNNGTU

'LGEVRKPEJTQNNGTJQNFGT
.4

(7HTCOGWRRGT

'LGEVRKPEJURTKPI *QQM

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;


 4GOQXGVJGVYQGLGEVRKPEJTQNNGTUHTQODQVJQHVJGGLGEVRKPEJJQNFGT
. CPF
4 

'LGEVRKPEJTQNNGTU

'LGEVRKPEJTQNNGTU

'LGEVRKPEJTQNNGTJQNFGT
4

'LGEVRKPEJTQNNGTJQNFGT
.

(KI


 4GOQXGVJGHQWTEWR$/:6CRVKVGUETGYUCPFVJGHQWTENCYJQNFGTRNCVGUHTQOVJG
(7HTCOGWRRGT

 4QVCVGVJGUGRCTCVGENCY#55;HTQOVJGTGXGTUGUKFGWPVKNVJGUNQVKPVJGUGRCTCVG
ENCY#55;CNKIPUYKVJVJGUNQVKPVJG(7HTCOGWRRGTCPFVJGPTGOQXGVJGDQUUWUKPIC
RKGEGQHVYGG\GTU 5GRCTCVGENCY#55;

6CRVKVGEWR$/Z

%NCYJQNFGTRNCVG
$QUU

5GRCTCVGENCY#55;

6YGG\GTU
(7HTCOGWRRGT

(KI

016'
• 9JGPTGCUUGODNKPIVJGUGRCTCVGENCY#55;VQVJG(7HTCOGWRRGTJQQMVJGJQQMQHVJG
UGRCTCVGENCY#55;QPVQVJG(7HTCOG


%*#26'4&+5#55'/$.;#0&4'#55'/$.;


 4GNGCUGVJGRCRGTGLGEVCEVWCVQTHTQOVJGJQQMQPVJG(WHTCOGNQYGTCPFVJGPUNKFG
VJGRCRGTGLGEVCEVWCVQTVQVJGTKIJVFKTGEVKQPVQTGOQXGVJGRCRGTGLGEVCEVWCVQTCPF
VJGGLGEVRCRGTURTKPIHTQOVJG(WHTCOGNQYGT

2CRGTGLGEVCEVWCVQT

'LGEVCEVWCVQTURTKPI

(WHTCOGNQYGT

(KI

016'
9JGPTGCUUGODNKPIVJGRCRGTGLGEVCEVWCVQTCPFVJGGLGEVCEVWCVQTURTKPIVQVJG(7HTCOG
NQYGTGPUWTGVJGRCRGTGLGEVCEVWCVQTKUUGCVGFEQTTGEVN[KPVJGNQECVKPIEJCPPGNTGHGTTKPIVQ
VJGHKIWTGDGNQY

2CRGTGLGEVCEVWCVQT

(WHTCOGNQYGT

'LGEVCEVWCVQTURTKPI

(KI

$
%*#26'4&+5#55'/$.;#0&4'#55'/$.;


 4GOQXGVJGQPG6CRVKVGRCP$/ZHTQOVJG(7HTCOGWRRGT

 4GOQXGVJGCEVWCVQTJQNFGTHTQOVJG(7HTCOGWRRGT

 4GNGCUGVJG#RCTVQHVJGGLGEVCEVWCVQTURTKPIHTQOVJGJQQMCPFVJGPTGOQXGVJG
GLGEVCEVWCVQTD[NKHVKPIKVWRYCTFUHTQOVJG(7HTCOGWRRGT

*QQM 6CRVKVGRCP$/Z
'LGEVCEVWCVQT #EVWCVQTJQNFGT
ő#Œ URTKPI

'LGEVCEVWCVQT

'LGEVCEVWCVQTURTKPI

(7HTCOGWRRGT

(KI





















%*#26'4&+5#55'/$.;#0&4'#55'/$.;

 $CUG2NCVG

 6WTPVJGOCKPHTCOGWRUKFGFQYP

 4GOQXGVJGHKXG/Z6CRVKVGUETGYUCPF
UKZVGGP /Z6CRVKVGUETGYUHTQOVJG
DCUGRNCVG

 5NKFGVJGDCUGRNCVGVQVJGTGCTQHVJGRTKPVGTVQTGOQXGKV

! %#76+10
&QPQVTGOQXGVJGITQWPFYKTGEQPPGEVGFVQVJGDCUGRNCVGKHKVKUPQVPGEGUUCT[VQTGOQXGVJG
NQYXQNVCIGRQYGTUWRRN[WPKV7PPGEGUUCT[FKUEQPPGEVKQPQHVJGITQWPFYKTGOC[ECWUG
KPETGCUGFRTKPVGTPQKUG

6CRVKVGDKPF/Z
6CRVKVGDKPF/Z

6CRVKVGDKPF/Z

/CKPHTCOG

)TQWPFYKTGEQPPGEVKQP

6CRVKVGDKPF/Z

6CRVKVGDKPF/Z $CUGRNCVG

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

! %#76+10
• 9JGPTGCUUGODNKPIVJGDCUGRNCVGDGUWTGVJCVVJGITQWPFYKTGEQPPGEVGFVQVJGRCRGT
HGGFTQNNGT#55;KUHKZGFKPVQVJGUNKVQPVJGRNCUVKEEJWVGTGHGTTKPIVQVJGHKIWTGDGNQY
)TQWPFYKTG

2NCUVKEEJWVG


UNKV

/CKPHTCOG

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

 /CKP2%$#55;
016'(QT*.0QPN[
'PUWTGVJCVCP[KPUVCNNGF5+//OGOQT[KUTGOQXGF$'(14'TGOQXKPIVJGOCKP2%$


 4GOQXGVJGVYQ/ZUETGYUHTQOVJG+(RNCVGVQTGNGCUGVJGOCKP2%$

 .KHVVJGKPUWNCVKQPUJGGVCPFTGOQXGVJGOCKP2%$#55;

 &KUEQPPGEVVJGVJTGGEQPPGEVQTUHQTVJGNQYXQNVCIGRQYGTUWRRN[GPIKPG2%$CPF.&

/CKP2%$

+PUWNCVKQPUJGGV

.&EQPPGEVQT
'PIKPG2%$EQPPGEVQT
.QYXQNVCIGRQYGTUWRRN[EQPPGEVQT


5ETGY/Z

+(RNCVG

(KI

 .QYGT6TC[4GNC[2%$#55;
HQT*.0QPN[


 4GOQXGVJG/Z6CRVKVGUETGYCPFTGOQXGVJGNQYGTVTC[TGNC[2%$#55;

/CKPHTCOG

6CRVKVGEWR/Z

.QYGTVTC[TGNC[
2%$#55;

.QYGTVTC[TGNC[2%$#55;

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

 .QY8QNVCIG2QYGT5WRRN[2%$#55;

 4GOQXGVJG/Z6CRVKVGUETGYVQTGOQXGVJGKPUWNCVKQPUJGGV

 5NKIJVN[NKHVWRVJGNQYXQNVCIGRQYGTUWRRN[2%$#55;HTQOVJGHTCOGCPFFKUEQPPGEVVJG
GPIKPG2%$EQPPGEVQT6JGPNKHVVJGRQYGTUWRRN[2%$#55;HWTVJGTCPFFKUEQPPGEVVJG
JCNQIGPJGCVGTNCOREQPPGEVQT

 4GOQXGVJG/ZUETGYVQFKUEQPPGEVVJGITQWPFYKTGHTQOVJGDCUGRNCVG

6CRVKVGDKPF/Z

+PUWNCVKQPUJGGV

.QYXQNVCIGRQYGT
UWRRN[2%$#55;

.QYXQNVCIGRQYGT
#%KPNGVJQNFGT UWRRN[2%$#55;

)TQWPFYKTG

5VGR


5ETGY/Z

*CNQIGPJGCVGT
NCOREQPPGEVQT

$CUGRNCVG
'PIKPG2%$EQPPGEVQT

(KI


 4GOQXGVJG/Z6CRVKVGUETGYUGEWTKPIVJG#%KPNGVJQNFGT

 6WTPVJG#%KPNGVVQVJGTKIJVVQTGNGCUGKVCPFTGOQXGVJG#%KPNGV#55;CPFVJGNQY
XQNVCIGRQYGTUWRRN[2%$VQIGVJGT

/CKPHTCOG

#%KPNGVJQNFGT

6CRVKVGEWR/Z


RQUKVKQPKPIDQUU

2TQVGEVKQPVWDG

(KI

016'
9JGPTGCUUGODNKPIVJG#%KPNGVJQNFGTHKZVJGJQNFGTQPVQVJGRQUKVKQPKPIDQUUGUHKTUVVJGP
UGEWTGKVVQVJGHTCOGYKVJVJGUETGY
4GHGTVQVJGHKIWTGCDQXG


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

• 9JGPTGCUUGODNKPIVJGNQYXQNVCIGRQYGTUWRRN[2%$#55;GPUWTGVJCVVJGJCTPGUUGU
EQPPGEVGFVQVJG#%KPNGVCTGPQVVTCRRGFKPUKFGVJGRTKPVGT#RTQVGEVKQPVWDGEQXGTKPIVJG
JCTPGUUGUKUHKVVGFVQNCVGTRTKPVGTUECTGOWUVDGVCMGPYKVJOCEJKPGUOCPWHCEVWTGFDGHQTG
VJGRTQVGEVKQPVWDGYCUCFFGF

! %#76+10
$GUWTGVQCVVCEJVJGHKNOVQVJG#%KPNGV#55;KPVJGHQNNQYKPIECUGUTGHGTTKPIVQVJGHKIWTG
DGNQY
• +HVJGHKNOKUPQVCVVCEJGFVQVJG#%KPNGVQPVJGRTKPVGT[QWCTGUGTXKEKPI
• +HVJGHKNOKUFCOCIGFQTVJGCFJGUKXGKUYGCM


#%KPNGV#55;

(KNO

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

 'PIKPG2%$#55;*KIJ8QNVCIG2QYGT5WRRN[2%$#55;

 4GOQXGVJG/Z6CRVKVGUETGYVQTGOQXGVJGKPUWNCVKQPUJGGV

 4GOQXGVJGVJTGG/Z6CRVKVGUETGYUUGEWTKPIVJGGPIKPG2%$CPFVJGJKIJXQNVCIG
RQYGTUWRRN[2%$

 .KHVVJGGPIKPG2%$CPFJKIJXQNVCIGRQYGTUWRRN[2%$VQIGVJGTCPFFKUEQPPGEVVJG
EQPPGEVQTYJKEJEQPPGEVUVYQ2%$UVQIGVJGTVQTGOQXGVJGJKIJXQNVCIGRQYGTUWRRN[
2%$#55;

 +HPGEGUUCT[TGOQXGVJG64GNGEVTQFGJGNKECNURTKPIHTQOVJG64RNCVG

5ETGYDKPF/Z 5VGR


+PUWNCVKQPUJGGV

5ETGYDKPF/Z

5ETGYDKPF/Z
'PIKPG2%$#55;

64GNGEVTQFG
JGNKECNURTKPI

5VGR


*KIJXQNVCIGRQYGT
UWRRN[2%$#55;
%JWVG

(KI

! %#76+10
$GUWTGPQVVQNQUGVJG64GNGEVTQFGJGNKECNURTKPICHVGTTGOQXKPIKV

016'
9JGPTGCUUGODNKPIVJG64GNGEVTQFGJGNKECNURTKPIQPVQVJGRNCVGRTGUUVJGURTKPIQPVQVJG
RNCVGHKTON[YKVJCHNCVDNCFGFUETGYFTKXGTCPFGPUWTGVJCVKVKUTGVCKPGFUGEWTGN[


%*#26'4&+5#55'/$.;#0&4'#55'/$.;


 &KUEQPPGEVVJG
VYGNXG EQPPGEVQTUHQT*.QT
VJKTVGGP EQPPGEVQTUHQT
*.0HTQOVJGGPIKPG2%$VQTGOQXGVJGGPIKPG2%$#55;

.QYXQNVCIGRQYGT
6QPGTUGPUQT
NKIJV UWRRN[EQPPGEVQT
TGEGRVKQP EQPPGEVQT
HQT*825

'PIKPG2%$#55;

/CKP2%$EQPPGEVQT

.QYXQNVCIGRQYGT
UWRRN[EQPPGEVQT
,COUGPUQT2%$
#55;

6JGTOKUVQTEQPPGEVQT

6QPGTUGPUQT
NKIJV
GOKUUKQP EQPPGEVQT
(CPOQVQTEQPPGEVQT

2QN[IQPOQVQTEQPPGEVQT
5QNGPQKFEQPPGEVQT
.QYGTRCRGTECUUGVVG
5QNGPQKFEQPPGEVQT EQPPGEVQT
*.
2CPGN2%$EQPPGEVQT 0QPN[

(KI

! %#76+10
• 'XGPKH[QWYCPVVQTGOQXGQPN[QPGQHGKVJGTVJGGPIKPGCPFJKIJXQNVCIGRQYGTUWRRN[
2%$UGPUWTG[QWTGOQXGCNNUETGYUUGEWTKPIDQVJ2%$UCPFFKUEQPPGEVVJGEGPVTCN
EQPPGEVQTYJKNGNKHVKPIDQVJQHVJGOWR(CKNWTGVQFQUQOC[FCOCIGVJG2%$U
• 9JGPTGCUUGODNKPIVJGGPIKPG2%$GPUWTGKVKUCNKIPGFYKVJVJGRQUKVKQPKPIDQUUHKTUV
$GECTGHWNVJGOCKPOQVQTJCTPGUUKUPQVECWIJVDGVYGGPVJGGPIKPG2%$CPFVJGHTCOG
• 9JGPTGCUUGODNKPIVJGGPIKPG2%$QTJKIJXQNVCIGRQYGTUWRRN[2%$GPUWTGVJG
EGPVTCNEQPPGEVQTKUEQPPGEVGFEQTTGEVN[


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

 2CPGN2%$#55;
016'
$GUWTGVQTGOQXGVJGFTKXGWPKVCPFFKUEQPPGEVVJGRCPGN2%$EQPPGEVQTQPVJGGPIKPG2%$
DGHQTGTGOQXKPIVJGRCPGN2%$#55;


 4GOQXGVJG/Z6CRVKVGUETGYVJGPTGOQXGVJGRCPGN2%$#55;

2CPGN2%$

6CRVKVGEWR/Z

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

 5QNGPQKF#55;
016'
$GUWTGVQTGOQXGVJGFTKXGWPKVCPFFKUEQPPGEVVJGUQNGPQKFEQPPGEVQTQPVJGGPIKPG2%$
DGHQTGTGOQXKPIVJGUQNGPQKF#55;


 2NCEGVJGOCKPHTCOGUQVJCVVJGFTKXGWPKVUKFGKUCVVJGVQR

 4GNGCUGVJGECVEJCPFTGOQXGVJGRNCPGVIGCT#55;HTQOVJGRCRGTRKEMWRTQNNGTUJCHV

 4GOQXGVJGRNCPGVIGCT#55;$HTQOVJGRCRGTHGGFTQNNGTUJCHVCPFIGCT

ECVEJ
2NCPGVIGCT#55;
HQT
RCRGTRKEMWRTQNNGT


)GCT

2NCPGVIGCT#55;
/CKPHTCOG
HQTRCRGTRKEMWRTQNNGT

2NCPGVIGCT#55;$
5QNGPQKF
HQTRCRGTHGGFTQNNGT

(KI

 4GNGCUGVJGECVEJCPFTGOQXGVJGENWVEJNGXGTUHQTVJGHGGFTQNNGTCPFRKEMWRTQNNGT

%NWVEJNGXGT
%NWVEJNGXGTURTKPI
HQTRCRGTHGGFTQNNGT %NWVEJNGXGT

HQTRCRGTHGGFTQNNGT
4QF

%NWVEJNGXGT

HQTRCRGTRKEMWRTQNNGT

5QNGPQKF %NWVEJNGXGT

HQTRCRGTRKEMWRTQNNGT

/CKPHTCOG

(KI

! %#76+10
• 9JGPTGOQXKPIVJGENWVEJNGXGTUVJGENWVEJNGXGTURTKPIOC[EQOGQHH$GUWTGPQVVQNQUG
KV
• 9JGPTGCUUGODNKPIVJGENWVEJNGXGTHQTVJGRCRGTHGGFTQNNGTGPUWTGVJCVVJG7UJCRGF
ITQQXGQHVJGNGXGTKUHKVVGFQPVQVJGTQFKPVJGUQNGPQKFEQTTGEVN[TGHGTTKPIVQVJGHKIWTG
CDQXG


%*#26'4&+5#55'/$.;#0&4'#55'/$.;


 2NCEGVJGOCKPHTCOGVJGTKIJVYC[WRCPFTGOQXGIGCTKHPQVTGOQXGFGCTNKGTFWTKPI
HKZKPIWPKVTGOQXCN
)GCT

/CKPHTCOG

(KI

016'
9JGPTGCUUGODNKPIVJGUQNGPQKFGPUWTG[QWFQPQVHQTIGVVQTGHKVIGCT


%*#26'4&+5#55'/$.;#0&4'#55'/$.;


 6WTPVJGOCKPHTCOGWRUKFGFQYP

 4GOQXGVJGVYQ/Z6CRVKVGUETGYUCPFTGNGCUGVJGUQNGPQKFJCTPGUUHTQOVJGJQQM
CPFTGOQXGVJGECUUGVVGIWKFG.(

5VGR


%CUUGVVGIWKFG.(
6CRVKVGEWR/Z

(KI


 4GOQXGVJG/ZUETGYCPFVJGVCRGQPVJGUQNGPQKFJCTPGUUCPFTGOQXGVJGUQNGPQKF
#55;

016'
9JGPTGCUUGODNKPIVJGUQNGPQKFTGNGCUGURTKPIQPVQVJGUQNGPQKF#55;DGUWTGVJCV
VJGECVEJQHVJGURTKPIKUJQQMGFQPVQVJGUQNGPQKF#55;CUUJQYPKPVJGRKEVWTGDGNQY

5QNGPQKFTGNGCUGURTKPI
6CRG 4QF
/CKPHTCOG

5QNGPQKF#55;

5ETGYDKPF/Z

(KI

! %#76+10
9JGPTGOQXKPIVJGUQNGPQKFVJGUQNGPQKFTQFCPFURTKPIOC[EQOGQHH$GECTGHWNPQVVQNQUG
VJGO
4GHGTVQVJGHKIWTGCDQXG


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

 (CP/QVQT#55;
016'
$GUWTGVQTGOQXGVJGHKZKPIWPKVCPFFKUEQPPGEVVJGHCPOQVQTEQPPGEVQTQPVJGGPIKPG2%$
DGHQTGTGOQXKPIVJGHCPOQVQT#55;


 2NCEGVJGOCKPHTCOGUQVJCVVJGHCPOQVQT#55;KUCVVJGVQR

 4GOQXGVJGVYQ/Z6CRVKVGUETGYUUGEWTKPIVJGHCPEQXGT

 4GOQXGVJGHCPOQVQT#55;YKVJVJGHCPEQXGTCPFTGOQXGVJGHCPOQVQT#55;HTQOVJG
EQXGT

6CRVKVGEWR/Z
6CRVKVGEWR/Z
/CPWHCEVWTGTUVKEMGTUKFG

(CPOQVQT#55;

(CPEQXGT

/CKPHTCOG

(KI

016'
9JGPTGCUUGODNKPIVJGHCPOQVQTHKZVJGJCTPGUUKPVQVJGITQQXGQPVJGOQVQTVJGPHKZVJG
OQVQTQPVQVJGDQUUGU

(CPEQXGT

(CPOQVQT


ITQQXG

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

 6QPGT5GPUQT2%$#55;
.KIJV'OKUUKQP
016'
$GUWTGVQFKUEQPPGEVVJGVQPGTUGPUQT
NKIJVGOKUUKQP EQPPGEVQTQPVJGGPIKPG2%$DGHQTG
TGOQXKPIVJGVQPGTUGPUQT2%$#55;
NKIJVGOKUUKQP 


 4GNGCUGVJGJQQMUQHVJGVQPGTUGPUQT2%$#55;
NKIJVGOKUUKQP CPFTGOQXGKV
6QPGTUGPUQT2%$#55;

NKIJVGOKUUKQP


JQQMU


JQQM

(KI

 6QPGT5GPUQT2%$#55;
.KIJV4GEGRVKQP
016'
$GUWTGVQFKUEQPPGEVVJGVQPGTUGPUQT
NKIJVTGEGRVKQP EQPPGEVQTQPVJGGPIKPG2%$DGHQTG
TGOQXKPIVJGVQPGTUGPUQT2%$#55;
NKIJVTGEGRVKQP 


 4GOQXGVJGQPG/Z6CRVKVGUETGYCPFTGNGCUGVJGJQQMUVJGPTGOQXGVJGVQPGT
UGPUQT2%$#55;
NKIJVTGEGRVKQP 

6CRVKVGEWR/Z

JQQMU

6QPGTUGPUQT2%$#55;

NKIJVTGEGRVKQP

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

 2CRGT2KEMWR4QNNGT#55;
016'
$GUWTGVQTGOQXGCNNVJGEQXGTUCPFVJGDCUGRNCVGDGHQTGTGOQXKPIVJGRCRGTRKEMWRTQNNGT
#55;

 2NCEGVJGOCKPHTCOGWRUKFGFQYP

 7PJQQMVJGJQQMVQTGOQXGVJGKPPGTIGCTIGCTCPFIGCTHTQOVJGOCKPHTCOG

 4GOQXGVJGDGCTKPIHTQOVJGRCRGTRKEMWRTQNNGTUJCHV

 4GNGCUGVJGJQQMQPVJGDGCTKPICVVJGQVJGTUKFGQHVJGUJCHVCPFTGOQXGVJGRCRGTRKEM
WRTQNNGT#55;CPFVJGUJCHVHTQOVJGOCKPHTCOG

/CKPHTCOG

)GCT
2CRGTRKEMWRTQNNGT#55;
)GCT

)GCT
5VGR

$GCTKPI


JQQM

2CRGTRKEMWRTQNNGT#55;

(KI


 4GOQXGVJGDGCTKPICPFVJGRCRGTRKEMWRTQNNGT#55;HTQOVJGUJCHV

2CRGTRKEMWRTQNNGTUJCHV

$GCTKPI

2CRGTRKEMWRTQNNGT#55;

(KI


%*#26'4&+5#55'/$.;#0&4'#55'/$.;

 2CRGT(GGF4QNNGT#55;
016'
$GUWTGVQTGOQXGCNNVJGEQXGTUCPFVJG2%$UDGHQTGTGOQXKPIVJGRCRGTHGGFTQNNGT#55;


 7PJQQMVJGDNCEMRNCUVKEJQQMQPVJGUJCHVVQTGOQXGIGCT

)GCT


JQQM

(KI

! %#76+10
6JGRNCUVKEJQQMJQNFKPIIGCTYKNNDTGCMGCUKN[KHKVKUPQVHWNN[TGNGCUGFDGHQTGVJG
IGCTKURWNNGFVQTGOQXGKV'PUWTGVJCVVJGJQQMKUHWNN[TGNGCUGF$'(14'CVVGORVKPI
VQTGOQXGIGCT


 6WTPVJGOCKPHTCOGVJGTKIJVYC[WR

 7PJQQMVJGJQQMQPVJGDGCTKPIVJGPUNKIJVN[UNKFGVJGRCRGTHGGFTQNNGT#55;VQVJGFTKXG
WPKVUKFG

 .KHVWRCPFTGOQXGVJGRCRGTHGGFTQNNGTYKVJVJGDGCTKPICPFLQKPVCPFTGOQXGVJGDGCTKPI
CPFLQKPVHTQOVJGRCRGTHGGFTQNNGT#55;
$GCTKPI
2CRGTHGGFTQNNGT#55;

,QKPV


JQQM

$GCTKPI
(KI


 1WVGT%JWVG

 4GOQXGVYQ/Z6CRVKVGUETGYUCPFVYQ/Z6CRVKVGUETGYUVQTGOQXGVJGQWVGTEJWVG
#55;

 7PJQQMVYQJQQMUWUKPICUNQVVGFUETGYFTKXGTCPFVJGPTGOQXGVJGQWVGTEJWVG

1WVGTEJWVG

1WVGTEJWVG#55;

6CRVKVGEWR/Z

6CRVKVGDKPF/Z

(KI

4-43
%*#26'4&+5#55'/$.;#0&4'#55'/$.;

 2#%-+0)

+PUGTVKQPUJGGV

#EEGUUQT[DCI

#EEGUUQT[ECTVQP
#%%QTF

2CF

&TWO7PKV

YKVJ6QPGT%CTVTKFIGKPENWFGF

2CF

2TKPVGT

%CTVQP

(KI


CHAPTER 5 PERIODIC MAINTENANCE

CHAPTER 5 PERIODIC MAINTENANCE

To avoid creating secondary problems by mishandling, follow the warnings below during
maintenance work.

WARNING
(1) Always turn off the power switch and unplug the power cord from the power outlet
before accessing any parts inside the printer.
(2) Some parts inside the printer are extremely hot immediately after the printer is used.
When opening the front cover or rear cover to access any parts inside the printer,
never touch the red colored parts shown in the following figures.

1. CONSUMABLE PARTS

The consumable parts described in this section are parts which are subject to deterioration or
damage and should be replaced at least once during the period of warranty of the product if
any print quality problem appears.

1.1 Drum Unit


The Drum LED is on when the drum unit is nearly at the end of its life.
Life expectancy: 20,000 pages
NOTE:
There are many factors that determine the actual drum life, such as temperature, humidity,
type of paper and toner that you use, the number of pages per print job, etc.

<Replacement Procedure>
(1) Open the front cover of the printer and
pull out the drum unit.
(2) Place the drum unit on a flat, horizontal
surface, and remove the toner cartridge
from the drum unit while pushing the
lock lever down with your right hand.
(Fig. 5-1)
(3) Unpack the new drum unit.
Fig. 5-1

5-1
CHAPTER 5 PERIODIC MAINTENANCE

(4) Install the toner cartridge into the new


drum unit until it locks into place,
indicated by a click. When the toner
cartridge is installed correctly, the lock
lever is lifted automatically. (Fig. 5-2)
(5) Install the new drum unit into the printer.
Check that the printer is turned on, the
front cover is open and the Drum and
Alarm LEDs illuminate.

Fig. 5-2

(6) Press the control panel button until all the LEDs are on. (The LED turns on in sequence
from top to bottom.) The drum page counter is reset.
(7) Close the front cover, and check that the Drum LED is now off.

! CAUTION:
• For best performance, use only genuine Brother toner. The product should only be used in
a clean, dust-free environment with adequate ventilation..
• Only unpack a drum unit immediately before you need to install it into the printer. If an
unpacked drum unit is subjected to excessive direct sunlight or room light, the unit may be
damaged.
• Handle the drum unit and toner cartridge carefully. If toner scatters on your hands or
clothes, wipe or wash it off with cold water immediately.
• Do not reset the page counter when replacing the toner cartridge only.

1.2 Toner Cartridge


Toner low: The Data and Alarm LEDs blink once every five seconds.
Toner empty: The Data and Alarm LEDs blink once every second.
Life expectancy: 3,000 pages/standard toner cartridge
6,000 pages/high-capacity toner cartridge
(When printing A4- or Letter-size paper at 5% print coverage)
NOTE:
There are many factors that determine the actual toner life, such as temperature, humidity,
type of paper that you use, the number of pages per print job, etc.

<Replacement Procedure>
(1) Open the front cover, and pull out the
drum unit from the printer.
(2) Place the drum unit containing the old
toner cartridge on a flat, horizontal
surface, and remove the toner cartridge
from the drum unit while pushing the
lock lever down with your right hand.
(3) Unpack the new toner cartridge, and
gently rock it from side to side 5 or 6
times keeping it horizontal. (Fig. 5-3)
Fig. 5-3

5-2
CHAPTER 5 PERIODIC MAINTENANCE

(4) Remove the protective cover. (Fig. 5-4)


(5) Install the new toner cartridge into the
drum unit until it locks into place,
indicated by a click. When the toner
cartridge is installed correctly, the lock
lever is lifted automatically.

Fig. 5-4

(6) Clean the primary corona wire inside the


drum unit by gently sliding the wire
cleaner (blue tab) to the right end and
left end several times. (Fig. 5-5)
(7) Return the cleaner to the home position
before re-installing the drum unit.
(8) Re-install the drum unit into the printer
and close the front cover.

Fig. 5-5

! CAUTION:
• Keep the drum unit level after removing the toner cartridge to avoid possible toner spill or
scatter.
• Handle the drum unit and toner cartridge carefully. If toner scatters on your hands or
clothes, wipe or wash it off with cold water immediately.
• Only unpack a toner cartridge immediately before you need to install it into the printer. If a
toner cartridge is left unpacked for a long period of time, the toner life is shortened
• If an unpacked drum unit is subjected to excessive direct sunlight or room light, the unit
may be damaged.
• Use a Brother genuine toner cartridge which is specially formulated to ensure top print
quality.
• Printing with a 3rd party toner or toner cartridge may reduce not only the printing quality but
also the quality and life of the printer itself. It may also cause serious damage to the
performance and life of a genuine Brother drum unit. Warranty cover is not applied to
problems caused by the use of 3rd party toner or toner cartridges.
• Make sure that the wire cleaner on the drum unit is returned to the home position (▲ mark
position) before re-installing the drum unit into the printer, or printed pages may have
vertical stripes. (Refer to Fig. 5-5.)
• Install the toner cartridge immediately after you remove the protective part. Do not touch
the development roller and photosensitive drum colored red as shown below;

Fig. 5-6

5-3
CHAPTER 5 PERIODIC MAINTENANCE

2. PERIODICAL REPLACEMENT PARTS

Periodical replacement parts are the parts to be replaced periodically to maintain product
quality. These parts would affect the product quality greatly if they lost their function even if
they do not appear to be damaged or there is no change in their appearance.)
The periodical replacement parts listed below should be replaced at the service center
referring to the service life. For the procedures to replace these parts, refer to CHAPTER 4
“DISASSEMBLY AND RE-ASSEMBLY”.

Service life Replacement


Parts Name Part No. Qty
(number of prints) Procedure

Fixing Unit (115V) LJ5829001 1 50,000 pages See P. 4-18.

Fixing Unit (230V) LJ5830001 1 50,000 pages See P. 4-18.

Separation Pad Holder


UL9084001 1 50,000 pages See P. 4-4.
ASSY

Paper Pick-up Roller


UL9066001 1 50,000 pages See P. 4-38.
ASSY

NOTE:
The above table shows only estimated values. They are subject to change without prior notice.

5-4
CHAPTER 5 PERIODIC MAINTENANCE

3. PERIODICAL CLEANING

Clean the following parts periodically to avoid any printer problems or print image defects.

! CAUTION:
While drum unit and scanner window cleaning basically can be implemented by the end user,
the electrical terminals inside the printer and on the drum unit should be cleaned by a service
technician. Instruct the users not to touch those terminals.

3.1 Cleaning the Printer Exterior


Clean the printer exterior to keep the printer clean.
1) Turn off the power switch and unplug the power cord.
2) Wipe dirt and dust away from the printer exterior with a damp cloth and allow the printer
to dry completely before turning the power on again.

! CAUTION:
Use water or neutral detergents for cleaning. Cleaning with volatile liquids such as thinners or
benzene will damage the surface of the printer.

3.2 Cleaning the Drum Unit


When replacing the drum unit or toner cartridge with a new one, be sure to clean the drum unit.
1) Turn off the power switch and unplug the power cord.
2) Remove the drum unit from the printer.
3) Clean the primary corona wire inside the drum unit by gently sliding the wire cleaner
(blue tab) to the right end and left end several times.

Home position (▲)

Fig. 5-7

4) Return the cleaner to the home position.

! CAUTION:
Make sure that the wire cleaner on the drum unit is returned to the home position (▲ mark
position) before re-installing the drum unit into the printer, or printed pages may have vertical
stripes.

5) Install the drum unit into the printer.

5-5
CHAPTER 5 PERIODIC MAINTENANCE

3.3 Cleaning the Scanner Window


When replacing the drum unit or toner cartridge with a new one, be sure to clean the scanner
window.
1) Turn off the power switch and unplug the power cord.
2) Remove the drum unit from the printer.
3) Gently wipe the scanner window (colored magenta in the figures below) with a soft dry
cloth.

Fig. 5-8

! CAUTION:
• Do not touch the scanner window with your fingers.
• Do not wipe the scanner window with cleaning alcohol (isopropyl).

3.4 Clean the Electrical Terminals


To obtain the best print performance, be sure to clean the electrical terminals inside the printer
body.
1) Turn off the power switch and unplug the power cord.
2) Remove the drum unit from the printer.
3) Wipe the electrical terminals as shown in the figure below with a soft dry cloth.

Fig. 5-9

5-6
CHAPTER 5 PERIODIC MAINTENANCE

4. MTBF / MTTR

The meantime between failure (MTBF) and the meantime to repair (MTTR) for this printer are
as follows;

MTBF: Up to 4,000 hours


MTTR: Average 30 minutes

5-7
%*#26'46417$.'5*116+0)

%*#26'46417$.'5*116+0)

 +0641&7%6+10

 +PKVKCN%JGEM

 1RGTCVKPIGPXKTQPOGPV
%JGEMKH
• 6JGUQWTEGXQNVCIGUVC[UYKVJKPvHTQOVJGTCVGFXQNVCIGUJQYPQPVJGTCVKPIRNCVG
• 6JGRTKPVGTKUKPUVCNNGFQPCUQNKFNGXGNUWTHCEG
• 6JGTQQOVGORGTCVWTGKUOCKPVCKPGFDGVYGGPu%CPFu%6JGTGNCVKXGJWOKFKV[KU
OCKPVCKPGFDGVYGGPCPF
• 6JGRTKPVGTKUPQVNQECVGFKPCFWUV[RNCEG
• 6JGRTKPVGTKUPQVGZRQUGFVQCOOQPKCHWOGUQTQVJGTJCTOHWNICUGU
• 6JGRTKPVGTKUPQVNQECVGFKPCJQVQTJWOKFCTGC
UWEJCUPGCTYCVGTQTCJWOKFKHKGT 
• 6JGRTKPVGTKUPQVGZRQUGFVQFKTGEVUWPNKIJV
• 6JGTQQOKUYGNNXGPVKNCVGF
• 6JGRTKPVGTKUPQVRNCEGFYJGTGVJGXGPVKNCVKQPJQNGQHVJGRTKPVGTKUDNQEMGF

 2TKPVRCRGT
%JGEMKH
• #TGEQOOGPFGFV[RGQHRTKPVRCRGTKUDGKPIWUGF=+HVJGRCRGTKUVQQVJKEMQTVQQVJKP
QTVGPFUVQEWTNRCRGTLCOUQTRCRGTHGGFRTQDNGOUOC[QEEWTQTRTKPVGFKOCIGUOC[
DGDNWTTGF?
• 6JGRTKPVRCRGTKUFCORGF=+HUQWUGHTGUJRCRGTCPFEJGEMYJGVJGTVJGRTKPVSWCNKV[
KORTQXGUQTPQV?
• 6JGRTKPVRCRGTKUUJQTVITCKPGFRCRGTQTCEKFRCRGT=+HUQRTKPVSWCNKV[RTQDNGOUOC[
QEEWT?
(QTHWTVJGTKPHQTOCVKQPQPRCRGTTGHGTVQUWDUGEVKQPŎ2CRGTŏKP%*#26'4

 %QPUWOCDNGRCTVU
%JGEMKH
• 6JG6QPGT.'&KUPQVNKVQPVJGRTKPVGTEQPVTQNRCPGNYJGPCVQPGTECTVTKFIGKUKPUVCNNGFKP
VJGRTKPVGT=+HVJG.'&KUNKVTGRNCEGVJGECTVTKFIGYKVJCPGYQPG?
(QTHWTVJGTKPHQTOCVKQPQPEQPUWOCDNGRCTVUTGHGTVQ5GEVKQPŎ%QPUWOCDNG2CTVUŏKP
%*#26'4

 1VJGTU
%QPFGPUCVKQP
9JGPVJGRTKPVGTKUOQXGFHTQOCEQNFTQQOKPVQCYCTOTQQOKPEQNFYGCVJGT
EQPFGPUCVKQPOC[QEEWTKPUKFGVJGRTKPVGTECWUKPIXCTKQWURTQDNGOUCUNKUVGFDGNQY
• %QPFGPUCVKQPQPVJGQRVKECNUWTHCEGUUWEJCUVJGUECPPKPIOKTTQTNGPUGUVJGTGHNGEVKQP
OKTTQTCPFVJGRTQVGEVKQPINCUUOC[ECWUGVJGRTKPVKOCIGVQDGNKIJV
• +HVJGRJQVQUGPUKVKXGFTWOKUEQNFVJGGNGEVTKECNTGUKUVCPEGQHVJGRJQVQUGPUKVKXGNC[GTKU
KPETGCUGFOCMKPIKVKORQUUKDNGVQQDVCKPVJGEQTTGEVEQPVTCUVYJGPRTKPVKPI
• %QPFGPUCVKQPQPVJGEQTQPCWPKVOC[ECWUGEQTQPCEJCTIGNGCMCIG


%*#26'46417$.'5*116+0)

• %QPFGPUCVKQPQPVJGJQRRGTRNCVGCPFUGRCTCVKQPRCFOC[ECWUGRCRGTHGGFVTQWDNGU
+HEQPFGPUCVKQPJCUQEEWTTGFRTKPVUGXGTCNRCIGUQTNGCXGVJGRTKPVGTHQTJQWTUVQCNNQYKVVQ
TGCEJTQQOVGORGTCVWTG
+HVJGFTWOWPKVKUWPRCEMGFUQQPCHVGTKVKUOQXGFHTQOCEQNFTQQOVQCYCTOTQQO
EQPFGPUCVKQPOC[QEEWTKPUKFGVJGWPKVYJKEJOC[ECWUGKPEQTTGEVKOCIGU+PUVTWEVVJGWUGT
VQCNNQYVJGWPKVVQEQOGVQTQQOVGORGTCVWTGDGHQTGWPRCEMKPIKV6JKUYKNNVCMGQPGQTVYQ
JQWTU

 9CTPKPIUHQT/CKPVGPCPEG9QTM
6QCXQKFETGCVKPIUGEQPFCT[RTQDNGOUD[OKUJCPFNKPIHQNNQYVJGYCTPKPIUDGNQYFWTKPI
OCKPVGPCPEGYQTM

9#40+0)

 #NYC[UVWTPQHHVJGRQYGTUYKVEJCPFWPRNWIVJGRQYGTEQTFHTQOVJGRQYGTQWVNGV
DGHQTGCEEGUUKPICP[RCTVUKPUKFGVJGRTKPVGT

 5QOGRCTVUKPUKFGVJGRTKPVGTCTGGZVTGOGN[JQVKOOGFKCVGN[CHVGTVJGRTKPVGTKUWUGF
9JGPQRGPKPIVJGHTQPVEQXGTQTTGCTEQXGTVQCEEGUUCP[RCTVUKPUKFGVJGRTKPVGT
PGXGTVQWEJVJGTGFEQNQTGFRCTVUUJQYPKPVJGHQNNQYKPIHKIWTGU


%*#26'46417$.'5*116+0)

 +FGPVKH[VJG2TQDNGO
+H[QWGPEQWPVGTCP[RTKPVGTGTTQTQTRTQDNGOHKTUVKFGPVKH[KVTGHGTTKPIVQVJGEJCTVDGNQYVJGPUGGVJGCRRTQRTKCVGUGEVKQP
016'
6JGHQNNQYKPIVTQWDNGUJQQVKPIUGEVKQPUEQPVCKPDQVJVJGCEVKQPUYJKEJWUGTUUJQWNFVCMGQTEJGEMCPFVJGQPGUYJKEJUGTXKEGVGEJPKEKCPUUJQWNF
RGTHQTO

The printer does not print. Printed page has a problem.

LED is blinking. 2.1 'Operator Calls' Printed image has 7 'Image Defects'
a problem.

2.2 'Service Calls' 4.2 'Paper Feeding Problems'

Status monitor error 3.1 'Error Messages Turn off and on the printer
message appears. in the Status Monitor' (Service errors power switch. Printout is not
correct. 8 'Incorrect Printout'
only) (The same error appers.)

Error message is
printed. 3.2 'Error Message Printouts'
(Service errors
only)
6. 'Malfunctions'

The printer does 4.1 'Paper Loading Problems'


not load paper.

Paper jam occurs. 4.2 'Paper Jams'

The printer does


not start printing. 5. 'Software Setting Problems'

9. 'Network Problem'


%*#26'46417$.'5*116+0)

 12'4#614%#..55'48+%'%#..5

 1RGTCVQT%CNNU
#PŎQRGTCVQTECNNŏYJKEJVJGRTKPVGTKPFKECVGUQPVJG.'&UKUWUGTTGEQXGTCDNG+FGPVKH[VJGGTTQT
HTQOVJGVCDNGDGNQYCPFVCMGVJGEQTTGEVKXGCEVKQPFGUETKDGFHQTGCEJKPFKECVKQPVQEQTTGEVKV
6JGRTKPVGTCWVQOCVKECNN[TGEQXGTUHTQOOQUVGTTQTUDWVKVOC[CNUQDGPGEGUUCT[VQTGUGVVJG
RTKPVGTYKVJVJGEQPVTQNRCPGNDWVVQP

.'&+PFKECVKQP 'TTQT 4GOGF[


#NCTO.'&KUDNKPMKPI %QXGTQRGP %NQUGVJGHTQPVEQXGT+HVJGGTTQTKUPQV
ENGCTGFGXGPCHVGTENQUKPIKVQRGPVJGEQXGT
QPEGCPFENQUGKVCICKP
6JGGTTQTOC[QEEWTDGECWUGQHVJGNCUGT
$&OCNHWPEVKQP4GHGTVQŎ/$&HCKNWTGŏKP
5GEVKQP
4GCF[#NCTO.'&UCTG 2CRGTLCO %NGCTVJGLCOOGFRCRGTKPUKFGVJGRTKPVGT
DNKPMKPI 2TGUUVJGRCPGNDWVVQPKHVJGRTKPVGTFQGU
PQVCWVQOCVKECNN[TGUWOGRTKPVKPI
0QRCRGT .QCFRCRGTKPVQVJGRTKPVGTCPFRTGUUVJG
RCPGNDWVVQP
/KUHGGF 4GKPUVCNNVJGRCRGTCPFRTGUUVJGRCPGN
DWVVQP
#NCTO&CVC.'&UCTG 6QPGTNQY +PFKECVGUVJCVVJGVQPGTECTVTKFIGKUPGCTN[
DNKPMKPI
'XGT[UGEQPFU GORV[2WTEJCUGCPGYVQPGTECTVTKFIGKP
QTFGTVQDGTGCF[HQTYJGPVJGŎVQPGTGORV[ŏ
OGUUCIGKUKPFKECVGF
#NCTO&CVC.'&UCTG10 6QPGTGORV[ 4GRNCEGVJGVQPGTECTVTKFIGYKVJCPGYQPG

 5GTXKEG%CNNU
9JGPVJGRTKPVGTKPFKECVGUVJGPGGFHQTCUGTXKEGECNND[KNNWOKPCVKPICNNVJG.'&UCPFVJGPC
EQODKPCVKQPQH.'&UCNVGTPCVGN[CUUJQYPKPVJGVCDNGQPVJGPGZVRCIGCWUGTWPTGEQXGTCDNG
GTTQTOC[JCXGQEEWTTGF
+PUVTWEVVJGWUGTVQVWTPQHHVJGRQYGTUYKVEJYCKVCHGYUGEQPFUCPFVJGPVWTPKVQPCICKPCPF
VT[VQRTKPVCICKP+HVJGGTTQTKUPQVENGCTGFCPFVJGUCOGUGTXKEGECNNCRRGCTUUGG5GEVKQP
Ŏ/CNHWPEVKQPUŏVQVCMGVJGEQTTGEVKXGCEVKQP

Error occurs.

Confirm the LED


indication.

Turn OFF/ON
the power switch.

NO
Error occurs
again.

YES

Temporary error.
See Section 6
Use the printer with-
'Malfunction'.
out corrective action.


%*#26'46417$.'5*116+0)

6[RGQHGTTQT &TWO 4GCF[ #NCTO &CVC 4GOGF[


(WUGT/CNHWPEVKQP { 5GGŎ/(WUGTHCKNWTGŎ
.CUGT$&/CNHWPEVKQP { 5GGŎ/$&HCKNWTGŏ
5ECPPGT/CNHWPEVKQP { { 5GGŎ/5ECPPGTHCKNWTGŏ
41/'TTQT { 5GGŎ/41/GTTQTŏ
&4#/'TTQT { { 5GGŎ/&4#/GTTQTŏ
5GTXKEG# { { 5GGŎ/5GTXKEG#ŏ
5GTXKEG$ { { { 5GGŎ/5GTXKEG$ŏ
'PIKPG+PVGTHCEG'TTQT { 5GGŎ/'PIKPGKPVGTHCEGGTTQTŏ
/CKP/QVQT/CNHWPEVKQP { { { 5GGŎ//CKPOQVQTFQGUPQVTQVCVGFŏ
084#/'TTQT { { { 5GGŎ/084#/GTTQTŏ
%274WPVKOG'TTQT { { { { 5GGŎ/%27TWPVKOGGTTQTŏ
2%+$WU'TTQT { { 5GGŎ/2%+DWUGTTQTŏ
{$NKPMKPI

 4GHGTVQVJGHWTVJGTFGUETKRVKQPQHVJGUGGTTQTUCUHQNNQYU
• 5GTXKEG# #FFTGUU'TTQT
• 5GTXKEG$ $WU'TTQT
• %274WPVKOG'TTQT #%27GTTQTQVJGTVJCPVJGCDQXGVYQFGHGEVUUWEJCUCP
+NNGICN+PUVTWEVKQPQT1RGTCVKQP1XGTHNQY

*QYVJG.'&UKPFKECVGCPGTTQT
GZ(WUGT/CNHWPEVKQP


Drum

Ready
Paper
Alarm
Toner
Data

Time delay
: OFF : Blinking

(KI


%*#26'46417$.'5*116+0)

 '4414/'55#)'5

 'TTQT/GUUCIGUKPVJG5VCVWU/QPKVQT
6JGUVCVWUOQPKVQTYKNNTGRQTVRTQDNGOUYKVJVJGRTKPVGTCUFGHKPGFKPVJGHQNNQYKPIVCDNG6CMG
VJGEQTTGEVKXGCEVKQPUHQTVJGGTTQTOGUUCIGVJGUVCVWUOQPKVQTTGRQTVU

'TTQT/GUUCIG 4GOGF[
%18'412'0 %NQUGVJGHTQPVEQXGT
+HVJGHTQPVEQXGTKUJCNHQRGPGFVJGGTTQTOC[PQVDGENGCTGFGXGP
CHVGTENQUKPIKV+PVJCVECUGQRGPVJGEQXGTQPEGCPFENQUGKV
CICKP
012#2'4QT
 .QCFRCRGTKPVQVJGRCRGTECUUGVVGRTQRGTN[
/+5(''&
 +HRCRGTKUGORV[NQCFCPGYUVCEMQHRCRGTKPVQVJGECUUGVVG

 %JGEMVJCVRCRGTKPVJGECUUGVVGKUUVTCKIJV+HKVKUEWTNGF
UVTCKIJVGPKVDGHQTGRTKPVKPI5QOGVKOGUKVKUJGNRHWNVQTGOQXG
VJGRCRGTVWTPVJGUVCEMQXGTCPFRWVKVDCEMKPVQVJGRCRGT
ECUUGVVG

 4GFWEGVJGCOQWPVQHRCRGTKPVJGECUUGVVG-GGRRCRGT
NQCFUDGNQYOOKPFGRVJ

 %JGEMVJCVVJGRCRGTKUCURGEKHKGFV[RGQHRCRGT
2#2'4,#/ %NGCTVJGLCOOGFRCRGTKPUKFGVJGRTKPVGT2TGUUVJGRCPGNDWVVQP
KHVJGRTKPVGTFQGUPQVCWVQOCVKECNN[TGUWOGRTKPVKPI
610'4.19 +PFKECVGUVJCVVJGVQPGTECTVTKFIGKUPGCTN[GORV[2WTEJCUGCPGY
VQPGTECTVTKFIGKPQTFGTVQDGTGCF[HQTYJGPVJGŎVQPGTGORV[ŏ
OGUUCIGKUKPFKECVGF
610'4'/26; 4GRNCEGVJGVQPGTECTVTKFIGYKVJCPGYQPG
24+0618'4470
 2TGUUVJGRCPGNDWVVQPVQRTKPVVJGFCVCTGOCKPKPIKPVJG
RTKPVGT

 4GFWEGVJGEQORNGZKV[QHVJGFQEWOGPVQTTGFWEGVJGRTKPV
TGUQNWVKQP


(QT*.0QPN[ 'ZRCPFVJGRTKPVGTOGOQT[
D[CFFKPICEQOOGTEKCNN[CXCKNCDNG5+//5GVRCIG
RTQVGEVKQPVQ10D[WUKPIVJGUWRRNKGF9KPFQYUFTKXGTQT
42%RTQITCO


(QT*.0QPN[ %JCPIGVJGHQNNQYKPIUGVVKPIUKP
VJGUWRRNKGF9KPFQYUFTKXGTCPFVT[CICKP6JGDGUV
EQODKPCVKQPQHUGVVKPIUDGNQYYKNNXCT[FGRGPFKPIQPVJG
FQEWOGPV
)TCRJKEU/QFG6TWG6[RGŠOQFG7UG
2TKPVGT6TWG6[RGŠ(QPVU
/'/14;(7..
 2TGUUVJGRCPGNDWVVQPVQRTKPVVJGFCVCTGOCKPKPIKPVJG
RTKPVGT

 4GFWEGVJGEQORNGZKV[QHVJGFQEWOGPV


(QT*.0QPN[ 'ZRCPFVJGRTKPVGTOGOQT[
D[CFFKPICEQOOGTEKCNN[CXCKNCDNG5+//
4'51.76+10
 4GFWEGVJGEQORNGZKV[QHVJGFQEWOGPVDGHQTGRTKPVKPIVQ
#&#26'& RTGXGPVCWVQOCVKETGFWEVKQPQHVJGTGUQNWVKQP

6JGRTKPVGTJCURTKPVGF

(QT*.0QPN[ 'ZRCPFVJGRTKPVGTOGOQT[
VJGFQEWOGPVCVC D[CFFKPICEQOOGTEKCNN[CXCKNCDNG5+//
TGFWEGFTGUQNWVKQP


%*#26'46417$.'5*116+0)


'TTQT/GUUCIG 4GOGF[
%NGCP&TWOWPKV 6JGKPVGTPCNOQPKVQTKPIU[UVGOQH[QWTRTKPVGTJCUFGVGEVGFVJCV
VJGTGKUCRTKPVSWCNKV[KORTQXGOGPVVJCVECPDGCEJKGXGFD[
%QTQPCYKTG ECTT[KPIQWVCPQRGTCVQTKPVGTXGPVKQP











%*#26'46417$.'5*116+0)

'TTQT/GUUCIG 4GOGF[
(75'4/#.(70%6+10 6WTPVJGRQYGTUYKVEJQHHYCKVCHGYUGEQPFUCPFVJGPVWTPKVQP
CICKP.GCXGVJGRTKPVGTHQTOKPWVGUYKVJRQYGTQP
+HVJGUCOGGTTQTQEEWTUCICKPUGGŎ/(WUGTHCKNWTGŏ
.#5'4$& 6WTPVJGRQYGTUYKVEJQHHYCKVCHGYUGEQPFUCPFVJGPVWTPKVQP
/#.(70%6+10 CICKP
+HVJGUCOGGTTQTQEEWTUCICKPUGGŎ/$&HCKNWTGŏ
5%#00'4 6WTPVJGRQYGTUYKVEJQHHYCKVCHGYUGEQPFUCPFVJGPVWTPKVQP
/#.(70%6+10 CICKP
+HVJGUCOGGTTQTQEEWTUCICKPUGGŎ/5ECPPGTHCKNWTGŏ
&4#/'4414 6WTPVJGRQYGTUYKVEJQHHYCKVCHGYUGEQPFUCPFVJGPVWTPKVQP
CICKP
+HVJGUCOGGTTQTQEEWTUCICKPUGGŎ/41/GTTQT&4#/
GTTQT084#/GTTQTŏ
084#/'4414 6WTPVJGRQYGTUYKVEJQHHYCKVCHGYUGEQPFUCPFVJGPVWTPKVQP
CICKP
+HVJGUCOGGTTQTQEEWTUCICKPUGGŎ/41/GTTQT&4#/
GTTQT084#/GTTQTŏ
/#+0/1614'4414 6WTPVJGRQYGTUYKVEJQHHYCKVCHGYUGEQPFUCPFVJGPVWTPKVQP
CICKP
+HVJGUCOGGTTQTQEEWTUCICKPUGGŎ//CKPOQVQTFQGUPQV
TQVCVGŏ
'0)+0'+06'4(#%' 6WTPVJGRQYGTUYKVEJQHHYCKVCHGYUGEQPFUCPFVJGPVWTPKVQP
'4414 CICKP
+HVJGUCOGGTTQTQEEWTUCICKPUGGŎ/'PIKPGKPVGTHCEGGTTQTŏ


%*#26'46417$.'5*116+0)

 'TTQT/GUUCIG2TKPVQWVU
6JGRTKPVGTYKNNTGRQTVRTQDNGOUD[RTKPVKPICPGTTQTOGUUCIGCUFGHKPGFKPVJGHQNNQYKPIVCDNG
6CMGVJGEQTTGEVKXGCEVKQPUHQTVJGGTTQTOGUUCIGVJG2TKPVQWVTGRQTVU

'TTQT/GUUCIG 4GOGF[
/'/14;(7..
 2TGUUVJGRCPGNDWVVQPVQRTKPVVJGFCVCTGOCKPKPIKPVJG
RTKPVGT

 4GFWEGVJGEQORNGZKV[QHVJGFQEWOGPV


(QT*.0QPN[ 'ZRCPFVJGRTKPVGTOGOQT[
D[CFFKPICEQOOGTEKCNN[CXCKNCDNG5+//
24+0618'4470
 2TGUUVJGRCPGNDWVVQPVQRTKPVVJGFCVCTGOCKPKPIKPVJG
RTKPVGT

 4GFWEGVJGEQORNGZKV[QHVJGFQEWOGPVQTTGFWEGVJGRTKPV
TGUQNWVKQP


(QT*.0QPN[ 'ZRCPFVJGRTKPVGTOGOQT[
D[CFFKPICEQOOGTEKCNN[CXCKNCDNG5+//5GVRCIG
RTQVGEVKQPVQ10D[WUKPIVJGUWRRNKGF9KPFQYUFTKXGTQT
42%RTQITCO


(QT*.0QPN[ %JCPIGVJGHQNNQYKPIUGVVKPIUKP
VJGUWRRNKGF9KPFQYUFTKXGTCPFVT[CICKP6JGDGUV
EQODKPCVKQPQHUGVVKPIUDGNQYYKNNXCT[FGRGPFKPIQPVJG
FQEWOGPV
)TCRJKEU/QFG6TWG6[RGOQFG7UG2TKPVGT
6TWG6[RG(QPVU
4'51.76+10
 4GFWEGVJGEQORNGZKV[QHVJGFQEWOGPVDGHQTGRTKPVKPIVQ
#&#26'& RTGXGPVCWVQOCVKETGFWEVKQPQHVJGTGUQNWVKQP

6JGRTKPVGTJCURTKPVGF


(QT*.0QPN[ 'ZRCPFVJGRTKPVGTOGOQT[
VJGFQEWOGPVCVC
D[CFFKPICEQOOGTEKCNN[CXCKNCDNG5+//
TGFWEGFTGUQNWVKQP
016'
6JGEQOOWPKECVKQPRCTCOGVGTUGVVKPIUCTGRTKPVGFQPVJG2TKPV%QPHKIWTCVKQPUJGGV(QT
FGVCKNUQPJQYVQRTKPVVJG2TKPV%QPHKIWTCVKQPUJGGVUGG5GEVKQPŎ2TKPV%QPHKIWTCVKQPŏKP
#RRGPFKZ


%*#26'46417$.'5*116+0)

 2#2'4241$.'/5

9JGPCP[RCRGTTGNCVGFRTQDNGOQEEWTUGPUWTGVJCVVJGRCRGTWUGFOGGVUVJGTGEQOOGPFGF
RCRGTURGEKHKECVKQPUTGHGTTKPIVQ5WDUGEVKQPŎ2CRGTŏKP%*#26'4

 2CRGT.QCFKPI2TQDNGOU

2TQDNGO 4GOGF[
6JGRTKPVGTFQGUPQV
 %JGEMVJCVRCRGTKPVJGRCRGTECUUGVVGKUUVTCKIJV+HKVKU
NQCFRCRGT EWTNGFUVTCKIJVGPKVDGHQTGRTKPVKPI5QOGVKOGUKVKUJGNRHWNVQ
TGOQXGVJGRCRGTVWTPVJGUVCEMQXGTCPFRWVKVDCEMKPVQVJG
RCRGTECUUGVVG

 4GFWEGVJGCOQWPVQHRCRGTKPVJGECUUGVVG-GGRRCRGT
NQCFUDGNQYOOKPFGRVJ

 %JGEMVJCVOCPWCNHGGFOQFGKUPQVUGNGEVGFKPVJGRTKPVGT
FTKXGT
6JGRTKPVGTFQGUPQV
 4GKPUVCNNVJGRCRGTHKTON[KPVQVJGOCPWCNHGGFUNQVQPGUJGGV
NQCFRCRGTHTQOVJG CVCVKOG
OCPWCNHGGFUNQV

 %JGEMVJCVOCPWCNHGGFOQFGKUUGNGEVGFKPVJGRTKPVGTFTKXGT
6JGRTKPVGTYKNNPQVNQCF %JGEMVJCVGPXGNQRGUCTGNQCFGFKPVQVJGOCPWCNHGGFUNQV6JG
GPXGNQRGU CRRNKECVKQPUQHVYCTGOWUVDGUGVWREQTTGEVN[VQRTKPVQPVJG
GPXGNQRGUK\G[QWCTGWUKPI
6JGRTKPVGTFQGUPQV %NQUGVJGTGCTEQXGT
RTKPVKPVQVJGQWVRWVVTC[
6JGRTKPVGTFQGUPQV
 %JGEMVJCVVJG.QYGTVTC[ECDNGKUEQPPGEVGFVQVJGRTKPVGT
RTKPVQPVJGURGEKHKGF

 %JGEMVJCVVJGCRRTQRTKCVGRTKPVGTFTKXGTKUUGNGEVGF
RCRGT

*.0YKVJ
QRVKQPCNNQYGTVTC[WPKV
QPN[


%*#26'46417$.'5*116+0)

 2CRGT,COU
 %NGCTKPILCOOGFRCRGT
%NGCTVJGLCOOGFRCRGTHQNNQYKPIVJGRTQEGFWTGUDGNQY

 4GOQXGVJGRCRGTECUUGVVGEQORNGVGN[
HTQOVJGRTKPVGT

 2WNNCP[LCOOGFRCRGTWRCPFQWVQH
VJGRTKPVGT
(KI

 1RGPVJGHTQPVEQXGT

(KI


 4GOQXGVJGFTWOWPKVCUUGODN[2WNNCP[LCOOGFRCRGTWRCPFQWVQHVJGRTKPVGT
&QPQVTGOQXGVJGFTWOWPKVCUUGODN[YKVJCFFKVKQPCNHQTEGCVVJKUVKOGKH[QWECPPQV
TGOQXGKVGCUKN[+PUVGCFRWNNVJGGFIGQHVJGLCOOGFRCRGTHTQOVJGWPFGTPGCVJQHVJG
RTKPVGT

(KI


 1RGPVJGTGCTEQXGTCPFRWNNVJG
LCOOGFRCRGTQWVQHVJGHKZKPIWPKV+H
[QWJCXGVQRWNNVJGRCRGTVQYCTFUVJG
DCEMQHVJGRTKPVGTVJGHWUGTOC[IGV
FKTV[YKVJVQPGTRQYFGTCPFOC[TGUWNV
KPVQPGTUECVVGTQPVJGPGZVRTKPVGFRCIG
QTRCIGU2TKPVCHGYEQRKGUQHVJGVGUV
RCIGWPVKNVJGVQPGTUECVVGTQPVJG
RTKPVGFRCIGUUVQRU
(KI

 %NQUGVJGTGCTEQXGT
(KI

 +PUVCNNVJGFTWOWPKVCUUGODN[CPFVJG
RCRGTECUUGVVGVJGPENQUGVJGHTQPV
EQXGT

016'
+HVJGLCOOGFRCRGTKUTGOQXGFEQORNGVGN[KPUVCNNVJGRCRGTECUUGVVGHKTUVVJGPENQUGVJGHTQPV
EQXGTCPFVJGRTKPVGTYKNNTGUWOGRTKPVKPICWVQOCVKECNN[+HVJGRTKPVGTFQGUPQVTGUWOGRTKPVKPI
CWVQOCVKECNN[RTGUUVJGEQPVTQNRCPGNDWVVQP


%*#26'46417$.'5*116+0)

 %CWUGUEQWPVGTOGCUWTGU
6JGECWUGUHQTRCRGTLCORTQDNGOUXCT[FGRGPFKPIQPVJGNQECVKQPQHVJGRCRGTLCO9JGPC
RCRGTLCOQEEWTUKPUKFGVJGRTKPVGT[QWJCXGVQHKPFVJGNQECVKQPQHVJGRCRGTLCOHKTUVTGOQXG
VJGLCOOGFRCRGTCPFVJGPVCMGVJGCRRTQRTKCVGEQWPVGTOGCUWTGTGHGTTKPIVQVJGVCDNGDGNQY

2TQDNGO 6[RGQH,CO %CWUG 4GOGF[


,COYJGPVJGRTKPVGTKU 2CRGTUVWEM 6JGHTQPVTGIKUVTCVKQP 4GOQXGVJGRCRGTKPUKFG
VWTPGFQP UGPUQTQTRCRGTGLGEV VJGRTKPVGT+HVJGTGKUPQ
UGPUQTKUVWTPGFQP RCRGTEJGEMVJGUWURGEV
UGPUQTUTGHGTTKPIVQ
016'
6QRQHRCRGTUVQRRGFCV ,COECWUGFD[RCRGT 6JGHTQPVTGIKUVTCVKQP %JGEMHTQPVTGIKUVTCVKQP
OOHTQOVJGUGEQPF NGPIVJFGVGEVGFCU UGPUQTKUPQVTGVWTPKPI UGPUQTOQVKQPTGHGTTKPIVQ
GZKVTQNNGT0GZVRCRGTKU NQPIGTVJCPOO
 RTQRGTN[CPFKUPQV 016'
PQVHGF KP  VWTPKPIQHH
$QVVQOQHRCRGTUVQRRGF ,COECWUGFD[RCRGT 6JGHTQPVTGIKUVTCVKQP %JGEMVJGHTQPV
CTQWPFVJGVTCPUHGTTQNNGT NGPIVJFGVGEVGFCU UGPUQTYCUVWTPGFQHH TGIKUVTCVKQPUGPUQT
UJQTVGTVJCPOO GCTN[/CNHWPEVKQPQH TGHGTTKPIVQ016'
CEVWCVQTQTJCTFYCTG
PQKUG
6QRQHRCRGTUVQRRGF ,COECWUGFD[C 2CRGTYCUPQVHGFKPCV 4GOQXGVJGRCRGTFWUV
DGVYGGPVJGRCRGTHGGF RCRGTHGGFFGNC[ VJGRTQRGTVKOKPIFWG CVVCEJGFVQVJGRKEMWR
TQNNGTCPFVJGRKEMWR VQRCRGTFWUVQTYGCT TQNNGT+HVJGTWDDGTKU
TQNNGT QHVJGTWDDGTRKEMWR YQTPQWVTGRNCEGKVYKVJC
TQNNGT PGYQPG
6QRQHRCRGTUVQRRGFCV ,COECWUGFD[VJG 6JGRCRGTGLGEVUGPUQT %JGEMUGPUQTOQVKQP
OOHTQOVJGEQPVCEV RCRGTUGPUGFCUPQV KUPQVYQTMKPIRTQRGTN[ TGHGTTKPIVQ016'
RQKPVQHVJGJGCVTQNNGTCPF DGKPIGLGEVGFHTQOVJG CPFJCUPQVVWTPGFQHH
RTGUUWTGTQNNGT RCRGTGLGEVUGPUQT
UKPINGRTKPVKPI
6QRQHRCRGTUVQRRGFCV ,COECWUGFD[ 6JGUWTHCEGQHVJG  %NGCPVJGUWTHCEGQH
OOHTQOVJG KPEQTTGEVRCRGTRKEM UGRCTCVKQPRCFQTVJG VJGUGRCTCVKQPRCFQT
EQPVCEVRQKPVQHVJGJGCV WR RKEMWRTQNNGTKUFKTV[QT RKEMWRTQNNGT
TQNNGTCPFRTGUUWTGTQNNGT YQTPQWV
 4GRNCEGVJGUGRCTCVKQP
,COOGFRCRGTKUPQV
RCFQTRKEMWRTQNNGT
RTKPVGFCVCNN
,COCHVGTRCRGTKU ,COECWUGFD[VJG 6JGRCRGTGLGEVUGPUQT %JGEMUGPUQTOQVKQP
GLGEVGF RCRGTUGPUGFCUPQV QTHTQPVTGIKUVTCVKQP TGHGTTKPIVQ016'
DGKPIGLGEVGFHTQOVJG UGPUQTKUPQVYQTMKPI
RCRGTGLGEVUGPUQT RTQRGTN[CPFJCUPQV
VWTPGFQHH
EQPVKPWQWU
RTKPVKPI
6QRQHRCRGTUVQRRGFCV ,COECWUGFD[VJG 6JGLCOUGPUQTKUPQV %JGEMUGPUQTOQVKQP
OOHTQOVJG RCRGTUGPUGFCUPQV YQTMKPIRTQRGTN[CPF TGHGTTKPIVQ016'
EQPVCEVRQKPVQHVJGJGCV DGKPIGLGEVGFHTQOVJG JCUPQVVWTPGFQHH
TQNNGTCPFRTGUUWTGTQNNGT LCOUGPUQT
UKPINGRTKPVKPI





%*#26'46417$.'5*116+0)

016'
*QYVQEJGEMVJGUGPUQTU
 6WTPQHHVJGRTKPVGTRQYGTUYKVEJQRGPVJGHTQPVEQXGTCPFTGOQXGVJGFTWOWPKV
 6WTPQPVJGRTKPVGTYJKNGRTGUUKPIVJGEQPVTQNRCPGNDWVVQP6JG&TWO.'&EQOGU10
 .KIJVN[RTGUUVJGRCPGNDWVVQPCICKP
Æ#NCTO.'&KU10(TQPVTGIKUVTCVKQPUGPUQTKUVWTPGF10
 2TGUUCPFTGNGCUGVJGRCPGNDWVVQPCICKP
Æ&TWO.'&KU102CRGTGLGEVUGPUQTKUVWTPGF10
(QTFGVCKNUQPVJGUGPUQTUUGGŎ(CEVQT[KPURGEVKQPOQFGŏKP5WDUGEVKQP


%*#26'46417$.'5*116+0)

 2CRGT(GGFKPI2TQDNGOU
'XGPKHVJGRCRGTKURTKPVGFCPFGLGEVGFYKVJQWVCP[RTQDNGOUUWEJCURCRGTLCOURCRGT
HGGFKPIRTQDNGOUDGNQYOC[CRRGCT
7UGTUECPENGCTVJGUGRTQDNGOUD[HQNNQYKPIVJGŎ7UGT%JGEMŏKVGOUHQTGCEJRTQDNGO'XGPKH
VJGUCOGRTQDNGOQEEWTUCICKPHQNNQYVJGRTQEGFWTGUKPVJGVCDNGDGNQY

( &QWDNGHGGFKPI

7UGT%JGEM
%JGEMVJGRCRGTWUGFOGGVUVJGTGEQOOGPFGFRCRGTURGEKHKECVKQPU

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


5GRCTCVKQPRCF  +UVJGUWTHCEGQHVJGUGRCTCVKQP ;GU 4GRNCEGVJGUGRCTCVKQPRCF
RCFYQTPQWV!

( 9TKPMNGUQTETGCUGU

7UGT%JGEM

 %JGEMVJCVRCRGTKUNQCFGFKPVQVJGRCRGTECUUGVVGEQTTGEVN[

 %JGEMVJGRCRGTWUGFOGGVUVJGTGEQOOGPFGFRCRGTURGEKHKECVKQPU

 6T[RTKPVKPIWUKPIVJGUVTCKIJVVJTQWIJQWVRWVRCVJ

 6WTPQXGTVJGUVCEMQHRCRGTKPVJGECUUGVVGQTVT[TQVCVKPIVJGRCRGTuKPVJGECUUGVVG

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


2CRGT  +UVJGRTQDNGOUQNXGFKHPGY ;GU +PUVTWEVVJGWUGTJQYVQUVQTG
RCRGTKUWUGF! RCRGTUQVJCVKVFQGUPQV
CDUQTDOQKUVWTG
(KZKPIWPKV  +UVJGGPVTCPEGIWKFGFKTV[! ;GU %NGCPVJGGPVTCPEGIWKFG
GPVTCPEGIWKFG
(KZKPIWPKV  +UVJGRTGUUWTGTQNNGTFKTV[! ;GU %NGCPVJGRTGUUWTGTQNNGT
0Q 4GRNCEGVJGHKZKPIWPKV


%*#26'46417$.'5*116+0)

( 2CIGUMGY

7UGT%JGEM

 %JGEMVJCVVJGRCRGTQTQVJGTOGFKCKUNQCFGFKPVQVJGRCRGTECUUGVVGEQTTGEVN[CPFVJCVVJGRCRGT
IWKFGUCTGPQVVQQVKIJVQTVQQNQQUGCICKPUVVJGRCRGTUVCEM

 +HWUKPIVJGOCPWCNHGGFUNQVEJGEMJQYVQNQCFRCRGTKPVQVJGOCPWCNHGGFUNQVEQTTGEVN[

 6JGRCRGTECUUGVVGOC[DGVQQHWNN.QCFRCRGTDGNQYOOKPFGRVJ

 %JGEMVJGRCRGTWUGFOGGVUVJGTGEQOOGPFGFRCRGTURGEKHKECVKQPU

( %WTNQT9CXG

7UGT%JGEM

 %JGEMVJGRCRGTWUGFOGGVUVJGTGEQOOGPFGFRCRGTURGEKHKECVKQPU$QVJJKIJVGORGTCVWTGCPF
JWOKFKV[YKNNECWUGRCRGTVQEWTN

 +HVJGRTKPVGTKUWUGFKPHTGSWGPVN[VJGRCRGTOC[JCXGUCVHQTVQQNQPIKPVJGRCRGTECUUGVVG6WTP
QXGTVJGUVCEMQHRCRGTKPVJGRCRGTECUUGVVG#NUQVT[TQVCVKPIVJGRCRGTuKPVJGRCRGT
ECUUGVVG

 6T[RTKPVKPIWUKPIVJGUVTCKIJVVJTQWIJQWVRWVRCVJ

016'
(QTPQRCRGTUWRRNKGFCUVJGECWUGQHCOCNHWPEVKQPUGGŎ/0QRCRGTUWRRNKGFŏKP5GEVKQP
Ŏ/CNHWPEVKQPUŏ


%*#26'46417$.'5*116+0)

 51(69#4'5'66+0)241$.'/5

6JGRTKPVGTOC[PQVRTKPVVJGFCVCEQTTGEVN[KHVJGTGCTGKPEQTTGEVUQHVYCTGUGVVKPIU

5 ő6JGTGYCUCPGTTQTYTKVKPIVQ.26
QT$475$ HQTVJGRTKPVGTŒGTTQTOGUUCIGCRRGCTU

7UGT%JGEM

 %JGEMVJCVVJGRTKPVGTECDNGKUPQVFCOCIGFQTDTQMGP%JGEMCNUQVJCVVJGECDNGKUEQPPGEVGFVQ
VJGEQTTGEVKPVGTHCEGEQPPGEVQTUQHDQVJVJGRTKPVGTCPF2%

 %JGEMVJCVVJGEQTTGEVRTKPVGTKUUGNGEVGFKH[QWJCXGCPKPVGTHCEGUYKVEJKPIFGXKEG

 %JGEMVJCVVJGCRRTQRTKCVGRTKPVGTFTKXGTKUUGNGEVGFCUŎ5GVCU&GHCWNVŏ%JGEMCNUQVJCVVJG
EQTTGEVRTKPVRQTVKUUGVHQTVJGUGNGEVGFRTKPVGTFTKXGT

 %JGEMVJCVVJGRTKPVGTKUPQVEQPPGEVGFVQVJGUCOGRQTVYJKEJKUCNUQEQPPGEVGFVQCOCUU
UVQTCIGFGXKEGQTUECPPGT4GOQXGCNNQVJGTFGXKEGUCPFEQPPGEVVJGRQTVVQVJGRTKPVGTQPN[
6WTPQHHVJGRTKPVGTUVCVWUOQPKVQTKPVJGFGXKEGQRVKQPUVCDKPVJGRTKPVGTFTKXGT

 +HVJGRTKPVRQTVKUUGVCUCP'%2RQTVEJCPIGKVVQCPQTOCNRQTV

 6T[RTKPVKPIVJGVGUVRCIGTGHGTTKPIVQ5WDUGEVKQPŎ6GUV2TKPV/QFGŏKPVJKUEJCRVGT

 6T[TGUGVVKPIVJGHCEVQT[UGVVKPIU

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


(CKNWTGKPUKFG  +UKVRQUUKDNGVQRTKPVVJGVGUV 0Q +FGPVKH[VJGGTTQTV[RGVJGP
VJGRTKPVGT RCIGYKVJVJGOGVJQFQH TGHGTVQVJGURGEKHKGFUGEVKQPQH
5WDUGEVKQPŎ6GUV2TKPV VJKUEJCRVGT
/QFGŏKPVJKUEJCRVGT!
/CKP2%$  +UKVRQUUKDNGVQRTKPVYKVJ 0Q 4GRNCEGVJGOCKP2%$
HCKNWTG CPQVJGT2%CPFRTKPVGTECDNG!
;GU 6JKURTQDNGOOC[CRRGCT
WPFGTVJGURGEKHKGFU[UVGO
GPXKTQPOGPV%JGEMVJG
GPXKTQPOGPVYJKEJVJGWUGT
WUGF


%*#26'46417$.'5*116+0)

5 7PCDNGVQRTKPVHTQOCRRNKECVKQPUQHVYCTGWPFGT&15

7UGT%JGEM

 %JGEMVJCVVJG&15CRRNKECVKQPUQHVYCTGKPVGTHCEGUGVVKPIUOCVEJVJCVQH[QWTRTKPVGT

 %JGEMKHVJGRTKPVGTJCUCP[RTKPVGTCNCTOUCEVKXG

 %JGEMKHVJGCRRTQRTKCVGRTKPVGTKUUGNGEVGFKP[QWTCRRNKECVKQPUQHVYCTG

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


(CKNWTGKPUKFG  +UKVRQUUKDNGVQRTKPVVJGVGUV 0Q +FGPVKH[VJGGTTQTV[RGVJGP
VJGRTKPVGT RCIGYKVJVJGOGVJQFQH TGHGTVQVJGURGEKHKGFUGEVKQPQH
5WDUGEVKQPŎ6GUV2TKPV VJKUEJCRVGT
/QFGŏKPVJKUEJCRVGT!
/CKP2%$  +UKVRQUUKDNGVQRTKPVYKVJ 0Q 4GRNCEGVJGOCKP2%$
HCKNWTG CPQVJGT2%CPFRTKPVGTECDNG!
;GU 6JKURTQDNGOOC[CRRGCT
WPFGTVJGURGEKHKGFU[UVGO
GPXKTQPOGPV%JGEMVJG
GPXKTQPOGPVYJKEJVJGWUGT
WUGF
016'
+HVJKURTQDNGOCRRGCTUYJGPWUKPIVJG45/HQNNQYVJGRTQEGFWTGUKPő5ŒQPVJKURCIG


%*#26'46417$.'5*116+0)

5 #NVJQWIJVJG75$FTKXGTKUKPUVCNNGFKVKUWPCDNGVQHKPFVJG$475$RQTV

*.0QPN[

7UGT%JGEM

 4GKPUVCNNVJG75$FTKXGTD[HQNNQYKPIVJGUVGRUDGNQY
K &QWDNGENKEMVJGHKNGő&GKPU75$GZGŒKPVJG75$FKTGEVQT[QHVJG%&41/
KK 4GDQQVVJG2%
KKK 6WTPVJGRTKPVGTQHHCPFQPCICKP
KX ő#FF0GY*CTFYCTG9K\CTFŒKUNCWPEJGFCICKPHQNNQYVJGKPUVTWEVKQPUKPVJG9K\CTFVQTG
KPUVCNNVJGFTKXGT

 6T[VQEQPPGEVVJGRTKPVGTFKTGEVN[VQVJGEQORWVGTKHKVKUEQPPGEVGFVJTQWIJC75$JWD

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


%QORWVGT  &QGUŎ7PKXGTUCN5GTKCN$WU 0Q 6JKURTQDNGOECPDGECWUGF
UGVVKPIU %QPVTQNNGTUŏCRRGCTKPVJG D[[QWTEQORWVGTUGVVKPIU
&GXKEG/CPCIGTVCDQHŎ5[UVGO 5GGVJGEQORWVGTOCPWCN
2TQRGTVKGUŏKP%QPVTQN2CPGN!
75$ECDNG  &QGUő#FF0GY*CTFYCTG 0Q 6JG75$ECDNGKUFCOCIGF
RTKPVGTFCOCIG 9K\CTFŒCRRGCTQPVJGUETGGP 4GRNCEGVJGECDNG
QT&QGUVGUVRTKPVEQORNGVG! +HVJGUCOGRTQDNGOCRRGCTU
VJGRTKPVGTYKNNDGFCOCIGF


%*#26'46417$.'5*116+0)

5 6JKURTKPVGTFQGUPQVCRRGCTKP%JQQUGTYKVJK/CECPF2QYGT/CEKPVQUJ
)YKVJ75$
*.0QPN[

7UGT%JGEM

 %JGEMVJGRTKPVGTKUVWTPGFQP

 %JGEMVJG75$KPVGTHCEGECDNGKUEQPPGEVGFEQTTGEVN[

 %JGEMVJGRTKPVGTFTKXGTKUKPUVCNNGFEQTTGEVN[

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


2TKPVGT  5GNGEVŎ#RRNG5[UVGO2TQHKNGTŏ 0Q %JGEMVJGRTKPVGTKUVWTPGFQP
EQPPGEVKQP KP#RRNG/GPW#TGVJG CPFVJG75$KPVGTHCEGECDNGKU
HQNNQYKPIKVGOUKPFKECVGFKPVJG EQPPGEVGFEQTTGEVN[
75$DQZQHVJG&GXKEGCPF %JGEMVJCVVJG75$ECDNG
8QNWOGUVCD! WUGFKUVJGUJKGNFGFVYKUVGF
• 2TQFWEV+&
Z& 
HQT RCKTV[RGCPFOQTNGUU
*. 
Z' 
HQT*. 6T[VQEQPPGEVVJGRTKPVGTCPF
 QT
Z( 
HQT*. 2%YKVJVJG75$ECDNGFKTGEVN[
0 
• 8GPFGT$TQVJGT+PVGTPCVKQPCN
%QTRQTCVKQP
QTZH
&TKXGT  #TGVJGTGVJGHQNNQYKPIHKNGUKP 0Q 6T[VQTGKPUVCNNVJGRTKPVGT
KPUVCNNCVKQP VJG'ZVGPUKQPU(QNFGTQH FTKXGT
5[UVGO(QNFGT!
(QT5[UVGOQTJKIJGT ;GU 6WTPQHHVJGRTKPVGTCPF2%
• $4A$CEMITQWPFGT RQYGTUYKVEJCPFEJGEMCNN
• $4A2TKPV/QPKVGT
75$ EQPPGEVKQPUDGVYGGPVJGO
• *./(.2TQ 6JGPVWTPVJGOQPCICKP
• 75$2TKPV&TKXGT
(QT5[UVGO
• $4A$CEMITQWPFGT
• $4A2TKPV/QPKVGT
75$
• *./(.2TQ
• 75$2TKPV&TKXGT
$4
• 75$2TKPV&TKXGT
$4
• 75$2TKPV&TKXGT
$4
• 75$2TKPV&TKXGT
$4
• 75$2TKPV&TKXGT
$4#
• 75$2TKPV&TKXGT
$4
016'
6JGXCNWGQTCNRJCDGVHQNNQYKPIŎ$4ŏKUCRTQFWEV+&


%*#26'46417$.'5*116+0)

 /#.(70%6+105

9JGPVCMKPIEQWPVGTOGCUWTGUHQTOCNHWPEVKQPUCUFGUETKDGFKPVJKUUGEVKQPEJGEMEQPPGEVQTU
HQTEQPVCEVHCKNWTGDGHQTGOGCUWTKPIVJGXQNVCIGCVVJGURGEKHKGFEQPPGEVQTRKPU

/ 0Q#%RQYGTUWRRNKGF

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


5WRRN[XQNVCIG  +UVJGEQTTGEVXQNVCIGRTGUGPV 0Q +PHQTOVJGWUGTVJCVVJGEQTTGEV
CVVJGQWVNGV! XQNVCIGKUPQVUWRRNKGFCVVJG
QWVNGV
2QYGTRNWI  +UVJGRQYGTEQTFUGEWTGN[ 0Q 2NWIVJGRQYGTEQTFUGEWTGN[
RNWIIGFKPVQVJGQWVNGV! KPVQVJGQWVNGV
(WUG
((  +UVJGHWUGDNQYP! ;GU +HVJGHWUGDNQYUCICKP
KOOGFKCVGN[CHVGTTGRNCEKPIVJG
NQYXQNVCIGRQYGTUWRRN[2%$
EJGEMVJCVVJGTGKUPQVCUJQTV
EKTEWKVUQOGYJGTGKPVJG#%
RQYGTUWRRN[NKPG
9KTKPI  7PRNWIVJGRQYGTUWRRN[RNWI ;GU 4GRNCEGVJG#%RQYGTEQTF
+UVJGTGCDTQMGPYKTGDGVYGGP
VJG#%KPRWVEQPPGEVQTQHVJG
NQYXQNVCIGRQYGTUWRRN[CPF
VJGRQYGTRNWI!

/ 0Q&%RQYGTUWRRNKGF

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


#%RQYGT  +U#%RQYGTUWRRNKGFDGVYGGP 0Q (QNNQYVJGUCOGEJGEM
UWRRN[ EQPPGEVQTU%0.CPF%00 RTQEGFWTGQH/ő0Q#%
YJGPVJGRQYGTRNWIKU RQYGTUWRRNKGFŒ
RNWIIGFKPVQVJGQWVNGV!
9KTKPI&%NQCF  6WTPQHHVJGRQYGTUYKVEJCPF ;GU 6WTPQHHVJGRQYGTUYKVEJ
FKUEQPPGEVVJG2CPF2 TGEQPPGEVVJGEQPPGEVQTCPF
EQPPGEVQTUQPVJGGPIKPG2%$ VWTPVJGRQYGTUYKVEJQPCICKP
6WTPQPVJGRQYGTCICKP +HVJGRTQVGEVQTEKTEWKVKU
/GCUWTGVJGXQNVCIGUDGVYGGP CEVKXCVGFEJGEMVJGEQPPGEVQT
VJGVGTOKPCNU&QVJG VJGYKTKPIHTQOVJGEQPPGEVQT
OGCUWTGFXQNVCIGUCVKUH[VJG CPFVJG&%NQCF
RTGUETKDGFXCNWGFKPVJGVCDNG
DGNQY!
.QYXQNVCIG  PCB + lead pin - lead pin Voltage 0Q 4GRNCEGVJGNQYXQNVCIGRQYGT
RQYGTUWRRN[ P5-2 P5-3 Approx. 24V UWRRN[2%$
Engine
2%$ P3-10 P3-9 Approx. 5V

9#40+0)
+H[QWCPCN[\GOCNHWPEVKQPUYKVJVJGRQYGTRNWIKPUGTVGFKPVQVJGRQYGTQWVNGVURGEKCN
ECWVKQPUJQWNFDGGZGTEKUGFGXGPKHVJGRQYGTUYKVEJKU1((DGECWUGKVKUCUKPINGRQNG
UYKVEJ


%*#26'46417$.'5*116+0)

/ /CKPOQVQTFQGUPQVTQVCVG

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


(CKNWTGQH  +UVJGEQPPGEVKQPQHEQPPGEVQT 0Q 4GEQPPGEVVJGEQPPGEVQT
EQPPGEVQT 2QPVJGGPIKPG2%$EQTTGEV!
/CKPOQVQT  +UVJGRTQDNGOUQNXGFD[ ;GU 4GRNCEGVJGOCKPOQVQT
TGRNCEKPIVJGOCKPOQVQT!
'PIKPG2%$  +UVJGRTQDNGOUQNXGFD[ ;GU 4GRNCEGVJGGPIKPG2%$
TGRNCEKPIVJGGPIKPG2%$!
/CKP2%$  +UVJGRTQDNGOUQNXGFD[ ;GU 4GRNCEGVJGOCKP2%$
TGRNCEKPIVJGOCKP2%$!

/ 0QRCRGTUWRRNKGF

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


(CKNWTGQH  +UVJGEQPVCEVQHVJGUQNGPQKF 0Q 4GEQPPGEVVJGEQPPGEVQT
EQPPGEVQT EQPPGEVQTQPVJGGPIKPG2%$
IQQF!
'PIKPG2%$  5GVRCRGTKPVJGOCPWCNRCRGT ;GU 4GRNCEGVJGGPIKPG2%$
EKTEWKV UNQVCPFOCMGCVGUVRTKPVD[
RTGUUKPIVJGEQPVTQNRCPGN
DWVVQP
2CRGTRKEMWR &QGUVJGXQNVCIGDGVYGGPRKPU 0Q 4GRNCEGVJGRCRGTRKEMWR
ENWVEJUQNGPQKF 
51.'01+& CPF
8 QH UQNGPQKF
VJG2EQPPGEVQTQPVJG
GPIKPG2%$EJCPIGHTQO
CRRTQZ8&%VQ8YKVJKP
VJGURGEKHKGFVKOG!
5GRCTCVKQPRCF  +UVJGUWTHCEGQHVJGUGRCTCVKQP ;GU  %NGCPVJGUWTHCEGQHVJG
RKEMWRTQNNGT RCFQTVJGRKEMWRTQNNGTFKTV[QT UGRCTCVKQPRCFQTRKEMWR
HCKNWTG YQTPQWV! TQNNGT
 4GRNCEGVJGUGRCTCVKQPRCF
QTRKEMWRTQNNGT
/CKP2%$  +UVJGRTQDNGOUQNXGFD[ ;GU 4GRNCEGVJGOCKP2%$
TGRNCEKPIVJGOCKP2%$!


%*#26'46417$.'5*116+0)

/ +PUWHHKEKGPVQWVRWVHTQOJKIJXQNVCIGRQYGTUWRRN[WPKV

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


*KIJXQNVCIG  &QCP[QHVJGVGTOKPCNUQPVJG ;GU %NGCPVJGVGTOKPCNU
EQPVCEV JKIJXQNVCIGEQPVCEVUJCXGFKTV
QTEQPVCEVDWTPU!
*KIJXQNVCIG  %JGEMVJGEQPPGEVKQPUQHVJG ;GU 4GRNCEGVJGJKIJXQNVCIG
RQYGTUWRRN[ EQPPGEVQTDGVYGGPVJGJKIJ RQYGTUWRRN[2%$
2%$ XQNVCIGRQYGTUWRRN[CPFVJG
GPIKPG2%$CTGUGEWTGF
EQTTGEVN[
0Q 4GEQPPGEVVJGEQPPGEVQT
DGVYGGPVJGJKIJXQNVCIG
RQYGTUWRRN[CPFVJGGPIKPG
2%$

/ (KZKPIJGCVGTVGORGTCVWTGHCKNWTG

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


2QQTVJGTOKUVQT  +UVJGEQPVCEVQHEQPPGEVQT2 0Q 4GEQPPGEVVJGEQPPGEVQT
JCTPGUUEQPVCEV QPVJGGPIKPG2%$IQQF!
$NQYPVJGTOCN  4GOQXGVJGHKZKPIWPKVCPF ;GU 4GRNCEGVJGHKZKPIWPKV
HWUG OGCUWTGVJGTGUKUVCPEGQHVJG
VJGTOKUVQT+UKVQRGPEKTEWKV!
6JGTOKUVQT  +UVJGVJGTOKUVQTKPUVCNNGF ;GU 4GRNCEGVJGHKZKPIWPKV
HCKNWTG RTQRGTN[!
0Q 4GKPUVCNNVJGVJGTOKUVQT
RTQRGTN[
*CNQIGPJGCVGT  4GOQXGVJGHKZKPIWPKVCPF ;GU 4GRNCEGVJGJCNQIGPJGCVGT
NCORHCKNWTG OGCUWTGVJGTGUKUVCPEGQHVJG NCOR
JCNQIGPJGCVGTNCOR+UKV
QRGPEKTEWKV!

/ $&HCKNWTG

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


*CTPGUU  +UEQPPGEVQT2QPVJGOCKP 0Q 4GEQPPGEVVJGEQPPGEVQT
EQPPGEVKQP 2%$UGEWTGFEQTTGEVN[! UGEWTGN[
HCKNWTG
;GU 4GRNCEGVJGNCUGTWPKV


%*#26'46417$.'5*116+0)

/ 5ECPPGTHCKNWTG

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


*CTPGUU  +UVJGEQPPGEVKQPQHVJG 0Q 4GEQPPGEVVJGEQPPGEVQT
EQPPGEVKQP UECPPGTOQVQTEQPPGEVQT2 UGEWTGN[
HCKNWTG QPVJGGPIKPG2%$UGEWTG!
2QYGTUWRRN[  +UVJGXQNVCIGDGVYGGPRKPU 0Q %JGEMKH 8&%KUUWRRNKGF
KPRWV
8&% CPF
)0& QH DGVYGGPRKPU
8&% CPF
EQPPGEVQT2QPVJGGPIKPG 
84'6 QHEQPPGEVQT2
2%$8&%! QPVJGGPIKPG2%$+HPQV
EJGEMVJGRQYGTUWRRN[QWVRWV
QPVJGNQYXQNVCIGRQYGT
UWRRN[2%$
;GU 4GRNCEGVJGNCUGTWPKV

/ (WUGTHCKNWTG

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


2QQTVJGTOKUVQT  +UVJGEQPVCEVQHEQPPGEVQT2 0Q 4GEQPPGEVVJGEQPPGEVQT
JCTPGUUEQPVCEV QPVJGGPIKPG2%$IQQF!
$NQYPVJGTOCN  4GOQXGVJGHKZKPIWPKVCPF ;GU 4GRNCEGVJGHKZKPIWPKV
HWUG OGCUWTGVJGTGUKUVCPEG
DGVYGGPVJGKPRWVEQPPGEVQTU
+UKVQRGPEKTEWKV!
6JGTOKUVQT  +UVJGVJGTOKUVQTKPUVCNNGF ;GU 4GRNCEGVJGHKZKPIWPKV
HCKNWTG RTQRGTN[!
0Q 4GKPUVCNNVJGVJGTOKUVQT
RTQRGTN[
*CNQIGPJGCVGT  4GOQXGVJGHKZKPIWPKVCPF ;GU 4GRNCEGVJGJCNQIGPJGCVGT
NCORHCKNWTG OGCUWTGVJGTGUKUVCPEGQHVJG NCOR
JCNQIGPJGCVGTNCOR+UKV
QRGPEKTEWKV!
*GCVGTJCTPGUU  +UVJGJGCVGTJCTPGUU 0Q 4GEQPPGEVVJGEQPPGEVQTU
EQPPGEVKQP EQPPGEVQTEQPPGEVGFVQVJG UGEWTGN[
HCKNWTG NQYXQNVCIGRQYGTUWRRN[2%$
CPFHKZKPIWPKVUGEWTG!

016'
• 6JKURTQDNGOYKNNDGENGCTGFKHNGCXKPIVJGRTKPVGTRQYGT10HQTVGPOKPWVGU
• +HVJGJGCVGTKUEQQNGFFQYPUWHHKEKGPVN[VJKURTQDNGOOC[DGENGCTGFD[VWTPKPIQPVJG
RTKPVGTRQYGTUYKVEJYJKNGRTGUUKPIVJGRCPGNDWVVQP$GYCTPGFJQYGXGTVJCVVJKU
QRGTCVKQPYKNNOGNVVJGHKZKPIWPKVKHVJGJGCVGTKUJQV


%*#26'46417$.'5*116+0)

/ 41/GTTQT&4#/GTTQT084#/GTTQT

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


/CKP2%$  +UKVRQUUKDNGVQRTKPVVJGVGUV 0Q 4GRNCEGVJGOCKP2%$
RCIGYKVJVJGOGVJQFQH
5WDUGEVKQPŎ6GUV2TKPV
/QFGŏKPVJKUEJCRVGT!
5QHVYCTGDWI  &QGUVJKURTQDNGOCRRGCT ;GU +PHQTOVJG$TQVJGTQHHKEGQHVJG
YJGPRTKPVKPIURGEKHKEFCVCQT WUGFURGEKHKEFCVCRTKPVGT
RTKPVKPIWPFGTCURGEKHKE EQPFKVKQPCPFU[UVGO
GPXKTQPOGPV! GPXKTQPOGPV

/ 5GTXKEG#
#FFTGUUGTTQT 5GTXKEG$
$75GTTQT %27TWPVKOGGTTQT

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


/CKP2%$  +UKVRQUUKDNGVQRTKPVVJGVGUV 0Q 4GRNCEGVJGOCKP2%$
RCIGYKVJVJGOGVJQFQH
5WDUGEVKQPŎ6GUV2TKPV
/QFGŏKPVJKUEJCRVGT!
5QHVYCTGDWI  &QGUVJKURTQDNGOCRRGCT ;GU +PHQTOVJG$TQVJGTQHHKEGQHVJG
YJGPRTKPVKPIURGEKHKEFCVCQT WUGFURGEKHKEFCVCRTKPVGT
RTKPVKPIWPFGTCURGEKHKE EQPFKVKQPCPFU[UVGO
GPXKTQPOGPV! GPXKTQPOGPV

/ 'PIKPGKPVGTHCEGGTTQT

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


(KZKPIWPKV  +UVJGITQWPFYKTGQPVJGHKZKPI 0Q 5GEWTGVJGITQWPFYKTG
ITQWPFYKTG WPKVUGEWTGFYKVJVJGUJQWNFGT EQTTGEVN[YKVJVJGUJQWNFGT
EQPPGEVKQP UETGYEQTTGEVN[! UETGY
*CTPGUU  +UVJGEQPPGEVKQPDGVYGGP 0Q 4GEQPPGEVVJGEQPPGEVQTU
EQPPGEVKQP EQPPGEVQT2QPVJGOCKP2%$ UGEWTGN[
HCKNWTG CPFEQPPGEVQT2QPVJG
GPIKPG2%$UGEWTG!
'PIKPG2%$  +UVJGRTQDNGOUQNXGFD[ ;GU 4GRNCEGVJGGPIKPG2%$
TGRNCEKPIVJGGPIKPG2%$!
/CKP2%$  +UVJGRTQDNGOUQNXGFD[ ;GU 4GRNCEGVJGOCKP2%$
TGRNCEKPIVJGOCKP2%$!

/ 2%+$75GTTQT
*.0QPN[

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


*CTPGUU  +UVJGEQPPGEVKQPDGVYGGP 0Q 4GEQPPGEVVJGEQPPGEVQTU
EQPPGEVKQP EQPPGEVQT2QPVJGOCKP UGEWTGN[
HCKNWTG 2%$CPFEQPPGEVQT2QPVJG
PGVYQTMDQCTFUGEWTG!
0GVYQTMDQCTF  +UVJGRTQDNGOUQNXGFD[ ;GU 4GRNCEGVJGPGVYQTMDQCTF
TGRNCEKPIVJGPGVYQTMDQCTF!
/CKP2%$  +UVJGRTQDNGOUQNXGFD[ ;GU 4GRNCEGVJGOCKP2%$
TGRNCEKPIVJGOCKP2%$!


%*#26'46417$.'5*116+0)

 +/#)'&'('%65

 +OCIG&GHGEV'ZCORNGU

I-1 Light I-2 Dark I-3 Completely blank I-4 All black I-5 Dirt on back of paper

I-6 Black vertical I-6 Black vertical I-7 Black horizontal I-8 Black vertical I-9 White vertical
streaks streaks stripes streaks streaks

o tnirp tset tuo tnirP o tnirp tset tuo tnirP tset tuo tnirp tset tuo tnirp tset tuo tnirP Print out test print out test print out test Print out test print o Print out test print o

o tnirp tset tuo tnirP o tnirp tset tuo tnirP tset tuo tnirp tset tuo tnirp tset tuo tnirP Print out test print out test print out test Print out test print o Print out test print o

o tnirp tset tuo tnirP o tnirp tset tuo tnirP tset tuo tnirp tset tuo tnirp tset tuo tnirP Print out test print out test print out test Print out test print o Print out test print o

o tnirp tset tuo tnirP o tnirp tset tuo tnirP tset tuo tnirp tset tuo tnirp tset tuo tnirP Print out test print out test print out test Print out test print o Print out test print o

o tnirp tset tuo tnirP o tnirp tset tuo tnirP tset tuo tnirp tset tuo tnirp tset tuo tnirP Print out test print out test print out test Print out test print o Print out test print o

o tnirp tset tuo tnirP o tnirp tset tuo tnirP tset tuo tnirp tset tuo tnirp tset tuo tnirP Print out test print out test print out test Print out test print o Print out test print o

o tnirp tset tuo tnirP o tnirp tset tuo tnirP tset tuo tnirp tset tuo tnirp tset tuo tnirP Print out test print out test print out test Print out test print o Print out test print o

o tnirp tset tuo tnirP o tnirp tset tuo tnirP tset tuo tnirp tset tuo tnirp tset tuo tnirP Print out test print out test print out test Print out test print o Print out test print o

o tnirp tset tuo tnirP o tnirp tset tuo tnirP tset tuo tnirp tset tuo tnirp tset tuo tnirP Print out test print out test print out test Print out test print o Print out test print o

o tnirp tset tuo tnirP o tnirp tset tuo tnirP tset tuo tnirp tset tuo tnirp tset tuo tnirP Print out test print out test print out test Print out test print o Print out test print o

o tnirp tset tuo tnirP o tnirp tset tuo tnirP tset tuo tnirp tset tuo tnirp tset tuo tnirP Print out test print out test print out test Print out test print o Print out test print o

o tnirp tset tuo tnirP o tnirp tset tuo tnirP tset tuo tnirp tset tuo tnirp tset tuo tnirP Print out test print out test print out test Print out test print o Print out test print o

o tnirp tset tuo tnirP o tnirp tset tuo tnirP tset tuo tnirp tset tuo tnirp tset tuo tnirP Print out test print out test print out test Print out test print o Print out test print o

I-10 White horizontal I-11 Faulty I-12 Poor fixing I-13 Image distortion
I-14 Faint print
streaks registration

I-15 White spots I-16 Black spots I-17 Black band I-18 Gray background I-19 Hollow print

I-20 Downward fogging I-21 Horizontal lines I-22 Light rain I-23 Ghost I-24 Toner specks
of solid black

(KI


%*#26'46417$.'5*116+0)

 6TQWDNGUJQQVKPI+OCIG&GHGEV
5GXGTCNV[RGUQHVJGKOCIGFGHGEVUECPDGENGCTGFD[GPFWUGTU(QTVJQUGFGHGEVUKPUVTWEV
VJGWUGTVQEJGEMVJGŎ7UGT%JGEMŏKVGOUFGUETKDGFKPGCEJVCDNG'XGPKHVJGUCOGKOCIG
FGHGEVCRRGCTUVJGHQNNQYKPIRTQEGFWTGUUJQWNFDGHQNNQYGFKPVJGGXGPVQHURGEKHKEKOCIG
FGHGEVU
5GGCNUQ5WDUGEVKQPHQTKPHQTOCVKQPCDQWVVJGNQECVKQPQHVJGITQWPFKPIEQPVCEVU

! %#76+10
9JGPWUKPIVJGRTKPVGTHQTCURGEKCNLQDUWEJCURTKPVKPIQHPCOGECTFURTKPVSWCNKV[ECPPQVDG
IWCTCPVGGF

+ .KIJV

7UGT%JGEM

 %JGEMVJGRTKPVGTŏUGPXKTQPOGPV%QPFKVKQPUUWEJCUJWOKFKV[JKIJ
VGORGTCVWTGUGVEOC[ECWUGVJKUUKVWCVKQPVQQEEWT

 +HVJGYJQNGRCIGKUNKIJVVQPGTUCXGOQFGOC[DGQP&KUCDNGVQPGTUCXGOQFG
YKVJKP2TKPVGT2TQRGTVKGUVCDQHVJGFTKXGT

 6T[KPUVCNNKPICPGYVQPGTECTVTKFIGQTFTWOWPKV

)TQWPF
2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[ EQPVCEVU

6QPGTUGPUKPI  %CPRTKPVKPIDGUVCTVGFYKVJVJG ;GU %JGEMKHVJGVQPGT


HCKNWTG FTWOWPKVCPFVQPGTECTVTKFIG UGPUQTKUFKTV[CPF

RTKPVGTUKFG TGOQXGF! EJGEMVJGVQPGT
UGPUQTEQPPGEVKQP
6QPGTUGPUKPI  +UVJGRTQDNGOUQNXGFYJGP ;GU 6JGYKRGTQHVJGVQPGT
HCKNWTG QTRCIGUCTGRTKPVGFCHVGTVJG ECTVTKFIGKUFGHGEVKXG

VQPGTECTVTKFIG VQPGTECTVTKFIGKUTGRNCEGFYKVJ 4GRNCEGVJGVQPGT
UKFG CHWNNQPG! ECTVTKFIG
&TWO  #TGCNNVJGEQPVCEVUDGVYGGP 0Q %NGCPEQPVCEV
EQPPGEVKQP VJGFTWOWPKVCPFRTKPVGTDQF[ GNGEVTQFGUDQVJQPVJG ➀➃
HCKNWTG EQPPGEVGFEQTTGEVN[! FTWOWPKVCPFKPVJG ➄➅
RTKPVGTDQF[
*KIJXQNVCIG  +UVJGJCTPGUUEQPPGEVKQP ;GU 4GRNCEGVJGJKIJ
RQYGTUWRRN[ DGVYGGPVJGJKIJXQNVCIG XQNVCIGRQYGTUWRRN[
2%$HCKNWTG RQYGTUWRRN[2%$CPFVJG 2%$
GPIKPG2%$EQTTGEV!
'PIKPG2%$  +UVJGJCTPGUUEQPPGEVKQP ;GU 4GRNCEGVJGGPIKPG
/CKP2%$HCKNWTG DGVYGGPVJGGPIKPG2%$CPF 2%$QTVJGOCKP2%$
VJGOCKP2%$EQTTGEV!
&KTVQPVJG  +UVJGTGCP[FKTVQPVJGUECPPGT ;GU 9KRGKVQHHYKVJCUQHV
UECPPGTYKPFQY YKPFQY! ENGCPRCRGT
.CUGTWPKVHCKNWTG  +UVJGRTQDNGOUQNXGFCHVGT ;GU 4GRNCEGVJGNCUGTWPKV
TGRNCEKPIVJGNCUGTWPKV!


%*#26'46417$.'5*116+0)

+ &CTM

7UGT%JGEM

 %JGEMVJGRCRGTWUGFOGGVUVJGTGEQOOGPFGFRCRGTURGEKHKECVKQPU

 %JGEMVJGRTKPVGTŏUGPXKTQPOGPV*KIJVGORGTCVWTGCPFJKIJJWOKFKV[EQPFKVKQPU
ECPKPETGCUGVJGCOQWPVQHDCEMITQWPFUJCFKPI

 %NGCPVJGEQTQPCYKTGYKVJVJGYKTGENGCPGT

 6T[KPUVCNNKPICPGYVQPGTECTVTKFIGQTFTWOWPKV

)TQWPF
2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[ EQPVCEVU

%QTQPCHCKNWTG  #TGVJGEJCTIGGNGEVTQFGU ;GU %NGCPDQVJGNGEVTQFGU

EQPVCEVHCKNWTG DGVYGGPVJGRTKPVGTDQF[CPF ➂
VJGFTWOWPKVFKTV[!
&TWOWPKVHCKNWTG  +UVJGRTQDNGOUQNXGFCHVGT ;GU 4GRNCEGVJGFTWOWPKV
TGRNCEKPIVJGFTWOWPKV! YKVJCPGYQPG
6QPGTECTVTKFIG  +UVJGRTQDNGOUQNXGFCHVGT ;GU 4GRNCEGVJGVQPGT
HCKNWTG TGRNCEKPIVJGVQPGTECTVTKFIG! ECTVTKFIGYKVJCPGY
QPG
*KIJXQNVCIG  +UVJGEQPPGEVKQPUQHVJG ;GU 4GRNCEGVJGJKIJ
RQYGTUWRRN[ EQPPGEVQTDGVYGGPVJGJKIJ XQNVCIGRQYGTUWRRN[
2%$HCKNWTG XQNVCIGRQYGTUWRRN[2%$CPF 2%$
VJGGPIKPG2%$UGEWTGF
EQTTGEVN[!
/CKP2%$HCKNWTG  #TGVJGTGCP[FKUEQPPGEVGF 0Q 4GRNCEGVJGOCKP
EQPPGEVQTU! 2%$
'PIKPG2%$  #TGVJGTGCP[FKUEQPPGEVGF 0Q 4GRNCEGVJGGPIKPG
HCKNWTG EQPPGEVQTU! 2%$


%*#26'46417$.'5*116+0)

+ %QORNGVGN[DNCPM

)TQWPF
2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[ EQPVCEVU

&GXGNQRKPIDKCU  #TGVJGFGXGNQRKPIDKCU ;GU %NGCPVJGGNGEVTQFGU


EQPVCEVHCKNWTG EQPVCEVUDGVYGGPVJGRTKPVGT CVDQVJUKFGU ➃
DQF[CPFFTWOWPKVFKTV[!
&TWOWPKV  #TGVJGFTWOUJCHVCPFFTWO ;GU %NGCPVJGUJCHVCPF
GNGEVTQFGQHVJGRTKPVGTDQF[ VJGGNGEVTQFG ➀
EQPPGEVGFEQTTGEVN[!
0Q %JGEMVJGEQPPGEVKQP
DGVYGGPVJGUJCHVCPF ➀
VJGGNGEVTQFG
&TWOWPKVHCKNWTG  +UVJGRTQDNGOUQNXGFCHVGT ;GU 4GRNCEGVJGFTWO
TGRNCEKPIVJGFTWOWPKV! WPKV
6QPGTECTVTKFIG  +UVJGRTQDNGOUQNXGFCHVGT ;GU 4GRNCEGVJGVQPGT
HCKNWTG TGRNCEKPIVJGVQPGTECTVTKFIG! ECTVTKFIGYKVJCPGY
QPG
5ECPPGT  +UVJGUECPPGTJCTPGUU 0Q 4GEQPPGEVVJG
JCTPGUU EQPPGEVGFUGEWTGN[! EQPPGEVQTEQTTGEVN[
EQPPGEVKQP
%JGEMKHVJGTGKUCP[RNC[KP
HCKNWTG VJGEQPPGEVKQP
/CKP2%$HCKNWTG  #TGRTKPVKPIUKIPCNUDGKPIKPRWV ;GU 4GRNCEGVJGOCKP
VQVJGNCUGTWPKV! 2%$
+UVJGRTQDNGOUQNXGFCHVGT
TGRNCEKPIVJGOCKP2%$!
.CUGTWPKVHCKNWTG  +UVJGUECPPGTKPVGTNQEMNGXGT ;GU 4GRNCEGVJGNCUGTWPKV
FCOCIGF!
+UVJGUECPPGTOKTTQTDTQMGPQT 0Q 4GRNCEGVJGJKIJ
NQQUG! XQNVCIGRQYGTUWRRN[
2%$


%*#26'46417$.'5*116+0)

+ #NNDNCEM

7UGT%JGEM

 %NGCPVJGEQTQPCYKTGQHVJGFTWOWPKV

 6JGFTWOWPKVOC[DGFCOCIGF+PUVCNNCPGYFTWOWPKV

)TQWPF
2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[ EQPVCEVU

%QTQPCHCKNWTG  +UVJGEQTQPCYKTGFKTV[! ;GU %NGCPVJGEQTQPCYKTG


YKVJVJGYKTGENGCPGT ➁
 +UVJGEQTQPCYKTGDTQMGP! ;GU 4GRNCEGVJGFTWO
WPKV
 #TGVJGEJCTIGGNGEVTQFGU ;GU %NGCPDQVJGNGEVTQFGU
DGVYGGPVJGRTKPVGTDQF[CPF ➂
VJGFTWOWPKVFKTV[!
*CTPGUU  +UVJGNCUGTWPKVEQPPGEVGFVQ 0Q %QPPGEVVJGJCTPGUU
EQPPGEVKQP VJGOCKP2%$EQTTGEVN[! DGVYGGPVJGNCUGTWPKV
CPFVJGOCKP2%$
EQTTGEVN[
*KIJXQNVCIG  +UVJGRTQDNGOUQNXGFCHVGT ;GU 4GRNCEGVJGJKIJ
RQYGTUWRRN[ TGRNCEKPIVJGJKIJXQNVCIG XQNVCIGRQYGTUWRRN[
2%$HCKNWTG RQYGTUWRRN[2%$! 2%$
/CKP2%$HCKNWTG  +UVJGRTQDNGOUQNXGFCHVGT ;GU 4GRNCEGVJGOCKP
TGRNCEKPIVJGOCKP2%$! 2%$


%*#26'46417$.'5*116+0)

+ &KTVQPVJGDCEMQHRCRGT

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


(KZKPIWPKVFKTV[  +UVJGRTGUUWTGTQNNGTFKTV[! ;GU %NGCPVJGRTGUUWTGTQNNGT
TGHGTTKPIVQVJGHQNNQYKPI
+UCP[QVJGTCTGCKPVJGRTKPVGT RTQEGFWTG
FKTV[!
&KTVKPVJGFTWO  +UVJGVTCPUHGTTQNNGTFKTV[! ;GU 4GRNCEGVJGFTWOWPKV
WPKV
+UVJGRTQDNGOUQNXGFCHVGT
TGRNCEKPIVJGFTWOWPKV!
0Q 4GRNCEGVJGJKIJXQNVCIGRQYGT
UWRRN[2%$

016'
• 6JKURTQDNGOOC[FKUCRRGCTCHVGTRTKPVKPICRRTQZKOCVGN[RCIGUQHEQORNGVGN[DNCPM
UJGGVU
• 6JGFKTVQPVJGDCEMQHRCRGTCUUJQYPCVVJGTKIJVKU
ECWUGFD[VQPGTQPVJGUVCTYJGGNJQQMUKPVJGHKZKPI
WPKV6JKURTQDNGOOC[FKUCRRGCTCHVGTRTKPVKPICHGY
RCIGU

(KI

*QYVQENGCPVJGRTGUUWTGTQNNGT
%NGCPVJGRTGUUWTGTQNNGTCUHQNNQYU

 5GVVJTGGQTOQTGUJGGVUQHRCRGTKPVJGRCRGTECUUGVVG

 1RGPVJGHTQPVEQXGTCPFVWTPQPVJGRQYGTUYKVEJYJKNGJQNFKPIFQYPVJGEQPVTQNRCPGN
DWVVQP

 4GNGCUGVJGRCPGNDWVVQPYJGPVJG&TWO.'&KUQP

 %NQUGVJGHTQPVEQXGT

 *QNFFQYPVJGRCPGNDWVVQPWPVKNVJG4GCF[.'&KUQPVJGPTGNGCUGVJGDWVVQP%TQUU
UVTKRGUCTGRTKPVGF

 2TKPVCRRTQZKOCVGN[RCIGUVJGPRTGUUVJGRCPGNDWVVQP

 /CMGUWTGVJCVVJGFKTVQPVJGDCEMQHRCRGTJCUFKUCRRGCTF


%*#26'46417$.'5*116+0)

+ $NCEMCPFDNWTTGFXGTVKECNUVTGCMU

7UGT%JGEM

 %NGCPVJGEQTQPCYKTGKPVJGFTWOWPKV

 %JGEMVJCVVJGEQTQPCYKTGENGCPGTKUCVVJGJQOGRQUKVKQP

 %JGEMVJCVVJGVQPGTECTVTKFIGKUPQVGORV[

 6JGFTWOWPKVOC[DGFCOCIGF+PUVCNNCPGYFTWOWPKV

 6JGVQPGTECTVTKFIGOC[DGFCOCIGF+PUVCNNCPGYVQPGTECTVTKFIG

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


%QTQPCHCKNWTG  +UVJGXGTVKECNDNQEMUVTGCM ;GU 4GVWTPVJGYKTGENGCPGTVQKVU
CDQWVOOYKFG! JQOGRQUKVKQP

%JGEMKHVJGYKTGENGCPGTKUCV
KVUJQOGRQUKVKQP
&KTVKPVJGRCRGT  +UVJGRCRGTECUUGVVGQTHGGF ;GU %NGCPVJGVQPGTQHH
HGGFU[UVGO U[UVGOQPVJGFTWOWPKVFKTV[
YKVJVQPGT!
5ETCVEJQPVJG  +UVJGFTWOUWTHCEGUETCVEJGF! ;GU 4GRNCEGVJGFTWOWPKV
FTWO
%NGCPKPIHCKNWTG  +UVJGFTWOUWTHCEGFKTV[YKVJ ;GU 4GRNCEGVJGFTWOWPKV
VQPGTKPUVTGCMU!
5ETCVEJQPVJG  +UVJGUWTHCEGQHVJGJGCVTQNNGT ;GU 4GRNCEGVJGHKZKPIWPKV
JGCVTQNNGT UETCVEJGF!

016'
• +H[QWRTKPVVJGUCOGRCVVGTPEQPVKPWQWUN[VJGFTWOYKNNDGYQTPCPFDNCEMXGTVKECNUVTGCMU
YKNNCRRGCTQPVJGRCRGT
• 6JKURTQDNGOOC[QEEWTYKVJPQKUGFWGVQVJGEQTQPCYKTGDGKPIFKTV[+PVJCVECUGENGCP
VJGEQTQPCYKTGYKVJVJGYKTGENGCPGT


%*#26'46417$.'5*116+0)

+ $NCEMCPFDNWTTGFJQTK\QPVCNUVTKRGU

7UGT%JGEM

 6JGFTWOWPKVOC[DGFCOCIGF+PUVCNNCPGYFTWOWPKV

 %JGEMVJGRCRGTWUGFOGGVUVJGTGEQOOGPFGFRCRGTURGEKHKECVKQPU

 %NGCPVJGRTKPVGTKPVGTKQTCPFVJGEQTQPCYKTGKPVJGFTWOWPKV

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[ )TQWPF


EQPVCEVU

5ETCVEJQPVJG  #TGVJGJQTK\QPVCNUVTKRGUCV ;GU 6JGRJQVQUGPUKVKXG


FTWO OO
RJQVQUGPUKVKXGFTWO FTWOYCUUETCVEJGF
KPVGTXCNU! 4GRNCEGVJGFTWO
WPKV
6QPGTUVWEMQP  #TGVJGJQTK\QPVCNUVTKRGUCV ;GU #HVGTRTKPVKPIUGXGTCN
VJGFGXGNQRGT OO
FGXGNQRGTTQNNGT RCIGUVJGRTQDNGO
TQNNGT KPVGTXCNU! YKNNFKUCRRGCT
+HPQVTGRNCEGVJG
VQPGTECTVTKFIG
5ETCVEJQPVJG  #TGVJGJQTK\QPVCNUVTKRGUCV ;GU 4GRNCEGVJGJGCV
JGCVTQNNGT OO
JGCVTQNNGT KPVGTXCNU! TQNNGT
%QTQPCEQPVCEV  #TGVJGEJCTIGGNGEVTQFGU ;GU %NGCPDQVJGNGEVTQFGU
HCKNWTG DGVYGGPVJGRTKPVGTDQF[CPF ➂
VJGFTWOWPKVFKTV[!
*KIJXQNVCIG  +UVJGRTQDNGOUQNXGFCHVGT ;GU 4GRNCEGVJGJKIJ
RQYGTUWRRN[ TGRNCEKPIVJGJKIJXQNVCIG XQNVCIGRQYGTUWRRN[
2%$HCKNWTG RQYGTUWRRN[2%$! 2%$

+ $NCEMXGTVKECNUVTGCMU
KPCITC[DCEMITQWPF

)TQWPF
2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[ EQPVCEVU

6TCPUNWEGPV  +UVJGTGCP[FKTVQPVJGUECPPGT ;GU  %NGCPVJGUECPPGT


UVCKPQPVJG YKPFQY! YKPFQY
UECPPGTYKPFQY
 +HKVKUPQVGHHGEVKXG
TGRNCEGVJGNCUGT
WPKV
%QTQPCHCKNWTG  +UVJGEQTQPCYKTGFKTV[! ;GU %NGCPVJGEQTQPCYKTG
YKVJVJGYKTGENGCPGT ➁


%*#26'46417$.'5*116+0)

+ 9JKVGXGTVKECNUVTGCMU

7UGT%JGEM

 6T[VQYKRGVJGUECPPGTYKPFQYYKVJCUQHVENQVJ

 6JGVQPGTECTVTKFIGOC[DGFCOCIGF+PUVCNNCPGYVQPGTECTVTKFIG

 %JGEMVJGRTKPVGTŏUGPXKTQPOGPV*KIJVGORGTCVWTGCPFJKIJJWOKFKV[EQPFKVKQPU
ECPECWUGVJKURTQDNGO

 &COR
YGV RCRGTOKIJVDGWUGF6T[VQEJCPIGVQHTGUJN[WPRCEMGFRCRGT

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


6TCPUHGTHCKNWTG  +UVJGVTCPUHGTTQNNGTUETCVEJGF! ;GU 4GRNCEGVJGFTWOWPKV
%QPFGPUCVKQP  *CUEQPFGPUCVKQPQEEWTTGF ;GU 6T[VQRTKPVUGXGTCNRCIGUQT
KPUKFGVJGRTKPVGT! NGCXGVJGRTKPVGTJQWTUVQCNNQY
KVVQTGCEJTQQOVGORGTCVWTG

+ 9JKVGJQTK\QPVCNUVTKRGU

7UGT%JGEM

 %JGEMVJGRCRGTWUGFOGGVUVJGTGEQOOGPFGFRCRGTURGEKHKECVKQPU#TQWIJ
UWTHCEGFRCRGTFCORRCRGTQTVJKEMOGFKCECPECWUGVJGRTQDNGO

 %JGEMVJCVVJGCRRTQRTKCVGOGFKCV[RGKUUGNGEVGFKPVJGRTKPVGTFTKXGT

 6JGRTQDNGOOC[FKUCRRGCTD[KVUGNH6T[RTKPVKPIOWNVKRNGRCIGUVQENGCTVJKU
RTQDNGOGURGEKCNN[KHVJGRTKPVGTJCUPQVDGGPWUGFHQTCNQPIVKOG

 6JGFTWOWPKVOC[DGFCOCIGF+PUVCNNCPGYFTWOWPKV

)TQWPF
2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[ EQPVCEVU

&GXGNQRKPIDKCU  #TGVJGFGXGNQRKPIDKCU ;GU %NGCPVJGGNGEVTQFGU


EQPVCEVHCKNWTG EQPVCEVUDGVYGGPVJGRTKPVGT CVDQVJUKFGU ➃
DQF[CPFVQPGTECTVTKFIGFKTV[!


%*#26'46417$.'5*116+0)

+ (CWNV[TGIKUVTCVKQP

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


'ZEGUUKXGRCRGT  +UVJGRCRGTNQCFGFKPVJG ;GU +PUVTWEVVJGWUGTVQMGGRRCRGT
NQCF RCRGTECUUGVVGOQTGVJCP NQCFUDGNQYOOKPFGRVJ
OOJKIJ!
2TKPVRCRGT  +UVJGURGEKHKGFYGKIJVQHVJG 0Q 4GEQOOGPFVQWUGVJGURGEKHKGF
TGEQOOGPFGFRCRGTDGKPI V[RGUQHRCRGT
WUGF!
 +UVJGHKTUVRTKPVKPIRQUKVKQP ;GU #FLWUVVJG;QHHUGVD[WUKPIVJG
YKVJKPvOOQHVJGVQNGTCPEG WVKNKV[UQHVYCTGUWRRNKGF
URGEKHKECVKQP!
4GCTTGUKUV  +UVJGRQUKVKQPQHVJGTGCT 0Q 4GRQUKVKQPVJGUGPUQTVQVJG
UGPUQTRQUKVKQP TGIKUVTCVKQPUGPUQTPQTOCN! EQTTGEVRQUKVKQP
KPEQTTGEV

+ 2QQTHKZKPI

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


2TKPVRCRGT  +UVJKEMRCRGTQHOQTGVJCP ;GU 4GEQOOGPFVQWUGVJGURGEKHKGF
NDDGKPIWUGF! V[RGUQHRCRGT
6QPGTUGPUKPI  +UVJGRTQDNGOUQNXGFD[ ;GU  6QPGTKUGORV[
HCKNWTG TGRNCEKPIVJGFTWOWPKVQTVJG  6JGVQPGTUGPUKPIKU

9JGPRTKPVKPI VQPGTECTVTKFIG! FGHGEVKXG%NGCPVJGVQPGT
KUHCKPV UGPUQT
 +HVJGYKRGTKPVJGVQPGT
ECTVTKFIGKUDTQMGPTGRNCEG
VJGVQPGTECTVTKFIGYKVJCPGY
QPG
6JGTOKUVQT  +UVJGVJGTOKUVQTHKVVGF 0Q (KVVJGVJGTOKUVQTEQTTGEVN[
HCKNWTG EQTTGEVN[!
.QYXQNVCIG  +UVJGRTQDNGOUQNXGFD[ ;GU 4GRNCEGVJGNQYXQNVCIGRQYGT
RQYGTUWRRN[ TGRNCEKPIVJGNQYXQNVCIG UWRRN[2%$
2%$HCKNWTG RQYGTUWRRN[2%$!


%*#26'46417$.'5*116+0)

+ +OCIGFKUVQTVKQP

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


.CUGTWPKV  +UVJGNCUGTWPKVUGEWTGFVQVJG ;GU 5GEWTGVJGWPKVEQTTGEVN[CPF
KPUVCNNCVKQP HTCOGKPEQTTGEVN[! VKIJVGPVJGUETGYU

%JGEMKHVJGTGKUCP[RNC[
5ECPPGT.&  +UVJGNCUGTFKQFGQTVJG ;GU 4GRNCEGVJGNCUGTWPKV
GOKUUKQPHCKNWTG UECPPGTOQVQTFGHGEVKXG!
5ECPPGTOQVQT
TQVCVKQPHCKNWTG
5ECPPGT  +UVJGUECPPGTJCTPGUU 0Q %QPPGEVVJGJCTPGUUEQTTGEVN[
EQPPGEVKQP EQPPGEVGFRTQRGTN[!
HCKNWTG
%JGEMKHKVKUEQOKPINQQUG

+ (CKPVRTKPV

o tnirp tset tuo tnirP o tnirp tset tuo tnirP tset tuo tnirp tset tuo tnirp tset tuo tnirP Print out test print out test print out test Print out test print o Print out test print o

o tnirp tset tuo tnirP o tnirp tset tuo tnirP tset tuo tnirp tset tuo tnirp tset tuo tnirP Print out test print out test print out test Print out test print o Print out test print o

o tnirp tset tuo tnirP o tnirp tset tuo tnirP tset tuo tnirp tset tuo tnirp tset tuo tnirP Print out test print out test print out test Print out test print o Print out test print o

o tnirp tset tuo tnirP o tnirp tset tuo tnirP tset tuo tnirp tset tuo tnirp tset tuo tnirP Print out test print out test print out test Print out test print o Print out test print o

o tnirp tset tuo tnirP o tnirp tset tuo tnirP tset tuo tnirp tset tuo tnirp tset tuo tnirP Print out test print out test print out test Print out test print o Print out test print o

o tnirp tset tuo tnirP o tnirp tset tuo tnirP tset tuo tnirp tset tuo tnirp tset tuo tnirP Print out test print out test print out test Print out test print o Print out test print o

o tnirp tset tuo tnirP o tnirp tset tuo tnirP tset tuo tnirp tset tuo tnirp tset tuo tnirP Print out test print out test print out test Print out test print o Print out test print o

o tnirp tset tuo tnirP o tnirp tset tuo tnirP tset tuo tnirp tset tuo tnirp tset tuo tnirP Print out test print out test print out test Print out test print o Print out test print o

o tnirp tset tuo tnirP o tnirp tset tuo tnirP tset tuo tnirp tset tuo tnirp tset tuo tnirP Print out test print out test print out test Print out test print o Print out test print o

o tnirp tset tuo tnirP o tnirp tset tuo tnirP tset tuo tnirp tset tuo tnirp tset tuo tnirP Print out test print out test print out test Print out test print o Print out test print o

o tnirp tset tuo tnirP o tnirp tset tuo tnirP tset tuo tnirp tset tuo tnirp tset tuo tnirP Print out test print out test print out test Print out test print o Print out test print o

o tnirp tset tuo tnirP o tnirp tset tuo tnirP tset tuo tnirp tset tuo tnirp tset tuo tnirP Print out test print out test print out test Print out test print o Print out test print o

o tnirp tset tuo tnirP o tnirp tset tuo tnirP tset tuo tnirp tset tuo tnirp tset tuo tnirP Print out test print out test print out test Print out test print o Print out test print o

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


2TKPVGT  +UVJGRTKPVGTRNCEGF 0Q 2NCEGVJGRTKPVGTQPCHNCV
KPUVCNNCVKQP JQTK\QPVCNN[! UWTHCEG
6QPGTECTVTKFIG  &QGUVJGRTQDNGOJCRRGPGF ;GU 4GOQXGCPFECTGHWNN[UJCMGVJG
KOOGFKCVGN[CHVGTTGRNCEKPIVJG VQPGTECTVTKFIGJQTK\QPVCNN[
VQPGTECTVTKFIGYKVJCPGY
QPG!
5ECPPGTYKPFQY  +UVJGUECPPGTYKPFQYFKTV[! ;GU %NGCPVJGUECPPGTYKPFQYYKVJ
FKTV[ CUQHVFT[ENQVJ
.CUGTWPKVHCKNWTG  +UVJGRTQDNGOUQNXGFD[ ;GU 4GRNCEGVJGNCUGTWPKV
TGRNCEKPIVJGNCUGTWPKV!


%*#26'46417$.'5*116+0)

+ 9JKVGURQVU

7UGT%JGEM

 +HVJGRTQDNGOKUPQVUQNXGFCHVGTRTKPVKPICHGYRCIGUVJGFTWOWPKVOC[JCXG
INWGHTQONCDGNUVQEMQPVJGRJQVQUGPUKVKXGFTWOUWTHCEG4GHGTVQ5VGRKPVJG
VCDNGDGNQYCPF016'KPVJGPGZVRCIG

 6JGFTWOWPKVOC[DGFCOCIGF+PUVCNNCPGYFTWOWPKV

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


&TWOWPKVHCKNWTG  #TGVJGYJKVGURQVCVOO ;GU  +HVQPGTQTINWGTGOCKPU
KPVGTXCNU! UVWEMYKRGKVQHHIGPVN[YKVJC
EQVVQPUYCD
4GHGTVQ016'
KPVJGPGZVRCIG
 +HVJGFTWOUWTHCEGKU
UETCVEJGFTGRNCEGVJGFTWO
WPKV
&TWOWPKVHCKNWTG  +UVJGRTQDNGOUQNXGFCHVGT ;GU 4GRNCEGVJGFTWOWPKV
TGRNCEKPIVJGFTWOWPKV!
0QVQPGT  +UVJGVQPGTKPVJGVQPGT ;GU 4GRNCEGVJGVQPGTECTVTKFIGYKVJ
ECTVTKFIGCNOQUVGORV[! CPGYQPG
2TKPVRCRGT  +UVJGRTQDNGOUQNXGFCHVGT ;GU &COR
YGV RCRGTOKIJVDG
EJCPIKPIVQURGEKHKGFHTGUJN[ WUGF4GEQOOGPFVQEJCPIG
WPRCEMGFRCRGT! HTGUJN[WPRCEMGFRCRGT

'PXKTQPOGPV  &QGUVJGRTQDNGOUVKNNCRRGCT ;GU  4GRNCEGVJGFTWOWPKV


CHVGTVJGRTKPVGTJCUYCTOGF  #FXKUGVJGWUGTQHVJG
WR! URGEKHKGFRTKPVGPXKTQPOGPV


%*#26'46417$.'5*116+0)

016'
%NGCPVJGFTWOWPKVCUHQNNQYU

 4GOQXGVJGVQPGTECTVTKFIGHTQOVJGFTWOWPKV2NCEGVJGRTKPVKPIUCORNGUKPHTQPVQHVJG
FTWOWPKVCPFHKPFVJGGZCEVRQUKVKQPQHVJGKOCIGFGHGEV

&TWOWPKV

2QUKVKQPQHUOWFIGQP
VJGFTWO

OOKPVGTXCN

2TKPVKPIUCORNG

(KI

 6WTPVJGFTWOIGCTD[JCPFYJKNGNQQMKPICVVJGUWTHCEGQHVJGRJQVQUGPUKVKXGFTWO

2JQVQUGPUKVKXGFTWO

(KI

 9KRGVJGUWTHCEGQHVJGRJQVQUGPUKVKXGFTWOYKVJCEQVVQPUYCDWPVKNVJGFWUVQTRCRGT
RQYFGTQPVJGUWTHCEGEQOGUQHH

2JQVQUGPUKVKXGFTWO

(KI

! %#76+10
• &QPQVYKRGVJGUWTHCEGQHVJGRJQVQUGPUKVKXGFTWOYKVJUQOGVJKPIUJCTR
DCNNRQKPVRGP
GVE
• 7UGENGCPKPINKSWKFYJKEJKUCOKZVWTGQHGVJ[NCNEQJQNCPFRWTGYCVGT


%*#26'46417$.'5*116+0)

+ $NCEMURQVU

7UGT%JGEM

 +HVJGRTQDNGOKUPQVUQNXGFCHVGTRTKPVKPICHGYRCIGUVJGFTWOWPKVOC[JCXG
INWGHTQONCDGNUVQEMQPVJGRJQVQUGPUKVKXGFTWOUWTHCEG4GHGTVQ5VGRKPVJG
VCDNGDGNQYCPF016'KPVJGRTGXKQWURCIG

 6JGFTWOWPKVOC[DGFCOCIGF+PUVCNNCPGYFTWOWPKV

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


&TWOWPKV  #TGVJGURQVUCVOO ;GU  +HVQPGTQTINWGTGOCKPU
KPVGTXCNU! UVWEMYKRGKVQHHIGPVN[YKVJC

6JGRTQDNGOKUPQVUQNXGF EQVVQPUYCD
4GHGTVQ016'
CHVGTRTKPVKPICHGYRCIGU KPVJGRTGXKQWURCIG
 +HVJGRJQVQUGPUKVKXGFTWOKU
UETCVEJGFQTFGVGTKQTCVGF

GZRQUGF TGRNCEGVJGFTWO
WPKV
(KZKPIWPKV  #TGVJGURQVUCVOO ;GU  %JGEMCPFENGCPVJGJGCV
KPVGTXCNU! TQNNGTYKVJCENQVJFCORGPGF

6JGRTQDNGOKUPQVUQNXGF YKVJCNEQJQN
CHVGTRTKPVKPICHGYRCIGU  4GRNCEGVJGHKZKPIWPKV
*KIJXQNVCIG  +UVJGRTQDNGOUQNXGFCHVGT ;GU 4GRNCEGVJGJKIJXQNVCIGRQYGT
RQYGTUWRRN[ TGRNCEKPIVJGJKIJXQNVCIG UWRRN[2%$
2%$HCKNWTG RQYGTUWRRN[2%$!

+ $NCEMDCPF

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[ )TQWPF


EQPVCEVU

%QTQPCHCKNWTG  +UVJGYKTGENGCPGTCVKVUJQOG 0Q 4GVWTPVJGYKTG


RQUKVKQP! ENGCPGTVQKVUJQOG ➁
RQUKVKQP
%QTQPCHCKNWTG  +UVJGEQTQPCYKTGFKTV[! ;GU  %NGCPVJGEQTQPC
YKTG ➁
 +HVJGRTQDNGOUVKNN
CRRGCTUCHVGT
ENGCPKPITGRNCEG
VJGFTWOWPKV


%*#26'46417$.'5*116+0)

+ )TC[DCEMITQWPF

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


2TKPVRCRGT  &QGUVJGRCRGTDGKPIWUGF 0Q 4GEQOOGPFVQWUGVJGURGEKHKGF
OGGVVJGRCRGTURGEKHKECVKQP V[RGUQHRCRGT

YGKIJVGVE 
;GU 4GEQOOGPFVQEJCPIGVQ
HTGUJN[WPRCEMGFRCRGT
6QPGTUGPUKPI  +U4GCF[.'&QPGXGPCHVGT ;GU 6QPGTUGPUQTHCKNWTG%NGCPVJG
HCKNWTG TGOQXKPIVJGFTWOWPKVCPF VQPGTUGPUQTCPFEJGEMVJG

RTKPVGTUKFG VQPGTECTVTKFIG! VQPGTUGPUQTEQPPGEVKQP


6QPGTECTVTKFIG  +UVJGRTQDNGOUQNXGFCHVGT ;GU 4GRNCEGVJGVQPGTECTVTKFIG
HCKNWTG TGRNCEKPIVJGVQPGTECTVTKFIG!
&TWOWPKVHCKNWTG  +UVJGRTQDNGOUQNXGFCHVGT ;GU 4GRNCEGVJGFTWOWPKV
TGRNCEKPIVJGFTWOWPKV!
0Q 4GRNCEGVJGJKIJXQNVCIGRQYGT
UWRRN[2%$
016'
6JGHQNNQYKPIECUGUKPETGCUGVJGRQUUKDKNKV[QHVJKURTQDNGO
• #EKFRCRGTKUDGKPIWUGF
• 6JGFTWOWPKVKUCVVJGGPFQHKVUNKHG
• 6JGTGKUFWUVQTRCRGTRQYFGT

+ *QNNQYRTKPV

7UGT%JGEM

 %JGEMVJGRCRGTWUGFOGGVUVJGTGEQOOGPFGFRCRGTURGEKHKECVKQPU

 5GNGEVVJGŎ6JKEMRCRGTOQFGŏKPVJGRTKPVGTFTKXGTQTWUGVJKPPGTRCRGTVJCP[QW
CTGEWTTGPVN[WUKPI

 %JGEMVJGRTKPVGTŏUGPXKTQPOGPVEQPFKVKQPUUWEJCUJKIJJWOKFKV[OC[ECWUGVJKU
UKVWCVKQPVQQEEWT

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


2TKPVRCRGT  +UVJKEMRCRGTQHOQTGVJCP ;GU 4GEQOOGPFVQWUGVJGURGEKHKGF
NDDGKPIWUGFQTGZVTGOGN[ V[RGUQHRCRGT
TQWIJUWTHCEGRCRGT!
0Q 4GHGTCPFEQORCTGYKVJ+


%*#26'46417$.'5*116+0)

+ &QYPYCTFHQIIKPIQHUQNKFDNCEM

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


6QPGTECTVTKFIG  +UVJGRTQDNGOUQNXGFCHVGT ;GU 4GRNCEGVJGVQPGTECTVTKFIG
HCKNWTG TGRNCEKPIVJGVQPGTECTVTKFIG!
*KIJXQNVCIG  +UVJGRTQDNGOUQNXGFCHVGT ;GU 4GRNCEGVJGJKIJXQNVCIGRQYGT
RQYGTUWRRN[ TGRNCEKPIVJGJKIJXQNVCIG UWRRN[2%$
2%$HCKNWTG RQYGTUWRRN[2%$!

+ *QTK\QPVCNNKPGU

)TQWPF
2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[ EQPVCEVU

2CRGTHGGFTQNNGT  #TGVJGHGGFTQNNGTUJCHVCPF 0Q %JGEMVJGEQPPGEVKQP


VJGITQWPFEQPVCEVEQPPGEVGF DGVYGGPVJGUJCHVCPF
EQTTGEVN[! VJGITQWPFEQPVCEV
#NUQEJGEMVJGITQWPF
EQPVCEVQPVJGDCEMQH
VJGHGGFTQNNGT4GHGT
VQ2
2CRGTECUUGVVG  #TGVJGITQWPFEQPVCEVUQPVJG 0Q %NGCPVJGEQPVCEVU
EQPVCEVU DCEMUKFGQHVJGRCRGTECUUGVVG ➆
EQPPGEVKPIEQTTGEVN[!


%*#26'46417$.'5*116+0)

+ .KIJVTCKP

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[

&TWOWPKVHCKNWTG  +UVJGRTQDNGOUQNXGFCHVGT ;GU 4GRNCEGVJGFTWOWPKV


TGRNCEKPIVJGFTWOWPKV!
*KIJXQNVCIG  +UVJGRTQDNGOUQNXGFCHVGT ;GU 4GRNCEGVJGJKIJXQNVCIGRQYGT
RQYGTUWRRN[ TGRNCEKPIVJGJKIJXQNVCIG UWRRN[2%$
2%$HCKNWTG RQYGTUWRRN[2%$!

+ )JQUV

7UGT%JGEM

 %JGEMVJGRCRGTWUGFOGGVUVJGTGEQOOGPFGFRCRGTURGEKHKECVKQPU&COR
RCRGTVJKEMOGFKCQTTQWIJUWTHCEGFRCRGTECPECWUGVJGRTQDNGO

 %JGEMVJGRTKPVGTŏUGPXKTQPOGPV*KIJVGORGTCVWTGCPFJKIJJWOKFKV[EQPFKVKQPU
ECPECWUGVJGRTQDNGO

 %JGEMVJCVVJGCRRTQRTKCVGOGFKCV[RGKUUGNGEVGFKPVJGRTKPVGTFTKXGT

 6T[KPUVCNNKPICPGYFTWOWPKV

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[



&TKXGTUGVVKPI  +UVJKPRCRGTUWEJCUIO ;GU  %JCPIGVJGEWTTGPVOQFGVQ
WUGFWPFGTVJGVJKEMRCRGT VJGPQTOCNOQFGHTQOVJG
OQFG! FTKXGTUGVVKPI
 2TKPVQTDNCPMRCIGUKHVJKU
RTQDNGOQEEWTU
&TWOWPKVHCKNWTG  +UVJGRTQDNGOUQNXGFCHVGT ;GU 4GRNCEGVJGFTWOWPKV
TGRNCEKPIVJGFTWOWPKV!
*KIJXQNVCIG  +UVJGRTQDNGOUQNXGFCHVGT ;GU 4GRNCEGVJGJKIJXQNVCIGRQYGT
RQYGTUWRRN[ TGRNCEKPIVJGJKIJXQNVCIG UWRRN[2%$
2%$HCKNWTG RQYGTUWRRN[2%$!


%*#26'46417$.'5*116+0)

+ 6QPGTURGEMU

7UGT%JGEM

 %JGEMVJGRCRGTWUGFOGGVUVJGTGEQOOGPFGFRCRGTURGEKHKECVKQPU#TQWIJ
UWTHCEGFRCRGTOC[ECWUGVJGRTQDNGO

 6JGVQPGTECTVTKFIGOC[DGFCOCIGF+PUVCNNCPGYVQPGTECTVTKFIG

 6JGFTWOWPKVOC[DGFCOCIGFQTOC[DGPGCTN[CVVJGGPFQHNKHG+PUVCNNCPGY
FTWOWPKV


%*#26'46417$.'5*116+0)

 .QECVKQPQH)TQWPFKPI%QPVCEVU
 &TWOWPKV

&TWO7PKV ➁9KTGENGCPGT

➄)TKF

➃&GXGNQROGPVTQNNGT
➂%JCTIG
➀2JQVQUGPUKVKXGFTWO

➅6TCPUHGTTQNNGT
(KI

 2TKPVGTDQF[2CRGTECUUGVVG

➀2JQVQUGPUKVKXGFTWO
➄)TKF

➂%JCTIG ➃&GXGNQROGPVTQNNGT

➅6TCPUHGTTQNNGT

➆)TQWPF

2CRGT%CUUGVVG

(KI


%*#26'46417$.'5*116+0)

 +0%144'%624+06176

9JGPVJGFCVCKUPQVRTKPVGFEQTTGEVN[CUKVKUUGGPQPVJG2%UETGGPHQNNQYVJGRTQEGFWTGU
DGNQYKPVJGGXGPVQHCURGEKHKEGTTQT

2 6JGRTKPVGTRTKPVUWPGZRGEVGFN[QTKVRTKPVUICTDCIG

7UGT%JGEM

 %JGEMKHVJGRTKPVGTECDNGKUPQVVQQNQPI+VKUTGEQOOGPFGFVQWUGCRCTCNNGNECDNGQHNGUUVJCP
OGVGTU
HGGV KPNGPIVJ

 %JGEMVJCVVJGRTKPVGTECDNGKUPQVFCOCIGFQTDTQMGP%JGEMCNUQVJCVVJGRTKPVGTECDNGKU
EQPPGEVGFVQVJGEQTTGEVKPVGTHCEGEQPPGEVQTUQHDQVJVJGRTKPVGTCPF2%

 +HCPKPVGTHCEGUYKVEJKPIFGXKEGKUWUGFTGOQXGKVCPFEQPPGEVVJGEQORWVGTFKTGEVN[VQVJGRTKPVGT
CPFVT[CICKP

 %JGEMVJCVVJGCRRTQRTKCVGRTKPVGTFTKXGTKUUGNGEVGFCUŎ5GVCU&GHCWNVŏ%JGEMCNUQVJCVVJG
EQTTGEVRTKPVRQTVKUUGVHQTVJGUGNGEVGFRTKPVGTFTKXGT

 %JGEMVJCVVJGRTKPVGTKUPQVEQPPGEVGFVQVJGUCOGRQTVYJKEJKUCNUQEQPPGEVGFVQCOCUU
UVQTCIGFGXKEGQTUECPPGT4GOQXGCNNQVJGTFGXKEGUCPFEQPPGEVVJGRQTVVQVJGRTKPVGTQPN[
6WTPQHHVJGRTKPVGTUVCVWUOQPKVQTKPVJGFGXKEGQRVKQPUVCDKPVJGRTKPVGTFTKXGT

 +HVJGRTKPVRQTVKUUGVCUCP'%2RQTVEJCPIGKVVQCPQTOCNRQTV

 6T[RTKPVKPIVJGVGUVRCIGTGHGTTKPIVQ5WDUGEVKQPŎ6GUV2TKPV/QFGŏKPVJKUEJCRVGT

 6T[TGUGVVKPIVJGHCEVQT[UGVVKPIU

2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[


(CKNWTGKPUKFG  +UKVRQUUKDNGVQRTKPVVJGVGUV 0Q +FGPVKH[VJGGTTQTV[RGVJGP
VJGRTKPVGT RCIGYKVJVJGOGVJQFQH TGHGTVQVJGURGEKHKGFUGEVKQPQH
5WDUGEVKQPŎ6GUV2TKPV VJKUEJCRVGT
/QFGŏKPVJKUEJCRVGT!
/CKP2%$  +UKVRQUUKDNGVQRTKPVYKVJ 0Q 4GRNCEGVJGOCKP2%$
HCKNWTG CPQVJGT2%RTKPVGTECDNG

016'
+HVJGRTKPVGTRTKPVUICTDCIGQTKPEQTTGEVHQPVUKPUVTWEVVJGWUGTVQWUGVJGŎ6TQWDNGUJQQVKPIHQT
2TKPVGTYQPŏVRTKPVŏVQQNQHVJGUGNHFKCIPQUVKEUVQQNU+HVJGRTQDNGOECPPQVDGUQNXGFKPUVTWEV
WUGTVQWUGVJGŎ&KCIPQUVKEUŏVQQNFGUETKDGFKPVJG#RRGPFKZUQVJCV[QWECPIGVCNQIHKNGVQ
KPXGUVKICVGVJGECWUGQHVJGRTQDNGO(QTFGVCKNUQPVJGUGNHFKCIPQUVKEUVQQNUUGG#22'0&+:
Ŏ*196175'5'.(&+#)0156+%5611.5ŏ


%*#26'46417$.'5*116+0)

2 7PCDNGVQRTKPVHWNNRCIGUQHCFQEWOGPVYKVJVJGő24+0618'4470ŒOGUUCIG

7UGT%JGEM

 2TGUUVJGRCPGNDWVVQPVQRTKPVVJGFCVCTGOCKPKPIKPVJGRTKPVGT

 +HVJKUFQGUPQVENGCTVJGGTTQTTGFWEGVJGEQORNGZKV[QH[QWTFQEWOGPVQTTGFWEGVJGRTKPVGT
TGUQNWVKQP

 'ZRCPFVJGRTKPVGTOGOQT[D[CFFKPICEQOOGTEKCNN[CXCKNCDNG5+//
*.0
QPN[

 %JCPIGVJGHQNNQYKPIUGVVKPIKPVJGRTKPVGTFTKXGTCPFVT[CICKP6JGDGUVEQODKPCVKQPQHUGVVKPIU
DGNQYYKNNXCT[FGRGPFKPIQP[QWTFQEWOGPV
*.0QPN[
6/ 6/
)TCRJKE/QFG6TWG6[RG OQFG7UG2TKPVGT6TWG6[RG (QPVU
016'
6JKURTQDNGOOC[CRRGCTKHVJGFCVCKUVQQEQORNGZ+HKVKUPQVENGCTGFD[VCMKPIVJGCEVKQPU
CDQXGKVYKNNDGKORQUUKDNGVQRTKPVUWEJFCVCWPFGTVJGRTKPVGTURGEKHKECVKQPU

2 7PCDNGVQRTKPVHWNNRCIGUQHCFQEWOGPVYKVJVJGő/'/14;(7..ŒOGUUCIG

7UGT%JGEM

 2TGUUVJGRCPGNDWVVQPVQRTKPVVJGFCVCTGOCKPKPIKPVJGRTKPVGT

 4GFWEGVJGEQORNGZKV[QH[QWTFQEWOGPVQTTGFWEGVJGRTKPVGTTGUQNWVKQP

 'ZRCPFVJGRTKPVGTOGOQT[D[CFFKPICEQOOGTEKCNN[CXCKNCDNG5+//
*.0
QPN[
016'
6JKURTQDNGOOC[CRRGCTKHVJGFCVCKUVQQEQORNGZ

(QTVJG*.0RTKPVGTVCMGVJGHQNNQYKPIRTQEGFWTGU

(QT*.0QPN[
2QUUKDNGECWUG 5VGR %JGEM 4GUWNV 4GOGF[
7PCDNGVQ  %JGEMVJGOGOQT[UK\GKP2TKPV ;GU 'ZRCPFVJGOGOQT[UK\GD[
TGEQIPK\G5+// %QPHKIWTCVKQP+UKVVJGFGHCWNV CFFKPI5+//
UK\G! +HVJGOGOQT[KUCNTGCF[CVVJG
OCZKOWOUK\GKVYKNNDG
KORQUUKDNGVQRTKPVVJGFCVC
WPFGTVJGRTKPVGT
URGEKHKECVKQPU
5+//OCKP  6T[KPUVCNNKPI5+//KPVQ ;GU 4GRNCEGVJG5+//
2%$HCKNWTG CPQVJGTRTKPVGTVJGPEJGEMVJG
OGOQT[UK\GKP2TKPV
%QPHKIWTCVKQP
+UKVRQUUKDNGVQRTKPVVJGFCVC! 0Q 4GRNCEGVJGOCKP2%$


%*#26'46417$.'5*116+0)

2 *GCFGTUQTHQQVGTUCTGPQVRTKPVGFQWVGXGPVJQWIJVJG[CTGXKGYGFQP2%UETGGP

7UGT%JGEM
/QUVNCUGTRTKPVGTUJCXGCTGUVTKEVGFCTGCVJCVECPPQVDGRTKPVGFQP7UWCNN[VJGHKTUVVYQNKPGUCPFNCUV
VYQNKPGUQHVGZVECPPQVRTKPV
NGCXKPIRTKPVCDNGNKPGU #FLWUVVJGVQRCPFDQVVQOOCTIKPUKP[QWT
FQEWOGPVVQCNNQYHQTVJKU

2 6JGRTKPVGTUQOGVKOGURTKPVUCEQWRNGQHEJCTCEVGTUCPFVJGPGLGEVUVJGRCIG

*.0QPN[

7UGT%JGEM

(QT&15GPXKTQPOGPVQPN[
6JGCRRNKECVKQPRTKPVGTGOWNCVKQPUGVVKPICPFVJGRTKPVGTŏUGOWNCVKQPFQPQVOCVEJ%JGEMKPVJG
CRRNKECVKQPUQHVYCTGYJKEJRTKPVGT[QWJCXGUGNGEVGFVQOCMGUWTGVJGRTKPVGTKUUGVWREQTTGEVN[
4GOGODGTVJCVVJGRTKPVGTGOWNCVGUYKFGN[WUGFRTKPVGTUGNGEVKQPU
*.*2.CUGT,GV++2
*.0*2.CUGT,GV2$TQVJGT$45ETKRV.GXGN'RUQP(:+$/2TQRTKPVGT:.
6T[UGVVKPIVJGRTKPVGTKPVQ*2GOWNCVKQPCPFVJGPUGNGEVVJG*2.CUGT,GV++2
HQT*. QT*2
.CUGT,GV2
HQT*.0 RTKPVGTKPVJGCRRNKECVKQPUQHVYCTG


%*#26'46417$.'5*116+0)

 0'6914-241$.'/
(14*.010.;

+HVJGGTTQTTGNCVGFVQPGVYQTMQEEWTUTGHGTVQVJGHQNNQYKPIUGEVKQPU

 +PUVCNNCVKQP2TQDNGO
+H[QWECPPQVRTKPVQXGTVJGPGVYQTMEJGEMVJGHQNNQYKPI

 /CMGUWTGVJCVVJGRTKPVGTKURQYGTGFQPKUQPNKPGCPFTGCF[VQRTKPV
8GTKH[VJCVVJGRTKPVGTCPFVJGEQPHKIWTCVKQPCTGIQQFD[RTKPVKPIVJG0GVYQTM%QPHKIWTCVKQP
RCIG
6QRTKPVVJG%QPHKIWTCVKQPRCIGRTGUUVJG0GVYQTM6GUVDWVVQPHQTNGUUVJCP
UGEQPFU +HVJGVGUVHCKNUEJGEM
C +HVJG#NCTO.'&QPVJGRTKPVGTHTQPVRCPGNKU10QTDNKPMKPICPFCNNQHVJG.'&UQPVJG
DCEMRCPGNPGCTVJG762
'VJGTPGV EQPPGEVQTCTG1((QTVJG1TCPIG
( .'&KU
DNKPMKPIVJGPVJGPGVYQTMHKTOYCTGUGVVKPIUOC[DGEQTTWRVGF
D +PVJKUGXGPVVT[VQTGUVQTGVJGHCEVQT[FGHCWNVUGVVKPIUQHVJGRTKPVUGTXGTD[RTGUUKPI
VJG0GVYQTM6GUVDWVVQPQPVJGDCEMRCPGNQHVJGRTKPVGTHQTOQTGVJCPUGEQPFU
1PEG[QWJCXGFQPGVJCVVWTPVJGRTKPVGTRQYGTQHHCPFVJGPQPCICKPCPFVT[VQRTKPV
QWVVJG0GVYQTM%QPHKIWTCVKQPRCIG

 +HVJG%QPHKIWTCVKQPRCIGKURTKPVGFDWV[QWECPPQVRTKPVFQEWOGPVUVT[VJGHQNNQYKPI
016'
+HPQPGQHVJGHQNNQYKPIUVGRUCTGUWEEGUUHWNVJGTGKUCNOQUVEGTVCKPN[CJCTFYCTGQT
PGVYQTMRTQDNGO

C +H[QWCTGWUKPI6%2+2
6T[RKPIKPIVJGRTKPVUGTXGTHTQOVJGJQUVQRGTCVKPIU[UVGORTQORVYKVJVJGEQOOCPF
RKPIKRCFFTGUUYJGTGKRCFFTGUUKUVJGRTKPVUGTXGT+2CFFTGUUPQVGVJCVKPUQOG
KPUVCPEGUKVECPVCMGWRVQVYQOKPWVGUHQTVJGRTKPVUGTXGTVQNQCFKVU+2CFFTGUU
CHVGT
UGVVKPIVJG+2CFFTGUU +HCUWEEGUUHWNTGURQPUGKUTGEGKXGFVJGPRTQEGGFVQVJG
70+:6%2+29KPFQYU06.#05GTXGT9KPFQYU/G2GGTVQ2GGT
.24 
+PVGTPGV2TKPVKPIQT9GD$TQYUGTVTQWDNGUJQQVKPIUGEVKQP1VJGTYKUGRTQEGGFVQUVGR

 CPFVJGPIQVQUWDUGEVKQPŎ6%2+26TQWDNGUJQQVKPIŏ
D +H[QWCTGWUKPI0QXGNNU[UVGO
8GTKH[VJCVVJGRTKPVUGTXGTECPDGUGGPQPVJGPGVYQTM6QFQVJKUNQIKPCUVJG
572'48+514
PQVCUUQOGQPGYKVJUWRGTXKUQTRTKXKNGIGU QT#&/+0
HQT0GVYCTG
QTNCVGTUGTXGTU IQKPVQ2%1051.'UGNGEV24+065'48'4+0(14/#6+10CPF
UGNGEVVJGPCOGQHVJGRTKPVUGTXGT
OCMGUWTGVJCV[QWJCXGGPVGTGFVJGRTKPVUGTXGT
PCOG +H[QWECPUGGPrint Server StatusCPFControlKPVJGOGPWVJGPVJG
$TQVJGTRTKPVUGTXGTKUXKUKDNGVQVJGPGVYQTMRTQEGGFVQUWDUGEVKQPŎ0QXGNN
0GV9CTG6TQWDNGUJQQVKPIŏ1VJGTYKUGIQVQUVGR
 
E +H[QWCTGTWPPKPI#RRNG6CNMHQT/CEKPVQUJ
/CMGUWTGVJCV[QWECPUGGVJGRTKPVUGTXGTPCOGWPFGTVJG.CUGT9TKVGTKEQPKPVJG
%JQQUGT+HKVKUXKUKDNGVJGPVJGEQPPGEVKQPKUIQQFUQRTQEGGFVQUWDUGEVKQP
Ŏ#RRNG6CNM6TQWDNGUJQQVKPIŏ1VJGTYKUGIQVQUVGR
 


%*#26'46417$.'5*116+0)


 +H[QWECPPQVOCMGCP[QHVJGEQPPGEVKQPUKPUVGR
 EJGEMVJGHQNNQYKPI
C /CMGUWTGVJGRTKPVGTKUVWTPGFQPCPFQPNKPG
D 8GTKH[VJCVVJGECDNKPICPFPGVYQTMEQPPGEVKQPCTGIQQF+HRQUUKDNGVT[VJGRTKPV
UGTXGTQPCFKHHGTGPVEQPPGEVKQPQPVJGPGVYQTM#NUQRTKPVQWVC%QPHKIWTCVKQPRCIGVQ
UGGKH[QWECPUGGCP[0GVYQTM5VCVKUVKEUKPHQTOCVKQP
E %JGEMVQUGGKHVJGTGKUCP[.'&CEVKXKV[
6JGRTKPVUGTXGTJCUVJTGG.'&U6JGUGECPDGWUGFVQFKCIPQUGRTQDNGOU
• ..'&
ITGGP .KPMCEVKXKV[
6JKU.'&KUQPKHVJGTGKUCXCNKFEQPPGEVKQPVQVJGPGVYQTM
GKVJGT$CUG6
QT$CUG6: +VKUQHHKHPQPGVYQTMKUFGVGEVGF
• (.'&
QTCPIG (CUV'VJGTPGV
6JKU.'&YKNNDGQPKHVJGRTKPVUGTXGTKUEQPPGEVGFVQC$CUG6:(CUV
'VJGTPGVPGVYQTM+VKUQHHKHVJGRTKPVUGTXGTKUEQPPGEVGFVQC$CUG6
PGVYQTM
• #.'&
ITGGP 6TCPUOKUUKQP#EVKXKV[
6JKU.'&YKNNDNKPMU[PEJTQPK\GFVQVJGVTCPUOKUUKQPQTTGEGKXGUVCVWU

 +H[QWCTGWUKPICTGRGCVGTQTJWDOCMGUWTGVJCV53'
JGCTVDGCV KUVWTPGFQHHCVVJGJWD
#NUQKH[QWJCXGCJWDQTOWNVKRQTVTGRGCVGTXGTKH[VJCVVJGJWDQTTGRGCVGTRQTVKUIQQF
D[VT[KPIVJGRTKPVUGTXGTQPCFKHHGTGPVRQTV

 +H[QWJCXGCDTKFIGQTTQWVGTNQECVGFDGVYGGPVJGRTKPVUGTXGTCPFJQUVEQORWVGTOCMG
UWTGVJCVVJGFGXKEGKUUGVWRVQCNNQYVJGRTKPVUGTXGTVQUGPFCPFTGEGKXGFCVCHTQOVJG
JQUV(QTGZCORNGCDTKFIGECPDGUGVWRVQQPN[CNNQYEGTVCKPV[RGUQH'VJGTPGV
CFFTGUUGUVQRCUUVJTQWIJ
CRTQEGUUMPQYPCUHKNVGTKPI VJGTGHQTGUWEJCDTKFIGOWUV
DGEQPHKIWTGFVQCNNQY$TQVJGTRTKPVUGTXGTCFFTGUUGU.KMGYKUGCTQWVGTECPDGUGVWRVQ
RCUUQPN[EGTVCKPRTQVQEQNUUQDGUWTGVJCVVJGFGUKTGFRTQVQEQNECPDGRCUUGFVJTQWIJVQ
VJGRTKPVUGTXGT

 +HVJGLQDGZKVUVJGSWGWGDWVFQGUPQVRTKPVOCMGUWTGVJCV[QWCTGPQVVT[KPIVQRTKPVC
VGZVLQDVQC2QUV5ETKRVRTKPVGT+H[QWJCXGCRTKPVGTVJCVKUECRCDNGQHCWVQOCVKENCPIWCIG
UYKVEJKPIOCMGUWTGVJCVVJGRTKPVGTKUPQVHQTEGFKPVQ2QUV5ETKRVOQFG

 +PVGTOKVVGPV2TQDNGO
+HVJGRTKPVUGTXGTCPFRTKPVGTUVCTVWR1-DWV[QWKPVGTOKVVGPVN[JCXGRTQDNGOURTKPVKPIEJGEM
VJGHQNNQYKPI

 +H[QWECPRTKPVUOCNNLQDUDWVNCTIGITCRJKEULQDUCTGFKUVQTVGFQTKPEQORNGVGOCMGUWTG
VJCV[QWJCXGCFGSWCVGOGOQT[KP[QWTRTKPVGTCPFVJGNCVGUVRTKPVGTFTKXGTKPUVCNNGFQP
[QWTEQORWVGT6JGNCVGUV$TQVJGTRTKPVGTFTKXGTUECPDGFQYPNQCFGFHTQO
JVVRYYYDTQVJGTEQOCPFJVVRUQNWVKQPUDTQVJGTEQO

 %JGEMVJGKPFKXKFWCNRTQVQEQNVTQWDNGUJQQVKPIUGEVKQPUKPVJKUEJCRVGTHQTCFFKVKQPCNECWUGU
QHKPVGTOKVVGPVRTKPVGTRTQDNGOU


%*#26'46417$.'5*116+0)

 6%2+26TQWDNGUJQQVKPI
+H[QWCTGWUKPI6%2+2CPFECPPQVRTKPVVQVJGRTKPVUGTXGTCPF[QWJCXGEJGEMGFVJG
JCTFYCTGCPFPGVYQTMCUFGUETKDGFKPVJGRTGXKQWUUVGRUVJGPEJGEMVJGHQNNQYKPI
016'
+VKUCNYC[UCIQQFKFGCVQVT[VJGHQNNQYKPIKPQTFGTVQGNKOKPCVGVJGRQUUKDKNKV[QHUGVWRGTTQTU
• 6WTPQHHVJGRTKPVGTCPFVJGPCICKP
• &GNGVGCPFTGETGCVGVJGRTKPVUGTXGTCPFETGCVGCPGYRTKPVSWGWGKPQTFGTVQGNKOKPCVGVJG
RQUUKDKNKV[QHUGVWRGTTQTU


 6JGRTQDNGOOC[DGVJGTGUWNVQHOKUOCVEJGFQTFWRNKECVG+2CFFTGUU8GTKH[VJCVVJG+2
CFFTGUUKUEQTTGEVN[NQCFGFKPVQVJGRTKPVUGTXGT
XKCVJGEQPHKIWTCVKQPRCIG /CMGUWTG
VJCVPQQVJGTPQFGUQPVJGPGVYQTMJCXGVJKUCFFTGUU
&72.+%#6'+2#&&4'55#4'
6*'$+))'56%#75'1(6%2+224+06+0)241$.'/5 

 +H[QWWUGF$4%10(+)VQGPVGTVJG+2CFFTGUUOCMGUWTGVJCV[QWGZKVGFVJGTGOQVG
EQPUQNGRTQRGTN[YKVJC%64.&QT':+6CPFVJCV[QWVWTPGFVJGRTKPVGTQHHCPFVJGPCICKP

KVOC[VCMGWRVQVYQOKPWVGUHQTVJG+2CFFTGUUVQVCMGGHHGEV 

 /CMGUWTGVJCVVJG6%2+2RTQVQEQNQHVJGRTKPVUGTXGTKUGPCDNGF

 +H[QWWUGFTCTROCMGUWTGVJCV[QWUVCTVGFVJGTCTRFCGOQPQPCP[YQTMUVCVKQPWUKPI
VJGTCTRFTCTRFCQTGSWKXCNGPVEQOOCPF8GTKH[VJCVVJG/etc/ethersHKNGEQPVCKPUVJG
EQTTGEV'VJGTPGVCFFTGUUCPFVJCVVJGRTKPVUGTXGTPCOGOCVEJGUVJGPCOGKPVJG
/etc/hostsHKNG

 +H[QWWUGFDQQVROCMGUWTGVJCV[QWUVCTVGFVJGDQQVRFGCOQPQPCP[70+:YQTMUVCVKQP
CPFDQQVRKUGPCDNGF
KGVJGőŒKUTGOQXGFHTQOVJGDQQVRGPVT[ KPVJGGVEDQQVRVCDHKNG
KUEQTTGEVN[EQPHKIWTGF

 #NUQXGTKH[VJCVJQUVEQORWVGTCPFVJGRTKPVUGTXGTCTGQPVJGUCOGUWDPGVKHVJGRTKPVGTKU
QPCFKHHGTGPVUWDPGVOCMGUWTGVJCVVJGTQWVGTKUEQPHKIWTGFEQTTGEVN[CPFGPUWTGVJCVVJG
)#6'9#;CFFTGUUKUEQPHKIWTGFVQOCVEJVJG+2CFFTGUUQHVJGTQWVGT

 70+:6TQWDNGUJQQVKPI

 /CMGUWTGVJCVVJG/etc/printcapHKNG
KHCRRNKECDNG KUV[RGFKPEQTTGEVN[+PRCTVKEWNCT
NQQMHQTOKUUKPICPF>EJCTCEVGTUDGECWUGCUOCNNGTTQTCP[YJGTGKPVJGHKNGECPJCXG
OCLQTEQPUGSWGPEGU#NUQEJGEMVJG/usr/spoolFKTGEVQT[VQOCMGUWTGVJCV[QWJCXG
ETGCVGFCXCNKFURQQNFKTGEVQT[

 +H[QWCTGWUKPIC.KPWZQRGTCVKPIU[UVGOVJG:9KPFQY2TKPVVQQNRTQITCOVJCVKU
KPENWFGFYKVJ.KPWZOC[PQVRTQRGTN[EQPHKIWTGVJGGVERTKPVECRHKNGHQTNRFQRGTCVKQPVJGP
[QWOKIJVCNUQGFKVVJGGVERTKPVECRHKNGCPFEJCPIGVJGHQNNQYKPINKPGKPVJGGPVT[HQTVJG
RTKPVGT
KH
:lp = /dev/null: \

VJGPVQ
:lp = :\

 +H[QWCTGWUKPIC$GTMGNG[DCUGF70+:OCMGUWTGVJCVVJGFCGOQPKUUVCTVGFQP
$GTMGNG[DCUGFU[UVGOUYKVJVJGEQOOCPFNREUVCTVRTKPVGTYJGTGRTKPVGTKUVJGPCOGQH
VJGNQECNRTKPVSWGWG


%*#26'46417$.'5*116+0)


 +H[QWCTGWUKPICP#66DCUGF70+:OCMGUWTGVJGRTKPVGTKUGPCDNGF
GPCDNGRTKPVGT
YJGTGRTKPVGTKUVJGPCOGQHVJGNQECNRTKPVSWGWG 

 /CMGUWTGVJCVVJGNRTNRFTGOQVGNKPGRTKPVGTUGTXKEGCTGTWPPKPIQPVJGJQUVEQORWVGT

TGHGTVQ[QWTJQUVEQORWVGTFQEWOGPVCVKQPHQTKPHQTOCVKQPQPJQYVQFQVJKU 

 +H[QWCTGJCXKPIVTQWDNGRTKPVKPIOQTGVJCPQPGLQDCVCVKOGVT[KPETGCUKPIVJG+2VKOGQWV
WUKPIVJG5'6+26+/'176EQOOCPFQTWUKPI$4#FOKPRTQHGUUKQPCN

 +HVGZVQT2%.LQDUCTGTWPVQIGVJGTVT[UGVVKPIVJGUGTXKEG
TGOQVGRTKPVGT YKVJ'16UGVVQ
UVTKPIPWODGT
'5% ' (QTGZCORNG
SET SERVICE BRN_xxxxxx_P1 EOT 2

 +H2QUV5ETKRVLQDUHCKNVQRTKPVQTCTGTWPVQIGVJGTVT[UGVVKPIVJGUGTXKEG
TGOQVGRTKPVGT
YKVJ'16UGVVQUVTKPIPWODGT
EQPVTQN& (QTGZCORNG
SET SERVICE BRN_xxxxxx_P1 EOT 3

 +HVJGNKPGUQHCVGZVHKNGCTGUVCIIGTGFOCMGUWTGVJCV[QWJCXGURGEKHKGFCTGOQVGRTKPVGT

TR PCOGQH6':6KP[QWT/etc/printcapHKNG

 +H[QWCTGWUKPI5WP5QNCTKU8QTGCTNKGTVJGTGKUCDWIYJKEJECWUGUNQPIRTKPVLQDUVQ
HCKNYJGPWUKPICRTKPVUGTXGT+H[QWCTGJCXKPIVTQWDNGRTKPVKPINQPILQDU
QXGT/$ CFF
VJGNKPGmx#0 VQ[QWTetc/printcapHKNGGPVT[

 9KPFQYU06.#05GTXGT
6%2+2 6TQWDNGUJQQVKPI
+H[QWCTGJCXKPIVTQWDNGRTKPVKPIYKVJ9KPFQYU06QT.#05GTXGTEJGEMVJGHQNNQYKPI

 /CMGUWTGVJCV6%2+2CPF6%2+2RTKPVUGTXKEGCTGKPUVCNNGFCPFTWPPKPIQPVJG9KPFQYU
06U[UVGOQTVJG.#05GTXGTHKNGUGTXGT

 9KPFQYU/G2GGTVQ2GGT2TKPV
.24 6TQWDNGUJQQVKPI
+H[QWCTGJCXKPIVTQWDNGRTKPVKPIQPC9KPFQYU/G
QTNCVGT 2GGTVQ2GGTPGVYQTM
.24
OGVJQF EJGEMVJGHQNNQYKPI

 /CMGUWTGVJCVVJG$TQVJGT.242QTVFTKXGTKUEQTTGEVN[KPUVCNNGFCPFEQPHKIWTGFCEEQTFKPI
VQVJG9KPFQYU/G2GGTVQ2GGTEJCRVGTUKPVJG0GVYQTM7UGTŏU)WKFG

 ;QWOC[HKPFVJCVFWTKPIVJGKPUVCNNCVKQPQH$.2UQHVYCTGVJGUETGGPVJCVRTQORVU[QWHQT
C2QTVPCOGKUPQVFKURNC[GF6JKUOC[JCRRGPQPUQOG9KPFQYU/GEQORWVGTU
2TGUUVJG#.6CPF6#$MG[UVQOCMGKVCRRGCT


%*#26'46417$.'5*116+0)

 9KPFQYU/G062GGTVQ2GGT2TKPV
0GV$+15 6TQWDNGUJQQVKPI
+H[QWCTGJCXKPIVTQWDNGRTKPVKPIQPC9KPFQYU/G06
QTNCVGT 2GGTVQ2GGT
PGVYQTM
0GV$+15 EJGEMVJGHQNNQYKPI

 /CMGUWTGVJCVVJG$TQVJGT0GV$+152QTVFTKXGTKUUGEWTGN[KPUVCNNGFCPFEQPHKIWTGF
CEEQTFKPIVQVJG9KPFQYU/G062GGTVQ2GGT
0GV$+15 EJCRVGTU;QW
OC[HKPFVJCVFWTKPIVJGKPUVCNNCVKQPQHVJGRQTVFTKXGTVJGUETGGPVJCVRTQORVU[QWHQTC
2QTVPCOGKUPQVFKURNC[GF6JKUJCRRGPUQPUQOG9KPFQYU/G06
EQORWVGTU2TGUUVJG#.6CPF6#$MG[UVQOCMGKVCRRGCT

 /CMGUWTGVJCVVJGRTKPVUGTXGTKUEQPHKIWTGFVQDGKPVJGUCOGYQTMITQWRQTFQOCKPCU
VJGVGUVQH[QWTEQORWVGTU+VOC[VCMGUGXGTCNOKPWVGUHQTVJGRTKPVUGTXGTVQCRRGCTKP
VJGPGVYQTMPGKIJDQTJQQF

 $TQVJGT+PVGTPGV2TKPV
6%2+2 6TQWDNGUJQQVKPI

0QVG+VKU$TQVJGTŏUQTKIKPCNRTKPVUGTXKEGD['OCKNPQV+22


 6JGHKTUVUVGRKPVTQWDNGUJQQVKPIKUVQOCMGUWTGVJCV[QWJCXGCXCNKF'OCKNEQPPGEVKQP
QPDQVJVJGUGPFKPI2%CPFVJGTGEGKXKPIRTKPVUGTXGT6T[UGPFKPICP'OCKNOGUUCIG
HTQOVJG2%VQCWUGTCVVJGTGOQVGUKVGYJQECPTGEGKXGOCKNXKCVJG212UGTXGT+HVJKU
FQGUPQVYQTMVJGTGOC[DGCP'OCKNEQPHKIWTCVKQPRTQDNGOQPVJG2%QPVJGNQECN'
OCKNUGTXGTQTQPVJGTGOQVG212UGTXGT&QWDNGEJGEMVQOCMGUWTGVJCVVJG'OCKN
RCTCOGVGTUVJCV[QWEQPHKIWTGFQPVJG2%CPFQPVJGTGOQVGRTKPVUGTXGTOCVEJVJQUG
VJCVCTGEQPHKIWTGFQPVJG'OCKNUGTXGTU

 +H[QWECPRTKPVUOCNNHKNGU1-DWVCTGJCXKPIRTQDNGOURTKPVKPINCTIGHKNGUVJGRTQDNGO
OC[DGKPVJGGOCKNU[UVGO5QOG'OCKNU[UVGOUJCXGFKHHKEWNVKGURTKPVKPINCTIGHKNGU+H
VJGHKNGFQGUPQVTGCEJKVUFGUVKPCVKQPKPVCEVVJGPVJGRTQDNGOKUYKVJVJG'OCKNU[UVGO

 ;QWECPCNUQGPCDNGVJGRCTVKCNGOCKNRTKPVHCEKNKV[QP[QWTENKGPV2%VJKUYKNNURNKVVJGG
OCKNWRKPVQHTCIOGPVUYJKEJUJQWNFVJGPPQVQXGTYJGNO[QWTGOCKNUGTXGT6QFQVJKU
UGNGEVVJGRTQRGTV[FKCNQIQHVJG$TQVJGT+PVGTPGV2TKPV2QTV

 0QXGNN0GVYCTG6TQWDNGUJQQVKPI
+H[QWECPPQVRTKPVHTQO0GV9CTGCPF[QWJCXGEJGEMGFVJGJCTFYCTGCPFPGVYQTMCU
FGUETKDGFKPVJGRTGXKQWUUVGRUHKTUVXGTKH[VJCVVJG$TQVJGTRTKPVUGTXGTKUCVVCEJGFVQVJG
UGTXGTSWGWGD[IQKPIVQ2%1051.'UGNGEVKPIPRINT QUEUE INFORMATIONCPFVJGP
CURRENTLY ATTACHED SERVERS+HVJGRTKPVUGTXGTFQGUPQVCRRGCTKPVJGNKUVQHCVVCEJGF
UGTXGTUVJGPEJGEMVJGHQNNQYKPI
016'
+VKUCNYC[UCIQQFKFGCVQVT[HQNNQYKPIUKPQTFGTVQGNKOKPCVGVJGRQUUKDKNKV[QHUGVWRGTTQTU
• 6WTPVJGRTKPVGTQHHCPFVJGPQPCICKPVQHQTEGVJGRTKPVGTVQTGUECPVJG0GVYCTGSWGWG
• &GNGVGCPFTGETGCVGVJGRTKPVUGTXGTCPFETGCVGCPGYRTKPVSWGWGKPQTFGTVQGNKOKPCVGVJG
RQUUKDKNKV[QHUGVWRGTTQTU


 +H[QWEJCPIGFVJGNQIKPRCUUYQTF[QWOWUVEJCPIGVJGRCUUYQTFKPDQVJVJG$TQVJGT
RTKPVUGTXGT
WUKPIVJGSET NETWARE PASSWORDEQOOCPFKH[QWCTGWUKPIVJG
$4%QPHKIUQHVYCTG QTD[WUKPICYGDDTQYUGTQTVJG$4#FOKPRTQHGUUKQPCNWVKNKV[CPFKP
VJGHKNGUGTXGT
WUKPIVJG2%1051.'2TKPV5GTXGT+PHQTOCVKQP%JCPIG2CUUYQTF
EQOOCPF 


%*#26'46417$.'5*116+0)


 +H[QWETGCVGFVJGRTKPVSWGWGWUKPI2%1051.'CPFKPUVGCFQH$4#FOKPRTQHGUUKQPCN
OCMGUWTGVJCV[QWJCXGGPCDNGFCVNGCUVQPG0GV9CTGHKNGUGTXGTWUKPIVJGSET
NETWARE SERVERservername ENABLEDEQOOCPF

 *CXG[QWGZEGGFGF[QWT0GV9CTGWUGTNKOKV!

 /CMGUWTGVJCVVJGRTKPVUGTXGTPCOG[QWWUGFKP2%1051.'GZCEVN[OCVEJGUVJGPCOG
VJCVKUEQPHKIWTGFKPVJGRTKPVUGTXGTCPFOCMGUWTGKVKUFGHKPGFCUC3WGWG5GTXGTHQT
VJGRTKPVSWGWG

 +H[QWCTGTWPPKPIDQVJCPF'VJGTPGV++HTCOGUQPFKHHGTGPVHKNGUGTXGTUQP[QWT
PGVYQTMVJGTGKUCRQUUKDKNKV[VJCVVJGRTKPVUGTXGTOC[PQVOCMGCEQPPGEVKQPVQVJG
FGUKTGFHKNGUGTXGT6T[HQTEKPIVJGHTCOGV[RGVQVJGFGUKTGFQPGWUKPIVJGSET NETWARE
FRAMEEQOOCPFHTQOVJGRTKPVUGTXGTTGOQVGEQPUQNGQTWUKPI$4#FOKPRTQHGUUKQPCN

 +H[QWCTGWUKPI&15%#2674'UVCVGOGPVCPFNQUKPIRQTVKQPUQH[QWTRTKPVLQDVT[UGVVKPI
VJG6+/'176RCTCOGVGTKP[QWT%#2674'UVCVGOGPVVQCJKIJGTXCNWG
CVNGCUV
UGEQPFUHQT9KPFQYU 

 #RRNG6CNM6TQWDNGUJQQVKPI
+H[QWECPPQVRTKPVHTQOCP#RRNG6CNMHQT/CEKPVQUJEQORWVGTCPF[QWJCXGEJGEMGFVJG
JCTFYCTGCPFPGVYQTMCUFGUETKDGFKPVJGRTGXKQWUUVGRUVJGPEJGEMVJGHQNNQYKPI

 /CMGUWTGVJCV[QWCTGTWPPKPI2JCUG#RRNG6CNMCPFVJCV[QWJCXGUGNGEVGFVJGEQTTGEV
PGVYQTMKPVGTHCEGHTQOVJG0GVYQTM%QPVTQN2CPGNQPVJG/CEKPVQUJ

 /CMGUWTGVJCVVJG#RRNG6CNMRTQVQEQNQHVJGRTKPVUGTXGTKUGPCDNGF

 +H[QWJCXGCNCTIGPGVYQTMOCMGUWTGVJCV[QWJCXGVJG.CUGT9TKVGT8ZZQTGSWKXCNGPV
FTKXGTUKPEGGCTNKGTXGTUKQPUOC[ECWUG2QUV5ETKRVGTTQTU#NUQXGTKH[VJCV[QWIGVVJG
EQTTGEVRTKPVGTKPHQTOCVKQPYJGP[QWUGNGEV2TKPVGT+PHQHTQOVJG5GVWRDWVVQPKPVJG
%JQQUGT

 /CMGUWTGVJCV[QWJCXGUGNGEVGFVJGEQTTGEV2TKPVGT&GUETKRVKQP(KNG
22& HTQOVJG
%JQQUGT
QVJGTYKUG2QUV5ETKRVGTTQTUOC[TGUWNV


%*#26'46417$.'5*116+0)


 8GTKH[VJCV[QWJCXGUGNGEVGFVJGEQTTGEV#RRNG6CNM\QPG$GECWUGVJGRTKPVUGTXGTIGVUKVU
\QPGKPHQTOCVKQPHTQOTQWVGTDTQCFECUVUKVOC[PQVDGKPVJG\QPG[QWGZRGEVCPFYKNN
VJGTGHQTGPQVUJQYWRKPVJG%JQQUGT+HVJKUKUVJGECUG[QWOC[PGGFVQHQTEGVJG\QPG
PCOGYKVJVJGSET APPLETALK ZONEEQOOCPFFGUETKDGFKP#RRGPFKZ#QTWUKPI
$4#FOKPRTQHGUUKQPCN

 8GTKH[VJCVVJG.CUGT2TGRXGTUKQPUQPCNN/CEKPVQUJEQORWVGTUVJCVPGGFVQRTKPVVQVJG
RTKPVUGTXGTCTGVJGUCOG

 #RRNG6%2+22TKPVKPI
5[UVGOQTNCVGT

 (TQOU[UVGOQTNCVGT#RRNGKPVTQFWEGFVJG&GUMVQR2TKPVGT7VKNKV[6JKUWVKNKV[CNNQYU
6%2+2RTKPVKPIHTQOCPK/CE)QTNCVGT/CEKPVQUJ

 (TQOVJGő+PVGTPGV2TKPVGTŒFKCNQIWGRNGCUGGPUWTGVJCV[QWGPVGTVJGEQTTGEVUGTXKEG
PCOGKPVJGő3WGWGŒQRVKQP(QTGZCORNGHQT0%UGTKGUPGVYQTMECTFUGPVGT
$40AZZZZZZA2A#6
YJGTGZZZZZZKUVJGNCUVUKZFKIKVUQHVJG/#%CFFTGUUQHVJG0%
UGTKGUECTF 

 6JKUOGVJQFQHRTKPVKPITGSWKTGUVJCVVJGRTKPVGTUWRRQTVU2QUV5ETKRV+H[QWTRTKPVGTFQGU
PQVUWRRQTV2QUV5ETKRVRTKPVKPI2NGCUGEQPUWNV[QWTRTKPVGTOCPWCNVQUGGKH[QWTRTKPVGT
UWRRQTVU2QUV5ETKRV

 9GD$TQYUGT6TQWDNGUJQQVKPI
6%2+2

 +H[QWECPPQVEQPPGEVVQVJGRTKPVUGTXGTWUKPI[QWTYGDDTQYUGTKVOC[DGYQTVJ
EJGEMKPIVJG2TQZ[5GVVKPIUQH[QWTDTQYUGT.QQMKPVJG'ZEGRVKQPUUGVVKPICPFKH
PGEGUUCT[V[RGKPVJG+2CFFTGUUQHVJGRTKPVUGTXGT6JKUYKNNUVQR[QWT2%HTQOVT[KPIVQ
EQPPGEVVQ[QWT+52QTRTQZ[UGTXGTGXGT[VKOG[QWYKUJVQNQQMCVVJGRTKPVGTUGTXGT

 /CMGUWTGVJCV[QWCTGWUKPIVJGRTQRGT9GD$TQYUGTYGTGEQOOGPF0GVUECRG
0CXKICVQTXGTUKQPQTNCVGT/KETQUQHV+PVGTPGV'ZRNQTGTXGTUKQPQTNCVGT


%*#26'46417$.'5*116+0)

 +052'%6+10/1&'

 6GUV2TKPV/QFG
6JGRTKPVGTKPEQTRQTCVGUXCTKQWUVGUVRTKPVOQFGU
5GNGEVVJGVGUVOQFG[QWYCPVVQWUGHQNNQYKPIVJGUVGRUDGNQY

 6WTPQHHVJGRQYGTUYKVEJQHVJGRTKPVGTCPFEJGEMVJCVVJGHTQPVEQXGTKUENQUGF

 6WTPQPVJGRQYGTUYKVEJYJKNGJQNFKPIFQYPVJGEQPVTQNRCPGNDWVVQP2TGUUVJGDWVVQP
WPVKNVJG&TWO.'&EQOGUQP
6JG&TWO.'&KNNWOKPCVGUVQKPFKECVGVJCVVJGRTKPVGTGPVGTUKPVQVJGVGUVRTKPVOQFG

 +H[QWYCPVVQGZGEWVGVJGVGUVRTKPVTGNGCUGCPFVJGPRTGUUVJGDWVVQPCICKPYJGPVJG
&TWO.'&EQOGUQP
+H[QWYCPVVQGZGEWVGCPQVJGTQRVKQPJQNFFQYPVJGDWVVQPVQUGNGEVKVCUUJQYPKPVJG
VCDNGDGNQY4GNGCUGCPFVJGPRTGUUVJGDWVVQPVQGZGEWVGVJGUGNGEVGFQRVKQP

.'& 6[RGQHOQFG (WPEVKQP


&TWO 6GUV5CORNG2CIG 6JGRTKPVGTRTKPVUCVGUVUCORNGRCIG6JG
RTKPVGTTGVWTPUVQVJGTGCF[UVCVWUCHVGTRTKPVKPI
4GCF[ 2TKPV%QPHKIWTCVKQP 6JGRTKPVGTRTKPVUVJGEWTTGPVEQPHKIWTCVKQPQH
2TKPV(QPVU+ VJGRTKPVGTCPFCNKUVQHVJGKPVGTPCNHQPVU6JG

*.0 RTKPVGTTGVWTPUVQVJGTGCF[UVCVWUCHVGTRTKPVKPI
QPN[
#NCTO (CEVQT[4GUGV 6JGRTKPVGTKUTGUVQTGFVQVJGHCEVQT[UGVVKPI
CPFRGTOCPGPVHQPVUCPFOCETQUCTGENGCTGF
6JGRTKPVGTTGVWTPUVQVJGTGCF[UVCVWUCHVGT
RTKPVKPI
&CVC *GZ&WOR2TKPV 6JGRTKPVGTECPRTKPVFCVCCUJGZCFGEKOCN

*.0 XCNWGUUQVJCV[QWECPEJGEMFCVCGTTQTUCPF
QPN[ RTQDNGOU6QGZKVHTQOVJKUOQFG[QWJCXGVQ
VWTPQHHVJGRTKPVGT
(QTVJGFGOQRTKPVGT
1PEG[QWJCXGUGPVCP[FCVCHTQOC2%VQCFGOQRTKPVGTVQRTKPVVJGFGOQRTKPVGTVWTPUKPVQC
PQTOCNRTKPVGT(QNNQYVJGRTQEGFWTGUDGNQYVQTGVWTPKVVQDGKPICFGOQRTKPVGT
$[WUKPIVJG2CPGNDWVVQP
6QTGVWTPKVVQCFGOQRTKPVGTD[WUKPIVJG2CPGNDWVVQP

 2GTHQTOUVGRU
 CPF
 CDQXGVJG&TWO.'&KUQP

 &GRTGUUVJGRCPGNDWVVQPVJG4GCF[.'&KNNWOKPCVGUVJGPVJG#NCTO.'&KNNWOKPCVGU
VJGPVJG&CVC.'&CPFTGNGCUGVJGRCPGNDWVVQPYJGPVJG&TWO.'&KUKNNWOKPCVGF+VPQY
TGVWTPUVQCFGOQRTKPVGTCWVQOCVKECNN[
5GPFKPIVJGRTKPVHKNGWUKPIVJG$TQYPKGWVKNKV[

 &QYPNQCFVJG$TQYPKGWVKNKV[CPFVJG240HKNGHQT[QWTNCPIWCIGHTQOVJG2TKPVGT7VKNKV[
&$QH.QVWU0QVGUCPFKPUVCNNVJG$TQYPKGUQHVYCTGQPVQ[QWT2%

 1RGPVJG$TQYPKGWVKNKV[CPFUGNGEVVJGRTKPVGT[QWYCPVVQTGVWTPVQDGKPICFGOQRTKPVGT

 1RGP'ZRNQTGTCPFHKPFVJG240HKNG[QWJCXGFQYPNQCFGFKPUVGR VJGPFTCIVJGHKNG
QPVQVJG$TQYPKGYKPFQY

 1PEGVJG$TQYPKGWVKNKV[JCUHKPKUJGFUGPFKPIVJG240HKNGVWTPVJGRTKPVGTRQYGTQHHCPF
VJGPVWTPKVQPCICKP


%*#26'46417$.'5*116+0)


 2TGUUVJGRCPGNDWVVQPVJGFGOQRCIGRTKPVKPIUVCTVU
 +PURGEVKQP/QFG
6JGRTKPVGTKPEQTRQTCVGUXCTKQWUKPURGEVKQPOQFGUUWEJCUVJGHCEVQT[KPURGEVKQPOQFGCPF
VJGVGUVRTKPVOQFG
6JGRTKPVGTUWRRQTVUCHCEVQT[KPURGEVKQPOQFGEQPVKPWQWUITKFRCVVGTPRTKPVOQFGRCVVGTPU
RTKPVOQFGCPF084#/XCNWGFWOROQFG

5GNGEVVJGKPURGEVKQPOQFG[QWYCPVVQWUGHQNNQYKPIVJGUVGRUDGNQY

 6WTPQHHVJGRQYGTUYKVEJQHVJGRTKPVGT

 1RGPVJGHTQPVEQXGTCPFVWTPQPVJGRQYGTUYKVEJYJKNGJQNFKPIFQYPVJGEQPVTQNRCPGN
DWVVQP

 9JGPVJGRTKPVGTGPVGTUKPVQVJGKPURGEVKQPOQFGVJG&TWO.'&KU10*QNFKPIFQYPVJG
RCPGNDWVVQPYKNNECWUGVJG.'&UVQVWTP10KPVJGQTFGT&TWO→4GCF[→#NCTO→&CVC
→&TWO9JGP[QWTGNGCUGVJGDWVVQPCOQFGKUUGNGEVGF
6JGOQFGUGNGEVGFKUKPFKECVGFD[VJG.'&YJKEJKU10YJGP[QWTGNGCUGVJGDWVVQP
6JGKPURGEVKQPOQFGUCTGCUUKIPGFVQVJGTGURGEVKXG.'&UCUUJQYPDGNQY
.'& 6[RGQHKPURGEVKQP
&TWO (CEVQT[KPURGEVKQPOQFG
4GCF[ %QPVKPWQWUITKFRCVVGTPRTKPVOQFG
#NCTO RCVVGTPURTKPVOQFG
ITKF\KRDNCEM
&CVC 084#/XCNWGFWOROQFG
&TWO 4GCF[ 41/EQFGTGRTQITCOOKPIOQFG
QPN[YJGP
HNCUJOGOQT[KUHKVVGF
4GCF[ #NCTO 4#/EJGEM
#NCTO &CVC FGPUKV[RCVVGTPRTKPVOQFG
016'
• 6QRTKPVVJGVGUVRCVVGTPVGUVUKPVJGVCDNGCDQXGENQUGVJGHTQPVEQXGT1RGPKPIVJGHTQPV
EQXGTCICKPYKNNUVQRVJGVGUVRTKPV


%*#26'46417$.'5*116+0)

(CEVQT[KPURGEVKQPOQFG
6JGHCEVQT[KPURGEVKQPOQFGKUWUGFVQEJGEMKHVJGUGPUQTUKPVJGRTKPVGTCTGHWPEVKQPKPI
EQTTGEVN[+PVJGRTQEGUUQHVJKUKPURGEVKQPVJG.'&UCPFVJGEQPVTQNRCPGNDWVVQPCTGCNUQ
EJGEMGF
1PGPVGTKPIVJKUOQFGVJG.'&UUJQYVJGUVCVWUQHVJGTGURGEVKXGUGPUQTUCUUJQYPKPVJG
HKIWTGDGNQY

Drum Toner sensor

Ready Rear registration sensor


Paper
Alarm Front registration sensor
Toner
Data Upper paper cassette sensor
(HL-1450/1470N)

Button pressed

(KI

6QPGTUGPUQT 10
6JGVQPGTECTVTKFIGKUKPUVCNNGF &TWO.'&10
1((
0QVQPGTECTVTKFIGKUKPUVCNNGF &TWO.'&1((
4GCTTGIKUVTCVKQPUGPUQT 10
2CRGTKUFGVGEVGF 4GCF[.'&10
1((
0QRCRGTKUFGVGEVGF 4GCF[.'&1((
(TQPVTGIKUVTCVKQPUGPUQT 10
2CRGTKUFGVGEVGF #NCTO.'&10
1((
0QRCRGTKUFGVGEVGF #NCTO.'&1((
7RRGTRCRGTECUUGVVG 10
0QRCRGTECUUGVVGKUKPUVCNNGF &CVC.'&10
UGPUQT
*.0QPN[ 1((
6JGRCRGTECUUGVVGKUKPUVCNNGF &CVC.'&1((

(QTEJGEMKPIOQTGUGPUQTURTGUUVJGRCPGNDWVVQP6JG.'&UUJQYVJGUVCVWUQHVJG
TGURGEVKXGUGPUQTUCUUJQYPKPVJGHKIWTGDGNQY

(KI


%*#26'46417$.'5*116+0)

2CRGTGLGEVUGPUQT 10
2CRGTKUFGVGEVGF &TWO.'&10
1((
0QRCRGTKUFGVGEVGF &TWO.'&1((
.QYGTRCRGTECUUGVVG 10
0QNQYGTRCRGTECUUGVVGKUKPUVCNNGF 4GCF[.'&10
TGIKUVTCVKQPUGPUQT 2CRGTKUFGVGEVGF

*.0QPN[ 1((
6JGNQYGTRCRGTECUUGVVGKU 4GCF[.'&1((
KPUVCNNGF0QRCRGTKUFGVGEVGF
2CRGTLCOUGPUQT 10
2CRGTKUFGVGEVGF #NCTO.'&10
1((
0QRCRGTKUFGVGEVGF #NCTO.'&1((
%QXGTUGPUQT 10
6JGHTQPVEQXGTKUENQUGF &CVC.'&1((
1((
6JGHTQPVEQXGTKUQRGP &CVC.'&10

6JGRTQEGFWTGHQTVJGHCEVQT[KPURGEVKQPOQFGKUCUHQNNQYU

 6WTPQHHVJGRTKPVGTRQYGTUYKVEJQRGPVJGHTQPVEQXGTCPFTGOQXGVJGFTWOWPKV

 6WTPQPVJGRTKPVGTRQYGTUYKVEJYJKNGJQNFKPIFQYPVJGEQPVTQNRCPGNDWVVQP6JG&TWO
.'&EQOGU10

 .KIJVN[RTGUUVJGRCPGNDWVVQPCICKP

 %JGEMVJCVCNNVJG.'&UGZEGRVVJG4GCF[.'&CTG1((
✒ +HVJGVQPGTUGPUQTKU10VJG&TWO.'&UVC[U10
GTTQT 
✒ +HVJGHTQPVTGIKUVTCVKQPUGPUQTKU10VJG#NCTO.'&UVC[U10
GTTQT 
✒ +HVJGWRRGTRCRGTECUUGVVGUGPUQTKU10VJG&CVC.'&UVC[U10
GTTQT 
*.
0QPN[
016'
6JGNQYGTRCRGTECUUGVVGUQNGPQKFKUVWTPGF101((GXGPKHVJGRCPGNDWVVQPKUPQVRTGUUGF

 %JGEMVJGTGCTTGIKUVTCVKQPUGPUQT
✒ +HVJGTGCTTGIKUVTCVKQPUGPUQTKUUVWEMDCEMYCTFUVJG4GCF[.'&UVC[U1((
GTTQT
✒ +HVJGTGCTTGIKUVTCVKQPUGPUQTKUOQXGFDCEMCPFHQTVJVJG4GCF[.'&EQOGU10CV
CP[VKOG
GTTQT
016'
9JGPEJGEMKPIVJGTGCTTGIKUVTCVKQPUGPUQTYKVJVJGFTWOWPKVTGOQXGFVQGPCDNGCTGNKCDNG
VGUVVQDGECTTKGFQWVVCMGVJGHQNNQYKPIUVGRU

K 2WUJVJGUGPUQTHWNN[DCEMYCTFUKPVQVJGRTKPVGTCPFGPUWTGVJG4GCF[.'&KUNKV

KK /QXGVJGUGPUQTCTOUNQYN[HQTYCTFUCPFGPUWTGVJG4GCF[.'&IQGUQWVCPFVJGP
EQOGUQPCICKPDGHQTGVJGUGPUQTCTOTGCEJGUKVUHTQPVNKOKVQHVTCXGN

KKK 4GHKVVJGFTWOWPKVCPFGPUWTGVJG4GCF[.'&KU1((

 %JGEMVJCVQPN[VJG&CVC.'&EQOGU10YJKNGRTGUUKPIVJGRCPGNDWVVQP
✒ +HVJGRCRGTGLGEVUGPUQTKU10VJG&TWO.'&UVC[U10
GTTQT
✒ +HVJGNQYGTRCRGTECUUGVVGTGIKUVTCVKQPUGPUQTKU10VJG4GCF[.'&UVC[U10
GTTQT
+HVJGTGIKUVTCVKQPUGPUQTKU10VJGNQYGTRCRGTECUUGVVGUQNGPQKFKUVWTPGF10CPF
VJG4GCF[.'&CNUQUVC[U10
*.0QPN[
016'
6JGNQYGTRCRGTECUUGVVGUQNGPQKFKUVWTPGF101((GXGPKHVJGRCPGNDWVVQPKUPQVRTGUUGF

 +PUVCNNVJGFTWOWPKV
✒ %JGEMVJCVVJG&TWO.'&IQGU10CPFVJG4GCF[.'&IQGU1((


%*#26'46417$.'5*116+0)


%*#26'46417$.'5*116+0)

 %NQUGVJGHTQPVEQXGT

 %QPVKPWGVQRTGUUVJGEQPVTQNRCPGNDWVVQP
✒ %JGEMVJCVVJG&CVC.'&UVC[U1((

 4GNGCUGVJGRCPGNDWVVQP

 +HCNNVJGUGPUQTUGZEGRVVJGVQPGTUGPUQTCTGEQTTGEVVJGRTKPVGTIQGUDCEMVQVJG4GCF[
UVCVWU
+HCP[GTTQTKUFGVGEVGFVJGRTKPVGTUVC[UKPVJGKPURGEVKQPOQFG
016'
+HVJGRTKPVGTIQGUDCEMVQVJG4GCF[UVCVWUCHVGTVJGVQPGTUGPUQTFQGUPQVFGVGEVVJGFTWO
WPKVVJGRTKPVGTUVCTVUVQTGEQIPK\GVJGOCKPOQVQT


#22'0&+:

#22'0&+: 5'4+#.01&'5%4+26+105

6JGFGUETKRVKQPUDGNQYUJQYJQYVQWPFGTUVCPFVJGOGCPKPIUQHVJGPWODGTURTKPVGFQPVJG
NCDGNUQTDCIQHVJGRTKPVGTCPFRTKPVGTRCTVU

+&HQTRTQFWEVKQPOQPVJ
# ,CPWCT[ $ (GDTWCT[ % /CTEJ & #RTKN
' /C[ ( ,WPG ) ,WN[ * #WIWUV
, 5GRVGODGT - 1EVQDGT . 0QXGODGT / &GEGODGT

+&HQTHCEVQT[
 -CTK[C2NCPV # /KG$TQVJGT % $+7-
, $WLK0CP.KPI(CEVQT[


 2TKPVGTRTKPVGFQPVJGNCDGNCVVCEJGFQPVJGTGCTQHVJGOCKPDQF[

/1&'.01 5'4+#.01

::::::),
5'37'06+#.01
(#%614;+&01
;'#4
/106*


 2TQEGUUWPKV KORTKPVGFQPVJGCNWOKPWODCI

&TWOWPKVYKVJVQPGTECTVTKFIG

(,
;'#4
/106*
&#6'
(#%614;+&01


 &TWOWPKVRTKPVGFQPVJGDCTEQFGNCDGNCVVCEJGFKPUKFGVJGFTWOWPKV

(
/106*
5'4+#.01
;'#4
(#%614;+&01

#
#22'0&+:


 6QPGTECTVTKFIGKORTKPVGFQPVJGCNWOKPWODCI

(,
;'#4
/106* &#6'
(#%614;+&01

RTKPVGFQPVJGDCTEQFGNCDGNCVVCEJGFQPVJGVQPGTECTVTKFIG

610'4.1601 '
/106*
;'#4
5'4+#.01

%#464+&)'
241&7%6+10+0(1 (
/106*
;'#4 5'4+#.01
(#%614;+&01


 .CUGTWPKV QPVJGNCUGTWPKV


&#6'01
+&01*.0

(#%614;+&01$WLK0CP.KPI(CEVQT[

#
#22'0&+:

#22'0&+: &+#/'6'4%+4%7/('4'0%'1(41..'45

6JGFKCOGVGTCPFEKTEWOHGTGPEGQHGCEJTQNNGTCTGNKUVGFDGNQY

0Q 2CTVU0COG &KCOGVGT


%KTEWOHGTGPEG
 2CRGT(GGF4QNNGT φOO
OO
 6TCPUHGT4QNNGT φOO
OO
 2JQVQUGPUKVKXG&TWO φOO
OO
 *GCV4QNNGT φOO
OO
 2TGUUWTG4QNNGT φOO
OO
 &GXGNQROGPV4QNNGT φOO
OO

#
#22'0&+:

#22'0&+: 24+0652''&59+6*8#4+1755'66+0)5

2TKPVURGGFQHVJG*.0RTKPVGTUKUWRVQRROYJGPNQCFKPI#WRVQ
RROYJGPNQCFKPI.GVVGTUK\GRCRGTHTQOVJGRCRGTECUUGVVGKPVJG4GIWNCTOQFGCPF*.
RTKPVGTKUWRVQRROYJGPNQCFKPI#WRVQRROYJGPNQCFKPI.GVVGTUK\GRCRGT
HTQOVJGRCRGTECUUGVVGKPVJG4GIWNCTOQFG#EVWCNRTKPVURGGFXCTKGUFGRGPFKPIQPVJGOGFKC
V[RGQTRCRGTUK\GCUUJQYPKPVJGVCDNGUDGNQY

#CPF
.GVVGTUK\G
/GFKCV[RGUGVVKPI *.0 *.
6TCPURCTGPEKGU WRVQRRO
WRVQRRO WRVQRRO
WRVQRRO
6JKP2CRGT WRVQRRO
WRVQRRO WRVQRRO
WRVQRRO
2NCKPRCRGT WRVQRRO
WRVQRRO WRVQRRO
WRVQRRO
6JKEM2CRGT WRVQRRO
WRVQRRO WRVQRRO
WRVQRRO
6JKEMGT$QPF2CRGT #RRO.GVVGTWRVQRRO
5OCNNGTUK\GVJCP#QT.GVVGT
/GFKCV[RGUGVVKPI #NNOQFGNU
6TCPURCTGPEKGU /CZURGGF
6JKP2CRGT /CZURGGF
2NCKPRCRGT RRO
RROHQT*. CHVGTOKPJCXGRCUUGF
6JKEM2CRGT RROCHVGTUGEJCXGRCUUGF
6JKEMGT$QPF2CRGT RRO

016'
• 9JGPCUOCNNGTUK\GRCRGTVJCP#QT.GVVGTKURTKPVGFVJGVGORGTCVWTGQPDQVJGFIGUQH
VJGHKZKPIWPKVKUOWEJJKIJGTVJCPVJGVGORGTCVWTGQPVJGEGPVGTQHVJGWPKVYJGTGVJGRCRGT
KUHGFFGRGPFKPIQPVJGUGVVKPIQTOQFGN6JGTGHQTGVJGRTKPVURGGFKUUNQYGFKPQTFGTVQ
FGETGCUGVJGVGORGTCVWTGQPVJGGFIGUCHVGTVJGURGEKHKGFVKOGKVKUOCZKOWORTKPVURGGF
YJGP[QWHKTUVUVCTVRTKPVKPI
• /CZURGGFKURROQTOQTG+VXCTKGUFGRGPFKPIQPVJGRCRGTUK\G

#
#22'0&+:

#22'0&+: *1961-019&47/70+6.+('2#)'%1706'4
+H[QWYCPVVQMPQYVJGFTWOWPKVNKHGQTVJGPWODGTQHRTKPVGFRCIGU[QWUJQWNFRTKPVQWVVJG
2TKPV%QPHKIWTCVKQPRCIGHQTVJG*.0RTKPVGTQTRTKPVQWVVJG6GUV2TKPVRCIG
HQTVJG*.
016'
6JGRCIGEQWPVGTFTWOEQWPVGTCPFFTWOWPKVNKHGDCTCTG016RTKPVGFQPVJG2TKPV
%QPHKIWTCVKQPRCIGHQTUQOGOQFGNU(QTVJQUGOQFGNUWUGVJG2TKPVGT+PHQTOCVKQPVQQN
YJKEJKPFKECVGUVJGRCIGEQWPVGTGVEQPVJG2%UETGGPTGHGTTKPIVQ5GEVKQPŎ2TKPVGT
+PHQTOCVKQPŏKP#22'0&+:

 2TKPV%QPHKIWTCVKQP
HQT*.0QPN[

 6WTPQPVJGRQYGTUYKVEJQHVJGRTKPVGTYJKNGRTGUUKPIVJGRTKPVGTEQPVTQNRCPGNDWVVQP

 4GNGCUGVJGRCPGNDWVVQPYJGPVJG&TWO.'&EQOGUQP

 2TGUUVJGRCPGNDWVVQPCICKPCPFTGNGCUGKVYJGPVJG4GCF[.'&EQOGUQP

 2TKPVVJG2TKPV%QPHKIWTCVKQPRCIG

6JGRCIGEQWPVGTCPFFTWOEQWPVGTCTGRTKPVGFCVVJGTKIJVWRRGTKP2TKPV%QPHKIWTCVKQP

4GHGTVQVJGHKIWTGDGNQY 0QVGVJCVVJGFTWOEQWPVGTKUCPCEVWCNRCIGEQWPVGTCHVGTCPGY
FTWOWPKVKUTGRNCEGFCPFOC[DGFKHHGTGPVHTQOVJGFTWOWPKVNKHGUJQYPKPVJGFTWONKHGDCT
(QTFGVCKNUUGG5GEVKQPŎ*QYVQ4GCFVJG&TWO7PKV.KHGŏ

5CORNG*.HQT'WTQRG
2CIGEQWPVGTCPF
FTWOEQWPVGTCTG
RTKPVGFJGTG

(KI#

#
#22'0&+:

016'
6JGFGUETKRVKQPURTKPVGFKP2TKPV%QPHKIWTCVKQPXCT[FGRGPFKPIQPVJGRTKPVGTOQFGNUQT
EQWPVTKGU

 6GUV2TKPV
HQT*.QPN[

 6WTPQPVJGRQYGTUYKVEJQHVJGRTKPVGTYJKNGRTGUUKPIVJGRTKPVGTEQPVTQNRCPGNDWVVQP

 4GNGCUGVJGRCPGNDWVVQPYJGPVJG&TWO.'&EQOGUQP

 2TGUUVJGRCPGNDWVVQPCICKPCPFTGNGCUGKVYJGPVJG&TWO.'&EQOGUQP

 2TKPVVJG6GUV2TKPVRCIG

6JGRCIGEQWPVGTCPFFTWOEQWPVGTCTGRTKPVGFCVVJGDQVVQOQHVJG6GUV2TKPV
4GHGTVQVJG
HKIWTGDGNQY 0QVGVJCVVJGFTWOEQWPVGTKUCPCEVWCNRCIGEQWPVGTCHVGTCPGYFTWOWPKVKU
TGRNCEGFCPFOC[DGFKHHGTGPVHTQOVJGFTWOWPKVNKHGUJQYPKPVJGFTWONKHGDCT(QTFGVCKNU
UGG5GEVKQPŎ*QYVQ4GCFVJG&TWO7PKV.KHGŏ

5CORNG*.HQT'WTQRG

2CIGEQWPVGTCPF
FTWOEQWPVGTCTG
RTKPVGFJGTG

(KI#

016'
6JGFGUETKRVKQPURTKPVGFKP6GUV2TKPVXCT[FGRGPFKPIQPVJGEQWPVT[

#
#22'0&+:

 *QYVQ4GCFVJG&TWO7PKV.KHG
6JGFTWOWPKVNKHGKUUJQYPD[VJGDCTCVVJGDQVVQOQH2TKPV%QPHKIWTCVKQPQT6GUV2TKPVCU
HQNNQYU
• +VKPKVKCNN[KPFKECVGUCPFITCFWCNN[FGETGCUGU
• +VKPFKECVGUYJGPVJG&TWO.'&KUQP
• +VUVC[UCVGXGPKHHWTVJGTRTKPVKPIKUFQPG

0% Drum Life 100%


2CIGEQWPVGT
99.4% 00000090909090909
MZ-L160003F000000
/CKPVGPCPEG
KPHQTOCVKQP
(KI#

6JGFTWOWPKVNKHGKUDCUGFQPVJGRCIGEQWPVGT+HVJGCXGTCIGPWODGTQHFTWOTQVCVKQPUKU
OQTGVJCPVJGPWODGTQHFTWOTQVCVKQPUKPPQPEQPVKPWQWURTKPVKPIJQYGXGTVJGFTWOWPKVNKHG
KUEQWPVGFD[VJGPWODGTQHFTWOTQVCVKQPU
5KPEGVJGFTWOEQWPVGTRTKPVGFKP2TKPV%QPHKIWTCVKQP
*.0 QT6GUV2TKPV
*.
 KUCPCEVWCNRCIGEQWPVGTCHVGTCPGYFTWOWPKVKUTGRNCEGFVJGFTWOWPKVNKHGOC[DG
FKHHGTGPVHTQOVJGFTWOEQWPVGT
(QTFGVCKNUQPVJGFKHHGTGPEGDGVYGGPVJGFTWOWPKVNKHGCPFFTWOEQWPVGTTGHGTVQVJGFTWOWPKV
NKHGECNEWNCVKQPDGNQY

*QYVQECNEWNCVGFTWOWPKVNKHG
2TKPVKPIVKOGHQTRCIGLQDKPFKUEQPVKPWQWURTKPVKPIUGEQPFU

2CIGEQWPVGTTGFWEGFD[VJGPWODGTQHFTWOTQVCVKQPU 
6KOGQHOQVQTTQVCVKQP Ò
UGE

'ZCORNG
%QNFUVCTV
+FNKPIHQTUGE *QVUVCTV 2CIGEQWPVGT
RCIGLQD
    
RCIGULQD
   
   
RCIGULQD
  Z 
 Z  

+HRTKPVKPIRCIGRGTLQDYKVJEQNFUVCTVVJGFTWOWPKVNKHGKUFGETGCUGFGCTNKGT

016'
(QTKPHQTOCVKQPQPJQYVQWPFGTUVCPFVJGPWODGTUQPVJGTKIJVDGNQYVJGDCTUGGVJGHQNNQYKPI
UGEVKQPUŎ*QYVQ4GCFVJG2CIG%QWPVGTŏCPFŎ*QYVQ4GCFVJG/CKPVGPCPEG
+PHQTOCVKQPŏ

#
#22'0&+:

 *QYVQ4GCFVJG2CIG%QWPVGT
6JGRCIGEQWPVGTKUUJQYPCVVJGTKIJVWRRGTEQTPGTKP2TKPV%QPHKIWTCVKQP
*.
0 QTCVVJGDQVVQOEGPVGTKP6GUV2TKPV
*. 
+VKUCNUQUJQYPKPVJGWRRGTNKPGQPVJGTKIJVDGNQYVJGFTWONKHGDCTCPFKPFKECVGUVJGPWODGT
QHRTKPVGFRCIGUKPWPKVUQHCPF

• 8CNWGKPWPKVUQH
6JGJGZCFGEKOCNXCNWGUVQTGFKP084#/KURTKPVGF
'ZCORNG '&&&&&
Value in units of 1,000 '&&&&&
(Refer to the list below.)

Z Z      

• 8CNWGKPWPKVUQH
2CIGEQWPVGTKPFKECVGFD[WPKVUQHRCIGU

ÆRCIGU  RCIGU 
RCIGU  RCIGU 
RCIGU  RCIGU 
RCIGU  RCIGU 
RCIGU  RCIGU #
RCIGU  RCIGU $

#
#22'0&+:

 *QYVQ4GCFVJG/CKPVGPCPEG+PHQTOCVKQP
6JGOCKPVGPCPEGKPHQTOCVKQPUWEJCUVJGHTGSWGPE[QHEQPUWOCDNGRCTVUTGRNCEGOGPVQT
RCRGTLCOECPDGHQWPFHTQOVJGFKIKVPWODGTUJQYPKPVJGNQYGTNKPGQPVJGTKIJVDGNQYVJG
FTWOWPKVNKHGDCT
016'
6JGFKIKVPWODGTKUCNUQUJQYPKPVJG2TKPVGT+PHQTOCVKQPFKCNQIDQZYJKEJKUQPGQHVJGUGNH
FKCIPQUVKEUVQQNU(QTFGVCKNUTGHGTVQ5GEVKQPŎ2TKPVGT+PHQTOCVKQPŏKP#22'0&+:

6QQDVCKPVJGOCKPVGPCPEGKPHQTOCVKQP[QWPGGFVQQDVCKPCPFNQCFVJG/CKPVGPCPEG
+PHQTOCVKQPWVKNKV[YJKEJUWRRNKGFQP5GTXKEG&CVCDCPMD[HQNNQYKPIVJGUVGRUDGNQY


 &QYPNQCFVJG/CKPVGPCPEG
+PHQTOCVKQPWVKNKV[HTQOVJG
2TKPVGT7VKNKV[&$KP5GTXKEG
&CVCDCPM

 1RGPVJGWVKNKV[VJGP
UGNGEVő&GEQFGVJGD[VG
FCVCŒKPVJGOGPW

 5GNGEVő*.
0Œ

(KI#

(KI#


 'PVGTVJGFKIKVPWODGT
CUUJQYPQPVJGTKIJV
HTQOVJGFKIKVPWODGT

 %NKEMVJ1-DWVVQP

(KI#

#
#22'0&+:


 6JGFKCNQIDQZUJQYPCV
VJGTKIJVYKNNCRRGCTCPF
UJQYVJGHTGSWGPEKGUQH
FTWOWPKVEJCPIGVQPGT
ECTVTKFIGEJCPIGCPF
RCRGTLCO

 %NKEMVJG1-DWVVQP

(KI#

+HVJGRTKPVGTKUEQPPGEVGFVQCRCTCNNGNRQTV[QWECPVCMGVJGHQNNQYKPIUVGRU

 1RGPVJG/CKPVGPCPEG
+PHQTOCVKQPWVKNKV[VJGP
UGNGEVŎ)GVVJG+PHQTOCVKQPŏ
KPVJGOGPW

 5GNGEVVJG.26RQTV[QWCTG
WUKPICPFUGNGEVő*.
ŒCPF
ENKEMVJG1-DWVVQP

(KI#


 6JGFKCNQIDQZUJQYPCV 
VJGTKIJVYKNNCRRGCTCPF
UJQYVJGHTGSWGPEKGUQH
FTWOWPKVEJCPIGVQPGT
ECTVTKFIGEJCPIGCPFRCRGT
LCOGVE
UGG(KI#

 %NKEMVJG1-DWVVQP
016'5GTKCN0QKPHQTOCVKQPKU
PQVCXCKNCDNGHQT*.



(KI#

#
APPENDIX

Note that each maintenance information is counted under the conditions below;
Information Conditions
Drum unit change When drum unit life is 100 pages or more, and the drum counter is
reset. (Maximum counter: 63)
Toner cartridge change When the toner cartridge is replaced after a Toner Empty error is
stored in NVRAM, then warming-up completes without a Toner
Empty or Toner Low error being detected. (Maximum counter: 27)
Paper jam When a paper jam occurs. (Maximum counter: 2047)

A-11
#22'0&+:

#22'0&+: *196175'6*'5'.(&+#)0156+%5611.5

6JTGGUGNHFKCIPQUVKEUVQQNUDGNQYCTGCWVQOCVKECNN[KPUVCNNGFYJGPVJGRTKPVGTFTKXGTKU
KPUVCNNGF
 6TQWDNGUJQQVKPIHQT2TKPVGTYQPŏVRTKPV
 &KCIPQUVKEU
 2TKPVGT+PHQTOCVKQP

6JGHQNNQYKPIUGEVKQPUFGUETKDGVJGFGVCKNUQPGCEJVQQN

 6TQWDNGUJQQVKPIHQT2TKPVGTYQPŏVRTKPV
6JKUVQQNKPUVTWEVU[QWJQYVQENGCTVJGRTQDNGOUWEJCUŎ6JGRTKPVGTECPŏVRTKPVŏQTŎ6JGRTKPVGT
RTKPVUICTDCIGQTKPEQTTGEVHQPVUŏ

 9JGP[QWUVCTVVJGRTQITCOVJG*GNRFKCNQIDQZUJQYPDGNQYCRRGCTU

(KI#


 5GNGEVVJGRTQDNGO[QWJCXGJCFVJGPVJGURGEKHKGFYKPFQYCRRGCTU

 (QNNQYVJGKPUVTWEVKQPUVJCVCRRGCTQPVJG2%UETGGP

+HVJGRTQDNGOECPPQVDGUQNXGFUVCTVVJGő&KCIPQUVKEUŒVQQNVQETGCVGCNQIHKNGYJKEJUJQWNFDG
UGPVVQVJGCWVJQTK\GFUGTXKEGEGPVGTVQKPXGUVKICVGVJGECWUGQHRTQDNGO(QTVJGFGVCKNUQP
VJGő&KCIPQUVKEUŒVQQNUGGVJGHQNNQYKPIUGEVKQPŎ&KCIPQUVKEUŏ

#
#22'0&+:

 &KCIPQUVKEU
6JKUVQQNJGNRU[QWVQTGRQTV[QWT2%GPXKTQPOGPVVQKPXGUVKICVGVJGECWUGQHRTQDNGOUWEJCU
Ŏ2TKPVGTYQPŏVRTKPVŏQTŎ2TKPVGTRTKPVUICTDCIGQTKPEQTTGEVHQPVUŏ$GHQTGWUKPIVJKUVQQNJQYGXGT
[QWJCXGVQEJGEMKH[QWECPENGCTVJGRTQDNGOWUKPIVJGŎ6TQWDNGUJQQVKPIHQTRTKPVGTYQPŏV
RTKPVŏVQQNFGUETKDGFKPVJGRTGXKQWUUGEVKQP


 9JGP[QWUVCTVVJGRTQITCOVJGFKCNQIDQZUJQYPDGNQYCRRGCTU(QNNQYVJGUVGRU
FGUETKDGFKPVJGDQZVJGPENKEMVJG1-DWVVQP

(KI#


 6JGOGUUCIGDGNQYCRRGCTUENKEMVJG1-DWVVQPKH[QWYCPVVQEJGEMYJGVJGTVJGTGKU
CP[KPEQTTGEVFCVCQTPQV+H[QWFQPQVYCPVVQEJGEMKVENKEMVJG%CPEGNDWVVQP

(KI#

#
#22'0&+:

 +H[QWENKEMVJG1-DWVVQPKP5VGRVJGFKCNQIDQZDGNQYCRRGCTU

(KI#

 %JGEMVJGTGUWNVVJCVVJGRTKPVGTTGRQTVGFCPFENKEMVJG#$QT%DWVVQPFGRGPFKPIQPVJG
TGUWNV

 6JGETGCVGFNQIHKNGKUUJQYPQPVJG2%UETGGP
6JGUQHVYCTGYKNNCUMYJGVJGT[QWYKUJ
VQRTKPVVJGNQIHKNGQTPQV

5GPFVJGNQIHKNGETGCVGFYKVJVJKUVQQNVQKPXGUVKICVGVJGRTQDNGOVQVJGCWVJQTK\GFUGTXKEG
EGPVGT

#
#22'0&+:

 2TKPVGT+PHQTOCVKQP
6JGFTWOWPKVNKHGQTRCIGEQWPVGTKURTKPVGFQP2TKPV%QPHKIWTCVKQP
*.0 QT
6GUV2TKPV
*. KPUQOGEQWPVTKGUCUFGUETKDGFKP#22'0&+:Ŏ*1961-019&47/
70+6.+('2#)'%1706'4ŏ
6JKUVQQNCNUQUJQYUVJGRTKPVGTKPHQTOCVKQPUWEJCURTKPVGTXGTUKQPQTRCIGEQWPVGTHQTCNN
OQFGNUQPN[YJGPVJGRTKPVGTKUEQPPGEVGFVQCRCTCNNGNRQTV

 9JGP[QWUVCTVVJGRTQITCOVJGFKCNQIDQZUJQYPDGNQYCRRGCTU

(KI#


 5GNGEVVJG.26RQTV[QWCTGWUKPICPFENKEMVJG1-DWVVQP

 6JGFKCNQIDQZDGNQYCRRGCTUCPFKPFKECVGUVJGRTKPVGTKPHQTOCVKQPRTKPVGT+&XGTUKQP
FTWOWPKVNKHGRCIGEQWPVGTCPFFTWOEQWPVGT

(KI#

016'
(QTJQYVQTGCFVJG/CKPVGPCPEG&CVCUJQYPKPVJGFKCNQIDQZCDQXGUGG5GEVKQPŎ*QYVQ
4GCFVJG/CKPVGPCPEG+PHQTOCVKQPŏKP#22'0&+:

#
#22'0&+:

#22'0&+: 084#/&'(#7.68#.7'

6JGFGHCWNVXCNWGUHQTVJGOCKPKVGOUVQDGUGVKP084#/CTGCUHQNNQYU

+VGOU &GUETKRVKQPU
6KOKPIQH&TWO.'&10 RCIG

%QWPVGFHTQOVJGFTWOWPKVNKHG
(KZKPIVGORGTCVWTG • 6TCPURCTGPE[u%
• 6JKPRCRGTu%
• 2NCKPRCRGTu%
• 6JKEMRCRGTu%
• 6JKEMGT$QPFRCRGTu%
KPPQPEQPVKPWQWU
RTKPVKPI
5OCNNGTUK\GOQFG 5GG#22'0&+:Ŏ24+0652''&59+6*
8#4+1755'66+0)5ŏ

#
#22'0&+:

#22'0&+: 2#2'4%#55'66'+0(14/#6+10
(14'7412'10.;

6JG#UK\GRCRGTECUUGVVGHKVVGFVQVJGRTKPVGTKUFKHHGTGPVHTQOVJGUGTXKEGOCPWCNKPHQTOCVKQP
HQTRTKPVGTUUJKRRGFVQ'WTQRGCUHQNNQYU


 6JGRCRGTECUUGVVGUWRRNKGFYKVJVJG*. 2CRGTVTC[EQXGT
0RTKPVGTJCUC
RNCUVKETKDQPVJGRCRGTVTC[EQXGT

 6JGRNCUVKETKDKUTGOQXGFHTQOVJGVTC[
EQXGTHQTVJGRCRGTECUUGVVGUWRRNKGFYKVJ
VJG.6
QRVKQPCN.QYGT6TC[7PKV CU
2NCUVKETKD
UJQYPQPVJGTKIJV

%WVVKPIRQUKVKQP

(KI#


 +HVJGQRVKQPCN.6.QYGT6TC[7PKVKUKPUVCNNGFQPVQVJG*.0RTKPVGTKVKU
PGEGUUCT[VQGZEJCPIGVJGECUUGVVGUWRRNKGFYKVJVJG.67PKVYKVJVJGWRRGTECUUGVVG
CNTGCF[HKVVGFKPVQVJGRTKPVGT+PUVCNNVJGECUUGVVGQTKIKPCNN[HKVVGFKPVJGRTKPVGTKPVQVJG.6
7PKV
(CKNWTGVQFQUQYKNNECWUGRCRGTLCOUCUVJGRCRGTECPPQVDGHGFHTQOVJGNQYGTECUUGVVG
VQVJGRTKPVGTDQF[DGECWUGVJGRNCUVKETKDQPVJGRCRGTVTC[EQXGTKUDNQEMKPIVJGRCRGTRCVJ

 (QTRCRGTECUUGVVGUUWRRNKGFCUURCTGRCTVUVJGRNCUVKETKDJCUDGGPEWVQHHUQVJCV[QW
ECPWUGKVCUDQVJCPWRRGTECUUGVVGCPFNQYGTECUUGVVG

#
APPENDIX

PR2002109

APPENDIX 8. TONER CARTRIDGE WEIGHT INFORMATION

Toner Cartridge Weight (approx weight)


TN6300 / TN430 TN6600 / TN460
Brand new Toner Cartridge Weight 775 g 820 g
Toner Weight at Brand New Toner Cartridge 145 ± 5g 190 ± 5g
Toner Cartridge Weight at Toner Near Empty 720 ~ 725 g 720 ~ 725 g
Remain Toner Weight at Toner Near Empty 90 ~ 95 g 90 ~ 95 g
Toner Cartridge Weight at Toner Empty 710 ~ 715 g 710 ~ 715 g
Remain Toner Weight at Toner Empty 80 ~ 85 g 80 ~ 85 g
You can print 500 ~ 600 pages with 10g toner.

* Without yellow protector


* Toner cartridge weight may vary within 2 – 3 g depending on the cartridge weight.

A-18
Appendix 8. Connection Diagram, HL-1230

AC INPUT

INLET

PARALLEL I/F

LVPS
MAIN PCB
POWER
SW

PAPER EJECT
SENSOR
CN1 CN101 P3 P4 P10

FAN POLYGON LASER


MOTOR MOTOR

LASER UNIT
P7 P6
P5 P3

T/R CHG
MAIN P1
MOTOR P17
GRID
P9
CN1
HVPS
P2 DEV
P12 P15
P10

ENGINE PCB
SOLENOID P13
REAR REGISTRATION
SENSOR
PANEL PCB
P14 FRONT REGISTRATION
SENSOR

TONER
SENSOR
(light emission) TONER
JAM SENSOR SENSOR
COVER (light reception)
SENSOR

FIXING UNIT THERMISTOR

HALOGEN HEATER LAMP

A - 17
Appendix 9. Connection Diagram, HL-1440

AC INPUT

INLET

USB
PARALLEL I/F
I/F
(HL-1440 only)

LVPS
MAIN PCB
POWER
SW SIMM

PAPER EJECT
SENSOR
CN1 CN101 P3 P4 P10

FAN POLYGON LASER


MOTOR MOTOR

LASER UNIT
P7 P6
P5 P3

T/R CHG
MAIN P1
MOTOR P17
GRID
P9
CN1
HVPS
P2 DEV
P12 P15
P10

ENGINE PCB
SOLENOID P13
REAR REGISTRATION
SENSOR
PANEL PCB
P14 FRONT REGISTRATION
SENSOR

TONER
SENSOR
(light emission) TONER
JAM SENSOR SENSOR
COVER (light reception)
SENSOR

FIXING UNIT THERMISTOR

HALOGEN HEATER LAMP

A - 17
Appendix 10. Connection Diagram, HL-1450

AC INPUT

INLET

PARALLEL I/F USB


I/F

LVPS
MAIN PCB
POWER
SIMM
SW

PAPER EJECT
SENSOR
CN1 CN101 P3 P4 P10

LOWER
PAPER
CASSETTE

FAN POLYGON LASER


MOTOR MOTOR

LASER UNIT
P7 P6
P3
P5
P8 T/R CHG
MAIN P1
MOTOR GRID
P9 P17 CN1 HVPS
P2 DEV
P12 P15
P10

ENGINE PCB
SOLENOID P13
REAR REGIST
SENSOR
PANEL PCB UPPER PAPER
P14 CASSETTE FRONT REGIST
SENSOR SENSOR

TONER
SENSOR
(light emission) TONER
JAM SENSOR SENSOR
COVER (light reception)
SENSOR

FIXING UNIT THERMISTOR

HALOGEN HEATER LAMP

A - 18
Appendix 11. Connection Diagram, HL-1470N

RJ45 (Ethernet)

SW P2

AC INPUT P1

NETWORK BOARD

INLET

PARALLEL I/F USB


I/F

P21PCI

LVPS
MAIN PCB
POWER
SIMM
SW

PAPER EJECT
SENSOR
CN1 CN101 P3 P4 P10

LOWER
PAPER
CASSETTE

FAN POLYGON LASER


MOTOR MOTOR

LASER UNIT
P7 P6
P3
P5
P8 T/R CHG
MAIN P1
MOTOR GRID
P9 P17
CN1 HVPS
P2 DEV
P12 P15
P10

ENGINE PCB
SOLENOID P13
REAR REGIST
SENSOR
PANEL PCB UPPER PAPER
P14 CASSETTE FRONT REGIST
SENSOR SENSOR

TONER
SENSOR
(light emission) TONER
JAM SENSOR SENSOR
COVER (light reception)
SENSOR

FIXING UNIT THERMISTOR

HALOGEN HEATER LAMP

A - 19
Appendix 12. Main PCB Circuit Diagram, HL-1230/1440 (1/3 )

CODE LJ8812001
NAME B512130 CIR (1/3)

A - XX
Appendix 13. Main PCB Circuit Diagram, HL-1230/1440 (2/3)

CODE LJ8812001
NAME B512130 CIR (2/3)

A - XX
Appendix 14. Main PCB Circuit Diagram, HL-1230/1440 (3/3)

CODE LJ8812001
NAME B512130 CIR (3/3)

A - XX
Appendix 15. Engine PCB Circuit Diagram

CODE LJ88009001
NAME B512136 CIR

A - XX
Appendix 16. Network Board Circuit Diagram, HL-1470N

CODE LJ8107000
NAME B512058CIR

A - 29
Appendix 17. Low-voltage Power Supply PCB Circuit Diagram (110 - 120V)

L
L2 PC2
F1 R22 1

ZC
R21

Z1

R1
C1
R20
TRA1 3

C22
R23
N

CN1

L1
Z2

C16

NTC1

F2
D12
D14
C109
CN101

D13
D11
T1 D101 BEA101
24V
5,7

R2
R110
5V

R3
R114 R116

+
C302
R111
R130

C5
D8 PC1

+
VR101

C101
D104
R208
D7 R7 D102
PC2

Q1 C10
R19 R6 R112 C110 HEAT ON

C8
C111

J105
R113

C102
6

D4
D9
R18
or R215
R15
R115 D105 C112
GND

R17

FG
1,3,4

R11
R9
R213

C12
R12
PC1 Q201

R5
D6
R201 L201

BEA1
R205

VR1
R13
D5
R202
R209

R10
R212

+
+

Q2

R8
C9
C205

C11
D203
D201

C206
C201
D202

R203
VR201

R206 C207

C7
R204

C203 R211
R210

R214
C204

C202

R207

C15
FG

VCC Cosc REF1 K1 GND OUT


10 9 8 7 6 5 4 3 2 1
IC101

Low-voltage PS Circuit
NAME
(110 - 120V)

A - 30
Appendix 18. Low-voltage Power Supply PCB Circuit Diagram (220 - 240V)

L
L2 PC2
F1 R22 1

ZC
R21

Z1

R1
C1
R20
TRA1 3

C22
R23
N

CN1

L1
Z2

C16

NTC1

F2
D12
D14
C109
CN101

D13
D11
T1 D101 BEA101
24V
5,7

R2
R110
5V

R3
R114 R116 2

+
C302
R111
R130

C5
D8 PC1

+
VR101

C101
D104
R208
D7 R7 D102
PC2

Q1 C10
R19 R6 R112 C110 HEAT ON

C8
C111

J105
R113

C102
6

D4
D9
R18
or R215
C112

R115 D105
R15
GND

R17

FG
1,3,4

R11
R9
R213

C12
R12
PC1 Q201

R5
D6
R201 L201

BEA1
R205

VR1
R13
D5
R202
R209

R10
R212

+
+

Q2

R8
C9
C205

C11
D203
D201

C206
C201
D202

R203
VR201

R206 C207

C7
R204

C203 R211
R210

R214
C204

C202

R207

C15
FG

VCC Cosc REF1 K1 GND OUT


10 9 8 7 6 5 4 3 2 1
IC101

Low-voltage PS Circuit
NAME
(220 - 240V)

A - 31
Appendix 19. High-voltage Power Supply PCB Circuit Diagram, ZLe (MPH3212)

CODE
NAME