Ur i ne t r eat ment Ur i ne t r eat ment Ur i ne t r eat ment , Ur i ne t r eat ment

,
r euse and r euse and
di ver si on component di ver si on component di ver si on component di ver si on component
t echnol ogy r evi ew t echnol ogy r evi ew
Lit erat ure Overview
Mariska Ront elt ap, March 2011
Report s
Technology Review Urine Divert ing Component s 3
ECOSAN_AT / I ssue 3: Use of Urine 35
Pract ical Guidance on t he Use of Urine in Crop Product ion 68
Toepassingsmogelij kheden voor urine in de landbouw 137
Verwij dering medicij nrest en en hormoonverst orende st offen uit urine 214
Prakt ij kproef t oepassing urine zorglocat ie Anderen 225
H
2
O: Ervaring met urinescheiding in Europa 254
Are pharmaceut ical residues a problem for urine reuse in agricult ure? 257
Three years of operat ion of t he UD syst em in GTZ headquart ers 277
Tabl e of Cont ent Tabl e of Cont ent
Technology Review | Urine diversion components
Overview of urine diversion components such as waterless urinals,
urine diversion toilets, urine storage and reuse systems
Imprint
Published by:
Deutsche Gesellschaft für
Technische Zusammenarbeit GmbH (GTZ)
Sustainable sanitation - ecosan program
Postfach 5180, 65726 Eschborn, Germany
T +49 61 96 79-4220
F +49 61 96 79-80 4220
E ecosan@gtz.de
I www.gtz.de/ecosan
Place and date of publication:
Eschborn, December 2009
Authors:
Dr. Elisabeth von Münch, Dr.-Ing. Martina Winker
Responsible editor:
Dr. Elisabeth von Münch
Acknowledgement:
Nathasith Chiarawatchai, Florian Klingel,
Christine Werner and Patrick Bracken
(authors of an earlier version),
Dr. Håkan Jönsson, Dr. Elisabeth Kvarnström
and Dr. Arno Rosemarin
(reviewers of the current document)
Printed on 100% recycled paper
Design:
creative republic
Thomas Maxeiner Kommunikationsdesign, Frankfurt am Main
www.creativerepublic.net
Photos:
Cover: © Philipp Feiereisen, Steffen Blume, Lukas Ulrich,
Abdoulaye Fall, Sören Rüd, Robert Gensch, iStock
Back: © GTZ, Steffen Blume, Elmer Sayre, Sören Rüd,
Patrick Zimmerer, Alexandra Höhne/Rwanda Village Concept Project,
Elisabeth von Münch, Stefanie Lorenz
Inside: © Elke Mühlegger/EcoSan Club Austria, Patrick Zimmerer,
Philipp Feiereisen, Julia Littmann, Håkan Jönsson, Abdoulaye Fall,
Steffen Blume, Philipp Feiereisen, Robert Gensch, Heike Hoffmann,
Arne Panesar, Michael Kropac
PrePress:
Rohland&more, Offenbach
Printed and distributed by:
Schätzldruck, Donauwörth
Technology Review | Urine diversion components
Overview of urine diversion components such as waterless urinals,
urine diversion toilets, urine storage and reuse systems
4
5 Foreword
ThispublicationisanimportantcontributionoftheGTZ
program“Sustainablesanitation–ecosan”asitpullstogether
scatteredknowledgearoundthetopicofurinediversionina
concisemanner.
TheprogramiscommisionedbytheGermanFederalMinistry
forEconomicCooperationandDevelopment(BMZ).The
ecologicalsanitation(ecosan)approachisabletoaddressboth:
childhealthwhichneedstobeimprovedthroughbettersani-
tation,andsustainablemanagementandsaferecyclingof
importantresourcessuchaswaterandnutrients,inparticular
phosphorus.
Itisapositivedevelopmentthatmoreandmorepeoplearenow
becomingawareofthepresentworldwidesanitationcrisis–
whichiskillingthousandsofyoungchildreneachday.Itisalso
becomingmorewidelyknownthatphosphorus(intheformof
phosphaterockdeposits),isanon-renewable,limitedresource.
High-qualityphosphaterockwillrunoutinthefuture.
Thesafeuseofurineasafertilisercanenableallfarmers
togrowmorefood–notonlythosewhohavethemeansto
buyartificialfertilisers.Whenpricesforartificialfertiliser
increaseagain–asin2008whenpricesincreasedbyupto
eighttimesinsomecountries–farmersrelyingonurinewill
belessaffectedbysuchfertiliserpricehikes.
Iamsurethistechnologyreviewwillhelpandinspirepeople
workingonsustainablesolutionsforexcretamanagement.
Feedbackaboutthispublicationiswelcomeandshouldbesent
toecosan@gtz.de.
Letusjointlycontinuetoworktowardstheaimofsafeand
sustainablesanitationforall!
Andreas Kanzler
Head of Water Section
Division Water, Energy, Transport
DeutscheGesellschaftfür
TechnischeZusammenarbeit(GTZ)GmbH
Eschborn,Germany
Eschborn,December2009
6 Contents
1 Summary .......................................................................................... 8
2 Introduction to urine diversion (UD) ................................... 8
2.1 DefnitionofUD.................................................... 8
2.2 PurposesofUDinstallations.................................. 9
2.3 BeneftsofUDsystems........................................... 9
2.3.1 BeneftsofalltypesofUDtoiletsand
waterlessurinals...................................................... 9
2.3.2FurtheradditionalbeneftsofUDDTscompared
topitlatrines...........................................................9
2.4 ChallengeswithUDsystems.................................. 10
2.4.1 Socialacceptanceamongstusers............................. 10
2.4.2Usercooperation..................................................... 10
2.4.3Urinereuse/disposalissues...................................... 10
2.4.4 Urineprecipitation.................................................. 10
2.5 Quantityofurine................................................... 11
2.6 Qualityofurine...................................................... 11
2.6.1 Sourceconsiderations............................................. 11
2.6.2Pathogens................................................................ 11
2.6.3Nutrients................................................................ 11
2.6.4Micro-pollutants..................................................... 12
2.7 Urinetreatment...................................................... 12
2.7.1 Treatmentobjectives............................................... 12
2.7.2 Treatmentbystorage.............................................. 12
2.7.3 Otherurinetreatmenttechnologies........................ 12
2.8 AreUDsystemsmorecostefective?...................... 13
2.9 TechnicalcomponentsusedforachievingUD....... 13
3 Reuse of urine as fertiliser in agriculture ....................... 13
3.1 Howtouseurineasafertiliser............................... 13
3.1.1 Basicguidelines...................................................... 13
3.1.2 Specifcadvantagesofurinecompared
toothermineralfertilisers.................................... ..14
3.1.3 Disadvantagesofurinecompared
toothermineralfertilisers.................................... ..14
3.1.4 Shouldurinebeappliedundiluted
ordilutedwithwater?........................................... ..15
3.2 Arehormonesandpharmaceutical
residuesinurineproblematicforreuse?.................. 15
3.3 Isurinean“organic fertiliser”
andcanitbeusedinorganicfarming?................... 16
4 Waterless urinals ........................................................................ 16
4.1 Defnitionandpurpose..............................................16
4.2 Historicaldevelopmentofwaterlessurinals............ 17
4.3 Odourcontrolmethods(general)........................... 17
4.4 Odourcontrolforconnectionofurinal
tosewerorstoragetank.......................................... 17
4.4.1 Rubbertubeseal..................................................... 17
4.4.2Curtainvalveseal.................................................. 17
4.4.3 Sealantliquid(blockingfuid)................................ 18
4.4.4 Othermethodsfortheodourseal.......................... 19
4.5 Furtherdesigninformation.................................... 19
4.6 Useandmaintenanceofwaterlessurinals............... 19
4.7 Useracceptanceofwaterlessurinals....................... 20
4.8 Suppliersandcostsofwaterlessurinals................... 20
4.9 Howtochoosetherighttypeofwaterlessurinal.... 20
5 Urine diversion toilets .............................................................. 21
5.1 Defnition............................................................... 21
5.2 BasicdesigninformationforUDtoilets................. 21
5.3 Urinediversiondehydrationtoilets(UDDTs)........ 21
5.3.1 Basicdesigninformation........................................ 21
5.3.2 Odourcontrolforurinecollectionsystem.............. 22
5.3.3 Constructionmethodsandmaterials...................... 22
5.3.4 Useandmaintenance.............................................. 22
5.3.5 Projectexamples..................................................... 22
5.4 UDfushtoilets...................................................... 22
5.4.1 Overviewonhistoricaldevelopment....................... 22
5.4.2 Basicdesigninformation........................................ 22
5.4.3 Odourcontrolfortheurinecollectionsystem........ 23
5.4.4 Materials................................................................. 23
5.4.5 Useandmaintenance.............................................. 23
5.4.6 Projectexamples..................................................... 23
5.5 SuppliersandcostsforUDtoilets.......................... 23
5.6 HowtochoosebetweenaUDDT
andaUDfushtoilet.............................................. 23
6 Urine piping and storage tanks ............................................. 24
6.1 Urinepiping........................................................... 24
6.1.1 Functionalprinciples.............................................. 24
6.1.2 Materials................................................................. 24
6.1.3 Pipesizeandlayout................................................ 24
6.1.4 Odourcontrol......................................................... 24
6.2 Urinestoragetanks................................................. 24
6.2.1Functionalprinciples.............................................. 24
6.2.2Locations................................................................ 25
6.2.3Materials................................................................. 25
6.2.4Urinetanksize....................................................... 25
6.2.5Numberofurinetanksneeded............................... 25
6.2.6Urineoverfowpipe................................................ 26
6.2.7Examples................................................................ 26
6.3 Ventilationforpressureequalisation
ofpipesandtanks................................................... 26
6.4 Maintenanceofurinepipesandtanks.................... 27
7 References ....................................................................................... 27
7.1 Referencesusedinthisdocument.......................... 27
7.2 Videoclips.............................................................. 29
7.3 Additionalphotos................................................... 29
8 Appendix:
Worldwide listing of suppliers for waterless urinals,
UD pedestals and squatting pans ....................................... 29
7 List of Tables & Figures:
Table 1.Averagechemicalcompositionoffreshurine
(literaturevalues)andstoredurine(simulatedvalues,
seeUdertetal.(2006))...................................................... 12
Figure 1.Waterlessurinalsformen.
Left:CentaurusmodelofKeramagcompany.
Right:PlasticurinalfromAddicom,SouthAfrica,
withEco-Smellstopdevice(sources:left:E.v.Münch,
Delft,2006;right:Addicom)............................................ 16
Figure 2.Twotypesofodoursealsforwaterlessurinals.
Left:Flatrubbertube(KeramagCentaurus).
Right:(leftside)See-throughpipeftting;
(rightside)see-throughEcoSmellstop(ESS)unit
showingthebluesiliconcurtainone-wayvalveinside
(source:(left):E.v.Münch,2007;right:Addicom).......... 18
Figure 3.EcoSmellstop(ESS)unitwithpipeftting
andextractor.InsidetheESSisthesiliconcurtain
valve(source:Addicom)..................................................... 18
Figure 4.Exampleinstructionsheet,showing
replacementofsealantliquidforUridanurinals
(otherurinalswithsealantliquidhaveasimilar
maintenanceroutine)(source:Uridan).............................. 18
Figure 5. Left:IndoorUDDT(pedestaltype)inJohannes-
burg,SouthAfricainthehouseofRichardHolden(source:
E.v.Münch,2006).Right:UDDTsquattingpaninBanga-
lore,India,withthreeholes:theareainthefrontisforanal
washing,middleisforfaecesandbackisforurine(source:
D.Schäfer,2008)............................................................... 22
Figure 6.UDfushtoilets.Left:Gustavsberg
(inMeppel,theNetherlands);Right:Dubbletten
(inStockholm,Sweden),(sources:E.v.Münch,2007)..... 23
Figure 7.Left:Low-costsolution:20Lplasticjerrycanfor
urinestorageatindividualtoiletlevelinOuagadougou,
BurkinaFaso(source:E.v.Münch,2006)
Right: Below-groundplasticurinestoragetanks
atKullön,Swedenduringtheconstructionprocess.
Tetankswillbecoveredwithsoil(photo:
MatsJohansson,source:Kvarnströmetal.,2006)............. 26
Figure 8.Urinestoragetankmadeofa150m³
plasticbladderatLakeBornsjönnearStockholm,
Sweden(photocomissionedby:E.v.Münch,2007)......... 26
Figure 9. PlasticurinestoragetankinOuagadougou,
BurkinaFasoaspartoftheEU-fundedprojectECOSAN_UE
ledbyCREPA(source:S.Rüd,2008)............................... 26
8 1 Summary
Tetargetaudienceforthispublicationarepeoplewho
arenewtothetopicofurinediversionornewtothetopic
ofecologicalsanitation(ecosan),andwho:
ÿ needtoobtainanoverviewofthemainissuesfor
urinediversionandthemaintechnicalcomponents
ÿ wanttoknowwhicharethemainimportantdocu-
mentsforfurtherreading
ÿ haveaparticularinterestindevelopingcountries,
withapro-poorperspective
ÿ needinformationonavailablesuppliersworldwide
andoncostsforwaterlessurinalsandurinediversion
toiletpedestalsandsquattingpans.
Tispublicationexplainsthepurposesofurinediversion,its
beneftsandchallenges,urineprecipitation,urinetreatment
andreuseinagriculture.Itprovidesanoverviewondesignand
operationalaspectsforequipmentneeded,suchaswaterless
urinalsandurinediversiontoiletsincludingsupplierinforma-
tionandindicativecosts.Tepublicationalsoprovidesbasic
designinformationforurinepipingandstoragetanks(inclu-
dingtanksizing,odourcontrolandventilationdesignissues).
Urinediversionisthetermusedtodescribekeepingurineand
faecesseparatefromeachotheratthepointofexcretion.Te
fourmainpurposesofimplementingsystemswithurinediver-
sion(UD)are:toreduceodour,topreventproductionofwet
faecalsludge,toreducewaterconsumptionandtocollectpure
urineforuseasfertiliserinagriculture.
Furtherbeneftsincludeminimisedexcreta-relatedgroundwater
pollution,thefactthatthetoiletcanbeindoors(asopposed
toapitlatrine)andbettercontrolovermicro-pollutantsdis-
chargedtotheenvironment.Techallengesincludesocial
acceptance,usercooperation,urinereuseordisposalissues
andurineprecipitation.
Equipmentusedinurinediversionsystemsincludeswaterless
urinals,urinediversiontoilets(eitherwithorwithoutfush
water),urinepipingandurinestoragetanks.Temostcom-
monandcheapestmethodtotreaturineforpathogenremoval
fromfaecalcross-contaminationisbyextendedstorage.
Urinecansafelybeusedingardeningandagricultureasa
nutrient-richfertiliser,providedrelevantreuseguidelines(see
WHO,2006)arefollowed.Ifthereisnousefortheurine,
itcanbedischargedtoasewerorpossiblyinfltratedinthe
ground(iflocalsoilandgroundwaterconditionspermitthis
withoutadverseimpactsongroundwaterquality).
Waterlessurinalsenablethecollectionofundilutedurineand
arealreadywidelyusedinmanyindustrialisedcountries(par-
ticularlyinGermany)inpublicorcommunalbuildings(not
commonathouseholdlevel).Butsofar,theyareusuallyjust
connectedtothesewersystemandtheurineisneithercollected
norreused.Odourcontrolinwaterlessurinalsiscrucialfor
useracceptance,andisachievedby(i)variousdesignsforan
odourblockingmechanism(mostnotablywithafatrubber
tube,siliconcurtainvalveorsealantliquid),and(ii)byen-
suringcorrectmaintenanceprocedures.
Urinediversiondehydrationtoilets(UDDTs)collectfaeces
“in a dry system”(i.e.separatelyfromurine,fushwaterandanal
washwater)invaultsorbucketslocatedunderneaththeUD
pedestalorsquattingpan.Forpro-poorapproachesindeve-
lopingcountries,UDDTsaremoresuitablethanUDfush
toilets,asthelatterstillrequireasewersystemandtreatment
forbrownwater.UDDTscaneasilybedesignedtosuitusers
whousewaterinsteadoftoiletpaperbyprovidingaseparate
drainholeforanalwashwater.
Odourcontrolandpressureequalisationwithinurinepipesand
urinestoragetanksneedtobeincludedinthedesigninthecase
ofindoormulti-toiletsystems.WaterlessurinalsandUDDTs
areapromisingstepforwardtowardsimplementingwatersa-
ving,moresustainablesanitationandreduceddependencyon
costlyartifcialfertiliser,thuscontributingtopovertyreduction.
2 Introduction to urine diversion (UD)
2.1 Defnition of UD
Urinediversion(UD)devicescollecturineseparatelyfrom
faecesandfromwater(orwithminimalfushwater).Aurine
diversiontoilethastwooutletswithtwocollectionsystems:one
forurineandoneforfaeces(andpossiblyathirdoneforanal
washwater),inordertokeepthesetwo(orthree)excretaor
wastewaterfractionsseparate.UDtoiletsmay,ormaynot,mix
waterandfaeces,orsomewaterandurine,buttheynever mix
urine and faeces.Section 5.1providesanoverviewofthetwo
maintypesofurinediversiontoilets:UDtoiletswithoutfush
water(thesearecalledurinediversiondehydrationtoiletsor
UDDTs)andthosewithfushwater(UDfushtoilets).
Urinals–widelyusedbymenatpublictoilets,restaurants,
schools,etc.–workasurinediversiondevicesbecauseurine
iscollectedseparatelyfromfaeces.Whenurinalsareofthe
waterlesstype,theycancollecttheurinepure,meaning
withoutdilutionwithwater.
Urinediversionmaybeusedinecologicalsanitation(ecosan)
concepts,butnot all ecosan projects use urine diversion.
Ecosanisanapproachtosanitationwhichfocussesonreuse
ofnutrientsandorganicmattercontainedinexcretaand
wastewater,andemphasisessustainabilityinallaspects1.
1 Tedefnitionof“sustainable sanitation”isprovidedinthe
frstvisiondocumentoftheSustainableSanitationAlliance
http://www.susana.org/lang-en/intro/156-intro/267-vision-document
9 2.2 Purposes of UD installations
TepurposeofaUDinstallationisusuallyone,orseveral
ofthefollowingfourpurposes–whichcanbesplitintwo
categories:
Purposes relevant for all types of UD systems (describedin
moredetailinSection 2.3.1below):
1. toreducewaterconsumption
2. tobeabletocollecturinepureandundilutedso
thatitcan–aftersanitisationbystorage–besafely
usedasfertiliserinagriculture.
Purposes relevant for UDDTs (urinediversiondehydration
toilets)comparedtopitlatrines(describedinmoredetailin
Section 2.3.2below):
3. toreduceodour
4. toavoidproductionofwet,odorousfaecalsludge,
whichhastoberemovedbysomeonewhenthepit
latrineisfull.
2.3 Benefts of UD systems
2.3.1 Benefts of all types of UD toilets and waterless urinals
ÿ Water savings: UDDTsandwaterlessurinalsrequire
nofushwater,whereasconventionalurinalsusearound
4Lperfush(fushtoiletsuseabout8-12Lperfush;
pourfushtoiletsuse2-3Lperfush).UDfushtoilets
canalsoreducewaterconsumptionwhencomparedto
conventionalwater-fushedtoilets:thisisbecausethe
“urine fush”usesalowvolumetofushawayremai-
ningurinedropsandusedtoiletpaper(0.5to2Lof
fushwater,dependingonthetoiletmodel).Ifurine-
soiledtoiletpaperiscollectedinabin,ratherthan
fushedaway,watersavingscouldbeevengreater.
ÿ Tecollectedurinecanbeusedasfertiliser,which
canincreasecropyields.Asexplainedfurtherin
Section 3,urineisaliquidfertiliserrichinnitrogen
andphosphorus.Tisisofparticularimportancefor
thosefarmersindevelopingcountrieswhocannot
afordmineralfertilisers.
ÿ Recycling of phosphorus from urinemaybecome
necessaryinthemid-termfutureandiseasierto
achieveifurineiscollectedpureratherthanmixed
withwastewater.Phosphorusisanessentialelement
foragriculturalproduction.Itiseitheravailableinthe
soiloraddedwithfertiliser,andisproducedfrommined
depositsofphosphaterock.High-gradephosphaterock
reservesarerunningout:atcurrentratesofexploitation
(increasingataround3%peryear),theeconomicre-
servesofphosphoruswilllastnomorethan50years.
TeeconomicallyviablereservesintheUnitedStates
forexample,willbedepletedwithin25to30years
(Rosemarinetal.,2008;Cordelletal.,2009).Inthe

future,increasedefortstorecyclethephosphorus
contentofhumanandanimalexcretaareinevitable
(EcoSanRes,2008).
ÿ Ifthereisconcernabouthormones and pharmaceuti-
calresiduesenteringdrinkingwatersourcesviahouse-
holdwastewater(sewage),thentheseparatecollection
ofurinecansimplifyremovalofthesesubstancesfrom
theenvironment.Particularlyforindustrialisedcoun-
tries,thiscouldbeamajordrivingforceinfavourof
UDsystems(see Section 3.2).
ÿ Urinediversionmayalsocreatebusiness opportunities
fortheprivatesectorviathesaleofUDtechnologyand
relatedservices.
ÿ Inmanycases,cost savingscanberealisedwhenim-
plementingUDsystemsespeciallyregardingeconomic
costswhenasystem-wideanalysisisperformed(inclu-
dingexternalcostsduetogroundwaterpollutionfor
example),seeSection 2.8fordetails.
2.3.2 Further additional benefts of UDDTs compared
to pit latrines
ÿ Tereissignifcantlyless odourwhenurineandfaeces
arenotmixed–asinaUDDT–comparedtothecase
whereurineandfaecesaremixedasinapitlatrine.
ÿ SinceUDDTsareodour-freewhendesignedandoper-
atedcorrectlyandsincetheydonotneedcontactwith
thesoiltoinfltrateliquids,UDDTscanbeindoors,
whichleadstoimprovedsecurity,privacyanduser
comfort.Tisaspectisveryimportantespeciallyfor
womenandgirls,forwhomitmaybetoodangerous
togotothetoiletoutsideindarkness(sexualassaults).
ÿ No production of wet faecal sludge:Faecescollected
inadrymanner,separatelyfromurineandwater,are
notofensive,especiallyafteranextendeddryingperiod.
Hence,itismucheasiertoemptythefaecesvaultofa
UDDTthanthepitofapitlatrine.Tisisparticularly
importantforhillyorcrowdedareaswhereaccessto
pitlatrinesbyconventionaltrucksisimpossible.
ÿ Minimised toilet-related groundwater pollution with
nitrate and pathogens.Pitlatrinesandseptictanksare
designedtoinfltrateliquidintothesoil,whichcan
leadtogroundwaterpollutionifthepopulationdensity
ishigh,thegroundwaterlevelishighortherearepre-
ferentialpathwaysinthesoiltothegroundwater.
UDDTsontheotherhandcollecttheurineandfaeces
above-groundandthereforedonotpollutetheground-
water.Notethatonsitegreywaterdisposalcanalsolead
togroundwaterpollutionandthisissueisnotaddressed
byurinediversiontoilets.
10 10 2.4 Challenges with UD systems
2.4.1 Social acceptance amongst users
Regardingsocialacceptance,thesuccessfuladoptionof
urinediversionsystemsiscloselylinkedto:
ÿ Users'motivationandwillingnesstochangeexisting
habitsandbehaviours,forexample:
„ Tewillingnessofmentositdownonpedestal-type
UDtoiletsforurinationifnourinalsarebeingprovi-
ded–thisdoesnotapplytosquatting-typeUDtoilets;
„ Tewillingnesstomovebackwardsalittlebitsothat
analwashwatercanbecollectedseparatelyfromfaeces
inthecaseofUDDTsand“anal washers”.
ÿ Supportiveattitudeofallstakeholdersinvolved
(users,maintenancestaf,planners,farmers,
politiciansandsoon).
ÿ Possibleuseofurineasafertiliser(orsomeother
disposaloptionforcollectedurineifreusein
agricultureoraquacultureisnotpossible).
ÿ Culturalobstacleslikesuperstitionoftheusers.
Odournuisance(beitonlyperceivedoractual)isafurther
potentialobstacletosocialacceptance,butwiththecorrect
designandoperation,odoursfromwaterlessurinalsand
UDtoiletsarethesameorlessthanconventionalurinalsand
toilets.Also,UDDTshavesignifcantlylessodourandfies
thanpitlatrines,andcanthereforebeplacedindoorswhich
mayprovetobeasignifcantdriverforsocialacceptance.
Socialacceptancealsodependstoahighdegreeon:
ÿ Tecurrentsanitationsituation(arepeopleusedto
“fying toilets”(plasticbags),pitlatrinesorfushtoilets?)
andtheusers’expectationforthefuture.
ÿ Teprevailingnormsregardingreuseofhuman
excretaandrelatedtaboos.
ÿ Availableserviceproviderswhocanoferacollection
andmaintenanceservice.
Hence,carefulplanningwithstakeholderparticipationiscrucial.
2.4.2 User cooperation
Terearethreemainissuestobekeptinmindregarding
usercooperation:
1. Usershaveto“think a bit”whentheyuseUDtoilets
forthefrsttime(thispointdoesnotapplytowater-
lessurinals,whichareusedinthesamewayaswater-
fushedurinals).Tus,urinediversiontoiletsneed
someupfrontawarenessraisingtoensurecorrectusage
andsocialacceptance.
2. Ifusersdonotcooperate,toiletmisusecanresultin
odour(e.g.ifusersurinateinthefaecescompartment
ofaUDDT)orina“messed-up”toilet(e.g.ifusers
defecateintotheurinecompartmentofaUDtoilet)–
althoughthisisnotdissimilarfrompitlatrinesand
fushtoilets.
3. CleaningofUDtoiletsisalittlemoretimeconsu-
mingthancleaningofconventionaltoilets,dueto
theseparateurinesectioninthetoiletbowl.
2.4.3 Urine reuse/disposal issues
Tefollowingissuesregardingurinereuseordisposalare
important:
ÿ Urineneedstobetransportedtothereuseareaswhich
leadstoincreasedtrafc,andisproblematicifthedis-
tancesarelarge(noise,airpollutionandCO₂emissions).
ÿ Whenurineisusedinagriculture,thefarmersneedto
betrainedonthecorrectmethods(see Section 3.1).
ÿ Ifurinecannotbereused,itissometimesinfltrated
intheground.Insomecircumstances,thishasnoad-
verseenvironmentalimpacts.Inothercases,thiscan
leadtogroundwaterpollutionwithnitrate(depen-
dingontheamountofurineinfltratedperarea,soil
properties,groundwatertable)–justlikewithpit
latrines(butwithpitlatrinesthereistheaddedpro-
blemofpathogentransporttogroundwater).
2.4.4 Urine precipitation
Teinformationgiveninthissectionwasmainlytaken
fromLarsenandLienert(2007).Infreshurine,themain
nitrogencompoundisurea.Duringstorage,ureaishydro-
lysedtoammonia/ammoniumandhydrocarbonatebyurease
enzymespresentintheurinestoragecontainer,soilandin
aquaticsystems(see also Table 1).Tisprocessisaccompa-
niedbyanincreaseinthepHvalue.TeincreasedpHvalue
resultsinprecipitationofstruvite(MgNH₄PO₄)andcalcium
phosphate(Ca₁₀(PO₄)₆(OH)₂)crystals.Tosecrystalscanform
incrustations,alsocalled“urine stone”.
Precipitationinurinepipesandstoragetanksoccursinboth
water-fushedandwaterlesssystems.Inadditionskincells,
hairandexcretedorganiccomplexeswillalsosettle.
Teendresultmaybehardprecipitates(incrustations)orsoft,
viscous,paste-likeprecipitates(deposits).Incrustationstend
tooccurontheinnerwallsofpipesandpipebends.Soft
depositsoccurinstoragetanks(wheretheyformasludgeat
thebottomofthetank)andinnear-horizontalurinepipes.
11 11 Tefollowingdesignparametersreducetheextent
ofprecipitation:
ÿ Short retention time:precipitationoftenoccursat
locationswheretheurinefowvelocityisloworeven
stagnant(suchassiphons,horizontalpipes,U-bends
ofthetoilet).Sucharrangementsshouldthereforebe
avoided.
ÿ Smooth surfaces and hydrophobic materialsshould
beused.Scratchingofsurfacesbymechanicalcleaning
shouldbeavoided.PlasticPVCpipesarecommonly
usedforurinepipes.
ÿ Iffushingwithwater:Flushing with soft water,
suchasrainwater,ispreferredtofushingwithhard
water(softwaterhaslesscalciumandmagnesium
whichcanprecipitatewiththeurine’sammonium
andphosphate).
ÿ Pipes with a relatively large diameter (atleast2.5cm)
arelesslikelytogetclogged.
Usingnofushwateratall(asinwaterlessurinals)doesnot
eliminatetheproblem,sinceurinealsocontainscalciumand
magnesiumwhichcanprecipitatewithammoniumandphos-
phatetoformstruvite.InwaterlessUDsystems,moresoft
depositstendtooccurthanhardincrustations,whereasfor
water-fushedUDsystemsitistheotherwayaround.Informa-
tionaboutmaintenancetaskstopreventorremoveblockages
inurinepipesisprovidedinSection 6.4.
2.5 Quantity of urine
Tequantityofurineproducedbyanadultisaround0.8
to1.5Lperadultperday(WHO,2006,Volume4)–itmainly
dependsontheamountapersondrinksandhisorhertranspi-
ration.Childrenproduceapprox.halfasmuchurineasadults.
Awidelyuseddesignfgure,basedonSwedishdata,is1.5 L/
cap/d (or 550 L/cap/year)2.
2.6 Quality of urine
2.6.1 Source considerations
Tedescriptionofurinequalityinthissectionappliesto
urinecollectedwithoutcross-contaminationwithfaeces.Such
cross-contaminationisdealtwithviaurinetreatmentmethods
(see Section 2.7).
Additionally,itshouldbehighlightedthatthequalityofthe
collectedurineisrelatedtothehealthandlifestyleofthe
peopleexcretingitandtotheurinecollectionsystem.Forex-
ample,ifurineiscollectedfromahospitaloranold-agehome
itwillmostlikelycontainmorepharmaceuticalresiduesthan
urinefromhealthyandyoungpeople.Andifurineisled
throughcopperpipesitmayhaveahighcopperconcentration.
Tishastobekeptinmindduringthedesignphase,especially
whenreuseisplanned.
2.6.2 Pathogens
Terearefourtypesofpathogensrelevantforsanitation:
bacteria,viruses,parasiticprotozoaandintestinalhelminths.
Itisimportanttoknowthaturineinthebladderofahealthy
personissterile(meaningitcontainsnopathogens).Only
veryfewdiseasesaretransmittedviapathogensinurine.Te
onlydiseasewhichneedstobeconsideredfromariskperspec-
tivewhenurineisreusedinagricultureisSchistosoma haema-
tobium–andonlyinareaswherethisdiseaseisendemic
(WHO,2006,Volume4).Incontrast,theamountofpatho-
gensinfaecescanbeveryhigh,dependingontheprevalence
ofdiseasesinthepopulation.
2.6.3 Nutrients
Macro-nutrientsinexcretaincludeN,P,KandS(nitrogen,
phosphorus,potassiumandsulphur)ofwhichNandPare
themostimportant.
Withregardstothenutrientscontainedinurine,thefollow-
ingdesignfguresareused(derivedmainlyfromSwedish
databutconsideredtobequiteuniversal,seeJönssonetal.,
2004):
ÿ Massofnutrientsexcretedwithurine:4kgN/cap/yr,
0.36kgP/cap/yrand1.0kgK/cap/yr.
ÿ Concentrationsofmacro-nutrientsinurine(design
fgure):7300mg/LN;670mg/LP;1800mg/LK.
ÿ Concentrationfguresarebasedonaperson’sdiet
andshouldpreferablybeverifedonsite.
ÿ 80%ofthenitrogenexcretedbyapersonisexcreted
withtheurine,andtherestwiththefaeces.Hence,
intermsofnitrogenfertiliser,urineismoreimportant
thanfaeces.Forphosphorus,55%isexcretedwiththe
urine,therestwiththefaeces.
ÿ Adultsexcretethesamemassofnutrientsastakenup
intheirdiet,asthereisnoretentionofnitrogenand
phosphorusinthehumanbody,exceptforchildren
whereasmallamountisretainedforbonegrowth.
Techemicalcompositionoffreshandstored3urineis
summarisedinTable 1(see next page) andthefollowing
observationsarehighlighted:
ÿ Freshurinecontainsnitrogenmainlyintheform
ofurea;storedurinecontainsnitrogenmainlyinthe
formofammonium/ammonia(thetransformation
processisdescribedinSection 2.7.2).
ÿ Telowerphosphate,magnesiumandcalciumcon-
centrationsinstoredurinecomparedtofreshurine
areduetoprecipitationprocessesduringstorage.

2 Cap=capita=person
3 Storedurinemeansurinewhichiscompletelyhydrolysed
(Udertetal.,2003),andthistypicallyoccurswithin2-4weeksdepen-
dingontheamountofureasepresent(Maurer,2007).
12 12

























2.6.4 Micro-pollutants
Micro-pollutantsinurinecouldincludethefollowing
categoriesofsubstances:
1. Naturalhormones
2. Pharmaceuticalresidues,includinghormones
fromcontraceptivepill
3. Heavymetals
4. Persistentorganicpollutants(POPs)
Telasttwocategoriesofmicro-pollutants–heavymetals
andPOPs–arevirtuallynon-existentinurineastheywould
originatefromthefoodapersonhaseaten.Urineisanim-
portantpathwayforthebodytoeliminateorganicdegrada-
tionproductswhicharetoxictothehumanbody,butthese
substancesareeasilybiodegradablebysoilmicroorganisms
afterexcretion.Tefrsttwocategoriesofmicro-pollutants–
thenaturalhormonesandpharmaceuticalresidues–dooccur
inurineandcanbemanaged(see Section 2.7.3 and 3.2).

2.7 Urine treatment
2.7.1 Treatment objectives
Urinetreatmenthasthefollowingobjectives:
ÿ Pathogen kill(thisisthemainobjective):Collected
urinemaybecontaminatedwithfaecalpathogensif
carelessusersdepositfaecesintheurinecompartment
ofaUDtoilet(thisistermed“cross-contamination”of
urinewithfaecalmaterial).Asmentionedabove,pure
urineisvirtuallypathogen-free.
ÿ Otherpossibletreatmentobjectivesmayinclude:
„ Volumereductionbyevaporationorbyconversion
intosolidform(struvite)toreducetransportcosts.
„ Extraction(furtherconcentration)ofnutrients.
„ Eliminationofmicro-pollutants.
2.7.2 Treatment by storage
Tesimplest,cheapestandmostcommonmethodto
treaturinewiththeaimofpathogenkill,isextendedstorage
instoragetanks.
Storageofurineinaclosedtankorcontainer(notnecessarily
gastight)isanefcienttreatmentmethodforreducingpatho-
gensinurine:Tedecompositionofureaintoammonia/
ammoniumandhydrocarbonate–whichisfacilitatedbythe
naturalenzymeurease–leadstoanincreased pH value(pH
around9)whichhasasanitisingefect(meaningitkillspatho-
gens),sothatbacteria,parasiticprotozoa,virusesandintestinal
helminthsdieofovertime.Anenvironmentwithahightem-
peratureandlowdilutionwithwaterenhancesthisefect.
Timeitselfalsoleadstopathogenkill.
Safereuseofurineinagriculturecanbeensuredifthefol-
lowingrecommendedstoragetimesareused(fordetailssee
WHO,2006,Volume4):
ÿ Urineoriginatingfromlargersystems(communitylevel)
–wherecross-contaminationwithfaecescannotbe
ruledout–shouldbestoredforatleastonemonthif
itisusedonfoodorfoddercropswhichareprocessed.
Forahighersafetymargin,6monthsofstoragecanbe
used(inwhichcasetheurinecanbeusedonallcrops).
Butiftheammonialevelintheurineisgreaterthan
2mgN/L(whichitshouldbeforundilutedurine)then
shorterstoragetimeswillsufce(Winkeretal.,2008).
ÿ Nostorageisneededwhenurinefromownproduction
(orfromsystemswherecross-contaminationwithfae-
cesisdefnitelynotoccurring5)isusedforcropsgrown
forownconsumption.Tisisbecausediseasetrans-
missionwithinthehouseholdviatheurine-oralroute
ismuchlesslikelycomparedtoday-to-daycontactof
thehouseholdmembers.
2.7.3 Other urine treatment technologies
Advancedurinetreatmenttechnologiescanincludebio-
logicalprocesses(nitrifcation),chemicalprocesses(struvite
precipitation;ozonation)orphysicalprocesses(membrane-
based).Someofthesehigh-techmethods(suchasozonation
Parameter Freshurine Storedurine
pH 6.2

9.1
Total nitrogen, TN (mg/L) 8830 9200
Ammonium/ammonia-N, 460 8100
NH
4
+
and NH
3
(mgN/L)
Nitrate/nitrite NO
3
+ NO
2
0.06 0
(mgN/L)
Chemical oxygen demand, 6,000 10,000
COD (mg/L)*
Total phosphorus, TP (mg/L) 800 – 2000 540
Potassium, K (mg/L) 2740 2200
Sulphate, SO
4
(mgSO
4
/L) 1500 1500
Sodium, Na (mg/L) 3450 2600
Magnesium, Mg (mg/L) 120 0
Chloride, Cl (mg/L) 4970 3800
Calcium, Ca (mg/L) 230 0
* COD is a measure of the organic components.
Table1. Average chemical composition of fresh urine (literature
values) and stored urine (simulated values, see Udert et al. (2006))
4
.
Signifcant changes during storage are indicated in bold.
5 Forexamplewhenurineiscollectedfromwaterlessurinals. 4 Source:Maurer(2007)
13 13 andmembrane-basedprocesses)canremovemicro-pollutants
fromurine(seeLarsenandLienert(2007);Tettenborn
(2007)).Tisisusefultoknowifthereisconcernabout
micro-pollutantsinurine(see Section 3.2).
2.8 Are UD systems more cost effective?
Possiblecostsavingsofurinediversionsystemsmaybere-
latedtothefollowingaspects(ineachcase,oneneedstocon-
siderwhichsystemsarebeingcompared):
ÿ Ifacentralisedsewersystemandwastewatertreatment
plantcanbeavoidedbyusingUDtoilets,thencost
savingswillbesignifcant.However,thecollection
andtreatmentofgreywater, industrial wastewater
and rainwaterstillrequiresasewersystemofsome
sort(separate,decentralisedsystemsmayoftenbe
preferable).NotethattheremaininggreywaterinUD
systemscontainsafarlowerconcentrationofpatho-
gensandnutrientscomparedtoconventionaldomestic
wastewater.
ÿ Inregionswherewaterisscarceandexpensive,water
savingsfromUDtoilets(inparticularUDDTs)can
leadtooverallcostsavingscomparedtofushtoilets.
ÿ Inregionswheresoilfertilityispoorandfertiliserex-
pensive,farmersmayhaveproductioncostsavingsor
higheryieldswhenusingurineasafertiliserinsteadof
mineralfertiliserornofertiliseratall.
Regardingpotentialenergysavings,thisneedstobeanalysed
onacasebycasebasis.Energysavingsmaybepossiblewith
UDsystemsinthreeareas:
1. Ifthesystemissetuptouselesswater,energysavings
arepossiblewithrespecttopumping,processingand
distributionofthetapwater.
2. Energysavingsmaybepossibleatthewastewater
treatmentplant,whichreceivesalowerloadofnitro-
geninthesewageifurineiscollectedseparately
(hencelessoxygenrequiredfornitrifcationprocess).
3. Ifurinereplacesartifcialmineralfertiliser,thenener-
gysavingsarepossibleforfertiliserproductionaswell
asforfertilisertransport(mostAfricancountrieshave
nolocalmineralfertiliserproductionfacilities).
Alifecycleanalysis,comparingtheenergydemandfornutri-
entremovalandmineralfertiliserproductionversusnutrient
recoveryidentifedaconsiderableenergysavingpotentialwith
urinediversionnutrientrecovery(Maureretal.,2003).
Ontheotherhand,thefollowingaspectscanleadtoUD
systemshavinghighercoststhanconventionalsystems:
ÿ Incomparisonwithconventionalsewer-basedsanitation
systems,urinediversionsystemsusingUDfushtoilets
tendtohaveahigherinitialinvestmentcostastheyre-
quireadditionalcomponentsfortheseparatecollection,
transportandtreatmentoftheurineandfaeces.
ÿ AUDDTusuallyhasaslightlyhighercapitalcost
thanasimplepitlatrineor–ofcourse–thedo-noth-
ingoptionofopendefecation.
Adequatefnancingandoperatingschemeshavetobefound
thatensurefnancialsustainabilityandmakethesystemaford-
ablefortheusers.Furtherinformationisavailableinthefact
sheetoftheSuSanAworkinggroupon“costs and economics”
(http://www.susana.org/index.php/lang-en/working-groups/
wg02/documents-wg02).
2.9 Technical components used for achieving UD
Toachieveurinediversion,thefollowingtechnicalcom-
ponentsareused:waterlessurinals,urinediversiontoilets,
urinepipingtoaurinestoragetank(ortoasewer)anda
reusesystemfortheurine.Furtherinformationisprovided
inSections 4 to 6.
TerearetwomainvariantsofUDtoilets:UDDTs(urine-
diversiondehydrationtoilets-nofushwaterisusedatall)
andUDfushtoilets(waterisusedtofushthefaecesaway
andtorinsetheurinecompartment).
3 Reuse of urine as fertiliser
in agriculture
3.1 How to use urine as a fertiliser
Whensanitationprojectsaresetupwherecollectedurine
istobeusedasfertiliser,consultationwithfarmersandsoilfer-
tilityexpertsisessential,astheengineerssettingupthesanita-
tionprojectsusuallylackthenecessaryagriculturalexpertise.
3.1.1 Basic guidelines
Tebeneftsofurineasafertiliseranditsapplicationme-
thodshavebeenwelldocumented,forexampleinSuSanA
(2008),PUVeP(2008),Morgan(2007),WHO(2006)and
Jönssonetal.(2004).Somehighlightsfromthesedocuments
aresummarisedbelow.
Urineisaquickactingfertiliserthatcanbeusedforanycrops
whichrequirethemacro-nutrientsN,P,KorS(nitrogen,
phosphorus,potassiumorsulphur6).Tefertilisingefects
ofthesenutrientsinurinearethesameasthoseofartifcial
mineralfertiliserifthesameamountofnutriensisapplied.
Hence,reuseofurineinagriculturehasthepotentialtore-
ducedemandforartifcialmineralfertiliser.
6 Sulphurisanimportantmacro-nutrient,neededin
approximatelythesameamountasphosphorus,andoftenlacking.
14 14 Belowaresomerulesofthumbfortheuseofurineasaferti-
liserwithrespecttoitsnutrientcontent(takenfromJönsson
etal.(2004)andothers):
ÿ Urineisanitrogen-richcompletefertiliser,containing
alsosodiumandchloride.Tismakesitwellsuitedas
fertiliserforcropsthrivingonnitrogen(suchasmaize)
andespeciallyforcropsalsoenjoyingsodium,suchas
chard(similartospinach).Careshouldbetakenwhen
applyingitforcropssensitivetochloride(suchaspota-
toesandtomatoes),althoughyieldsofthesecropscan
alsobemuchimprovedbyappropriateurineapplication.
ÿ Ifallurinefromonepersoniscollected,itwillsufceto
fertiliseabout300-400 m²ofcropperpersonperyear,
e.g.producingforexample250kgofmaize(roughly
equaltothefoodintakeofonepersonperyear).
ÿ Applytheamountofurinethatonepersonexcretesin
onedayonone square metrepercroppingseason(this
meansapprox.1.5Lundilutedurinepersquaremetre).
Ifweassumethatthereis7gN/Linurine(typicalvalue
forSwedishconditions),then1.5Lurine/m2willcor-
respondto105kgN/ha,whichisalowtonormaldose
forcereals(dependingonthecountry,soilandexpec-
tedharvestfromthefeld).
ÿ Tecropyieldalsodependsverymuchonthesoil,and
urinewillalwaysworkbetterin“living soils”compared
tobarren,sandysoils.Tenitrogenconvertingbacte-
riamustbepresentandcomposthelpsenormously7.
Somerecommendationsforthemethodsonhowurineshould
beappliedasafertiliserare:
ÿ Betweenlastfertilisationandharvestaperiodofat
leastonemonthshouldalwaysbeapplied(forboth
largeandsmallscalesystems).
ÿ Tepersonapplyingtheurinetothefeldsshould
followgoodpersonalhygienepractices(thorough
handwashingafterapplyingtheurine,andifpossible
alsowearingglovesandboots).
ÿ Tebestnitrogenfertilisingefectisobtainedwhen
urineisappliedclosetothegroundanddirectlyincor-
poratedorwateredintothesoilinordertominimise
ammonialossestotheair.Inordertoavoidleaching,
andforclimateswithheavyrainfallorverysandy
soils,frequentapplicationofsmallamountsofurineis
favourablebutnotessential.Itisnecessarytobalance
maximumcropyieldwithwhatispracticalinreallife.
ÿ Urineshouldalwaysbeappliedtothesoilnext to the
plant(infurrows)butnot ontotheplant.Otherwise
itmightleadto“burning”oftheleaves.

Note:“We fertilise the soil, not the plant! ”.

3.1.2 Specifc advantages of urine compared to
other mineral fertilisers

AspointedoutbyElisabethKvarnström(StockholmEnvironment
Institute),oneofthegreatadvantagesofurineisthat“the content of
heavy metals and organic compounds is very low, as these only come from
the food which you have once consi dered having a high enough quality to
ingest. Artifcial mineral fertilisers can have a relatively high content of
heavy metals.”
Secondly,whenfarmersareabletousetheurinefromtheir
familiesandneighboursintheirownfelds,thisfertiliseris
essentiallyforfree(butifurinehastobetransportedovera
distancefromproductiontouse,therearetransportcosts).
Urinefertiliserisalsoindependentfromtheavailabilityand
priceofmineralfertiliserontheworldmarket.Furthermore,
urinecontainsmicro-nutrientswhichthesoilmayneedfor
highersoilfertility.
3.1.3 Disadvantages of urine compared to
other mineral fertilisers
Whilsturineisaprovenfertiliser,ithassomedrawbacks
comparedtoartifciallymanufacturedchemicalfertilisers:
ÿ Urineis,comparedtoartifcialfertilisers,adiluted
fertiliser:TeN,P,KandSconcentrationinurine
ismuchlowerthaninartifciallymanufacturedferti-
liser.Urine’snutrientcontent–expressedwiththein-
ternationalfertiliserconventionofN:P₂O₅:K₂O8–
isapproximately0.7:0.15:0.22–comparedtoforex-
ampledi-ammonium-phosphate(DAP)or(NH₄)₂HPO₄
withthecompositionN:P₂O₅:K₂Oof21:46:0.Tis
meansthatahugevolumeofwateristransported
wheneverurinefertiliseristransported.
ÿ Urinecontainstracesofpharmaceuticalresiduesand
hormones,andpotentialbuyersofcropsfertilisedwith
urinemaybeputofeveniftheactualhealthrisksare
extremelylow(see Section 3.2).
ÿ Urineisamulti-componentfertiliser,containingN,P,
KandSinaslightlyvariableratio,whichmayormay
notbetherightfertiliserforagivensoilandcrop.
Temacro-nutrientconcentrationsinurinemayvary
somewhat(althoughinrelativelynarrowranges),de-
pendingonpeople’sdietandwhethertoiletusersadd
fushwatertothetoilet.
ÿ Urineisaliquidfertiliser,whilstsomefarmersmay
preferasolidfertiliserifthisiswhattheyareusedto
(unlessurineisconvertedtostruvite,byadditionof
magnesiumandraisingpH,whichisalsoaproven
process).
8 Tismeans0.15%byweightofP₂O₅,or1500mg/LP₂O₅(mul-
tiply%valueby10,000).
7 Source:PeterMorgan,Aquamor,Zimbabwein2008
15 15 Tefollowingdisadvantagesarenotspecifctourineasa
fertiliserbutstillneedtobekeptinmind:
ÿ Likeotherfertilisers,urinecancauseplantfertiliser
burn(alsocalledleafscorch)ifnotappliedcorrectly.
Fertiliserburnisthevisiblesymptomofinsufcient
waterinaplantassociatedwithanoverapplication
offertilisersalts(saltsdissolvedinurine)9.
ÿ Urineaddssalinitytothesoilandthereforeitsuseas
fertilisertopotplantsisonlyrecommendedwhenthe
soilcaneasilybeexchanged.
ÿ Alsolikeotherfertilisers,urinecanleadtoground-
waterpollution(withnitrate)andnutrientrun-of
(resultingineutrophicationinwaterbodies)ifexcess
amountsareapplied.
ÿ Urineisamulti-componentfertiliser(withafxed
ratioofN,P,KandS)whichshouldonlybeapplied
untilthefrstnutrientreachesitsoptimumforthe
soil(probablynitrogenorsulphur).Otherwise(if
applieduntilphosphorusissufcientlysupplied)
itcancauseover-fertilisationofnitrogenandsulphur.
3.1.4 Should urine be applied undiluted
or diluted with water?
Urinecanbeappliedeitherundilutedordilutedwith
water,dependingonthesoilandthegardener’sorfarmer’s
preferences.Somegardenersdiluteurinewithwaterina
ratioof1:3,1:5orevenupto1:15,andthisdilutionhasthe
followingadvantages:
1. Reducesriskofplant“ fertiliser burn”(see previous
section).
2. Enablesirrigationandfertilisationinonestep(also
called“ fertigation”)andwithonepieceofequipment.
Butnozzlesofdripirrigationmayclogwhenaurine-
watermixtureisusedforfertigation.
3. Reducesodourduringapplication,especiallyifa
highdilutionratioisused(1:5orgreater).
4. Minimisestheriskofapplyingtoomuchfertiliser
topottedplants,asthepotwilloverfowbeforetoo
muchnitrogenisapplied.
Ontheotherhand,applyingurineundilutedhastheadvan-
tagethatasmallervolumeofanodorousliquidhastobe
handled.
Whenapplyingurineundiluted,fertiliserburnoftherootsis
avoidedbyaddingurineinfurrows,somewhattothesideof
theplants(approx.15cm).Odournuisanceisminimisedby
immediatelycoveringtheurinewithsoilaftertheurinehas
beenaddedtothefurrows.Usually,irrigationwaterisadded
directlyaftertheurineapplication.
3.2 Are hormones and pharmaceutical residues
in urine problematic for reuse?
TeinformationinthissectionisbasedonWinker(2009)
andtheinputfromArnoRosemarin(StockholmEnvironment
Institute).TepublicationofLarsenandLienert(2007)isalso
recommendedinthiscontext.
Hormonesandpharmaceuticalresiduesaretwotypesofmi-
cro-pollutantswhichoccurinurine(concentrationlevelsare
availableinWinker(2009)),ashumansexcretethemwith
theirurineandfaeces(asaruleofthumb:twothirdsofphar-
maceuticalresiduesubstancesareexcretedwiththeurine,one
thirdwithfaeces,althoughthefgurescanvarywidelyforin-
dividualsubstances10).
Ifurineisreusedinagriculture,someofthesemicro-pollu-
tantscanbetakenupbyplantsandtherebyenterthehuman
foodchain.Tisisarisk,butasmallone.Afullevaluationof
thepotentialtoxicefectsofpharmaceuticalsingestedbyhu-
mansviaurine-fertilisedcropsisverydifcultandhasnotyet
beendone.Tepotentialrisksfromconsumingcropsfertilised
withurineneedtobecomparedwiththerisksrelatedtopesti-
cideuseoncrops,aswellasantiobioticsandhormonesgiven
tofarmanimals(poultryandcattle)whichcanbetracedfor
exampleinmilkandeggs.Attheendoftheday,itcomesdown
toariskanalysisandriskmanagementstrategy.
Animalmanuresandsewagesludgecontainingpharmaceuti-
calresiduesandhormonesarealreadynowbeingusedonfelds.
Itwasshownthattheloadofhormonesandantibioticsin
humanurineisinfactmuchlowerthaninanimalmanure
(howevernotallgroupsofsubstancescanbecomparedin
thiswayastheyarenotallpresentinanimalmanure).With
sewer-basedsanitationsystems,thesetypesofmicro-pollu-
tantsarenotremovedinconventionalsewagetreatmentplants
andarethusdischargedintosurfacewaterbodiesandcan
reachthegroundwater(detectedconcentrationsofpharma-
ceutialresiduesingroundwaterareintheorderof50ng/Lin
severallocationsinGermany).
Whencomparingthetwoapproaches(dischargingurinewith
treatedwastewatertosurfacewaterversusurineapplicationto
soil),itislikelytobesafertodischargeurinetosoilrather
thanwater.Temicro-pollutantscanbedegradedbetterin
theaerobic,biologicallyactivesoillayers(highconcentration
ofmicro-organismspercubiccentimetre)withlongerresidence
timesthaninwaterbodieswhoseecosystemsaremuchmore
sensitive.Tishaspreviouslybeenproveninthecaseofhor-
mones11,andmoreresearchisneededtoproveitforother
typesofmicro-pollutantsaswell.
10 Tobemoreprecise:around70%ofpharmaceuticalsubstances
areexcretedviaurineaccountingfor50%oftheoverallecotoxicological
risk(LarsenandLienert,2007).Teecotoxicologicalriskofthefraction
ofpharmaceuticalresiduescontainedinurineandinfaecesisthesame
regardlessofthehighernumberofsubstancesexcretedviaurine.
11 Tisfndingisofparticularrelevanceregardingtheartifcial
hormoneswhichareexcretedinurinefromwomentakingthe
contraceptivepill.
9 Rootcellsactivelyabsorbfertilisersaltsfromsoilsolution,and
undernormalconditionsmaintainahigherosmoticpressure.Ifexcess
fertilisersaltsareapplied(i.e.concentratedurinewhichisnotdiluted),
theosmoticpressureofthesoilsolutionisraised.Tismeanswatercan-
notenterthecellandmayactivelymoveoutofit.Teresultinginjuryis
knownasfertiliserburnorphysiologicaldrought(RobertHolmer,
Ecosanresdiscussionforum,2008).
16 16 Terrestialsystems(soil)aremoresuitablefornaturaldegra-
dationofpharmaceuticalsthanaquaticsystemsbecause:
ÿ Teoxygenlevelsarearound50,000timeshigher
insoilthaninwater.
ÿ ExposuretoUVlighthelpstodegradepharmaceuti-
cals,althoughthisonlyappliestothesurface(1-2cm
soildepth)andcropscanshadetheground.
ÿ Tehighspecifcsurfaceofsoilparticlesmaximises
theexposureofadsorbedchemicals,maximisingthe
kineticsofdegradation.
ÿ Tewidebiodiversityofthefungalandbacterialfora
ofsoilisadaptedtodegradevarioustypesoforganic
molecules,bothcomplexandsimple.
Finally:“Drug residues in sustainable sanitation products used
to supply plant nutrients can hardly be a serious issue in regions
where malnutrition, groundwater and surface water pollution
due to inappropriate sanitation and irrigation with untreated
wastewater is a reality”12.
3.3 Is urine an “organic fertiliser” and
can it be used in organic farming?
Tedefnitionof“organic fertiliser”maybeaccording
totwodiferentcategories:
1. Organicintheanalytical chemistry sense(acom-
poundwhichcontainscarbonandmaycontainother
elementssuchashydrogen,oxygen,nitrogen).
2. Organicina“green”, “eco” or “natural”sense.
Freshurinecontainsureaandisthusanorganicfertiliserin
theanalyticalchemistrysense.Storedurinecontainsammo-
niaandnourea(see Section 2.6.3),andisthereforenotorganic
butrathera“mineral fertiliser”intheanalyticalchemistry
sense.Inotherwords:Urineisbothanaturalmineralisedor
mineralfertiliser,andanorganic,ecologicalornaturalferti-
liser13.
Te“organic farming”14regulationsdiferbetweencountries
withregardstowhichtypeoffertiliserisallowed(andisin
thiscontextcalled“organic fertiliser”).Forexample,countries
intheEuropeanUnionaresubjecttotheEUorganicfarming
legislation,whereurineisnot consideredanallowedfertiliser.
InChinaontheotherhand,urineisconsideredanaturalfer-
tiliserandthusallowedinorganicfarming.Makingurineal-
lowedfororganicfarmingintheEUremainsanimportant
challenge.Itshouldbepossibleasurineisanaturalfertiliser
withasimilarcompositionasforexamplepigurine.
4 Waterless urinals
Tischapterdrawsonthepublicationbyv.Münchand
Dahm(2009).Note:“waterless”means“without water”in
English.Somepeoplealsousetheterm“waterfree”.Wedonot
recommendanyparticularurinalmodelinthispublication.
4.1 Defnition and purpose
Aurinalisaspecialisedtoiletforurinatingonly,whichis
usedwhilestandingup,andisdesignedprimarilyformale
users.Urinalsarewidelyusedaroundtheworld,especiallyin
publicfacilitiesbeingfrequentedbyalargenumberofboys
andmen,becausetheysavespaceandcostscomparedtotoi-
lets(simplerdesign;noseparatecubiclesneeded,althoughin
manycasesseparationpanelsareinstalled).Urinalsarenot
commonlyusedinprivatehouseholdsduetotheiradditional
spacerequirements.
Alimitednumberofurinalsforfemales(tobeusedwhile
standingorsquatting)areonthemarketbuttheyarenot
widelyacceptedforvariousreasons,suchasfemaleshaving
greaterneedsforprivacyastheyhavetopartiallyundress.
Squatting-typeurinals(squattingpanswithoutanoutletfor
faeces)aresometimesusedforgirlsinAfricanorAsianprima-
ryschoolstosaveonspaceandcostscomparedtotoilets.
Conventionalurinalsarefushedwithapprox.4Lofwater
eitheraftereachuseorbasedonatimer,whereaswaterless
urinals(see Figure 1)usenowaterforfushing.
Temainmotivationforusingwaterlessurinalsisto:
1. Savewaterandhencecosts–theseurinalsare
connectedtoasewersystem.
2. Allowcollectionofpure,undilutedurineforusein
agricultureasanitrogenandphosphorus-richfertiliser
–theseurinalsareconnectedtoaurinestoragetank.
Waterlessurinalsarethefrstandeasieststeptowardsurine
diversionand,possibly,ecologicalsanitation(ecosan).











12 Source:JörnGermeronEcosanresdiscussionforum,
April2009.
13 Source:HåkanJönsson(onEcosanresDiscussionForum,De-
cember2008,http://www.ecosanres.org/discussion_group.htm)
14 Apossibledefnitionof“organic farming/agriculture”:Organic
agricultureisaproductionsystemthatsustainsthehealthofsoils,eco-
systemsandpeople.Itreliesonecologicalprocesses,biodiversityand
cyclesadaptedtolocalconditions,ratherthantheuseofinputswith
adverseefects.Organicagriculturecombinestradition,innovationand
sciencetobeneftthesharedenvironmentandpromotefairrelationships
andagoodqualityoflifeforallinvolved(source:International
FederationofOrganicFarmingMovement,http://www.ifoam.org/).
Figure 1. Waterless urinals for men. Left: Centaurus model of Keramag
company. Right: Plastic urinal from Addicom, South Africa, with EcoSmell-
stop device (sources: (left) E. v. Münch, Delft, 2006; right: Addicom).
17 17

4.2 Historical development of waterless urinals
In1894,Mr.BeetzfromAustriapatentedadrainage
device(trap)whichallowedurinalstobemade"fushless".Te
trapusedasealantliquid(themechanismisexplainedin
section 4.4.3).Tispatentwasthencommerciallyexploited
bythecompanyF.ErnstEngineerinZürich,Switzerland
whowasthesolesupplierofwaterlessurinalsworldwidefor
approximately100years.
Intheearly1990s,watersavingcameintofashionandseveral
companiesappearedonthemarketusingderivativesofthe
Beetzpatent.AtmoreorlessthesametimeHepworth,aUK
plumbingmanufacturer,patentedadrainagedevice(oneway
valve)whichwasinfactafattube.Asimilardeviceisused
insmallboatstodrainspraywaterfromthebilge.Derivative
patentsofthefattubeelementsareusedtodayinwaterless
urinalsandmarketedbyvarioussanitarywarecompanies,for
exampleKeramag(modelCentaurus).
In2002,aSwissengineerlivinginSouthAfrica(PeterDahm)
patentedaonewayvalvesimilartothefattubedesignbut
usinga“curtain”mechanisminordertoreducemaintenance
requirements.Tisunit,whichisnowusedinwaterlessuri-
nalsofseveralsuppliers,issoldunderthenameofEcoSmell-
stop(ESS).
Atpresent,Germanyisprobablythecountrywiththehighest
numberofwaterlessurinalspercapita,asthepriceofmunici-
paltapwaterinGermanyisoneofthehighestintheworld,
andGermansareconsequentlyveryinterestedinallwater-
savingopportunities(1,200waterlessurinalsofKeramagare
inuseinthepublictoiletsofHamburginGermany).
Waterlessurinalsarecommonlyusedinindustrialisedcoun-
triesforpublictoiletswhicharenotconnectedtothesewer
(suchasreststopsalonghighways).Itwouldbebenefcialif
theybecamewidelyusedindevelopingcountriesaswell.
4.3 Odour control methods (general)
Togainwideacceptance,waterlessurinalsmustmeetthe
acceptedstandardsapplicableforconventionalwaterbornein-
stallations.Teirodouremissionmustbelessoratworstequal
totheoldsystem.Toachievethisodour-freeperformancefour
aspectsareabsolutelycrucialforwaterlessurinals:
1. Suitablemechanismtoblocktheodourcomingback
fromthesewerandurinestoragetank,forexample
(discussedindetailinthesections below):
„ rubbertubeseal
„ curtainvalveseal
„ sealantliquid(blockingfuid)
„ plastictabletennisballplacedinafunnelwhich
isinsertedintheopeningofajerrycan;or

„ placeurinalinawellventilatedarea(locatedoutside
ofhouses),andputupwithsomeodour(maybe
possibleforruralareas).
2. Appropriatesurfaceoftheurinalbowl(smooth,
non-sticky,e.g.withwaxcoating).
3. Correctlydesignedinterrelationbetweenurinalbowl
andthedrainfttingtominimisecreviceswhere
urinecanaccumulate.
4. Onanoperationallevel:athoroughmaintenancere-
gardingthebowlandtheodourblockingdevice.Te
surfaceoftheurinalbowlisusuallywipedcleanonce,
twiceorseveraltimesperdaywithamoistsponge.
Fortheodourblockingdevice,themaintenance
dependsonthespecifcationsoftheurinalsupplier
(see below).
4.4 Odour control for connection
of urinal to sewer or storage tank
4.4.1 Rubber tube seal
Forthismethod,afatrubbertubeisused(Figure 2).
Tisrubbertubeisfatatthebottomwhennotinuse(and
henceblocksodourfromthesewerorurinestoragetank)
butopensupwhenurineisfowingthrough.Tisone-way
valveallowspassageofgritupto2mm.
Urineprecipitates(“urine stone”),whichsticktotherubber
tubeneedtobecleanedofwithwaterregularly(otherwise
thefatrubbertubedoesnotcloseproperlyanymore).Te
cleaningfrequencydependsonthenumberofusesperday
(cleaningoncepermonthunderaveragecircumstancesmay
besufcient).Terubbertubeneedstobereplacedaround
onceayear.Terubbermaterialissensitivetosolvents,acids,
anddeodorisingtabletsoftenusedinurinals.Terefore,the
useofacidsoraggressivecleaningagentsmustbeavoided.Tis
systemisusedforexamplebytheGermancompanyKeramag
intheirCentaurusmodel.
4.4.2 Curtain valve seal
Tecurtainvalvesealissimilartotherubbertubeseal,
butwasdesignedtoreducemaintenancerequirements.Tis
typeofone-wayvalvehas“self-cleaning properties”asasmall
pressurediferenceforcestheurinetowetthewholeinner
surfacebetweenthe“curtains”,thereforefushingthemclean.
Teelementisdesignedinamannertominimisebuild-upof
urineprecipitatesorurinesludgeandthuskeepingthesealing
surfacesclean.Likethefatrubbertubeseal,thisone-way
valvealsoallowspassageofgritupto2mm.

Tesiliconcurtainelementisintegratedintoaplasticcasing
(Figure 2).TeplacingoftheEcoSmellstop(ESS)element
intoaplasticsleevehastwopurposes,frstlytoguaranteethat
18 18 noodourfromthesewerorurinestoragetanksescapesinto
theroom,andsecondlytoallowaneasyremovaloftheESS
unitformaintenancepurposes.Forreplacementofthe
curtain(ifsimplecleaningisnolongerpossible),theentire
plasticcasingisremovedwithasmallplasticextractortool
(Figure 3),thendiscardedandreplacedwithanewESS.Tis
replacementprocessmaybenecessaryaboutonceperyear
andtakesonlyafewseconds.Itcanbeperformedwithout
havingtotouchtheESSelementbyhand.
TeESSmanufacturingprocessisnotsimpleastheinjection
mouldsareofextremecomplexity,andthemixingandinjec-
tionrequiresverysophisticatedmachinery.Forthisreason,it
isnotyetpossibletomanufacturetheESSlocallyindevelo-
pingcountries,butitcaneasilybeimportedasitissmall,
light-weightandlow-cost.TispatentedESSunitisusedby
thecompaniesAddicom,KellerinventAGandF.ErnstInge-
nieurAG15since2006.

4.4.3 Sealant liquid (blocking fuid)
Tissystemworkswithasealantliquid(alsocalledblock-
ingfuid)whichismadeofvegetableoilsoraliphaticalcohols
–theyarebiodegradableifreleasedtothesewerorurinestor-
agetank.Tesealantliquid,withaspecifcgravityofaround
0.8,foatsontopoftheurinecontainedinthetrapandthus
constitutesanefectiveodourbarrier.Urineimmediatelype-
netratesthesealantliquidandfowstothedrain.Urinepre-
cipitatesarecollectedinacartridgeorinnercylinderofthe
trap.Temaintenanceprogramofwaterlessurinalswitha
sealantliquidconsistsofcleaningoftheurinalbowl,and
theregularexchangeofthecartridge(orthesealantliquid,
see Figure 4).Terequiredexchangefrequencydependson
thenumberofusers.Witheachuseandinbetweenuses,
someurineprecipitatesaccumulatewhicheventuallyrenders
thetrapinoperative.Foreignobjects,suchascigarettestubs,
acceleratetheprocess.Atthispointthecartridgehastobe
cleanedorreplaced.
Ifthetrapstartstosmell,whileitisstillfreelypassingurine,
merelyarefllwiththesealantliquidcanresolvetheproblem
forsomedesigns.IntheUSA,thisiscurrentlythemostcom-
montypeofwaterlessurinal,asundercurrentlegislationonly
theseliquid-flledtrapsareapprovedforwaterlessurinals.

Figure 2. Two types of odour seals for waterless urinals. Left: Flat rubber
tube (Keramag Centaurus). Right: (left side) See-through pipe ftting;
(right side) see-through EcoSmellstop (ESS) unit showing the blue
silicon curtain one-way valve inside (source: (left) E. v. Münch, 2007;
(right) Addicom).
Figure 3. EcoSmellstop (ESS) unit with pipe ftting and extractor.
Inside the ESS is the silicon curtain valve (source: Addicom).
Figure 4. Example instruction sheet, showing replacement of sealant
liquid for Uridan urinals (other urinals with sealant liquid have a similar
maintenance routine) (source: Uridan).
19 19 Possibleadvantagesofsealantliquidsystemsinthecontextof
developingcountriesmayinclude:
ÿ Noneedtobeexchangedwhenfullwithprecipitates,
butcanbeeasilycleaned.
ÿ Afterbeingcleaned,theycanbereflledwithsome
thickcookingoil16(thisdoesnotlastaslongasthe
recommendedliquid,butisavailablealmostanywhere).
Tereisnoclearevidenceyetwhichofthethreesystemsdis-
cussedaboveisbetterforlow-cost,low-maintenanceapplica-
tions,andthismaydependonthepreferenceoftheindividu-
alsorcompaniesresponsiblefortheurinals’maintenance.
4.4.4 Other methods for the odour seal
Othermethodsforodourcontrolareonthemarket(see
also suppliers listing in Appendix).Oneexampleisthesystem
byUrimatwherethesealantliquidisreplacedbyafoat(hy-
drostaticfoatbarrier)whichismagneticallyactivatedthus
openingthechanneltotheoverfowchamber.Forlow-cost
applicationsindevelopingcountries,thissystemhasthedis-
advantageofahighercomplexitycomparedtothesystems
describedabove17.
Small-scalesimplesystemsmayutilisejustapipeorhose(with-
outanyodourtrap)connectingtheurinalwiththetank.Here,
theodourcanbecontrolledbyhavingtheurinepipe(flling
hose)goingdowntoalmostthebottomofthecollectionvessel,
thuscreatingaliquidsealinthecollectionvessel.Anotherop-
tionistopoursomecookingoilintothecollectionvessel,thus
creatingathinsealantflminthecollectionvesselitself.Acut-
ofcondomontheurineoutletpipehasalsobeenused.
Anotherverysimpleoptionforawaterlessurinalisthe“eco-lily”,
whereaplasticfunnelisinsertedintotheopeningofaplastic
jerrycan.Anoldlightbulboratabletennisballisplacedinto
thefunneltoactasodourseal(itshouldfoatupwhenurine
entersthefunnelbutcouldendupstickingtothefunnel).
Tedisadvantageofthelightbulbovertheplasticballisthat
thesolderandmetalcaponthelightbulbcontainsheavymetals
whichcancontaminatetheurine.
4.5 Further design information
Tespacerequirementofaurinalislessthanthatofatoi-
let,whichmakesthempopularforanyvenuewheremanymen
needtourinate(soccerstadiums,restaurants,schools,etc.).
Waterlessurinalsareusuallywallhunganddonotrequire
pipingforfushwaternorfushingdevices,thusallowinga
considerablecostsaving.Tefushingdevicesaswellasthe
traditionalwatertrapsintheoutletpiping(U,Por“bottle”
shaped)ofconventionalurinalstendtoattractaconsiderable
amountofvandalism(hencewaterlessurinalscanfurtherre-
ducemaintenancecosts).Waterlessurinalsdonotneedtobe
connectedtoasewerbutcanbeconnectedtoaurinestorage
tankinstead(importantforremotelocationsnotconnected
tosewers).Obviously,waterforhandwashbasinsandwater-
f lushedtoilets(ifnotreplacedbywaterlesstoilets)isstill
requirednexttothewaterlessurinals.
Materials
Urinalbowlsaretypicallymadeofacrylic,ceramic,stainless
steelorglass-fbrereinforcedpolyester,butcanalsobemade
ofsimplelow-costplastic,providedthatithasasmoothsur-
face(forodourcontrol).Self-constructionofinexpensive
waterlessurinalsisalsopossible.Whenusingplasticurinal
bowls,oneoptionistouselinearlowdensitypolypropylene
asitisoneofthemostinertplastics(non-sticksurfaces).Te
hotproductionprocessat180°Cguaranteesasmooth,non-
poroussurface,thereforeminimisingbacterialbioflmgrowth.
Converting water-fushed urinals to waterless urinals
Itisinprinciplealsopossibletoconvertconventionalwater-
fushedurinalstowaterlessurinals(dependingonthebowl
design),forexamplebyusingtheESS,whichisalsosoldasa
standaloneunit.Itisveryimportanttogetasnugftofthe
ESSintotheurinaldrain.
4.6 Use and maintenance of waterless urinals
Teinstructionsgivenbelowarenotforurinalsathouse-
holdsbutforinstallationsatinstitutionsorpublicplaces18.
Athouseholdlevel,diferentmaintenanceroutinesapplythan
thosedescribedbelowduetomuchlowerfrequencyofuse.
Teurinalbowlshouldbecleaneddaily,justlikeanyother
(water-fushed)urinal.Tereare100%biodegradableclea-
ningsolutionsonthemarketthataresimplysprayedonto
theurinalbowlandnotwipedof.Forexample,URIMAT
MB-AktivReinigerwithtensidesisusedforthe50waterless
urinalsintheGTZheadquartersinEschborn,Germany.

15 TecompanyF.ErnstIngenieurAGusedthesealantliquidsys-
tem(initswaterlessurinalsinstalledmostlyinSwitzerlandandGerma-
ny),butchangedovertotheEcoSmellstopsysteminOctober2006,and
isnowretrofttingallofitsapprox.100,000urinalswhichwereinstalled
priortothatdate(F.ErnstAGoperatesitsurinalsunderamaintenance
contractshouldtheclientnotdecideotherwise).
16 HakanJönsson:“the important properties of oil for this use are
density lower than water - most oils have a density around 0.7 kg/L - this
way it foats on urine; hydrophobic - maintains a lid above the urine and its
content; and both of these are shared by cooking oils. Cooking oils are partly
unsaturated and will thus oxidise faster and need replacement, but this is
secondary to them being generally available”.
17 HansKellerusedtorunthecompanyUrimatandhasthepat-
ents.ButhenowrunsKellerInventwhichboughtFErnstAG(hence
Mr.KellermovedfromhydrostaticfoatbarriertoESS).
18 Incountrieswithwide-spreadsewersystems,urinalsarenot
usedathouseholdlevel.Butincountrieswhereonsitesanitationiscom-
mon,waterlessurinalsathouseholdlevelareusedtogetherwithurinedi-
versiondehydrationtoilets.
20 20 Anytypeofodourseal(beitfatrubbertube,curtainsealor
sealantliquid)needstobecleaned(orreplacedifcleaningis
nolongerpossible)atregularintervalstokeepitfullyfunc-
tional.Tefrequencyofcleaningorreplacementoftheodour
sealsystemdependsmainlyonthenumberofusesperdayas
wellasuserandcleaningstafbehaviour(intermsofforeign
objectsdiscardedinurinal).Itcanthereforevarywidely,
rangingfromonceaweektoonceeverysixmonths.
TefatrubbertubeandESSunitscanbecleanedmanytimes
beforehavingtobereplaced.Somesealantliquidcartridges
cannotbecleanedbutneedtobereplacedwhentheyfail,
whilstforexampletheUridansystemcanbecleaned,and
thesealantliquidreplaced,anynumberoftimes.Togivean
example:AccordingtoinformationgivenbyAddicom,anESS
elementcanlastfor16monthswithcarefulmaintenance,such
assprayingtheurinalbowlregularlywiththecleaningagent
“DestroySmell ”(containingtensidesandactivemicroorganisms),
andremovingtheESSelementandrinsingwithdilutedcitric
acidtoslowdowntheformationofurineprecipitatesonthe
curtains.
Empiricalevidencegatheredinlow-incomesettingsinSouth
Africa(suchaspublicparksandtaxiranksinJohannesburg)
since2004suggeststhatthecurtainseal(ESSsystem)can
performwithless maintenance thanthefatrubbertube.In
regionswherediligentmaintenanceofurinalscannotbegua-
ranteed(suchaspublictoiletsininformalsettlementsinsub-
SaharanAfrica),theESSsystemmaythereforebeabetter
choiceofthetwo.Moreside-by-sidecomparisonsbetween
diferentwaterlessurinaltypesarerequired,particularlyfor
urban,low-incomeareasindevelopingcountrieswithapoten-
tiallyhighlevelofabuseandneglect.
4.7 User acceptance of waterless urinals
Experienceworldwidehasshownthatwaterlessurinalsen-
joythesamelevelofuseracceptanceaswater-fushedurinals
do,sinceforthemaleusersthereisnobehaviourchangere-
quired(manyusersdonotevennoticethattheyareusinga
waterlessurinal).Forthosemenwhoareshyanddonotlike
usingurinalsinpublicplaces(forlackofprivacy),itmakesno
diferencewhethertheurinaliswater-fushedornot.
Incultureswhereanalwashingwithwaterispracticed,each
urinalcanbeinstalledinacubicletoguaranteeprivacy.For
example,manyMuslimmaleswashtheirgenitalswithwater
afterurinating,whichrequireswatersupplyandseparatedrai-
nagefacilities.Priortoprovidingwaterlessurinals,onehas
toestablishwhetherthecommunityinquestioniswilling
toacceptsuchfacilities.Notealsothatinsomecultures
menareusedtosquattingwhenurinating.Waterlessurinals
couldbeplacedonthegroundinsteadofbeingwall-hung.
Insomeinstances,theremaybeapsychologicalbarrierofusers
orcleaningstaf(“if a urinal is not fushed it cannot be hy gie-
nic”).Tethoughtthatwaterisalwaysequaltohygieneisan
understandablemisconception.However,whenfacedwitha
well-functioning,odourlesswaterlessurinal,thosefearsare
quicklyalleviated,whichiswhydemonstrationprojectscan
beuseful.Today’swaterlessurinalsaredesignedtobeodour-
lessandsimpletomaintain.
Aswaterlessurinalsareanoveltyformanypeople,anysmell
emittedfromawaterlessurinalgetsblamedonthenewsystem.
Howeverasmellywater-fushedurinalisacceptedasnormal
astheyhavealongodoroushistory.Itisafactthatanytype
ofurinal(water-fushedorwaterless)willnotsmellifwell
maintained.Theextentofmaintenancerequiredforwater-
lessurinalscanbehigherorlowercomparedtowater-fushed
urinals,dependingonthetypeofwaterlessurinalused(as
explainedabove).
4.8 Suppliers and costs of waterless urinals
Tefollowingoptionsexistforbuyingwaterlessurinalsin
developingcountries:
ÿ Importedwaterlessurinalswithorwithoutpatented
odourcontroldevices
ÿ Plasticwaterlessurinalsmanufacturedlocallyand
importedESSelementorliquidsealinsertedfor
odourcontrol
ÿ Self-constructedwaterlessurinalsmadefromplastic
containers.
Forlowcostapplications,simpleplasticurinalsmaybeagood
option.Tesecanbeproducedina"rotationmoulding"pro-
cess.Tisisacheapandsimpleprocesstomakeasingle-skin
typeunit,whichcanbereplicatedinanycountry.
SupplierslistsforwaterlessurinalsareprovidedintheAppendix.
Forreferenceinstallationseithercontactthemanufacturersor
seethecasestudydescriptionsofsustainablesanitation
projectsonwww.susana.org.Manyoftheseprojectsincorpo-
ratewaterlessurinals.Photosofwaterlessurinalsarealso
availablehere:http://www.fickr.com/photos/gtzecosan/
sets/72157613881735035/
4.9 How to choose the right type of waterless urinal
Whenchoosingawaterlessurinalfromthelargerangeof
suppliersandmodels,thefollowingguidequestionscanbe
used(forwaterlessurinalsininstitutionsandpublicplaces19):
1. Dotheurinalsneedtobeascheapaspossible?
2. Dotheuserspreferceramicurinalsoverplasticurinals?
19 Note:Forwaterlessurinalsathouseholds,themaintenancecon-
siderationsarequitediferent.Householdswanttousemaintenancema-
terialsthatcanbefoundinageneralstoreataminimalcost.
21 21 3. Aretheurinalsavailablelocally(localdistributor)
ordotheyhavetobeimported?
4. Doesthesupplieroferyoutogetincontact
withthesuppliers’existingclients?
5. Doesthesupplierhavereferenceletters?
6. Howmanyunitshasthesuppliersoldalready?
7. Dotheurinalsneedsparepartsandcantheybe
obtainedlocallywithminimalwaitingtimes?
8. Istherelikelytobeanyvandalisminthelocation
wheretheurinalswillbeinstalled?
9. Whowilldothemaintenanceandwilltheybe
diligentorratherunreliable?
10. Afterhowmanyusesdoestheodoursealneed
replacement(orafterwhattimeperiod)?
11. Howlongdoeseacheventofodourseal
replacementtake?
12. Howdifcultistheodoursealreplacementroutine?
5 Urine diversion toilets
5.1 Defnition
Urinediversion(UD)toiletsaredesignedtonotmixurine
andfaecesatthepointofcollectioninthetoilet.Tereare
twomainmaintypesofUDtoiletsandbothtypescanbe
builtindoors:
1. Urine diversion dehydration toilets (UDDTs)
Nofushwaterisused.Tesetoiletsareoftencalled
“ecosan toilets”butthiswouldwronglylabelone
particulartoilettypeasthe toilettobeusedin
ecosanprojects.
2. UD fush toilets
Waterisusedtofushthefaecesawayandto
rinsetheurinecompartment.
Tesetoiletsmaybeimplementedwithinnewsanitation
systemsormaycomplementexistingsystems.Inanycase,
additionalpipeworksuchasapipefromthetoiletstothe
urinestoragetanksbecomesnecessary(see Section 6).
5.2 Basic design information for UD toilets
Carefulplanningandappropriatedesignisessentialfor
successfulapplicationofUDtoilets.Teyshouldbedesigned
orchosenbasedontheneedsandthecustomsoftheusers.
Tepreferredpostureoftheusercanbe:
ÿ Sitting toilets (withpedestals):
thesecanbewall-hungorfoormounted;or
ÿ Squatting toilets(withsquattingpans):manypeople
areusedtotoiletswhichareusedinasquattingposition.
Furtherdesignconsiderationswhichareimportantforalltypes
ofUDtoilets(detailsareprovidedinSection 5.3 and 5.4):
1. Dotheuserswashtheiranalareawithwaterafter
usingthetoiletsordotheyusetoiletpaper(“washers”
asopposedto“wipers”)?Tisiscustomaryinmany
MuslimandBuddhistculturesbutmayalsobelinked
tofactorsotherthanreligion.
2. Needsofdisabledpeople,elderly,childrenwhen
usingthetoilet
3. Specifcneedsoffemales
(menstrualhygiene;privacyandsecurityneeds)
4. Odourcontrolfortheurinecollectionsystem
5. Willthetoiletbeanindoororanoutdoortoilet
(indoorislikelytobecomethenorminthefuture
andispossiblewithUDtoilets)?
5.3 Urine diversion dehydration toilets (UDDTs)
TissectiononUDDTscontainsonlybasicinformation.
Formoreinformationonthisimportanttechnologyandits
operationandmaintenancerequirementssee:
ÿ TechnologyreviewonUDDTsbyGTZ
(http://www.gtz.de/en/themen/umwelt-infrastruktur/
wasser/9397.htm)
ÿ BergerandLorenz-Ladener(2008);Morgan(2007);
Austin(2006);Kvarnströmetal.(2006);Winblad
andSimpson-Hebert(2004)
TebeneftsofUDDTscomparedtopitlatrineswerelisted
inSection 2.3.2.
5.3.1 Basic design information
UDDTsdonotusewaterforfushing.Teyuseaverysim-
plesystemwheretheurineiscapturedinabowlwhichis
integratedinthefrontofthetoiletpedestalorsquattingpan.
Fromhere,theurineisdrainedoftoastoragecontainer.
Forthefaeces,astraightdrop(orchuteiftoiletsareonseve-
rallevelsinthehouse)isprovidedfromthetoiletpedestalor
squattingpantoacollectionvaultorbin.
Aventpipeisprovidedtoventilatethefaeceschamber,remove
odourfromtheroomandtospeedupthedryingprocess.
UDDTsarenot designedforcompostingtotakeplaceinthe
faecesvaultbutjustfordrying.
Inregionswherepeoplepractiseanalcleansingwithwater,a
thirdoutletholeisused,tocollectandtreattheanalwashwater
separatelyfromurineandfaeces(see Figure 5).Itisbestnot
tomixanalwashwaterwithurinetokeeppathogenlevelsin
theurineataminimum,ifurineistobeusedasa

fertiliser.

22 22 Teanalwashwatercanbeinfltratedinagravelflteror
treatedtogetherwithgreywaterinasubsurfaceconstructed
wetland.UDDTsareespeciallypopularwhereverthereiswater
scarcityandademandforcheapfertiliser.Teycanbebuilt
indoorsoroutdoors.




















5.3.2 Odour control for urine collection system
Anodoursealmaybeusedontheurinepipeifthetoilet
isindoors,especiallyinsystemswithmanytoilets(thesame
typesofsealsasforwaterlessurinalscanbeused,including
theESS(see Section 4.3)).SomeUDDTsevenhaveaninte-
gratedfan(suchasthetoiletofSeparett),whichremovesodour
fromboththefaecesbucketandtheurinepipe.Noseparate
odourblockingdeviceisnecessaryinthiscase.
ForoutdoorUDDTswithindividualurinestoragetanks,the
connectiontotheurinestoragetankisusuallydirect,with-
outanyodourtrappingdevice.Tefaeceschamberhasavent
pipetoremoveodourfromthetoilet,anddryadditivesassist
inodourcontrol.
5.3.3 Construction methods and materials
Possiblematerialsforthetoiletpedestalorsquattingpan
are:ceramic,concrete,acrylicorglass-fbrereinforcedplastic.
Tetoiletcaneitherbeself-constructedorprefabricated.
Metalcomponents(exceptforstainlesssteel)cannotbeused
sinceurineiscorrosive.
5.3.4 Use and maintenance
TemainoperationalrequirementwhenusingUDDTsis
thatthefaecesvaultiskeptasdryaspossible(noadditionof
urineorwater).Teurineandfaecescontainersneedtobe
emptiedwhenfull.
Coveringmaterialshouldbeaddedtothefaecesvaultafter
eachdefecation.Coveringmaterialcanbeash,sand,soil,
lime,leavesorcompostandshouldbeasdryaspossible.
Tepurposeofaddingcoveringmaterialisto:
ÿ reduceodour
ÿ assistindryingofthefaeces(tosoakupexcessmoisture)
ÿ preventaccessforfiestofaeces
ÿ improveaestheticsofthefaecespile(fornextuser)
ÿ increasepHvalue(achievedwhenlimeorashisused).
5.3.5 Project examples
UDDTsareusedinmanyruralandurbansustainable
sanitationprojectsworldwide.Teyhavebeeninstalled
athouseholds,schools,prisons,universitiesetc.andforpublic
toilets(seeforexampleSuSanAcasestudieson:
http://www.susana.org/lang-en/case-studies).
5.4 UD fush toilets
5.4.1 Overview on historical development
UDfushtoiletswereinventedinSwedeninthe1990’s
(Kvarnströmetal.,2006).Teywerefrstadoptedineco-
villagesandholidayhomes.Today,theyarealsousedinsome
housingprojectsandpublicbuildingsinseveralcountries
inEurope,althoughstillonlyatapilotscale.Adetailedstudy
(calledNOVAQUATIS)onUDfushtoiletswasconducted
byEawag,Switzerland(LarsenandLienert,2007).
5.4.2 Basic design information
TebeneftsofUDfushtoiletscomparedtofushtoilets
werelistedinSection 2.3.1.TeUDfushtoilethasaparti-
tioninthetoiletbowlisolatingabowlforurineinthefront,
andabowlforfaecesintheback.Tebowlissimilarto
bowlsusedforUDDTs,exceptthatfortheUDfushtoilet,
waterisusedtofushthefaecesaway.Tefushingmechanism
fortheurinepartisdesignedinoneoftwoways:
1. Teurinepipestaysopenandthereforereceivesa
certainamountoffushingwaterwhenthebowlis
fushed(see Figure 6);or
2. theurinepipeisclosedbyavalveandtherefore
receivesnofushingwater(thisisthecaseforthe
RoedigerNoMixtoilets).
Figure 5. left: Indoor UDDT (pedestal type) in Johannesburg, South
Africa in the house of Richard Holden (source: E. v. Münch, 2006).
Right: UDDT squatting pan in Bangalore, India, with three holes: the area
in the front is for anal washing, middle is for faeces and back is for
urine (source: D. Schäfer, 2008).
23 23 TeUDfushtoiletscanreducewaterconsumptioncom-
paredtoconventionalwater-fushedtoiletsbecausethewater
requiredforthe“urine fush”islessthantheamountforthe
“ faeces fush”.
UDfushtoiletscanalsobecombinedwiththeconceptof
vacuumtoilets(realisedforexamplebythecompanyRoedi-
gerforapilotprojectinBerlinStahnsdorfandbytheSwe-
dishcompanyWostManEcology,seeAppendix).Tistype
oftoiletcollectsurineandasmall,concentratedamountof
brownwater(faeceswithabout1Loffushwater).

5.4.3 Odour control for the urine collection system
Fortheurinepipe,severaltypesofodoursealsareusedby
thetoiletmanufacturers,suchasavalve(RoedigerNoMixtoi-
lets),aurine/waterseal(Gustavsbergtoilets)oranovelsilicon
seal(Dubblettentoilets).
OdourlocksintheUDtoilet’surinepipearerequiredtopre-
ventbackfowofodourintothetoiletroom;butthesearenot
necessaryinthecaseofshorturinepipesystemsofupto3-4m.
Forthefaecespart,odourcontrolisachievedbyawatersealin
aU-bend(justlikeforconventionalfushtoilets).
5.4.4 Materials
AsUDfushtoiletshavebeendesignedforusersinhigh-
incomecountries,theyhavebeenmanufacturedonlyincera-
micandhaveasimilarappearancetoconventionalfushtoilets.
5.4.5 Use and maintenance
TefaecessectionofUDfushtoiletsiscleanedinthe
samewayasforconventionalf lushtoilets(withabrush).
Toiletpaperisfushedawaytogetherwiththefaeces.
AparticularproblemfoundwiththeRoedigerNoMixtoilet
isthattoiletpaperthrownintotheurinalbowlisnotfushed
awaywiththesmallurinefush;andhencemorethanone
fushbecomesnecessary–negatingthewatersavingefectof
thistypeoftoilet20.
AnotherproblemoftheRoedigerNoMixtoiletisthatthevalve
ontheurinepipecangetblockedovertime.Inthiscase,urine
isnolongercollectedinthestoragetankbutfowstothefaeces
sectionofthetoilet,orthevalveisnotclosinganymorecausing
odourproblemsinthetoiletroom.Terefore,theuserneedsto
carryoutpreventativemaintenancebyaddingdilutedcitricacid
tothevalveoncepermonthforaperiodof24hours.
5.4.6 Project examples
UDfushtoiletsareusedinsomeindustrialisedcountries
andtheyarenotalowcostoption.Sofartheyaremainlyused
inSwedenandinsomeprojectsinGermany,theNetherlands,
SwitzerlandandAustria.
Twoprojectexamplesforwhichdetaileddescriptionsareavail-
ableare(bothonhttp://www.susana.org/lang-en/case-studies/
region/europe):
ÿ UrineandbrownwaterseparationattheGTZ
mainbuilding,Eschborn,Germany
ÿ Urbanurinediversion&greywatertreatment
system,Linz,Austria
5.5 Suppliers and costs for UD toilets
Informationonmodelsandsupplierscanbefoundin
theAppendix.Tecostsforsomeofthesetoiletsarerelatively
high,asthenumbersoldisquitelow.Ifthemarketforthese
typesoftoiletsgrowsandmoresuppliersenterthemarket,
thentheunitcostswilldecline.
5.6 How to choose between a UDDT
and a UD fush toilet
Forpro-poorapproachesindevelopingcountries,UDDTs
aremoresuitablethanUDfushtoilets,asthelatterstillrequire
areliable24-hourwatersupply,asewersystemandatreatment
processforthefaeces-watermixture(brownwater).
Incountrieswithexistinginfrastructureforwastewatertreat-
ment,theUDfushtoiletmaybecomecompetitivewiththe
conventionalfushtoiletinthefutureifthebeneftslistedin
Section 2.3aredriversfortherequiredswitch.
Figure 6. UD fush toilets. Left: Gustavsberg (in Meppel, the Netherlands);
Right: Dubbletten (in Stockholm, Sweden); (sources: E. v. Münch, 2007).
20 TeRoedigerNoMixtoiletisafrstprototypewhichrequires
furtherdevelopmentofitsdesign.
24 24 6 Urine piping and storage tanks

Acomprehensivedescriptionofthetechnicaldetailsfor
urinepipesandtanksisavailableinKvarnströmetal.(2006).
Somekeyconsiderationsareprovidedbelow.
6.1 Urine piping
6.1.1 Functional principles
Teurinepipingsystemconnectswaterlessurinalsorthe
urinesectionofaUDtoilettotheurinestoragetank.As
urinegeneratesaconsiderableamountofurineprecipitates
andsludge(see Section 2.4.4 for causes),specialattentionhas
tobepaidtothedesignandmaintenanceoftheurinepiping
system.
6.1.2 Materials
Urinepipeworkisnormallymadeofdurableplasticssuch
aspolyethylene(PE)orpolyvinylchloride(PVC).
6.1.3 Pipe size and layout
Tomaximisethefowrateoftheurine(andanysediments),
theinsidesofthepipesshouldbesmooth.Flowrestrictions,
suchassharp90ºbends,shouldbeavoidedasmuchaspossible.
Teminimumrecommendeddiameterofthepipesis50mm,
buttheoptimumrangeisfrom75mmto110mm.
Forlargersystems(severaltoiletsconnectedtooneurinetank),
theslopeofthepipeshouldbeatleast1%tominimiseurine
precipitation.Forindividualtoiletsystems,theslopeshould
beatleast4%,butcanbebuiltwithsmallerdiameterpipes,
downtoabout15mm.
Forinspectionandcleaning,thepipesshouldbemade
accessible(byprovisionofinspectionopenings).
Asaruleofthumb:keepurinepipesas short as possible
andwiththehighestpossibleslope.Horizontalpipesshould
notexceed200mbecauseoftheproblemsofsludgeaccu-
mulationinthecontinuouslywettedsideofthepipe21.
Overtimecrystalsandsludgemayaccumulateintheslow
fowinghorizontalpartsofthepipesystem,soperiodicfush-
ingmaybenecessary(onceeveryfewyearsinthebestcase;
morefrequentintheworstcase)22.
6.1.4 Odour control
Topreventodours,thepipingsystemshouldbeonly spar-
inglyventilated,pressureequalisationisenough(see Section 6.3
for more details on ventilation).Alsothepipeopeningneedsto
beimmersedintotheliquidinthestoragetank.Tisisparti-
cularlyimportantinlongventpipesthatcanactaschimneys
withupwardfowofair23.
Tismeansthattheincomingpipetotheurinestoragetank
shouldgodownalmosttothebottom,sothataliquidsealis
formedpreventingunduegasmovementthroughthepiping
system.Butitisnotrecommendtoplaceabucketatthebase
ofthispipe,asitmightfllwithsludgeandthusintroducea
fowrestriction.
6.2 Urine storage tanks
6.2.1 Functional principles
Teurinewhichiscollectedbymeansofawaterlessurinal
orbyaurinediversiontoiletfowstoaurinestoragetank.
Tesetankshavealidandareclosedtopreventodourandloss
ofnitrogenviaammoniagas.Tetanksareeitheremptiedby
theusersthemselves(small-scalesystems)oremptiedbyapump
andtruckarrangement.Teurineisthentransportedtothe
pointofagriculturalreuseortofurtherstorageortreatment.
Urinestoragetankshaveoneorseveralofthefollowingthree
mainpurposes:
1. Tobridgethetimeinbetweencollection/emptying
events.
2. Tosanitisetheurine:overtime,pathogensinthe
urinearekilledof(increasedpHduetoureaconver-
siontoammonia(see Section 2.7.2).
3. Tobridgeperiodswhereplantsarenotfertilised:Te
plants’needforfertiliserisnotconstantallyearround
(exceptinthetropics).Fertilisernutrientsaregenerally
onlyneededjustbeforesowingandinthebeginning
ofthegrowthperiod (see Section 3).
Terearetwotypesofurinetanks:thereceptorurinetankat
thetoiletandtheurinestoragetankforstorage,sanitisation
andreuse(thesefunctionscanberealisedinthesamevessel
orinseparatevessels).






21 Source:ArnoRosemarin(March2009)
22 HakanJönsson(March2009):“My fairly extensive experience is
that as long as there is at least a slope of 1% and the diameter is 75 mm or
more, then the sludge will fow out at the rate of generation and fushing is
not necessary. Te reason why extensive pipes should be avoided is that fre-
quently there has been problems with groundwater leaking into the pipes, di-
luting the urine! ”
23 Source:ArnoRosemarin,March2009,basedonexperiencewith
large-scaleurinediversionsystemwithindoorUDDTsinErdos,China.
25 25 6.2.2 Locations
Telocationoftheurinestoragetankscanbe:
1. At toilet level:Iftheurineistobeusedinthehouse-
holdgarden,asimpleplasticjerrycancanbeused.
2. At household/building level(severaltoiletstogether).
3. At community level(severalhousestogether)–
thisispossibleifdistancesbetweenhousesareshort.
Astheurinetanksmustbeemptiedregularly,suitableaccess
forpersonsorvehiclesisrequired.
Tetankscanbelocatedeitherinthecellarofthebuilding,
nexttothebuildingorbelowground.Urinetanksbelow
groundhavethedisadvantagethatleaksfromtheurinetank
aredifculttodetect(aleakingurinestoragetankcanlead
togroundwaterpollutionwithammoniaandnitrateorto
thetankbeingflledwithgroundwater).Undergroundtanks
havetheadvantageshoweverthattheyareusuallycheaper
tobuild,haveabetterinsulationinwinter(relevantforcold
climates)andtheaccesstothemanholeisusuallyalsoeasier.
Inthecaseofundergroundtanksitisimportanttotakethe
groundwaterlevelintoaccount–toavoidtanksfoatinginthe
eventofrisinggroundwater.
Whilstthetanksareclosedanddesignedtominimiseodour,
someodourcouldstilloccur.Hence,thetanksshouldbein
awell-ventilatedareaandawayfromkitchens,ofcesand
bedroomstominimiseodourcomplaints.
Asecondaryurinestoragetankatthefarmer’spremisesmay
benecessarytoenablethefarmerstoapplytheurinewhenthey
needit(Figure 8).
6.2.3 Materials
Urinestoragetanksneedtobecompletelywatertightto
avoidlossofurinefertiliser,groundwatercontaminationand
groundwaterentering.Teyaremostcommonlymadeofglass
fbrereinforcedplastic,PE,PPorPVC,buttheycanalsobe
madeofrubberbladdersorhigh-qualityreinforcedconcrete
(thereareafairnumberofconcreteurinetanksinSweden,
buttheyneedtobebuilttoahighstandardtoavoidleakages).
Metalcomponentscannotbeusedsinceurineiscorrosive(ex-
ceptforstainlesssteel,whichcouldbeusedbutisexpensive).
Plastictankswhicharesoldforrainwaterharvestingarealso
suitableasurinestoragetanks,andcanbeagoodsolutionin
developingcountries.
6.2.4 Urine tank size
Teurinetanksystemmaybesetuptouseonelargeurine
storagetankorseveralsmallertanks(evendowntousingalarge
numberof20Ljerrycans).Ineithercase,therequiredtotal
storagevolume(Vstorage)canbeestimatedasfollows(addi-
tionalsafetyfactorsmaybeapplied):
V
storage
=N
users
·p
urine
·t
storage
·f
timefraction
with:
N
users
=numberofusers
p
urine
=specifcurineproductionperperson
(~1.5L/cap/dofurineiftheuserisatthe
premises24hoursperday24)
t
storage
=desiredstoragetime25
f
timefraction
=fractionoftimethattheusersstaysatthe
premiseswherethetoiletis.
Terequiredstoragetime(t
storage
)wasalreadydiscussedin
Section 2.7.2).Forexample,typicaldesigncriteriaforasto-
ragetankare360Lofurineperpersonperyear(iftheyspend
2/3oftheirtimeatthepremises)andastoragetimeofone
month.
Itisobviousfromthisequationthatifurineisfushedaway
withwater,thenalargerurinestoragetankisrequiredcom-
paredtoatoiletwhereurineiscollectedundiluted.
Whendesigningthesizeoftheurinestoragetank,considera-
tionalsoneedstobegiventothecapacityoftheemptying
vehicle.Detailsonpossibleemptyingvehiclesinthelow-cost
contextareprovidedinSlob(2006).
Iftransportationoccursmanually,thecollectiontanks
shouldnotbelargerthan20Lwhichequals20kgwhen
full(thiswouldalreadybetooheavyfortheelderly,
femalesandchildren).
6.2.5 Number of urine tanks needed
Forpropersanitisation(tokillpathogensoriginatingfrom
cross-contaminationwithfaeces)itisimportantthattheurine
isstoredwithoutfreshurineenteringbeforeitisappliedin
agriculture.Hence,atleasttwotanksarerecommended(are-
ceptortankandastoragetank).
Forlargeinstallations,theuseofseveralurinestoragetanksis
advisablesothatonecanbetakenoutofserviceifnecessary.


24 PlusfushingwaterifUDfushtoiletsareused,unlesstheyhave
avalveliketheRoedigerNoMixtoiletmodel.
25 Tiscouldalsobethedesiredtimebetweenemptyingeventsif
sanitisationbystorageisnottheaim(forreceptortankwithadditional
storageelsewhere).
26 26

6.2.6 Urine overfow pipe
Installationofaurineoverfowpipeonthetankisnot
recommended,asthisincreasescostsandintroducesariskof
contaminationoftheurinewhenthereisanoverfoworblock-
ageintheordinarywastewatersystem.Also,ifthereisanover-
fowarrangement,usersmaybetemptedtojustlettheurine
overfowandnotensureitsuse.Itisbetterthattheurineis
pumpedtoanacceptabledisposalpointwithaportablewaste-
waterpumpifthecollectiontankbecomestoofull.
6.2.7 Examples
Examplesforurinestoragetanksofdiferentsizesare
shownbelow.

6.3 Ventilation for pressure equalisation
of pipes and tanks
Tepipeandtanksystemshouldonlybepressureequal-
ised(notventilated)whichisbestdonebyasmallholeinthe
tankforequalisationwiththeurinetankpressure.Tisal-
lowsthereplacementofheadspaceairbyurinefowinginto
thetank,andviceversawhenemptyingthetank.
Tereasonswhythepipesystemshouldnotbeventilatedare:
ÿ Toeliminateammoniaemissionsandodour.
ÿ Toreduceriskofsuckingtheliquidoutofanyliquid
urinesealsintheUDtoilets.
Aone-wayvalveorairadmittancevalveplacedatthetopof
theventpipecanalsobeagoodoption.Advantagesofsuch
avalveare26:
1. thatammoniaisnotemitted,
2. internalpressureisequalisedensuringproperdrainage
downwardstothetank(emptiedurinepipesmeanno
standingurineandlessprecipitation),
3. theinstallationcanbedoneinsidethebuildingjust
abovethetopfoorinthebuildingsothatthetopof
theventpipedoesnotneedtopenetratetherooflike
old-fashionedventilationpipes,
4. savesonconstructioncosts,
5. eliminatesproblemscausedbycondensationicein
coldclimatesandUVweatheringofplasticpipes.
Teseone-wayairvalvesarepopularinSwedenforgreywater
andurinesystems,andmanynewhousesnolongerhavepro-
trudingventpipes.
Teurinetankshouldnotbeopenedmoreoftenthanneces-
saryinordertopreventodourdevelopmentandammonia-
nitrogenlosses.Importantpointsconcerningthetank’s
ventilationsystemare:
Figure 7. Left: Low-cost solution: 20 L plastic jerrycan for urine storage at in-
dividual toilet level in Ouagadougou, Burkina Faso (source: E. v. Münch, 2006).
Note: it might be quite diffcult to lift up a full jerrycan out of this enclosure.
Right: Below-ground plastic urine storage tanks at Kullön, Sweden during the
construction process. The tanks will be covered with soil (photo: Mats
Johans son, source: Kvarnström et al., 2006).
Figure 8. Urine storage tank made of a 150 m³ plastic bladder at Lake
Bornsjön near Stockholm, Sweden (photo comissioned by: E. v. Münch,
2007).
Figure 9. Plastic urine storage tank in Ouagadougou, Burkina Faso as part
of the EU-funded project ECOSAN_UE led by CREPA (source: S. Rüd, 2008).
26 PostingbyArnoRosemarin(SEI,Sweden)onEcosanresdiscus-
sionforum,August2008.
27 27 ÿ Normallynoventpipeisneeded,providedthatthe
mainopeningisnotverytightlysealed.
ÿ Inplaceswhereodourcontrolisessential,asmall
diameterventpipecanbeusedforpressureequalisa-
tionofthetank.
ÿ Ifthetankisemptiedbyapump,provisionsshouldbe
madeforsufcientfowofairintothetank.Tispre-
ventsexcessivevacuuminthetank,whichcancause
tankimplosion.
6.4 Maintenance of urine pipes and tanks
Itisdifculttopredicthowfrequentlypre-emptivemain-
tenanceshouldbecarriedoutasthisdependsonlocalcircum-
stances.Trialanderrorwillleadtoanoptimisedcleaning
schedule.Experiencehasshownthatcorrectlyinstalledpipes
generallyneednocleaning,exceptfortheodoursealor90°
bends(whichshouldbeavoided).
Detailedinstructionsforcleaningandpreventingblockagesin
U-bendodoursealsareprovidedinKvarnströmetal.(2006),
fromwherethefollowingparagraphsaretaken:
“In all installations there is a risk of blockages occurring mainly
in the odour seal in the urine pipe. It is a result of fbres and other
particles entering the piping system and of chemical precipitation
of struvite and calcium phosphates from the urine caused by the
increase in pH which occurs when its urea is degraded. Te pre-
cipitation also forms a viscous sludge, which will slowly fow to-
wards the tank provided that the slope of the pipes is correct.
Most blockages that occur in urine-diverting toilets are soft block-
ages caused by precipitation on hair and paper fbre. Te other
type is hard blockages, caused by precipitation directly on the pipe
wall 27. Te blockages are removed either mechanically by a drain
auger or chemically by use of strong solutions of caustic soda
(2 parts of water to 1 part of soda) or acetic acid (>24%).”
Itisimportantthatthecleaningiscarriedoutwithoutafect-
ingthequalityoftheurineintheurinestoragetanksisnot
negativelyafected.
Iftheurinecanfowfreelyandimmediatelywithoutaddi-
tionsofwaterdirectlyafterurinationtothestoragetank,
thennoorveryfewblockagesinthepipewilloccur.
Atthebottomoftheurinestoragetankalayerofsludge
formsovertime(containingprecipitatesandcrystals–see
Section 2.4.4),withhighlevelsofnitrogen,phosphorus,
calciumandmagnesium.Ifthefullnutrientvalueofurine
istobeusedforfertiliserpurposes,thenitneedstobeen-
suredthatalsothebottomsludgelayerisemptiedandreused.
Incompleteemptyingwouldalsoresultinreducedavailable
storagevolume.
7 References
7.1 References used in this document

Austin,L.M.(2006)Guidelinesforthedesign,operationand
maintenanceofurinediversionsanitationsystems,Volume4,
ReporttotheWaterResearchCommission,WRCTT275/06,
SouthAfrica,
http://www2.gtz.de/dokumente/oe44/ecosan/en-guidelines-
urinediversion-sanitation-systems-2006.pdf
Berger,W.andLorenz-Ladener,C.(2008)Kompost-Toiletten
–SanitärtechnikohneWasser(inGerman).ÖkobuchVerlag,
StaufenbeiFreiburg,Germany(www.oekobuch.de).Tableof
contents:http://www2.gtz.de/Dokumente/oe44/ecosan/de-
TOC-ONLY-kompost-toiletten-ohne-wasser-2008.pdf
Cordell,D.,Schmid-Neset,T.,White,S.andDrangert,J.-O.
(2009)Preferredfuturephosphorusscenarios:aframework
formeetinglong-termphosphorusneedsforglobalfoodde-
mand.InternationalConferenceonNutrientRecoveryfrom
WastewaterStreams,Vancouver,Canada,May2009,
http://www2.gtz.de/Dokumente/oe44/ecosan/en-preferred-
future-phosphorus-scenarios-2009.pdf
EcoSanRes(2008)Closingthelooponphosphorus,EcoSan-
ResFactsheet4,StockholmEnvironmentInstitute,Stock-
holm,Sweden,http://www.ecosanres.org/pdf_fles/ESR-
factsheet-04.pdf

Jönsson,H.,RichertStintzing,A.,Vinnerås,B.andSalo-
mon,E.(2004)Guidelinesontheuseofurineandfaeces
incropproduction,EcoSanResPublicationsSeries,Report
2004-2,Sweden,www.ecosanres.org/pdf_fles/
ESR_Publications_2004/ESR2web.pdf
Kvarnström,E.,Emilsson,K.,RichertStintzing,A.,Johans-
son,M.,Jönsson,H.,afPetersens,E.,Schönning,C.,Chris-
tensen,J.,Hellström,D.,Qvarnström,L.,Ridderstolpe,P.and
Drangert,J.-O.(2006)UrineDiversion-OneStepTowards
SustainableSanitation.Report2006-1,EcoSanResProgramme,
StockholmEnvironmentInstitute,Stockholm,Sweden,
http://www.ecosanres.org/pdf_fles/Urine_Diversion_2006-1.pdf
Larsen,T.A.andLienert,J.(2007)Novaquatisfnalreport.
NoMix–Anewapproachtourbanwatermanagement.
Eawag,Dübendorf,Switzerland,www.novaquatis.eawag.ch/
publikationen/fnal_report_E
Maurer,M.(2007)Urinetreatment–absolutefexibility,
EawagNews,March2007,resultsfromNovaquatisresearch
project,Dübendorf,Switzerland,http://www2.gtz.de/
Dokumente/oe44/ecosan/en-urine-treatment-absolute-
fexibility-2007.pdf
27 Hardblockagestendtooccurwhenwaterismixedwithurine,
whereassoftblockagestendtooccurinpureurinesystems.
28 28 Maurer,M.,Schwegler,P.andLarsen,T.A.(2003)Nutrients
inurine:energeticaspectsofremovalandrecovery.Water
Science and Technology,48(1),p.37-46.Abstractavailable
here:http://www2.gtz.de/Dokumente/oe44/ecosan/
en-ABSTRACT-ONLY-nutrients-in-urine-energetic-
aspects-of-removal-and-2003.pdf
Morgan,P.(2007)ToiletsTatMakeCompost-
Low-cost,sanitarytoiletsthatproducevaluablecompost
forcropsinanAfricancontext,StockholmEnvironment
Institute,EcoSanResProgramme,Stockholm,Sweden,
http://www.ecosanres.org/toilets_that_make_compost.htm
Münch,E.v.andDahm,P.(2009)Waterlessurinals:apro-
posaltosavewaterandrecoverurinenutrientsinAfrica.34th
WEDCInternationalConference,AddisAbaba,Ethiopia,
May2009,http://www2.gtz.de/Dokumente/oe44/ecosan/
en-waterless-urinals-a-proposal-to-save-water-and-recover-
urine-nutrients-in-africa-2009.pdf
PUVeP(2008)Philippineallotmentgardenmanualwithan
introductiontoecologicalsanitation.PeriurbanVegetable
Project(PUVeP),XavierUniversityCollegeofAgriculture,
CagayandeOroCity,Philippines,http://puvep.xu.edu.ph/
publications.htmorhttp://www2.gtz.de/Dokumente/oe44/
ecosan/en-philippine-allotment-garden-manual-2008.pdf
Rosemarin,A.,Ekane,N.,Caldwell,I.,Kvarnström,E.,
McConville,J.,Ruben,C.andFogde,M.(2008)Pathways
forSustainableSanitation-AchievingtheMillennium
DevelopmentGoals.SEI/IWA.Availablefororderfrom:
www.ecosanres.org.Tableofcontentsavailablehere:
http://www2.gtz.de/Dokumente/oe44/ecosan/en-TOC-
ONLY-pathways-for-sustainable-sanitation-2008.pdf
Schönning,C.andStenström,T.-A.(2004)Guidelinesfor
thesafeuseofurineandfaecesinecologicalsanitationsys-
tems,EcoSanResPublicationsSeries,Report2004-1,
www.ecosanres.org/pdf_fles/ESR_Publications_2004/
ESR1web.pdf
Slob,M.(2005)Logisticaspectsofecologicalsanitationin
urbanareas.Casestudyinlow-incomecommunityinDelhi,
India.MScTesis,UniversityofTwente,TeNetherlands
andWASTE,Gouda,http://www2.gtz.de/Dokumente/oe44/
ecosan/en-logistic-aspects-of-ecological-sanitation-2005.pdf

SuSanA(2008)Foodsecurityandproductivesanitation
systems.FactsheetofSustainableSanitationAlliance,
www.susana.org/lang-en/working-groups/wg05/own-docs-05
SuSanA(2009)UrineandbrownwaterseparationattheGTZ
mainofcebuilding,Eschborn,Germany.Casestudyofsus-
tainablesanitationprojects.SustainableSanitationAlliance,
http://www.susana.org/lang-en/case-studies/region/europe
Tettenborn,F.,Behrendt,J.andOtterpohl,R.(2007)Re-
sourcerecoveryandremovalofpharmaceuticalresidues-
Treatmentofseparatecollectedurine.Finalreportofthe
demonstrationproject"SanitationConceptsforSeparate
TreatmentofUrine,FaecesandGreywater"(SCST).Institute
ofWastewaterManagementandWaterProtection,Hamburg
UniversityofTechnology,Germany,http://www.tu-harburg.de/
aww/publikationen/pdf/endbericht_tutech151009.pdf
Udert,K.,Larsen,T.,Biebow,M.,Gujer,W.(2003)Urea
hydrolysisandprecipitationdynamicsinaurine-collecting
system.Water Research37(11),p.2571-2582.
Udert,K.,Larsen,T.andGujer,W.(2006)Fateofmajor
compoundsinsource-separatedurine.Water Science and
Technology54(11-12),p.413-420,http://www.
iwaponline.com/wst/05411/0413/054110413.pdf
WHO(2006)WHOGuidelinesfortheSafeUseofWaste-
water,ExcretaandGreywater.Volume4:Excretaandgrey-
wateruseinagriculture.WorldHealthOrganisation,Geneva,
Switzerland,http://www.who.int/water_sanitation_health/
wastewater/gsuweg4/en/index.html
Winblad,U.andSimpson-Hébert,M.(2004)Ecological
Sanitation-revisedandenlargededition.StockholmEnvi-
ronmentInstitute,Stockholm,Sweden,www.ecosanres.org/
pdf_fles/Ecological_Sanitation_2004.pdf
Winker,M.(2009)Pharmaceuticalresiduesinurineandpo-
tentialrisksrelatedtousageasfertiliserinagriculture,PhD
thesis,TechnicalUniversityofHamburg-Harburg,Institute
ofWastewaterManagementandWaterProtection,Germany,
http://doku.b.tu-harburg.de/volltexte/2009/557
Winker,M.,Vinnerås,B.,Arnold,U.,Muskulos,A.and
Clemens,J.(2008)Newfertilisersfromadvancedwastewater
treatment:Teirpotentialvaluesandrisks.In:Proceedingsof
13thRAMIRANInternationalConference,Potentialfor
simpletechnologysolutionsinorganicmanuremanagement,
June2008,Albena,Bulgaria,http://www.tu-harburg.de/aww/
publikationen/pdf/winker_etal_fnal.pdf
29 29 7.2 Video clips
TefollowingvideoclipsareavailableonYoutube.com:
ÿ Manyvideosonwaterlessurinalscanbefound
by29enteringthekeyword“waterlessurinal”in
thesearchfeldofYoutube.com.
ÿ WaterlessurinalatUNESCO-IHEinDelft,
theNetherlands(2007):www.youtube.com/
watch?v=z0GKD3JAUOY
ÿ WaterlessurinalmaintenanceatUniversityof
Witwatersrand,Johannesburg,SouthAfrica(Addicom):
http://www.youtube.com/watch?v=nTa4yerQL1o
ÿ VideosonUDDTscanbefoundbyentering
“ecosantoilet”inthesearchfeld.
7.3 Additional photos
TeGTZecosanteamandpartnershaveuploadedalarge
numberofecosan-relatedphotostothephotosharingwebsite
Flickr.com:
ÿ Waterlessurinals:http://www.fickr.com/photos/
gtzecosan/sets/72157613881735035/
ÿ Urinediversiontoiletseatsandsquattingpans:
http://www.fickr.com/photos/gtzecosan/
sets/72157612793192986/
8 Appendix
Worldwide listing of suppliers for waterless urinals, UD
pedestals and squatting pans
TeAppendixisprovidedasaseparatefletokeep
theflesizeofthisdocumentlow.Itcanbedownloadedhere:
http://www.gtz.de/en/themen/umwelt-infrastruktur/
wasser/9397.htm
Wethankallsupplierswhohaveprovidedinformation
ontheirproducts.
30 30 Notes
31
Published by:
Deutsche Gesellschaft für
Technische Zusammenarbeit (GTZ) GmbH
Dag-Hammarskjöld-Weg 1-5
65760 Eschborn / Germany
T +49 6196 79-0
F +49 6196 79-1115
E info@gtz.de
I www.gtz.de
 
P r a c t i c e
Sustainable  Sanitation 
Issue 3. 04/2010
 
Experiences from use of urine in 
Arba Minch, Ethiopia 
 
Pharmaceutical Residues in 
Urine as Fertiliser  
 
Backyard urine recycling in the 
United States of America 
 
Food Security and Productive 
Sanitation‐ practical 
guidelines on the use of urine 
Opening minds and closing loops 
– productive sanitation 
initiatives in Burkina Faso and 
Niger 
partner of
Use of Urine
Impressum 
 
published by / Medieninhaber, Herausgeber und Verleger 
EcoSan Club 
Schopenhauerstr. 15/8 
A‐1180 Vienna 
Austria 
www.ecosan.at 
Editors / Redaktion 
Elke Müllegger, Günter Langergraber, Markus Lechner • EcoSan Club 
Journal Manager / Journal Management 
Isabelle Pavese 
Contact / Kontakt 
ssp@ecosan.at 
 
Disclaimer / Haftungsausschluss 
The content of the articles does not necessarily reflect the views of EcoSan Club or the editors and should 
not  be  acted  upon  without  independent  consideration  and  professional  advice.  EcoSan  Club  and  the 
editors  will  not  accept  responsibility  for  any  loss  or  damage  suffered  by  any  person  acting  or  refraining 
from acting upon any material contained in this publication. 
Die  in  den  Artikeln  vertretenen  Standpunkte  entsprechen  nicht  notwendigerweise  der  Haltung  und  Ansichten  des  EcoSan  Clubs  oder 
des  Redaktionsteams.  Der  praktischen  Anwendung  dargestellter  Inhalte  muss  eine  unabhängige  Begutachtung  und  professionelle 
Beratung  vorausgehen.  EcoSan  Club  und  das  Redaktionsteam  haften  in  keiner  Weise  für  Schäden  (Sachschaden  oder 
Personenschaden), die durch die Anwendung, oder Nichtanwendung der in dieser Publikation vermittelten Inhalte, entstehen. 
Reproduction / Reproduktion 
Permission  is  granted  for  reproduction  of  this  material,  in  whole  or  part,  for  education,  scientific  or 
development  related  purposes  except  those  involving  commercial  sale,  provided  that  full  citation  of  the 
source is given. Cover photo excluded. 
Die Reproduktion,  Übernahme und Nutzung der Inhalte von SSP, vollständig oder teilweise, für Bildungszwecke, für die Wissenschaft 
und im Zusammenhang  mit Entwicklung ist unter Voraussetzung  der vollständigen Quellenangabe gestattet und erwünscht. Titelbild 
ausgenommen. 
aim and scope / Offenlegung der Blattlinie gemäß § 25, Abs. 4 Mediengesetz 
Sustainable  Sanitation  Practice  (SSP)  aims  to  make  available  high  quality  information  on  practical 
experiences  with  sustainable sanitation  systems.  For  SSP  a  sanitation  system  is  sustainable  when  it  is  not 
only  economically  viable,  socially  acceptable  and  technically  and  institutionally  appropriate,  but  it  should 
also  protect  the  environment  and  the  natural  resources.  SSP  is  therefore  fully  in  line  with  SuSanA,  the 
Sustainable  Sanitation  Alliance  (www.susana.org).  •  SSP  targets  people  that  are  interested  in  sustainable 
sanitation  systems  and  the  practical  approach  to  it.  •  Articles  are  published  after  blind  review  only.  • 
Sustainable Sanitation Practice is published quarterly. It is available for free on www.ecosan.at/ssp. 
Sustainable Sanitation Practice  (SSP) hat zum Ziel praxisrelevante Information in hoher  Qualität im Zusammenhang mit „sustainable 
sanitation“ bereit zu stellen. „sustainable“ also nachhaltig ist ein Sanitärsystem für SSP wenn es wirtschaftlich machbar, soziokulturell 
akzeptiert,  technisch  als  auch  institutionell  angemessen  ist  und  die  Umwelt  und  deren  Ressourcen  schützt.  Diese  Ansicht  harmoniert 
mit  SuSanA,  the  Sustainable  Sanitation  Alliance  (www.susana.org).  •  SSP  richtet  sich  an  Personen,  die  sich  für  die  praktische 
Umsetzung  von  „sustainable  sanitation“  interessieren.  •  Artikel  werden  nur  nach  einer  Begutachtung  veröffentlicht.  •  Sustainable 
Sanitation Practice erschient vierteljährlich, kostenlos unter: www.ecosan.at/ssp. 
Information on the publisher / Offenlegung gemäß § 25 Mediengesetz 
publisher:  EcoSan  Club,  Schopenhauerstr.  15/8,  A‐1180  Vienna,  Austria  •  chairperson:  Günter 
Langergraber  •  website:  http://www.ecosan.at/  •  scope:  EcoSan  Club  was  funded  as  a  non  profit 
association  in  2002  by  a  group  of  people  active  in  research  and  development  as  well  as  planning  and 
consultancy in the field of sanitation. The underlying aim is the realisation of ecological concepts to close 
material cycles in settlements.  
Medieninhaber:  EcoSan  Club,  Schopenhauerstr.  15/8,  A‐1180  Vienna,  Austria  •  Obmann:  Günter  Langergraber  •  Gegenstand  des 
Vereins:  Der  EcoSan  Club  wurde  2002  als  gemeinnütziger  Verein  von  einer  Gruppe  von  Personen  gegründet,  die  in  Forschung, 
Entwicklung, Planung und Beratung in der Siedlungshygiene ‐ Sammlung, Behandlung oder Beseitigung flüssiger und fester Abfälle aus 
Siedlungen ‐ tätig waren und sind. Das Ziel des EcoSan Clubs ist die Umsetzung kreislauforientierter Siedlungshygienekonzepte (EcoSan 
Konzepte) zu fördern, um einen Beitrag zum Schutz der Umwelt zu leisten.  
 
Cover Photo / Titelbild 
© fotolia. http://de.fotolia.com 
 
Sustainable Sanitation Practice  2  Issue 3 /2010 
Editorial 
 
The SuSanA factsheet on "food security and productive sanitation systems" states that  
 
"The  nutrient  content  of  human  excreta  depends  on  the  diet  and  varies  between  countries  as  well  as 
between individuals. Excreta contain all essential micronutrients and an average amount of plant available 
macronutrients  of  4.5 kg/person/year  (kg/p/a)  for  nitrogen,  0.6 kg/p/a  for  phosphorus  and  1.2 kg/p/a  for 
potassium. Most plant nutrients are found in the urine with a formulation similar to ammonium and urea 
and comparable results on plant growth. A combined application of faeces and urine is advantageous, since 
faeces  are  a  very  good  soil  conditioner  due  to  its  high  share  of  organic  matter.  The  use  of  excreta  in 
agriculture  improves  the  pH,  the  nutrient  content  and  water  retention  capacity  of  the  soil  as  well  as  the 
ability of plants to withstand insects, parasite attacks and pests". (see www.susana.org) 
 
"Use  of  urine"  is  the  thematic  topic  of  the  third  issue  of  Sustainable  Sanitation  Practice  (SSP).  If  urine  is 
collected separately, treated and converted to agricultural usage, the biggest step towards nutrient reuse and 
highly efficient water protection is taken. 
 
The papers present various aspects on the use of urine: Practical experiences from the use of urine in Ethiopia, 
West  Africa  and  from  the  United  States  of  America  are  presented.  Findings  on  the  fate  of  pharmaceutical 
residues  in  urine  are  summarized  in  another  article.  The  final  contribution  gives  an  outline  on  updated 
guidelines on the use of urine that will be published during 2010. 
 
The  next  issue  (issue  4,  July  2010)  will  present  the  main  results  from  the  ROSA  project  (Resource‐Oriented 
Sanitation  concepts  for  peri‐urban  areas  in  Africa)  which  lasted  from  October  2006  until  March  2010  and 
proposed resources‐oriented sanitation concepts as a route to sustainable sanitation. ROSA was implemented 
in four pilot cities: Arba Minch in Ethiopia, Nakuru in Kenya, Arusha in Tanzania, and Kitgum in Uganda. 
 
Information on future issues is available from the journal homepage (www.ecosan.at/SSP) and will be regularly 
updated.  Please  feel  free  to  suggest  further  topics  for  issues  of  the  journal  to  the  SSP  editorial  office,  Ms. 
Isabelle  Pavese  (ssp@ecosan.at).  Also,  we  would  like  to  invite  you  to  contact  the  editorial  office  if  you 
volunteer to act as a reviewer for the journal. 
 
SSP  is  available  online  from  the  journal  homepage  at  the  EcoSan  Club  website  (www.ecosan.at/SSP)  for  free. 
We do hope that SSP will be frequently downloaded and further distributed to interested people. 
 
With best regards, 
Günter Langergraber, Markus Lechner, Elke Müllegger 
EcoSan Club Austria (www.ecosan.at/ssp) 
 
 
 
Content: 
- Opening  minds  and  closing  loops  –  productive  sanitation  initiatives 
in Burkina Faso and Niger ............................................................................................................................... 4
- Experiences from the use of urine in Arba Minch, Ethiopia ......................................................................... 12
- Are pharmaceutical residues in urine a constraint for using urine as a 
fertiliser?....................................................................................................................................................... 18
- Backyard  Urine  Recycling  in  the  United  States  of  America:  An 
Assessment of Methods and Motivations .................................................................................................... 25
- Food  Security  and  Productive  Sanitation;  Practical  guideline  on  the 
use of urine in crop production .................................................................................................................... 31
Sustainable Sanitation Practice  3  Issue 3 /2010 
 
Sustainable Sanitation Practice  4  Issue 3 /2010 
 
 
 
implementing 
organisation: 
Opening minds and closing loops – 
productive sanitation initiatives in Burkina 
Faso and Niger 
This paper shows how two agriculture funded sanitation projects in rural 
Niger and Burkina Faso have introduced sanitized urine and faeces as new 
fertilizers for improved local nutrient management, food security and health. 
Authors: L. Dagerskog, M. Bonzi
 
Abstract 
The link between food production and sanitation is at the centre of two agriculture funded sanitation projects 
in Burkina Faso and Niger. Productive sanitation is used to increase food security, based on the fact that urine 
and  faeces  from  a  family  of  ten  contain  nutrients  equivalent  to  approximately  100 kg  of  chemical  fertilizer, 
locally  worth  ~80 US$.  Urine  contains  the  main  part  of  these  nutrients  and  is  relatively  easy  to  collect  and 
reuse.  The  agriculture  extension  officers  have  a  key  role  in  supervising  participative  tests  with  urine  as  a 
fertilizer  that  help  create  demand  for  sanitation.  Farmers  are  trained  on  how  to  produce  liquid  and  solid 
fertilizers  from  urine  and  faeces,  by  eliminating  the  dangers  and  capturing  the  resources  via  the  good  use  of 
simple  urinals  and  “productive  toilets”.  The  article  describes  the  arguments  and  methodology  used  in  the 
projects and perspectives for up scaling in Burkina Faso and Niger. 
 
Introduction 
By emphasising the strong link between sanitation 
and  agriculture,  the  Regional  Centre  for  low  cost 
Water  and  Sanitation  (Centre  Régional  pour  l'Eau 
Potable  et  l'Assainissement  à  faible  coût,  CREPA) 
has  obtained  funds  from  the  agriculture  sector 
with  the  main  objective  to  improve  food 
production  in  rural  areas  via  the  promotion  of 
sanitized  urine  and  faeces  as  fertilizers.  The  two 
main productive sanitation projects at the moment 
are  the  ECOSAN_UE
2
  project  in  province  of 
Kourittenga,  Burkina  Faso,  and  the  PS‐Aguié 
project  in  the  province  of  Aguié,  Niger  (see  boxes 
at  the  end  of  the  article).  Urine  is  central  in  both 
projects,  since  it  is  relatively  easy  and  cheap  to 
collect  and  represents  a  substantial  and  often 
neglected source of nutrients. This article develops 
the  arguments  used  to  involve  the  agriculture 
stakeholders  and  the  methodology  and  current 
results of the two projects. 
Nutrient  management  and  the  link  to 
sanitation 
The big picture 
On  a  global  level,  the  price  hike  of  chemical 
fertilizers  in  2008  and  the  emerging  “peak 
phosphorous”  and  “peak  oil”  indicate  that  the  era 
of  cheap  chemical  fertilizers  is  coming  to  an  end 
(see  Cordell,  2010  for  details).  Since  there  is  no 
substitute for phosphorous in food production, our 
societies  will  need  to  improve  nutrient 
management  on  all  steps  along  the  productive 
cycle.  
 
The  agriculture  sector  is  trying  to  reduce  nutrient 
losses  from  soils  as  well  as  recycling  animal 
manure  and  plant  residues,  but  relatively  little 
effort  has  been  made  to  recycle  the  nutrients 
present  in  the  food  taken  away  from  the  field  for 
human  consumption,  and  subsequently  excreted 
Key actions for introducing sanitized urine and faeces as fertilizers: 
 Illustrative examples of the quantity of fertilizer in human excreta and results of reuse 
 Simple urinals for “liquid fertilizer” production and composting/dry latrines for “solid fertilizer” production 
 Involve the agriculture extension officers 
 Participative evaluation of urine as a fertilizer to create demand for productive sanitation 
 Sensitization on dangers and resources in excreta – and how to eliminate dangers and maintain the resources 
 Follow up on the whole productive sanitation chain i.e. collection, sanitization and reuse. 
Opening minds and closing loops – productive sanitation initiatives 
Sustainable Sanitation Practice  5  Issue 3 /2010 
N = 2.8 kg 
P = 0.45 kg 
K ~ 1.3 kg 
Consumed per 
person per year 
~ 500 l 
  urine 
~50kg 
  faeces 
Figure 1. The average annual fertilizer production per person 
N = 2.8 kg 
P = 0.45 kg 
K ~ 1.3 kg 
as  urine  and  faeces.  The  global 
phosphorous  flow  analysis  by  Cordell  et 
al.  (2009)  estimates  that  only  10%  of 
phosphorous  in  human  excreta  is 
recycled to arable soil, while 50% ends up 
in  water  and  40%  under‐ground  or  on 
non‐arable  soil.  These  losses  are 
equivalent  to  around  20%  of  the  annual 
phosphorous mined (Cordell et al. 2009).  
In the urine and 
faeces per 
person per year   
 
In  Burkina  Faso  and  Niger  chemical 
fertilizers  are  out  of  reach  for  most 
farmers,  while  a  growing  population  increases  the 
pressure on arable land. Table 1 shows the difficult 
soil  fertility  and  sanitary  situation  in  these  two 
countries  with  low  chemical  fertilizer  use,  high 
nutrient  losses  from  agricultural  land,  a  high 
percentage of open defecation in rural areas and a 
high  number  of  child  deaths  per  year  due  to 
diarrhoea.  
 
Safe recycling of urine and faeces can help improve 
both  food  production  and  health,  but  the  farmers 
are  rarely  aware  of  the  possibilities  of  how  to 
“eliminate  the  danger”  and  “use  the  resources”  in 
human excreta.  
 
Table 1. Challenges with soil fertility and 
sanitation in Burkina Faso and Niger 
* NPK = N+P
2
O
5
+K
2


Morris et al (2007) 

Henau and Baanante (2006) 

UNICEF/WHO (2008)
 

UNICEF/WHO (2009) 
 
 
 
The fertilizer value of human excreta
To  capture  the  attention  of  agriculture 
stakeholders  it  is  important  show  that  human 
excreta  contain  a  substantial  amount  of  plant 
nutrients. According  to  Jönsson  et  al.  (2004)  the 
amount  of  nitrogen  and  phosphorous  in  human 
excreta  can  be  calculated  from  protein 
consumption.  There  is  an  equilibrium  over  the 
human  body  ‐  what  comes  in  sooner  or  later  also 
comes  out,  except  during  growth  when  a  minor 
part of consumed plant nutrients is incorporated in 
growing  body  tissue.  Dagerskog  (2007)  used  the 
method  proposed  by  Jönsson  et  al.  (2004)  and 
statistics on protein consumption (FAOSTAT, 2005) 
to estimate the human fertilizer production for the 
ten countries in West Africa concerned by CREPA’s 
ECOSAN  program:  Benin,  Burkina  Faso,  Congo, 
Côte  d’Ivoire,  Guinea,  Guinea  Bissau,  Mali,  Niger, 
Senegal  and  Togo.  An  average  person  in  these 
countries  excretes  annually  2.8  kg  of  nitrogen  (N), 
0.45  kg  of  phosphorous  (P)  and  approximately  1.3 
kg  of  potassium  (K)  with  the  urine  and  faeces 
(Figure 1). 
 
This  regional  average  was  used  to  illustrate  the 
value  of  human  excreta  in  Burkina  Faso.  The 
annual  quantity  of  N  and  P  in  urine  and  faeces 
from  a  family  of  ten  persons  corresponds 
roughly  to  the  quanitity  of  N  and  P  in 50  kg  of 
urea  and  50  kg  of  NPK(14‐23‐14)  which  are  the 
two  most  common  chemical  fertilizers  in 
Burkina Faso (Table 2). 
Burkina 
Faso  
Niger  
Chemical fertilizer use  
1996‐2002
1
 (kg NPK*/ha/yr) 
5.9  0.9 
Estimated nutrient balance  
2002‐2004

(kg NPK*/ha/yr)  
‐ 43  ‐ 56   
The local market price of 50 kg of Urea and 50 
kg  of  NPK  in  Burkina  Faso  is  about  80 US$ 
(SOGEDIF,  Feb.  2010).  The  total  Burkinabè 
population  of  ~15,6  million  inhabitants  then 
excrete  the  equivalent  of  125  million  US$ 
worth of fertilizers per year. In addition, urine and 
faeces are complete fertilizers, containing the main 
plant  nutrients  (N,  P,  K)  as  well  as  the  important 
trace elements and organic matter. 
Open defecation in rural areas 
in 2006
3
 (%) 
83  92 
 
Table 2. The annual quantity of nutrients in the 
excreta from 10 persons compared with chemical 
fertilizer 
Annual child deaths due to 
diarrhoea
4
 
24 300  26 400  
Fertilizer  N (kg)  P (kg)  K (kg) 
28  4.5  13 
Urine et faeces from 10 
persons in one year 
30   4.9  7 
50 kg of urea and 50 kg of 
NPK(14‐23‐14)  
 
Opening minds and closing loops – productive sanitation initiatives 
Sustainable Sanitation Practice  6  Issue 3 /2010 
Comparing urine and faeces as fertilizers

Figure 2. Two bags of fertilizer were brought along 
for sensitization sessions in Niger to illustrate the 
annual amount of nutrients that are present in the 
excreta from one family  
The  distribution  of  plant  nutrients  between  urine 
and  faeces  depends  mainly  on  the  digestibility  of 
the food. In general the absolute majority of N and 
K  are  excreted  with  the  urine  while  P  is  more 
evenly  distributed  between  urine  and  faeces  (see 
Jönsson  et  al.  2004  for  details).  Faeces,  rich  in 
phosphorous  and  organic  material,  are  a  suitable 
base  fertilizer  while  the  nitrogen  rich  urine  is  a 
suitable cover fertilizer. 
 
The  baseline  study  for  the  project  in  Aguié,  Niger, 
showed that defecation is mostly done in the fields 
around  the  villages,  while  the  shower/ablution 
area  is  the  preferred  place  for  urinating  (CREPA, 
2009). In this situation, a better urine management 
would  make  the  greatest  difference  to  the  local 
nutrient  recycling.  However  this  does  not  mean 
that open defecation should be encouraged for any 
reason. While defecating in the fields can bring the 
nutrients  in  faeces  back  into  the  productive  cycle, 
it  is  a  health  hazard  and  a  sub‐optimal  way  of 
recycling as it is not applied at the place, time and 
dose to optimize plant growth.  
Results and project experiences 
Introducing the new fertilizers ‐ methodology 
Both projects have followed a similar methodology 
when  introducing  sanitized  urine  and  faeces  as 
fertilizers. The methodology is based on how other 
new  fertilizers  are  usually  introduced,  via  practical 
participative tests: 
 All  concerned  stakeholders  are  informed  on  the 
new  fertilizers,  showing  the  experience  from 
CREPA’s  ECOSAN  projects  in  West  Africa  and 
photos  from  other  projects  around  the  world. 
The  population  is  sensitized  on  the  amount  of 
fertilizer  they  produce  (Figure  2)  and  the  local 
agriculture extension officers are trained. 
 Urine  collection  starts  via  simple  urinals  (jerry 
can and a funnel) to enable tests with the locally 
produced “liquid fertilizer”. 
 Participative  tests  are  done  to  demonstrate  the 
virtue  of  urine  as  a  nitrogen  fertilizer  (urine 
compared to urea) at farmer field schools and on 
individual fields. 
 Participative evaluation of the test plots. 
 Training of village facilitators and artisans. 
 Sensitization  in  the  villages  using  SARAR/PHAST 
tools  for  understanding  the  dangers  as  well  as 
the  resources  in  human  excreta  and  on  how 
good  use  of  latrines  and  urinals  can  help 
Table 3. The scale at local level of the two projects
 
ECOSAN_UE2,  
Kourittenga, Burkina Faso 
PS‐Aguié 
Aguié, Niger 
Number of villages involved:  30  11 
Vegetable farmers : 
366 farmers trained on urine application 
methods 
25 farmers involved in participative 
tests, 22 others applied urine on own 
initiative 
1255 farmers tested urine in 30 farmer 
field schools, 500 have done tests on own 
initiative  
122 farmers tested urine in eight 
farmer field schools, 65 have done 
tests on own initiative 
Cereal farmers: 
29   10 
Agriculture extension officers 
trained: 
A total of 5,7 ha for cereal tests in farmer 
field schools (half with urine) and 27 ha for 
individual tests (with and without urine). 
A total of 0,7 ha for cereal tests in 
farmer field schools (half with urine) 
Surface fertilized:  
?  > 125 m3 during 2009  Urine collected : 
318 (712 toilets still to construct) 
150 (another 60 toilets under 
construction) 
Households producing solid 
fertilizer via toilets:  
2000  1143  
Households producing liquid 
fertilizer via urinals: 
 
Opening minds and closing loops – productive sanitation initiatives 
Sustainable Sanitation Practice  7  Issue 3 /2010 
UDDT with adobe superstructure 
Urine separation integrated on the slab
Urinal dug down for squatting
Figure 3. UDDT and urinal in Kourittenga, Burkina Faso    
The composting toilet with urine diversion  Urine can either be transferred from a pot to the 
jerry can or enter directly. Dug down it is adopted 
for the squatting position 
The dry toilet in local 
material except the slab 
and vent pipe. 
Figure 4. Urinals and toilets in Aguié, Niger 
eliminate the dangers and capture the resources. 
 Construction  of  fertilizer  factories  (latrines)  that 
enable the production of “solid fertilizer” as well 
as “liquid fertilizer”. 
 Follow  up  on  the  whole  productive  sanitation 
chain i.e. collection, sanitization and reuse. 
 Use inter‐village visits to spread the message. In 
Niger  the  first  pilot  farmers  were  taken  on  a 
study  trip  to  exchange  and  train  with  farmers  in 
Burkina Faso. These first pilot villages were then 
visited by other villages in the province. 
Scale 
The  two  projects  operate  on  a  limited  scale,  but 
serves  as  references  for  further  productive 
sanitation  initiatives  in  Burkina  Faso  and  Niger. 
Table  3  provides  a  summary  of  the  scale  of  the 
two projects. 
Production of liquid and solid fertilizer 
In both projects urine collection was soon started 
using  simple  urinals.  After  the  urine  tests  as 
fertilizer and sensitization sessions on the dangers 
and  resources  in  excreta,  the  latrines  were 
introduced.  In  Kourittenga  it  was  decided  to  opt 
for the urine diverting dry toilet (UDDT), and build 
solid  double  vaults  with  cement  bricks  with  a 
180 US$ subsidy (Figure 3). 
 
In  Aguié,  all  pilot  village  households  got  the 
simple  urinal,  and  were  then  offered  a  choice 
between  a  low  cost  UDDT  (called  “dry  toilet”  in 
Aguié)  and  a  UD  Fossa  Alterna  (called 
“composting  toilet”  in  Aguié)  (Figure  4).  The  dry 
toilet is built off the ground and faeces is sanitized 
by  desiccation  together  with  ash,  while  the 
composting  toilet  is  a  shallow  pit  toilet  were 
sanitization  is  enhanced  by  composting  through 
the addition of organic material and some ash after 
defecation.  All  toilets  have  two  vaults/pits  used 
alternately. 
 
Both  models  were  subsidized  with  around  50   US$ 
to cover the imported materials and mason fee for 
the  vaults/pits.  The  composting  toilet  has  been 
very popular – no roof is needed, no stairs and the 
anal  wash  water  can  enter  the  pit.  A  study  by 
Djariri  (2009)  showed  that  it  would  be  possible  to 
decrease  the  subsidy  part  to  30 US$  with  some 
technical  modifications.  This  is  approaching  IFAD’s 
aim  of  a  maximum  subsidy  of  20   US$  per 
installation.  
 
Storing large volumes of urine is expensive and can 
be  difficult.  In  Aguié  the  farmers  are  advised  to 
enrich  their  compost  or  “dirt  pile”  or  apply  the 
urine  to  the  field  even  during  the  dry  period 
(covered  with  soil)  if  they  run  out  of  storage 
possibilities.  
Urine quality 
In  Niger  the  urine  was  sampled  during  four 
different  occasions  and  analyzed  with  the  results 
presented in Table 4 : 
 
Opening minds and closing loops – productive sanitation initiatives 
Sustainable Sanitation Practice  8  Issue 3 /2010 
Table 4. Results from analysing agronomic parameters in Aguié urine
Figure 5. Urine transport and application in Kourittenga
The  urine  is  especially  rich  in  nitrogen,  and  in  the 
higher  range  of  the  3‐7 g N/l  given  as  indicative 
values in Jönsson et al. (2004). It can also be noted 
that  sodium  concentration  is  much  higher  than 
magnesium  and  calcium.  In  irrigation  water  where 
the concentration of sodium salts is high relative to 
other types of salt, a sodic soil may develop, which 
is characterized by a poor soil structure: they have 
a low infiltration rate, they are poorly aerated and 
difficult  to  cultivate  (FAO,  1985).  Even  though  the 
salt  concentration  is  quite  high  in  urine,  the  total 
salt  quantity  applied  per  year  is  not  high  when 
compared  to  irrigation  water.  However  salinity  is 
complex  and  further  research  on  urine  use  and 
salinity  would  be  welcome  to  avoid  long  term 
problems. 
 
Laminou  (2009)  followed  the  volume  of  urine 
generated  from  10  men,  10  women  and 
10 children  (ca.  10  years  old)  in  two  villages  in 
Aguié. On average the men produced 1.7 l/day, the 
women  1.9  l/day  and  the  children  0.9  l/day.  With 
50% of the population under 15 years, the average 
daily  urine  production  would  be  about  1.35  litres 
per person. Using the concentrations in table gives 
that the average person in Aguié urinates annually 
~  3  kg  N,  0.4  kg  P  and  0.45  kg  K  with  the  urine, 
which  is  higher  than  expected,  except  for 
potassium.  It  should  be  noted  though  that  the 
study  was  made  just  after  harvest  time  when 
people have plenty to eat.  
 
Laminou  (2009)  also  analyzed  the  sanitization  of 
urine after 30 days of storage, and found no micro‐
organisms  except  for  anaerobic  sulphite  reducers 
that  were  present  in  3  out  of  9  samples. 
Clostridium Perfringens is one bacteria of this type 
that  can  cause  food  poisoning.  However,  the 
infective  dose  is  quite  high  and  clostridium  is 
frequently  present  in  the  intestines  of  both 
humans and animals and also widely distributed in 
the  environment  due  to  its  spore  forming 
capability (FDA, 2009). 
Application of urine in agriculture 
In  Kourittenga,  urine  tests  were  done  on  a 
relatively  large  scale.  To  facilitate  application,  the 
furrows  were  opened  and  closed  using  animal 
traction  and  the  urine  was  poured  directly  from 
the jerry cans (Figure 5).  
 
In  Aguié,  the  preferred  application  method  has 
been with a bucket and cup. The urine in Aguié was 
dosed  to  give  the  same  nitrogen  quantity  as  the 
locally  recommended  dose  for  urea.  With  a  urine 
concentration  of  about  5  g N/l  and  with  urea 
containing  46%  N,  10  grams  of  urea  corresponds 
roughly to 1 litre of urine. After the application it is 
important  to  water  down  thoroughly,  or  wait  to 
apply  until  after  a  rain.  Some  farmers  have  had 
problems  with  wilting  plants  after  urine 
application,  especially  young  tomato  plants.  A 
solution  has  been  to  avoid  application  during  the 
hottest  part  of  the  day  and  to  reinforce  watering 
the  two  following  days  after  application.  For 
cereals,  urine  application  has  been  made  after  a 
good rain when the soil is humid.  
In  both  projects  the  local  agriculture  extension 
officers  have  been  supervising  the  participative 
tests. 
 
Parameter  
(n=number of jerry cans analysed) 

(n=37) 

(n=33) 

(n=28) 
Na  
(n=9) 
Mg 
(n=3) 
Ca 
(n=3) 
pH 
(n=29) 
Unit  g/l  g/l  g/l  g/l  mg/l  mg/l   
Average  6,0  0,8  0,9  3,1  20  36  8,8 
Standard deviation  1,1  0,2  0,3  0,2  1,6  3,1  0,2 
Opening minds and closing loops – productive sanitation initiatives 
Sustainable Sanitation Practice  9  Issue 3 /2010 
OM 10,5kg  OM with urine 
17,5 kg 
Figure 6. Individual test in Kourittenga on 
sorghum where organic matter (OM) has been 
used as base fertilizer and urine as an 
additional source of nitrogen (pile to the right) 
Agronomic results with urine 
During the tests, urine has been compared to urea 
as  a  nitrogen  fertilizer,  or  complementing  the 
farmer’s  traditional  way  of  fertilizing  using  only 
organic matter. The test on sorghum in Figure 6 is 
an  example  of  an  individual  in  Kourittenga  who 
tested the nitrogen effect of urine on sorghum.  
 
The  tests  in  the  farmer  field  schools  were 
monitored  more  closely,  and  Table  5  summarizes 
millet  results  from  four  farmer  field  schools  in 
Aguié  in  2009.  All  test  plots  (T0‐T3)  of  200  m
2
  had 
organic  matter  (OM)  as  base  fertilizer  at  a  dose  of 
20  ton/ha.  T1  and  T2  also  had  50  kg/ha  of  Super 
Simple Phosphate (SSP) as extra base fertilizer. The 
N‐application  was  either  through  5  grams  of  urea 
(T1)  or  0.5  litres  of  urine  (T2  and  T3)  per  plant, 
which with 10000 millet plants/ha gives around 25 
kg N/ha. 
 
Urine gave roughly 10‐20 % more than urea. This is 
not  surprising  as  urine,  a  part  from  nitrogen,  also 
contains  some  phosphorous  and  potassium. 
Compared to the control with only organic matter, 
urine  increased  the  yields  in  general  by  40‐50%. 
One  25‐litre  jerry  can  of  urine  gave  around  2‐3  kg 
extra grains in the Aguié conditions. 
 
It  is  important  that  farmers  see  sanitized  human 
excreta as something that complement rather than 
replaces  existing  fertilizers.  Recycling  human 
excreta helps reduce losses, but to increase fertility 
in  degraded  soils  all  available  resources  are 
needed:  animal  manure,  crop  and  food  residues, 
chemical fertilizers as well as human excreta. 
 
Overcoming mental barriers
To  consider  human  urine  and  faeces  as  potential 
resources  requires  a  change  of  mindset.  Such 
change  does  not  come  over  night,  and  initial 
resistance is normal. Here are some experiences of 
how  mental  barriers  were  over  come  in  the  two 
projects: 
 The  farmers  want  to  see  to  believe.  It  was 
important  to  quickly  start  with  urine  collection 
and testing.  
 In  Muslim  societies  urine  is  considered  impure 
and  something  that  one  should  never  get  in 
contact with. On the other hand, the importance 
of cleanliness in Islam provides a good argument 
for  collecting  and  taking  away  urine  from  the 
compound.  Men  also  squat  when  urinating,  so 
the  alternative  to  dig  down  the  urinal  was 
appreciated.  When  applying  urine,  gloves  and 
mouth  protection  are  used,  and  the  same 
clothes  are  not  used  when  praying.  If  urine 
touches  the  clothes  or  skin,  the  accepted 
solution is to wash well with water. 
 The  fields  closest  to  the  village  has  always given 
the  best  yields  since  animals  and  people  relieve 
themselves there and no‐one has ever hesitated 
to  eat  what  is  produced  from  these  fields.  The 
new way of recycling excreta is an improvement 
of what is already done. 
 It  is  possible  to  eliminate  the  danger  and  keep 
the  resources  by  simple  storage  for  urine  or 
drying/composting  for  faeces.  After  sanitization 
urine  is  called  “liquid  fertilizer”  and  faeces  is 
called  “solid  fertilizer”,  which  makes  it  easier  to 
talk about. 
 The  urine  odour  is  said  to  be  the  fertilizer  ‐  if  it 
Table 5. Millet harvests (kg/ha) at four farmer field schools in Aguié. 
Village   Dan Bidé 
Malloumey 
Saboua 
Zabon 
Moussou 
Tsamiya 
Bakoye 
T0 (OM)  781  660  1244  1209 
T1 (OM+SSP+Urea)  1160  893  1318  1000 
T2 (OM+SSP+Urine)  1257  1072  1637  1111 
T3 (OM + Urine)  1161  948  1773  1399 
Surplus yield T2 compared to T1 (%)  8  20  24  11 
Surplus yield T3 compared to T0 (%)  49  44  42  16 
Opening minds and closing loops – productive sanitation initiatives 
Sustainable Sanitation Practice  10  Issue 3 /2010 
doesn't  smell,  it  is  no  good!  In  Kourittenga,  it  is 
compared  to  the  traditional  spice  soumbala, 
which  is  considered  to  be  better  the  stronger 
odour it has. 
 It  is  people  behind  desks  who  can  be  the  real 
barriers.  Farmers  are  often  very  pragmatic  in 
their  struggle  to  get  a  decent  harvest.  The 
productive  sanitation  approach  that  both 
improve  the  living  conditions  and  food 
production has been received with open arms in 
the two projects. 
 A  much  appreciated  activity  in  Aguié  was  the 
“blind  taste‐tests”  of  vegetables  and  cereals 
fertilized with urine and urea. The results show a 
sweeter taste for urine fertilized vegetables, and 
in  general  a  higher  buying  preference  for  the 
urine  fertilized  vegetables  both  based  on  taste 
and appearance (Saley, 2009).  
Scaling up potential 
In  Burkina  Faso,  the  use  of  excreta  derived 
fertilizers  could  either  be  scaled  up  like  other 
agriculture  innovations,  or  it  could  go  through  the 
national  sanitation  program  (PN‐AEPA)  that  is 
about  to  roll  out.  The  PN‐AEPA  includes  the  UDDT 
as  a  technical  option,  but  it  does  not  explicitly 
allocate  resources  for  accompanying  farmers  with 
the  recycling.  Fortunately,  in  Burkina  Faso  it  is  the 
Ministry  of  Agriculture  who  is  in  charge  of  water 
and sanitation, so there are good opportunities for 
synergy  between  sanitation  and  agriculture 
programs, if the political will is there. 
 
The  ongoing  EcoSan  projects  in  Burkina  Faso  are 
still  preparing  the  base,  and  the  information  and 
results are slowly reaching the top. To convince the 
decision makers there is still a lot of advocacy work 
needed,  with  precise  and  reliable  data,  as  well  as 
good  economic  arguments.  Part  of  this  work  is 
being done within the project in Kourittenga.  
 
In  Aguié,  Niger,  the  local  partner  project  partner 
(PPILDA)  will  continue  to  support  farmers  and 
eventually  extend  the  approach  to  the  entire 
intervention  zone  (260  villages).  On  national  scale 
in  Niger  the  Rural  Development  Strategy  (SDR) 
could  be  a  suitable  framework  to  take  the 
approach  further.  The  director  of  the  SDR 
executive  committee  has  shown  interest  but 
wishes to have more national research on hygienic 
and agronomic aspects. 
 
From  an  agro‐economic  point  of  view,  the  subsidy 
of  180 US$  in  the  Burkina  project  or  50 US$  in 
the Niger project for a productive toilet can help a 
family to potentially collect around 80 US$ worth 
of fertilizer per year. This is a short pay back time, 
but  the  construction  and  good  use  of  productive 
toilets  require  skill  and  knowledge.  A  large  scale 
program that provides these new skills and follows 
up on the whole system will need a lot of time and 
resources.  However,  simple  urine  collection 
captures  the  majority  of  plant  nutrients  in  human 
excreta and can be done to a much lower cost, and 
with  less  skills  and  follow  up.  An  interesting 
approach  would  be  to  scale  up  urine  recycling  via 
the  agriculture  sector  while  sanitation  programs 
promote  faeces  management.  The  agriculture 
extension  officers  already  widely  present  in  the 
rural  areas  could  disseminate  knowledge  on  urine 
reuse,  and  prepare  the  grounds  for  further 
sanitation interventions.  
 
As  an  alternative  to  large  national  programs  a 
recent example from Malawi (Bramley and Breslin, 
2010)  show  that  basic  productive  sanitation 
services  also  can  be  spread  on  grass  root  level  via 
business  opportunities  for  small  scale 
entrepreneurs.  There  are  signs  of  this  dynamic  in 
the  two  projects  discussed  in  this  article;  In 
Kourittenga  people  have  initiated  urine  collection 
on  public  places,  and  in  Aguié  an  individual  has 
already  bought  140  jerry  cans  of  urine  from  his 
neighbours to enrich his compost.  
Conclusion 
In the pilot villages in Kourittenga and Aguié, urine 
and faeces are now looked upon as potential liquid 
and solid fertilizers. An important reason has been 
the  methodology  of  participative  tests  with  urine. 
In  rural  areas  food  production  is  the  main 
occupation  and  an  effective  entry  door  to  create 
interest  for  sanitation,  at  least  among  the  men. 
The  women  tend  to  be  more  interested  by  the 
comfort,  hygiene  and  pride‐side  of  productive 
sanitation.  Already  a  simple  urinal  makes  a 
difference,  as  the  urine  odour  in  the  shower 
disappears with the collection.  
 
On  a  global  scale,  with  the  absence  of  political 
awareness and will, the incentive to recycle human 
excreta  will  come  with  increasing  fertilizer  prices. 
In  Burkina  Faso  and  Niger  were  commercial 
fertilizers  are  beyond  the  purchase  power  of  most 
farmers,  there  is  already  a  strong  recycling 
incentive.  The  important  knowledge  of  urine 
collection  and  reuse  can  be  spread  by  the  local 
agriculture  extension  officers.  They  are  in  a  good 
position to lead the yellow revolution! 
 
 
 
Opening minds and closing loops – productive sanitation initiatives 
References  Morris  et  al.  (2007):  Fertilizer  use  in  African  Agriculture  – 
Lessons  Learnt  and  Good  Practice  Guidelines,  World  Bank, 
Washington DC, USA. 
Bramley,  S.,  Breslin,  E.  (2010): 
Sanitation as a Business: A new spin on the challenge of sanit
ation. Sustainable Sanitation Practice 2, 10‐14.  
Saley, M. (2009): Etude organoleptique des produits maraîchers 
issus  de  l’application  des  urines  hygiénisées  et  de  l’urée. 
Project  report,  PS‐Aguié  project,  Niger 
http://www.ecosanres.org/aguie/documents/EtudeOrganole
ptique‐SALE.pdf (in French)  
Cordell,  D.,  Drangert,  J‐O.,  White,  S.  (2009):  The  story  of 
phosphorus:  Global  food  security  and  food  for  thought. 
Global Environmental Change 19, 292‐305. 
Cordell,  D.  (2010):  The  story  of  phosphorous  –  sustainability 
implications of global phosphorous scarcity for food security. 
PhD  thesis,  University  of  Technology,  Sydney,  Australia,  and 
Linköping University, Sweden. 
UNICEF/WHO (2008): Progress on drinking water and sanitation 
–  special  focus  on  sanitation,  JMP  report, 
http://www.who.int/entity/water_sanitation_health/monito
ring/jmp2008.pdf 
CREPA (2009): Etude de l’état des lieux AP‐Aguié. Project report, 
PS‐Aguié project, Niger (in French).  UNICEF/WHO  (2009):  Diarrhoea:  Why  children  are  still  dying 
and  what  can  be  done, 
http://whqlibdoc.who.int/publications/2009/978924159841
5_eng.pdf  
Dagerskog,  L.  (2007) :    ECOSAN  et  la  valeur  des  fertilisants 
humains  ‐  le  cas  du  Burkina  Faso,  ITN  conference  paper,  26‐
28 Nov. 2007, Ouagadougou, Burkina Faso (in French). 
 
Djariri,  M.L.  (2009):  Réduction  des  coûts  des  ouvrages 
d’assainissement  dans  le  cadre  du  projet  assainissement 
productif  à  Aguié  au  Niger.  MSc  Thesis,  2iE,  Ouagadougou, 
Burkina  Faso 
http://www.ecosanres.org/aguie/documents/Memoire‐
ReductionDesCouts‐DJARIRI‐lowres.pdf (in French) 
 
 
 
FAO,  (1985),  Irrigation  Water  Management:  Introduction  to 
irrigation,  Irrigation  water  management,  Training  manuals  ‐
 1, http://www.fao.org/docrep/R4082E/R4082E00.htm  
FAOSTAT,  statistics  from  2005  on  protein  consumption  in 
different  countries: 
http://faostat.fao.org/site/609/default.aspx#ancor,  (Date  of 
visit: Oct 2007) 
FDA,  (2009):  Bad  Bug  Book  –  Foodborne  Pathogenic  Micro‐
organisms  and  Natural  Toxins  Handbook, 
http://www.fda.gov/Food/FoodSafety/FoodborneIllness/Foo
dborneIllnessFoodbornePathogensNaturalToxins/BadBugBoo
k/default.htm (date of visit: 25 March 2010) 
Henau,  J.C.,  Baanante.  (2006):  Agricultural  Production  and  Soil 
Nutrient  Mining  in  Africa:  Implications  for  Resource 
Conservation  and  Policy  Development.  IFDC,  Muscle  Shoals, 
AL,  USA 
http://www.africafertilizersummit.org/Background_Papers/0
3%20Henao%20and%20Baanante‐‐
Agricultural%20Production.pdf 
e‐mail: linusdagerskog@yahoo.fr 
Name: Moussa Bonzi
Town, Country: Ouagadougou, Burkina Faso 
e‐mail: bouabonzi@yahoo.fr 
Organisation: CREPA Headquarters 
Organisation: CREPA Headquarters 
Town, Country: Ouagadougou, Burkina Faso 
Name: Linus Dagerskog
Jönsson,  H.,  Richert  Stintzing,  A.,  Vinneras,  B.,  Salomon,  E. 
(2004):  Guildelines  on  the  use  of  urine  and  faeces  in  crop 
production.  EcoSanRes  Publications  Series,  Report  2004‐2, 
Stockholm, Sweden. 
Laminou,  S.  (2009)  :  Identification  des  risques  sanitaires  et  des 
opportunités de production de fertilisants dans le système de 
collecte  d’urine  du  projet  assainissement  productif  dans  le 
département  d’Aguié  au  Niger.  MSc  Thesis,  2iE, 
Ouagadougou,  Burkina  Faso, 
http://www.ecosanres.org/aguie/documents/Memoire‐
RisquesSanitairesEtDesOpportunites‐LAMINOU‐lowres.pdf 
(in French) 
The ECOSAN_UE
2
 project in Burkina Faso is financed mainly with EU food security money (~1.5 million Euro, 2008‐2011). 
CREPA  together  with  the  National  Environment  and  Agriculture  Research  Institute  (INERA)  and  the  Ministry  of 
Agriculture  implement  the  project  covering  30  villages  in  the  Kourittenga  province.  Ecological  sanitation  is  combined 
with soil and water conservation techniques to improve food production.  
The International Fund for Agriculture Development (IFAD) granted a 200 000 US$ pilot project for CREPA, PPILDA (a 17 
million  US$  IFAD‐funded  rural  development  project  run  by  the  Ministry  of  Agriculture  in  Niger)  and  Stockholm 
Environment  Institute  (SEI)  to  test  urine  as  a  fertilizer  in  the  Aguié  province  in  Niger.  The  objective  was  to  show  the 
effectiveness  of  urine  and  to  develop  strategic  tools  as  well  as  low  cost  appropriate  technologies  for  an  eventual  up‐
scaling within the PPILDA rural development project and other IFAD funded projects. The PS‐Aguié project  was carried 
out  during  16  months  from  Nov  2008‐Feb  2010.  See  www.ecosanres.org/aguie  for  more  information,  fact  sheets  and 
tools.  
Sustainable Sanitation Practice  11  Issue 3 /2010 
 
Sustainable Sanitation Practice  12  Issue 3 /2010 
 
 
 
overall project: 
 
Experiences from the use of urine in Arba 
Minch, Ethiopia 
Urine crop trials in Arba Minch, Ethiopia, showed the possibility for improving 
soil fertility and increasing crop yield.  
Authors: K. Kassa, F. Meinzinger, W. Zewdie
 
Abstract 
In this paper an overview of practical experiences with the collection and the use of urine from urine diversion 
dry toilets in Arba Minch is discussed. At two crop trial sites maize was fertilized with urine and the maize yield 
and  the  effect  on  soil  was  studied.  At  one  site,  the  yield  of  urine  fertilized  maize  was  increased  seven  times 
compared  to  unfertilized  soil.  Analyses  of  the  soil  fertilized  with  urine  showed  that  Kjeldahl  nitrogen  and 
salinity  was  increased  while  pH  was  decreased  at  higher  rates  of  urine  application.  Urine  contains  important 
nutrients  for  the  plants  and  increases  the  quality  of  soil;  however  precautions  against  the  development  of 
salinity in the roots of plants are required. The urine crop trial sites have changed the attitude of many people 
who had a chance to visit. 
 
         
Introduction 
The  EU‐funded  project  called  ROSA  (Resource‐
Oriented  Sanitation  concepts  for  peri‐urban  areas 
in  Africa)  proposed  resource‐oriented  sanitation 
concepts  as  a  route  to  sustainable  sanitation  to 
meet  the  UN  MDGs.  These  concepts  have  been 
applied in four pilot cities in Eastern Africa, namely 
Arba  Minch  (Ethiopia),  Nakuru  (Kenya),  Arusha 
(Tanzania)  and  Kitgum  (Uganda).  Arba  Minch  is 
located  about  550 km  south  of  Addis  Ababa,  the 
capital  of  Etiopia,  and  has  a  population  of  about 
80'000.  ROSA  Arba  Minch  was  working  in  the 
whole of Arba Minch town on the management of 
solid  waste,  greywater,  faeces  and  urine  to 
improve  sanitation  of  the  town  and  to  increase 
agricultural  productivity  in  the  Arba  Minch  area. 
Different  resource  oriented  sanitation  systems 
have  been  implemented  in  Arba  Minch  town 
including 15 urine‐diversion dry toilets (UDDTs), 30 
Fossa  alternas,  9  Arborloos,  7  greywater  towers,  1 
biogas unit and more than 5 composting sites.  
 
Figure 1: Typical storage tank in UDDT toilet 
 
 
One  of  the  most  commonly  used  technologies  for 
the  source  separated  collection  of  urine  are 
UDDTs.  Urine  is  diverted  from  faeces  using 
separating pedestals. Urine is a valuable flow since 
it contains phosphate, nitrogen and potassium and 
can be used directly or after storage. It is a low cost 
alternative  to  the  application  of  nitrogen  rich 
mineral fertilizer in plant production. The chemical 
composition  of  urine  and  its  plant  availability  is 
comparable  to  chemical  fertilizer  (Johansson  et  al. 
2001; Kirchmann and Pettersson, 1995).  
Figure 2: Urine storage in UDDT toilet 
 
Considering  the  contents  of  the  major  nutrients  in 
urine,  research  in  applying  urine  in  agriculture 
especially  in  developing  countries  is  needed.  The 
use  of  urine  as  fertilizer  in  arid  and  semi  arid 
regions  like  Arba  Minch  gives  some  knowledge 
input and also may contribute to the change of the 
attitude  of  the  people  and  even  decision  makers. 
Experiences from use of urine in Arba Minch, Ethiopia 
Sustainable Sanitation Practice  13  Issue 3 /2010 
The  use  of  urine  in  agriculture  may  increase 
agricultural  production  and  eventually  reduce 
vulnerability in developing countries. 
 
The  objective  of  the  research  conducted  in  Arba 
Minch town was to test urine as fertilizer for maize 
on  two  types  of  soil  with  different  fertility.  The 
yield  of  maize  was  used  to  evaluate  the  effect  of 
urine  application.  The  impact  of  urine  on  the 
quality  of  the  soil  was  also  investigated  by 
measuring  parameters  such  as  conductivity,  pH 
and  nutrient  content.  The  trial  sites  were 
furthermore used to demonstrate the use of urine 
to farmers and other community members.  
Use of urine and analyses 
Urine separation, collection and transport in Arba 
 
Figure 4: Donkey cart used for transporting urine, 
solid waste, and dried faeces 
Minch 
Urine is stored in plastic jerry cans or plastic water 
tanks, which are available from local market, in the 
vaults of the UDDTs. Joints of urine collecting pipes 
are  connected  by  adhesives  and  flexible  plastic 
pipes  are  used  to  reduce  nitrogen  losses  in  the 
form of ammonia. The sizes of the tanks depend on 
the size of the family using the UDDT. Initially, the 
transfer  of  urine  from  the  UDDTs  tank  into  the 
transportable  jerry  cans  was  done  by  pump. 
However,  this  resulted  into  breakage  of  two 
pumps,  therefore,  a  cheap  method  of  collection 
was  introduced  which  is  a  plastic  hose  connected 
at  the  bottom  of  the  urine  tank  and  lowered  to 
pour  the  urine  and  raised  and  bent  to  seal  it 
(Figures  1‐2).  In  some  occasions  neighbours  were 
complaining and UDDT owners were also ashamed 
of  the  odour  produced  when  the  stored  urine  was 
transferred into transporting jerry cans. Taking this 
as  lesson  urine  was  poured  carefully  from 
container to container to avoid nuisance.  
 
Initially,  the  urine  used  to  be  transported  by  the 
ROSA  project  in  a  pick‐up  car  (Figure  3).  However, 
this  was  not  sustainable.  Therefore,  female  and 
youth  group  has  been  identified  which  has  been 
originally organized to collect the town solid waste 
from  households  and  business  centres.  These 
entrepreneurs  are  now  transporting  urine  from 
UDDT  toilets  to  the  area  of  use  by  donkey  carts 
(Figure  4).  The  donkey  cart  was  given  by  ROSA 
under  the  condition  that  the  entrepreneurs 
transport  excreta  and  solid  waste  to  earn  extra 
income  by  transporting  things  different  from 
waste.  The  UDDT  users  have  proposed  a  certain 
amount of money they are willing to pay for these 
services.  
 
 
For  a  hygienic  point  of  view,  human  urine  is  a 
“safe”  fertilizer  with  less  concern  regarding  risks 
for  disease  transmission  when  handling 
(Kvarnstrom,  et.  al.,  2006)  and  it  is  an  uncommon 
transmission route of disease. In rural Ethiopia, it is 
common  to  urinate  on  fresh  wounds  to  stop 
bleeding. In order to reduce the risk from  possible 
contamination  by  faeces,  urine  is  stored  at  the 
production  or  reuse  sites.  Some  families  were 
using  the  fresh  urine  directly  in  their  gardens. 
Urine  is  one  of  the  components  of  co‐compost 
produced  by  organized  youth  groups;  recently  the 
compost  producers  have  started  selling  their 
products to private farmers.  
 
The  use  of  urine  as  a  fertilizer  in  agriculture  in 
Ethiopia  is  generally  faced  with  some  cultural 
objections, although wastewater use in agriculture 
is  a  common  practice  in  Addis  Ababa.  In  Arba 
Minch reuse of urine was not practiced until ROSA 
started  it  in  trials.  There  was  a  widespread 
perception  that  urine  may  burn  the  plants.  A  part 
from  the  burning  effect,  many  households  in  Arba 
Minch,  who  were  interviewed  in  the  beginning  of 
the  project,  stated  that  they  would  be  hesitant  to 
eat  vegetables  fertilized  by  urine.  Nevertheless, 
urine trial farms were prepared in Arba Minch. The 
trial  sites  were  successful  in  showing  that  urine 

Figure 3: Transportation by pickup car 
Experiences from use of urine in Arba Minch, Ethiopia 
Sustainable Sanitation Practice  14  Issue 3 /2010 
Table 1: Urine application on the maize plant at Arba Minch University Plot (planting on 28.06.2007)
 
Figure 5: Urine application method on farm 
improves  yield  and  they  were  also  successful  in 
initiating an attitude change. Many people in Arba 
Minch  have  eventually  consumed  urine  fertilized 
maize,  lettuce  and  tomato  although  they  knew  it 
was fertilized by urine.  
Methods 
Urine fertilizer trials  
Arba Minch University farm trial plot 
The  urine,  which  was  collected  from  UDDTs,  was 
transported  in  20  litre  jerry  cans  and  stored  in  a 
tank  located  at  the  farmland.  Twenty  plots  each 
with  a  size  of  16  m
2
  were  prepared  in  Arba  Minch 
University  farm  (Figures  5).  Five  application  rates 
of  urine  based  on  nitrogen  amount  were  chosen 
including  four  replicates.  The  application  rates 
were 25kg N/ha, 50kg N/ha, 75 kg N/ha, and 100kg 
N/ha, respectively (Table 1). The yield of each plot 
was analyzed when the crops were mature. 
 
The application of urine was done by watering cans 
after  mixing  with  50%  irrigation  water.  The  plants 
were  counted  in  rows;  the  urine  irrigation  water 
mixture was applied nearby the roots of the plants 
keeping  the  watering  at  the  same  pace.  The 
application  was  done  back  and  forth  until  the 
mixture in the watering can was finished (Figure 5). 
The application of the urine on the farm was done 
in  different  portions  at  different  development 
stages  of  the  plant  before  the  first  signs  of  the 
maize  tassel  and  cob  appearance.  Operators 
applying  urine  in  the  farm  were  complaining  of 
strong smell in the direction of wind but there have 
been  no  problems  with  odour  once  the  urine  was 
poured  on  the  soil  even  at  high  temperatures  in 
Arba Minch. 
ROSA office farm trial plot, Secha  
Two plots each with a size of 4 m
2
 and 16 planting 
spots  were  prepared  at  the  ROSA  office  site  and 
two  maize  grains  were  planted  in  each  spot.  Each 
spot  of  the  first  plot  was  treated  with  1.2  litres  of 
urine  in  four  portions  while  the  second  plot  was 
watered only with water. All watering was done at 
the same day for all plots. The amount of nitrogen 
added  in  terms  of  urine  was  175  kg/ha.  Finally, 
each  plant  stand  was  analyzed  for  the  yield  and 
biomass when the crops were mature.  
Physicochemical analysis 
2.5  gram  of  soil  taken  from  20  cm  depth  were 
analyzed  for  potassium  using  flame  photometer 
after extracting with 100 ml of ammonium acetate 
buffer  solution  (Dewis,  et  al.,  1970,  APHA,  1992). 
2.5 gram were analysed for Kjeldahl nitrogen (TKN) 
after  extraction  (Dewis,  et  al.,1970,  APHA,  1992). 
pH  and  conductivity  were  analysed  after  shaking 
the  dispersed  sample  (1:5  sample:  water)  (Dewis, 
et  al.,1970).  Urine  was  analysed  for  phosphate, 
potassium, nitrogen, pH and conductivity according 
to standard methods (APHA, 1992). 
 
Results from crop trial plots 
Characteristics of urine  
The urine samples were collected from ROSA office 
for  use  at  the  ROSA  office  trial  plot  and  from 
construction  site  UDDT  toilets  for  use  at  the  Arba 
Minch  University  trial  plot  as  described  above. 
Table  2  shows  the  charcteristics  of  the  urine  from 
the 2 sites.   
Urine added (ml) 
Code 
N applied (kg 
N/ha)  21.6.07  04.8.07  28.8.07  17.9.07  Sum 
T25  25  100  50  50  38.1  238.1 
T50  50  200  100  100  76.2  476.2 
T75  75  300  150  150  114.3  714.3 
T100  100  400  200  200  152.4  952.4 
Table 2: Typical characteristics of nutrients in urine collected from two UDDT sites in Arba Minch (ROSA office 
and construction site) 
NH4+‐N  N‐org  TKN  PO43‐‐P  K+  pH  Conductivity  
Sample/Parameter 
g/l  g/l  g/l  g/l  g/l  ‐  mS/cm 
Urine ROSA office  3.3  0.3  3.7  0.4  1.6  8.8  25.9  
Urine construction site  3.9  0.4  4.2  0.6  2.7  8.9  35.8  
Experiences from use of urine in Arba Minch, Ethiopia 
Sustainable Sanitation Practice  15  Issue 3 /2010 
 
It  was  shown  that  there  is  a  difference  in  quality 
depending on way of storage, storage time and the 
differences  in  use  of  the  toilets.  The  urine  from 
ROSA office was collected from office workers who 
drink  water  when  they  need  and  the  urine  from 
the construction site UDDT was collected from day 
workers  who  had  a  possibility  of  dehydration. 
Besides,  the  conductivity  of  urine  from  the 
construction site was higher maybe because it was 
stored for a number of days in open sun in a water 
tank but the urine ROSA office was relatively fresh 
and  was  stored  under  the  shade  in  the  vault  of 
UDDT. 
Crop yields from trial sites  
Figures  6‐8  show  the  maize  yield  on  Arba  Minch 
university trial farm which was fertilized by urine at 
the  rate  of  25,  50,  75  and  100 kg N/ha, 
respectively.  Figure  7  shows  the  maize  yield 
increases  with  increasing  urine  application  rates. 
However,  finally  the  increase  is  stabilized  with  the 
increase  of  urine  amount.  The  difference  between 
the  yield  of  the  fertilized  and  unfertilized  maize 
was  not  much  compared  to  the  results  from  the 
ROSA office trial plot shown in Figure 9‐12. Figure 8 
shows  biomass  of  maize  without  the  cob  but  the 
change is not significant. One reason for this might 
be  the  damage  caused  by  wildlife  before  analysis. 
Figure  9‐12  show  the  results  of  the  ROSA  office 
   
Figure 6: Urine experiment on maize at Arba Minch 
University farm 
Figure 9: Left: urine fertilized; right: unfertilized maize 
collected from ROSA office farm. 
 
 
Figure 7: Maize yield (crop trial performed on Arba 
Minch University farm. The farm land is relatively fertile) 
Figure 10: Maize yield (crop trial results of the ROSA 
Office demonstration farm) 
 
 
Figure 8: Average of maize biomass measured without 
cob cover and root (University farm) 
Figure 11: Weight of maize biomass (ROSA office), 175 
kg N/ha equivalent of urine was added. 
Experiences from use of urine in Arba Minch, Ethiopia 
Sustainable Sanitation Practice  16  Issue 3 /2010 
trial  farm  where  there  is  big  difference  between 
the  urine  fertilized  and  unfertilized  maize  most 
probably  because  of  the  initial  lower  soil  fertility. 
The  maize  yield  fertilized  by  urine  at  a  rate  of 
175 kg N/ha  is  seven  times  more  than  the 
unfertilized  maize  (Figure  10).  The  related  maize 
biomass  fertilized by  urine  is  twice as  much  as the 
unfertilized one (Figure 11). 
Figure 13: Conductivity of urine fertilized soil after harvesting 
maize 
 
Figure 14: Potassium (filled) and TKN concentration (clean) in 
the soil fertilized with urine, after harvesting maize
A comparison of the results from the two trial plots 
shows  the  dependence  of  the  effect  of  urine  on 
the  initial  soil  quality.  Although  the  initial  soil 
quality  is  not  indicated  here  since  it  was  not 
sampled,  the  Arba  Minch  University  trial  plot  is 
very rich and it was in use as a farm while the farm 
in  ROSA  office  is  lacking  nutrients  and  was  not  in 
use  for  agriculture  before.  The  results  of  Arba 
Minch  University  farm  trial  plots  also  showed  that 
the maize yield and biomass increased in response 
to  the  increased  urine  application,  but  at  a  slower 
rate  at  higher  urine  applications.  Jönsson  et  al 
(2004)  indicated  that  the  effect  of  crop  yield 
increases with increasing fertiliser application rates 
and  then  remains  constant  at  higher 
concentrations.  
 
From  these  two  experiments,  it  is  possible  to  say 
that  less  fertile  soil  has  a  tendency  to  give  good 
yield  with  urine.  Hence,  the  Ethiopian  highlands, 
which  are  particularly  suffering  from  nutrient 
depletion,  are  a  promising  region  for  using  urine 
and compost conditioned with urine.  
Impact of urine application on soil quality 
Figures  13‐15  show  the  soil  quality  changes  after 
urine  addition  at  the  Arba  Minch  University  trial 
farm  plots.  The  conductivity  of  the  soil  increases 
with increasing urine application which means that 
there  is  a  possibility  of  increased  salinity  as  more 
urine is added to the soil (Figure 13). Farmers who 
are  going  to  use  urine  as  a  fertilizer  must  irrigate 
with  more  irrigation  water  to  leach  the  salt 
accumulation  in  the  root  zone  of  the  plants.  The 
dilution ratio can start from 3:1 urine to water and 
above.  If  1  litre  of  urine  is  added  either  diluted 
with 25% or 75% the nutrients that are supplied to 
the  plat  are  the  same.  The  problem  arises  when 
concentrated  urine  is  added  salt  is  being 
accumulated  on  the  soil  surface  and  not  reaching 
the  plant  root.  Yet,  when  the  urine  is  mixed  with 
more  water  the  nutrient  may  be  leached  or 
washed away before the roots absorbed it. 
 
Figure 12: Control (left) and urine fertilized maize 
(right) at the ROSA office trial plot 
 
Figure  14  Kjeldahl  nitrogen  and  potassium  of  soil 
fertilized  by urine.  The  amount  of  nitrogen slightly 
increased with addition of urine which is one of the 
positive  values  of  urine  as  a  fertilizer.  Potassium 
variation  with  increasing  amount  of  urine  was 
neglegible. 
 
The pH of neat urine applied was about 9 (Table 2). 
The  pH  of  soil  measured  after  application  of  urine 
indicated  in  Figure  15  decreased  with  increasing 
application  of  urine  on  the  soil.  This  might  be 
described by as the fact that ammonium is nitrified 
in  soil,  releasing  two  protons  and  thus  decreasing 
the  pH.  However,  this  might  be  only  a  temporarily 
Experiences from use of urine in Arba Minch, Ethiopia 
Sustainable Sanitation Practice  17  Issue 3 /2010 
Figure 15: pH of urine fertilized soil after harvesting 
maize 
effect since when nitrate is taken by plant root two 
hydroxide  ions  are  released  which  this  therefore 
result  in  the  neutralization  of  the  protons  in  the 
soil (Schönning, 2001). Then there might be no pH 
decline permanently in a soil treated with urine.  
 
Conclusions and Recommendations  
Urine  collection,  transport,  treatment  and  reuse  is 
one  of  the  difficult  step  in  resources‐oriented 
sanitation  systems  because  the  society  and  the 
decision  makers  may  not  be  aware  of  the 
advantages.  In  Arba  Minch  the  transport  and 
collection  of  urine  from  UDDTs  was  first  done  by 
car  but  gradually  entrepreneurs  were  involved  to 
independently  transport  by  donkey  cart  without 
external  support.  This  is  a  good  progress  to 
sustainability  of  the  implemented  sanitation 
systems. 
 
Youth  groups  also  use  urine  to  enrich  the  co‐
compost,  which  they  produce  from  faeces  and 
organic  waste.  Costumers  are  happy  to  buy  the 
produced  compost  so  that  the  youth  groups  can 
gain an income. 
 
The response of maize  plant for urine is very good 
but it depends on whether the soil is already fertile 
in  terms  of  nutrients  or  not.  The  response  is  very 
good  in  the  ROSA  office  trial  farm,  while  it  is 
smaller  at  the  University  trial  farm,  where  the  soil 
had already a relatively high initial fertility.  
 
Urine  increases  soil  fertility  but  the  development 
of  soil  salinity  might  happen  especially  in  areas 
where  irrigation  water  is  scarce.  Therefore, 
appropriate measures such as drainage might need 
to  be  taken  and  salt  tolerant  crops  should  be 
selected. 
In  order  to  make  urine  accepted  by  the  Ethiopian 
farmers  widely  repeated  research  and 
demonstration  should  be  done  in  different  agro‐
climatic  zones  and  preferably  in  cooperation  with 
farmer associations. 
 
 
Acknowledgements 
The  work  was  carried  out  within  the  project  ROSA 
(Resource‐  oriented  Sanitation  concepts  for  peri‐
Urban  areas  in  Africa;  Contract  No.  037025‐GOCE; 
duration:  1.10.2006‐31.3.2010),  a  Specific  Target 
Research Project (STREP) funded within the EU 6th 
Framework  Programme,  sub‐priority  „Global 
Change  and  Ecosystems“.  The  authors  are  grateful 
for  the  support.  We  thank  Mr  Yesuf  Ali  for  the 
anlaysis of soil samples. 
 
 
References 
APHA  (1992):  Standard  Methods  for  the  examination  of  water 
and  wastewater.  18th  Edition,  American  Public  Health 
Association/American  Water  Works  Association/Water 
Environmental Federation, Washington DC, USA.  
Dewis,  J.,  Freitas,  F.  (1970):  Physical  and  chemical  methods  of 
soil and water Analysis, FAO, Soil Bulletin No. 10. 
Jönsson,  H.,  Stinzing,  A.R.,  Vinneras,  B.,  Salomon,  E.  (2004): 
Guidelines  on  the  use  of  and  faeces  in  crop  production. 
EcoSanRes Publication Series p 4. 
Johansson,  H.,  Jönsson,  H.,  Hoglund,  C.,  Richert  Stintzing,  A., 
Rodhe, L. (2001): Urine separation‐closing the nutrient cycle. 
Stockholm  water  company,  Stockholm,  Sweden. 
Available:www.stockholmvatten.se/pdf_arkiv/English/urinse
p_eng.pdf. 
Kirchman,  H.,  Pettersson,  S.  (1995):  Human  urine‐chemical 
composition  and  fertilizer  efficiency,  Fertilizer  Research  40: 
149‐154. 
Kvarnstrom,  E.  Emilsson,  K.,  Stintzing,  A.R.,  Johansson,  M, 
Jönsson,H.,  Petersens,  E.,  Schönning,  C.,  Christensen,  J., 
Hellstrom,  D.,  Qvarnstrom,L.,  Ridderstolpe,  P.,  Drangert,  J. 
(2006):  Urine  diversion:  one  step  towards  sustainable 
sanitation. Report 2006‐1, EcoSanRes publication series, p37. 
Schönning,  C.  (2001)  Urine  diversion  ‐  hygenic  risks  and 
microbial  guidelines  for  reuse.  In:  Höglund,  C  (2001): 
Evaluation  of  microbial  health  risks  associated  with  reuse  of 
source separated human urine, PhD thesis, Royal Institute of 
Technology, Stockholm, Sweden. ISBN 91‐7283‐039‐5. 
 
 
Name: Franziska Meinzinger 
Organisation: ROSA, TU Hamburg‐Harburg,  
Town, Country: Hamburg, Germany 
Name: Kinfe Kassa
Organisation: ROSA, Arba Minch University 
Town, Country: Arba Minch, Ethiopia 
e‐mail: kinfe_k@yahoo.com 
Name: Wubshet Zewdie  
Organisation: ROSA, Arba Minch University 
Town, Country: Arba Minch, Ethiopia 
 
Sustainable Sanitation Practice  18  Issue 3 /2010 
 
 
 
implementing 
organisation: 
 
Are pharmaceutical residues in urine a 
constraint for using urine as a fertiliser? 
This paper provides an overview about pharmaceutical residues in urine and 
their potential role as constraint for reuse of the urine in agriculture. 
Author: M. Winker
 
Abstract 
Urine  is  an  excellent,  complete  plant  fertiliser  (containing  nitrogen,  phosphorus  and  potassium),  but  also 
contains certain amounts of pharmaceutical residues even after prolonged storage as a treatment step. If those 
substances are polar and hardly biodegradable they can be taken up by plants and thereby possibly enter the 
human  food  chain.  Research  has  shown  that  the  low  pharmaceutical  concentrations  provided  with  urine  are 
unlikely  to  affect  plant  development  and  growth.  A  full  evaluation  of  the  potential  toxic  effects  of 
pharmaceuticals  ingested  by  humans  via  urine‐fertilised  crops  is  very  difficult  and  has  not  yet  been  done. 
Perceptions of societies towards urine reuse vary widely and can work as a driver or a constraint for reuse. 
 
Introduction 
Urine  can  be  used  as  an  alternative  fertiliser  for 
agriculture.  It  contains  large  amounts  of  nutrients 
such  as  80%  of  nitrogen,  50%  of  phosphorus,  and 
70%  of  potassium  usually  present  in  domestic 
wastewater as well as various micronutrients (Ciba 
Geigy AG, 1977; Larsen and Gujer, 1996; Otterpohl, 
2002;  von  Münch  and  Winker,  2009).  But  this 
usage  of  urine  includes  the  risk  of  transfer  of 
pharmaceutical  residues  to  agricultural  fields 
(Lienert  et  al.,  2007a;  Winker  et  al.,  2008b).  Only 
recently  the  fate  of  pharmaceuticals  regarding 
their  accumulation  in  soils,  transfer  to 
groundwater,  and  incorporation  by  plants  came 
into  the  focus  of  research.  However,  these  effects 
cannot be excluded as fairly high concentrations of 
pharmaceuticals  are  expected  in  urine  (Winker  et 
al., 2008b). 
 
The  urine  normally  ends  up  in  the  domestic 
Key message:
 Pharmaceutical residues are contained in urine but only in few investigations concentrations have been 
measured so far. Predicted (German) concentrations were in the range of 0.1 to 103 μg/l of urine and 
determined for 124 substances. 
 Data from literature show that plants are generally able to take up pharmaceuticals. Concentrations in plant 
parts detected were very low (in the range of ng/kg) even though plants were exposed to high concentrations 
(mg/kg soil). Nevertheless, pharmaceuticals were also found in edible plant parts. 
 Pharmaceuticals can also cause phytotoxic effects in dependence of the applied pharmaceutical concentration. 
Also here, it has to be mentioned that high concentrations were applied. 
 Overall, different plant species have dissimilar sensitivity levels towards the same pharmaceutical as studies 
have shown. Unfortunately, it is impossible to extend these conclusions to long term effects in general. 
 Exposure of rye grass to pharmaceuticals contained in urine at expected “natural” levels as well as at higher 
concentrations did not affect dry matter production during the growth period of three months either for single 
pharmaceuticals, or for the combination of carbamazepine, ibuprofen, and 17α‐ethinylestradiol. 
 Only carbamazepine was shown to be taken up by roots and aerial plant parts of rye grass. The concentrations 
in aerial rye grass parts were in the mean 4950 μg/kg DM (dry matter), and in roots 225 μg/kg DM. This leads to 
the assumption that only pharmaceuticals which are persistent in soil and not biodegraded are transferred to 
plants in measureable concentrations. 
 Potential effect of pharmaceutical substances contained in urine towards plants cannot be determined in 
germination experiments. The urine matrix itself is much more affecting the seedlings due to its specific matrix 
than the active agents. 
 Farmers and consumers are open to urine as fertiliser, although they are aware of the aspect of pharmaceutical 
appearance. The perception varies not only among the stakeholder groups but also between countries. 
Pharmaceutical Residues in Urine as Fertiliser  
Sustainable Sanitation Practice  19  Issue 3 /2010 
wastewater  in  conventional,  sewer‐based 
collection  systems.  Many  of  these  pollutants  are 
not  removed  in  sewage  treatment  plants  and  are 
thus discharged into surface water bodies and can 
even reach the groundwater. 
 
The  collection,  storage  and  reuse  of  urine  include 
various  challenges.  This  article  provides  an 
overview  about  recent  research  (excluding 
advanced  treatment  technologies  for  urine  as  an 
excellent  overview  on  that  is  provided  by  Maurer 
et al. (2006)). Additionally, it is also explained why 
the  uptake  of  pharmaceuticals  in  plants  and  the 
effects on plant physiology and development is of 
major  interest  when  crops  are  fertilised  with 
urine.  The  article  is  based  on  the  results  of  the 
PhD thesis of Winker (2009). 
 
Concentrations  of  pharmaceutical 
residues  in  urine  and  the  effect  of 
storage 
 
Figure 2. Measured mean concentrations of active 
agents in German source‐separated urine done by 
Strompen et al. (2003) and Tettenborn et al. (2007) 
(Vinnerås et al., 2008). 
Urine  contains  pharmaceuticals:  around  70%  of 
the  pharmaceuticals  taken  in,  are  excreted  via 
urine  accounting  for  50%  of  the  overall 
ecotoxicological  risk  (Lienert  et  al.,  2007a;  Lienert 
et  al.,  2007b). Urine  analysed  in  various  occasions 
showed  concentrations  from  2200 ng/l 
(fenoprofen; Strompen et al., 2003) to 545000 ng/l 
(ibuprofen;  Tettenborn  et  al.,  2007)  (Figure  1). 
Apart  of  these  substances,  substance  belonging  to 
various  indication  groups  as  well  as  natural 
hormones  were  detected  in  human  urine  (Winker 
et al., 2008b). 
 
As  analytics  are  sometimes  difficult,  Lienert  et  al. 
(2007a)  and  Winker  et  al.  (2008b)  established 
theoretical  calculations  to  receive  a  potential 
overview  for  Swiss  and  German  urine.  Winker 
(2009)  could  determine  average  concentrations  in 
general  German  urine  for  124  active  substances 
(for  details  see  https://www.tu‐
harburg.de/aww/pharma/).  Also  pharmaceutical 
concentrations  in  the  urine  of  single  person  under 
medication  were  calculated  for  173  substances. 
Additionally,  Lienert  et  al.  (2007a)  determined  the 
excretion  rates  per  person  for  212  active 
substances  along  Swiss  standards  (Fehler! 
Verweisquelle  konnte  nicht  gefunden  werden. 
Table  1  shows  roughly  the  variations  of  excretion 
possible  among  the  different  active  agents  as  well 
as  it  points  out  the  fractions  of  unchanged  and 
metabolized substances. 
 
Overall,  it  has  to  be  pointed  out  that  the  effect  of 
storage,  induced  by  pH  augmentation  due  to 
ureolysis  (Udert  et  al.,  2003),  remains  uncertain. 
Such  as  Butzen  et  al.  (2005)  detected  efficient 
removal  for  diclofenac  after  six  month;  for  further 
pharmaceuticals  partial  removal  at  different  pH 
levels.  In  contradiction  to  these  findings,  Gajurel 
(2007)  did  not  find  any  decay  of  clofibric  acid, 
carbamazepine,  diclofenac,  and  ibuprofen  in 
spiked  urine  during  a  one  year  storage  period 
under  all  investigated  storage  conditions. 
Preliminary  sampling  in  the  urine  storage  tanks  in 
Table 3. Excretion of 212 pharmaceuticals (Lienert et al., 2007a (modified)). Total percentages excreted via 
urine as well as substances excreted unchanged as parent compound as well as metabolized. 
  Total    Unchanged    Metabolized 
 
  min  av  max    min  av  max    min  av  max 
Excretion (%)    0  64  100    0.1  35  100    1  42  124 
SD (N)    ±27% (212)    ±33% (132)    ±28% (57) 
“av” determined average of the collected data (for details see Lienert et al., 2007a); “SD” stands for standard deviation; 
“N” stands for sample size.
Pharmaceutical Residues in Urine as Fertiliser  
Sustainable Sanitation Practice  20  Issue 3 /2010 
 
the  GTZ  headquarters  in  Eschborn,  Germany, 
indicated  similar  tendency.  Several  beta‐blockers 
and antibiotics were found in urine stored for more 
than  1.5  years  (Montag  and  Schürmann,  2010; 
Institute  for  Environmental  Engineering,  RWTH 
Aachen; personal communication). This finding will 
be  followed  up  within  investigations  regarding  the 
storage  behaviour  of  active  substances  performed 
by the RWTH Aachen within the project SANIRESCH 
(2010).  Hence,  it  has  to  be  concluded  that 
pharmaceutical  residues  are  present  in  urine  after 
storage and have to be kept in mind when it comes 
to reuse in agriculture. 
 
Uptake  and  effects  of  pharmaceutical 
residues towards plants 
Plant experiments 
Figure 3. Overall dry weight of plant parts of rye 
grass determined during the full growth period. n = 
natural concentration (white bars), a = artificial 
concentration (grey bars). “Control 1” indicates 
plants treated with MeOH and urine, “Control 2” 
did not receive any application beside water; “3” is 
the designation for the combination of CZ, IBU, and 
EE2 (Winker, 2009). 
Greenhouse experiments in pots 
The fertilising effect of urine is clearly documented 
(Muskolus,  2008;  von  Münch  and  Winker,  2009) 
but nearly no investigations focused on application 
of  pharmaceuticals  by  urine  except  Schneider 
(2005) and Winker (2009). In the results presented 
here  the  focus  is  laid  on  uptake  of  certain 
pharmaceuticals  by  rye  grass.  Schneider  (2005) 
applied  diclofenac,  sulfamethoxazole  or 
sulfamethazine  but  in  concentrations  5*10
5
 
(diclofenac)  and  9*10
5
  (sulfamethoxazole)  higher 
than  expected  for  an  average  German urine  (AGU, 
Winker  et  al.,  2008b)  while  sulfamethazine  is  not 
even  present  in  AGU  at  all.  Winker  et  al.  (2010a) 
applied  carbamazepine  (CZ),  ibuprofen  (IBU),  and 
17α‐ethinylestradiol  (EE2)  alone  and  in 
combinations  in  the  expected  natural  as  well  as 
higher dosed concentrations of those in AGU. 
 
f  aerial  plant  matter  (Figure  2)  was  identified  for 
the entire 3 months experimental period. No visual 
effects  were  observed  except  Control  2  which 
received  only  irrigation  water  without  nutrients 
and  thus  showed  only  about  25%  of  the  biomass 
production  compared  to  the  fertilised  grass.  The 
lack of fertilisation led to a large weight reduction. 
The  overall  dry  matter  of  all  plants  fertilised  with 
urine  did  not  show  any  effect  irrespective  of  the 
kind  and  concentrations  of  added  pharmaceutical 
(Figure 2). 
 
IBU  and  EE2  could  not  be  detected  in  any  soil 
sample  after  the  3‐month  growing  period.  In 
contrast  to  IBU,  CZ  was  detected  in  all  pots 
irrespective  the  concentration  level.  On  average, 
49%  of  the  applied  CZ  was  recovered  3  months 
after  application.  In  plants,  only  CZ  could  be 
detected  at  artificial  concentrations  (10  times 
higher than expected in AGU). CZ concentrations in 
roots  showed  a  mean  concentration  of 
225 μg/kg DM while a mean of 4950 μg/kg DM was 
reached  in  aerial  plant  parts.  This  correlates  to  an 
average of 0.21% of the total amount of CZ applied 
to each pot was found in the roots of rye grass, but 
30% in the aerial plant parts. 
 
Germination experiments 
Plants  show  their  highest  sensitivity  as  seedlings. 
Therefore,  this  development  stage  is  very 
appropriate  for  investigations  regarding  potential 
pollutants.  Germination  tests  of  cress  and  four 
different  cereals  (Winker  et  al.,  2010b)  were 
performed  where  the  seeds  were  germinated  in 
urine‐water mix containing one up to five different 
pharmaceutical  substances  in  raising 
concentration. 
 
The  seedlings  show  sensitivity  against 
pharmaceutical  agents  (Table  2;  Winker  et  al., 
2008b).  The  sensitivity  lies  far  above  the 
concentration  levels  expected  in  average  German 
urine.  In  the  most  cases  the  sensitivity  lies  even 
above  the  investigated  range  of  concentrations. 
Apart,  the  urine  matrix  itself  is  much  more 
Pharmaceutical Residues in Urine as Fertiliser  
Sustainable Sanitation Practice  21  Issue 3 /2010 
Table 4. Influence on dry weight of the seedlings by addition of one active agent. “>” indicates that the 
limiting concentration causing an effect was not reached and lies most likely above the tested level (Winker 
et al., 2010b). 
affecting  the  seedlings  due  to  its  specific  matrix 
than  the  active  agents.  Nevertheless,  in  certain 
cases  reactions  of  seedlings  towards  the 
pharmaceutical  substances  could  be  observed. 
Overall,  it  can  be  concluded  that  the  potential 
effect  of  pharmaceutical  substances  contained  in 
urine  towards  plants  cannot  be  determined  in 
germination experiments. 
Literature review 
As  already  stated,  nearly  no  literature  is  available 
on  the  uptake  and  effect  of  pharmaceuticals  by 
plants spread via urine. Nevertheless, research was 
done  regarding  the  uptake  of  several  active 
substances  and  their  effects.  Data  from  literature 
show  that  plants  are  generally  able  to  take  up 
pharmaceuticals  (Winker  et  al.,  2008a).  The 
concentrations  usually  detected  in  plant  parts  are 
in  the  range  of  ng/kg.  Pharmaceuticals  have  also 
been  found  in  edible  plant  parts  such  as  carrot 
roots  and  cereal  grains  (Dolliver  et  al.  (2007)  and 
Boxall et al. (2006)). In addition, Brian et al. (1951) 
and  Stokes  (1954)  reported  excretion  of 
griseofluvin  via  guttation  drops  at  the  leaf  apex  of 
wheat seedlings. The rate of movement in plants is 
influenced  directly  by  rate  of  transpiration,  which 
in  turn  is  affected  by  air  humidity  and 
temperature.  This  finding  leads  to  two 
contradictory  assumptions.  On  the  one  hand, 
pharmaceuticals accumulate in leaves (Brian et al., 
1951;  Stokes,  1954),  and  higher  uptake  rates  have 
been found in older leaves (Grote et al., 2004). On 
the  other  hand,  leaves  are  able  to  secrete 
pharmaceuticals  (Brian  et  al.,  1951;  Stokes,  1954) 
and  to  degrade  organic  chemicals  taken  up,  in  a 
process  comparable  to  liver  metabolism  (Komoßa 
et  al.,  1995).  Moreover,  Kumar  et  al.  (2005) 
reported  that  the  correlation  between  the 
concentration  applied  and  uptake  is  nearly  linear, 
but it is currently impossible to generalise on these 
findings. 
 
Pharmaceutical concentrations in plants depend on 
amounts  of  pharmaceuticals  available  in  the 
respective  growth  medium.  Mapping  of  naturally 
occurring  concentrations  in  plant  parts  is  nearly 
impossible.  The  literature  screening  performed 
(Winker,  2009)  identified  studies  which  could  be 
split  into  45  datasets  (DS)  reporting  9 
pharmaceuticals.  All  studies  were  performed  with 
concentrations  above  those  expected  by  urine.  In 
18  datasets  application  rates  were  2‐182  times 
higher than those expected to be reached by urine 
fertilisation  (see  Table  3,  ratio  DS/AGU)  and  for  8 
of these datasets bioaccumulation or phytotoxicity 
was  reported.  The  others  showed  DS/AGU  ratios 
between  2*10
3
  (chlorotetracylcine  (Patten  et  al., 
1980)  and  2*10
8
  (chlorotetracycline  (Jacobsen  et 
al., 2004) and were thus too high to be of help for 
an evaluation of fertilization with urine. 
 
Pharmaceuticals  also  cause  phytotoxic  effects 
depending  on  the  concentration  of  the 
pharmaceutical  substance  resulting  in  a  change  of 
colour to darker green  (Grote et  al., 2004); lacking 
and  incomplete  colouring  (von  Euler,  1948;  Rosen, 
1954);  lower  chlorophyll  content  in  leaves  (von 
Euler  and  Stein,  1955);  as  well  as  hard  and  waxy 
leaves  (Rosen,  1954).  Moreover,  Rosen  (1954) 
reported  a  lack  of  lateral  root  development 
subsequent  to  pharmaceutical  exposure  and  von 
Euler (1948) found thickened coleoptiles. 
 
Studies  have  shown  that  different  plant  species 
have  differing  sensitivity  levels  towards  the  same 
pharmaceutical.  However,  it  must  be  pointed  out 
that  many  articles  were  published  20  to  30  years 
ago  and  the  sensitivity  and  selectivity  of  chemical 
analyses  at  that  time  was  somewhat  lower. 
Furthermore,  it  is  not  possible  to  extend  these 
conclusions  to  long‐term  effects  in  general,  as 
most  tests  described  in  the  literature  did  not  last 
for a whole growing season. 
Substance  Cress  Winter wheat  Winter rye*  Winter barley  Oat 
EE2 
>1.000.000 
fold 
> 1000 fold  >1000 fold  >1000 fold  > 1000 fold 
E2  >10.000 fold  > 1000 fold  >1000 fold  > 1000 fold  > 1000 fold 
CZ  >10.000 fold  > 1000 fold  AGU conc.  >1000 fold  > 1000 fold 
PI 
10 fold 
‐ better 
> 1000 fold 
1000 fold 
‐ worse 
>1000 fold  > 1000 fold 
IBU  >1000 fold  > 1000 fold 
1000 fold 
‐ better 
> 1000 fold  > 1000 fold 
* “worse”: the concentration let to a negative effect of the dry weight; “better”: the concentration let to a statistically 
relevant increase of the dry weight. 
Pharmaceutical Residues in Urine as Fertiliser  
Sustainable Sanitation Practice  22  Issue 3 /2010 
Table 5. The 8 datasets reporting concentration similar to those in the case of urine fertilisation (DS/AGU ratio 
<200) which showed phytotoxic or bioaccumulative effects (Winker, 2009). 
Substance  Plant species  Reported impacts1 
Concentration 
applied  
Ratio 
DS/AGU2 
Ref. 
Chloroquine  soybean 
Phytotoxic: negative impact on w, h, r, 
s, l  (13 d after germination) 
8000 ng/kg  182  Jjemba, 2002 
Chlorotetracycline  spring wheat 
Phytotoxic: positive impact on h, r  
(27 d after germination) 
160 ng/kg  82  Batchelder, 1982 
Chlorotetracycline  pinto bean 
Phytotoxic: negative impact on w, h, r, 
s, l  (45 d after germination) 
160 ng/kg  82  Batchelder, 1982 
Chlorotetracycline  green onion 
Uptake: 0.013 ng/kg FW in s and l 
(42 d after transplantation) 
100 ng/kg  51 
Kumar et al., 
2005 
Chlorotetracycline  cabbage 
Uptake: 0.01 ng/kg FW in s and l (42 d 
after transplantation) 
Kumar et al., 
100 ng/kg  51 
2005 
Phytotoxic: negative impact on w, h, r, 
Metronidazole  soybean  2000 ng/kg DM  67  Jjemba, 2002 
s, l  (13 d after germination) 
Phytotoxic: positive impact on h, r  
Oxytetracycline  spring wheat  160 ng/kg  2  Batchelder, 1982 
(27 d after germination) 
Phytotoxic: negative impact on w, h, r, 
Oxytetracycline  pinto bean  160 ng/kg  2  Batchelder, 1982 
s, l  (45 d after germination) 
1
 Letters denote weight (w), height (h), roots (r), stalk (s), and leaves (l). 
2
 "Ratio DS/AGU" describes the concentration applied in the specific investigation summarised in one dataset (DS) related 
to  the  pharmaceutical  concentration  calculated  to  be  reached  in  case  of  urine  application.  DS/AGU  =  1  describes  equal 
conditions,  <1/>1  implies  that  lower/higher  concentrations  would  be  applied  by  a  fertilisation  with  urine  under  the 
described conditions. (March 16, 2008).

Importance of the topic in societies 
The  reaction  of  societies  varies  when  they  are 
confronted  with  the  issue  of  urine‐fertilised  crops. 
The  concerns  regarding  pharmaceutical  residues 
differ  between  the  different  stakeholders.  A  very 
important  stakeholder  group  are  farmers.  In 
Switzerland,  a  high  percentage  of  farmers  (57%) 
would  accept  urine  as  fertiliser  (Lienert  et  al., 
2003). For them, the fate of pharmaceuticals in the 
environment  is  one  of  the  concerns  mentioned. 
Approx. 80% of Swedish farmers were interested in 
using  urine  as  fertiliser  (Tidåker  et  al.,  2004).  The 
issue  of  spreading  pathogens  and  pharmaceutical 
residues  to  the  fields  via  any  sewage  product  was 
the second highest concern after heavy metals and 
other  organic  compounds.  Nevertheless,  as 
pathogens  or  pharmaceutical  residues  were 
grouped  it  remained  unclear  which  of  the  two 
aspect  were  in  their  major  focus.  Muskolus  (2008) 
interrogated  farmers  around  Berlin.  They  tend  to 
react  conservatively  when  confronted  with  the 
issue.  Only  one  quarter  of  participating  farmers 
expressed  a  positive  attitude  towards  urine  as 
fertiliser.  
 
Users  of  urine‐diverting  systems  or  potential 
consumers  of  agricultural  products  fertilised  with 
urine  were  interrogated  in  several  studies. 
Amongst  the  users  of  urine  diversion  flush  toilets 
at  GTZ  headquarters  (Blume  and  Winker,  2010)  a 
remarkable 90% of the participants (218 persons of 
900  responded;  Blume  and  Winker,  2010)  were 
positive  towards  the  idea  of  urine  reuse  in 
agriculture.  71%  stated  explicitly  that  they  would 
buy  crops  which  have  been  fertilised  with  human 
excreta according to WHO guidelines (WHO, 2006). 
Other  studies  showed  similar  results.  Muskolus 
(2008)  interviewed  inhabitants  in  Berlin  as  well  as 
people  with  an  agricultural  background,  and  62% 
of  both  groups  stated  that  they  would  buy  food 
produced with urine as fertiliser. 
 
Samwel  (WECF,  www.wecf.org;  personal 
communication)  reported  a  varying  attitude  in 
Easter  European  and  Central  Asian  countries: 
Acceptance  depends  very  much  upon  the 
awareness  of  the  issue  by  involved  authorities.  In 
the  Ukraine  and  Romania,  members  of  the 
authorities  responsible  for  hygiene  and 
environment  do  reject  the  usage  of  urine  due  to 
the  risk  of  spreading  pharmaceutical  residues.  A 
major constraint is the lack of legal frameworks for 
UDDTs  and  reuse.  In  Central  Asia  and  the 
Caucasian  region,  implementation  of  urine 
diversion  systems  and  reuse  of  urine  are  well 
accepted  by  the  authorities.  For  example  in 
Western  Georgia  and  Northern  Kyrgyzstan  urine 
diversion  systems  are  very  welcome  due  to  high 
groundwater levels – normal pits simply fill up with 
water.  Moreover,  when  a  community  is  well 
informed,  Samwel  (2010;  WECF,  www.wecf.org; 
personal  communication)  observed  also  that 
groundwater protection can be a strong driver.  
 
Pharmaceutical Residues in Urine as Fertiliser  
Sustainable Sanitation Practice  23  Issue 3 /2010 
Sinar (2008) showed that apart from appearance of 
pharmaceutical residues in urine, it is important to 
investigate  a  societies’  attitude  on  pharmaceutical 
consumption  and  that  a  difference  between  rural 
and  urban  areas  might  exist.  In  Ghana,  the 
frequently  used  pharmaceutical  groups  (often 
referred  to  as  indications)  are  antimalarials, 
antibiotics,  analgesics,  antifungals  and 
antihelminthics;  in  urban  areas  pharmaceuticals 
addressing  diabetes  and  cardiovascular  diseases 
are  also  consumed  (Sinar,  2008).  While  in  Ghana, 
consumption  of  contraceptives  is  negligible,  they 
most  likely  play  a  major  role  in  Peru.  17α‐
ethinylestradiol  is  available  for  all  women  for  free 
and  very  popular  (Webb  and  Fernández  Baca, 
2006)  as  a  result  of  the  family  planning  below 
president Fujimori. 
Conclusion 
If  urine  is  reused  in  agriculture,  some  of  the 
pharmaceutical residues will be taken up by plants 
and  thereby  enter  the  human  food  chain.  This  is 
expected  especially  for  polar  and  hardly 
biodegradable  substances.  A  full  evaluation  of  the 
potential  toxic  effects  of  pharmaceuticals  ingested 
by humans via urine‐fertilised crops is very difficult 
and has not yet been done.  
 
Moreover,  research  carried  out  so  far  shows  that 
the  expected  concentrations  of  pharmaceutical 
residues  in  average  urine  do  not  reach 
concentration levels which affect plant growth and 
development. This finding can be supported by the 
fact  that  the  load  of  hormones  and  antibiotics  in 
human  urine  are  much  lower  than  in  animal 
manure which is already used in agriculture. 
 
Overall, it can be concluded with the statement of 
Jörn  Germer  (cited  in  von  Münch  and  Winker 
(2009))  that  “Drug  residues  in  sustainable 
sanitation  products  used  to  supply  plant  nutrients 
can  hardly  be  a  serious  issue  in  regions  where 
malnutrition,  groundwater  and  surface  water 
pollution  due  to  inappropriate  sanitation  and 
irrigation with untreated wastewater is a reality”. 
 
 
References 
Batchelder,  A.  (1982):  Chlortetracyline  and  oxytetracycline 
effects  on  plant  growth  and  development  in  soil  systems.  J 
Environ Qual, 11(4), 675‐678. 
Blume,  S.,  Winker,  M.  (2010):  Three  years  of  operation  of  the 
urine‐diversion system in GTZ headquaters in Germany; user 
opinions and maintenance challanges. In: IWA Conference on 
Sustainable  solutions  for  small  water  and  waterwater 
treatment systems, 19‐22 April 2010, Girona, Spain. 
Boxall,  A.,  Johnson,  A.,  Smith,  E.,  Sinclair,  C.,  Stutt,  E.,  Levy,  L. 
(2006): Uptake of veterinary medicines from soils into plants. 
J Agric Food Chem, 54(6), 2288‐2297. 
Brian,  P.,  Wright,  J.,  Stubbs,  J.,  Way,  A.  (1951):  Uptake  of 
antibiotic  metabolites  of  soil  microorganisms  by  plants. 
Nature, 167(4244), 347‐349. 
Butzen,  A.,  Werres,  F.,  Balsaa,  P.  (2005):  Aufbau  und  Einsatz 
einer  problemorientierten  Analytik  mit  dem  Ziel  eines 
Monitorings  ausgewählter  Pharmaka  in  Böden  und  Urin. 
Bonner Agrikulturchemische Reihe, 21, 25‐54. 
Ciba Geigy AG (1977): Teilband Körperflüssigkeiten. In: Lentner, 
C.  (editor),  Wissenschaftliche  Tabellen  Geigy,  8th  edition, 
CIBA‐GEIGY AG, Basel, Switzerland, pp. 51‐97. 
Dolliver, H., Kumar, K., Gupta, S. (2007): Sulfamethazine uptake 
by  plants  from  manure‐amended  soil.  J  Environ  Qual,  36(4), 
1224‐1230. 
Gajurel,  D.  (2007):  Investigation  of  elimination  of  selected 
pharmaceuticals  in  urine  during  storage,  by  UV  irradiation 
and  by  ozonsation  (in  German),  report,  DFG‐
Förderkennzeichen:  GA  1063/2‐1,  Institute  of  Wastewater 
Management  and  Water  Protection,  Hamburg  University  of 
Technology,  Hamburg,  Germany.  URL:  http://www.tu‐
harburg.de/aww/forschung/pdf/endbericht_dfg01.pdf 
Grote,  M.,  Freitag,  M.,  Betsche,  T.  (2004):  Antiinfektivaeinträge 
aus  der  Tierproduktion  in  terrestrische  und  aquatische 
Kompartimente,  Ministerium  für  Umwelt  und 
Naturschutz,L.u.V.d.L.N.‐W., Germany. 
Jacobsen,  A.,  Halling‐Sørensen,  B.,  Ingerslev,  F.,  Hansen,  S. 
(2004):  Simultaneous  extraction  of  tetracycline,  macrolide 
and  sulfonamide  antibiotics  from  agricultural  soils  using 
pressurised  liquid  excretion,  followed  by  solid‐phase 
extraction  and  liquid  chromatography‐tandem  mass 
spectrometry. J Chromatogr, 1038(1‐2), 157‐170. 
Jjemba,  P.  (2002):  The  effect  of  chloroquine,  quinacrine,  and 
metronidazole  on  both  soybean  plants  and  soil  microbiota. 
Chemosphere, 46(7), 1019‐1025. 
Komoßa, D., Langebartels, C., Sandermann, H. (1995): Metabolic 
processes  for  organic  chemicals  in  plants.  In:  Trapp,  S.  and 
Mc  Farlane,  J.  (editors):  Plant  contamination,  Lewis 
Publishers, Boca Raton, Florida, USA, pp. 69‐103. 
Kumar, K., Gupta, S., Chander, Y., Singh, A. (2005): Antibiotic use 
in  agriculture  and  its  impact  on  the  terrestrial  environment. 
Adv Agron, 87, 1‐54. 
Larsen,  T.,  Gujer,  W.  (1996):  Separate  management  of 
anthropogenic  nutrient  solutions  (human  urine).  Water  Sci 
Technol, 34(3‐4), 87‐94. 
Lienert,  J.,  Bürki,  T.,  Escher,  B.  (2007a):  Reducing 
micropollutants  with  source  control:  substance  flow  analysis 
of 212 pharmaceuticals in feces and urine. Water Sci Technol, 
56(5), 87‐96. 
Lienert,  J.,  Güdel,  K.,  Escher,  B.  (2007b):  Screening  method  for 
ecotoxicological  hazard  assessment  of  42  pharmaceuticals 
considering  human  metabolism  and  excretory  routes. 
Environ Sci Technol, 41(12), 4471‐4478. 
Lienert,  J.,  Haller,  M.,  Berner,  A.,  Stauffacher,  M.,  Larsen,  T. 
(2003):  How  farmers  in  Switzerland  perceive  fertilizers  from 
recycled  anthropogenic  nutrients  (urine).  Water  Sci  Technol, 
48(1), 47‐56. 
Mauer,  M.,  Pronk,  W.,  Larson,  T.  (2006):  Treatment  processes 
for source‐separated urine. Water Res, 40(17), 3151‐3166. 
Muskolus, A. (2008): Anthropogenic plant nutrients as fertiliser, 
PhD  thesis,  Institut  für  Pflanzenbauwissenschaften, 
Humboldt‐Universität  zu  Berlin,  Berlin,  Germany.  URL: 
http://edoc.hu‐berlin.de/dissertationen/muskolus‐andreas‐
2008‐04‐18/PDF/muskolus.pdf 
Otterpohl,  R.  (2002):  Options  for  alternative  types  of  sewerage 
and  treatment  systems  directed  to  improvement  of  the 
overall performance. Water Sci Technol, 45(3), 149‐158. 
Patten,  D.,  Wolf,  D.,  Kunkle,  W.,  Douglass,  L.  (1980):  Effect  of 
antibiotics  in  beef  cattle  feces  on  nitrogen  and  carbon 
Pharmaceutical Residues in Urine as Fertiliser  
Sustainable Sanitation Practice  24  Issue 3 /2010 
mineralization in soil and on plant growth and composition. J 
Environ Qual, 9(1), 167‐172. 
Rosen,  W.  (1954):  Effects  of  streptomycin  on  certain  green 
plants. The Ohio Journal of Science, 54(2), 73‐78. 
SANIRESCH  (2010):  Website  of  the  BMBF  project 
SanitaryRecycling  Eschborn,  German  Technical  Cooperation, 
Eschborn, Germany, http//:www.saniresch.de (date of visit: 1 
February 2010). 
Schneider,  R.  (2005):  Pharmaka  im  Urin:  Abbau  und 
Versickerung  vs.  Pflanzenaufnahme.  In:  Bonner 
Agrikulturchemische Reihe, 21, Bonn, Germany, pp.54‐81. 
Sinar, E. (2008): Pharmaceuticals in human sanitary products for 
use  in  tropical  agriculture.  Master  thesis,  University  of 
Hohenheim,  Stuttgart,  Germany. 
http://www2.gtz.de/Dokumente/oe44/ecosan/en‐
pharmaceuticals‐human‐sanitary‐2008.pdf. 
Stokes,  A.  (1954):  Uptake  and  translocation  of  griseofulvin  by 
wheat seedlings. Plant Soil, 5(2), 132‐142. 
Strompen, S., Werres, F., Balsaa, P., Overath, H. (2003): Analytik 
polarer  Arzneimittelrückstände  in  Urinproben  einschließlich 
der  Entwicklung  der  hierzu  notwendigen  adäquaten 
Verfahren  mittels  GC‐MS/MS.  In:  Wupperverband:  Das 
Projekt  Lambertsmühle:  Zukunftsfähiges 
Abwassermanagement  im  ländlichen  Raum?,  Remscheid, 
Germany, pp.32‐53. 
Tettenborn,  F.,  Behrendt,  J.,  Otterpohl,  R.  (2007):  Resource 
recovery and removal of pharmaceutical residues. Treatment 
of  separate  collected  urine  within  the  EU‐funded  SCST‐
project,  Institute  of  Wastewater  Management  and  Water 
Protection,  Hamburg  University  of  Technology,  Hamburg, 
Germany. 
Tidåcker,  P.,  Sjöberg,  C.,  Jönsson,  H.  (2004):  The  use  of  sewage 
fertiliser  products  on  arable  land  requirements  from  the 
farmers' perspective. In: Werner, C., et al. (editors): "Ecosan ‐ 
closing  the  loop"  ‐  Proceedings  of  the  2nd  International 
Symposium on ecological sanitation, 7‐11 April 2003, Lübeck, 
Germany, pp.455‐462. 
Udert,  K.,  Larsen,  T.,  Biebow,  M.,  Gujer,  W.  (2003):  Urea 
hydrolysis  and  precipitation  dynamics  in  a  urine‐collecting 
system. Water Res, 37, 2571‐2582. 
Vinnerås,  B.,  Clemens,  J.,  Winker,  M.  (2008):  Non‐metallic 
contaminants  in  domestic  waste,  wastewater  and  manures: 
constraints to agricultural use. In: The International Fertiliser 
Society, Proceedings, 641, United Kingdom, pp.1‐31. 
von  Euler,  H.  (1948):  Nukleinsäuren  als  Wuchsstoffe  in 
Gegenwart  von  Colchicin  und  von  Streptomycin.  Arkiv  för 
kemi, mineralogi och geologi, 25 A(8), 1‐9. 
von  Euler,  H.,  Stein,  M.  (1955):  Einfluss  von  Streptomycin  und 
von Tetracyclinen auf die Entwicklung keimender Samen. Cell 
Mol Life Sci, 11(3), 108‐110. 
von Münch, E., Winker, M. (2009): Technology Review on Urine 
diversion  components.  Overview  of  urine  diversion 
components such as waterless urinals, urine diversion toilets, 
urine  storage  and  reuse  systems.  German  Technical 
Cooperation  (GTZ)  GmbH,  Eschborn,  Germany.  URL: 
http://www.gtz.de/en/dokumente/gtz2009‐en‐technology‐
review‐urine‐diversion.pdf 
Webb,  R.,  Fernández  Baca,  G.  (2006):  Anuario  Estadístico:  Perú 
en Números 2006. Instituto Cuánto, Lima, Peru. 
WHO  (2006):  WHO  Guidelines  for  the  Safe  Use  of  Wastewater, 
Excreta and Greywater. Volume 4: Excreta and greywater use 
in  agriculture.  World  Health  Organisation,  Geneva, 
Switzerland,  http://www.who.int/water_sanitation_health/ 
wastewater/gsuweg4/en/index.html  (date  of  visit:  1 
February 2010). 
Winker,  M.  (2009):  Pharmaceutical  residues  in  urine  and 
potential  risks  related  to  usage  as  fertiliser  in  agriculture. 
PhD thesis, Institute of Wastewater Management and Water 
Protection,  Hamburg  University  of  Technology,  Hamburg, 
Germany.  URL:  http://doku.b.tu‐
harburg.de/volltexte/2009/557/ 
Winker, M., Behrendt, J., Otterpohl, R. (2008a): Pharmaceuticals 
in  the  environment  ‐  an  overview  via  database  (in  German). 
In:  Fachhochschule  Lübeck:  20.Norddeutsche  Tagung  für 
Abwasserwirtschaft  und  Gewässerentwicklung,  20,  Lübeck, 
Germany, pp.41‐50. 
Winker,  M.,  Clemens,  J.,  Reich,  M.,  Gulyas,  H.,  Otterpohl,  R. 
(2010a):  Ryegrass  uptake  of  carbamazepine  and  iburpofen 
applied  by  urine  fertilization.  Sci  Tot  Environ,  408(8),  1902‐
1908. 
Winker,  M.,  Dimova,  D.,  Ritter,  K.,  Otterpohl,  R.,  Clemens,  J. 
(2010b):  Effect  of  five  pharmaceutical  substances  contained 
in urine on the germination of cress and cereal seedlings. In: 
IWA Conference on Sustainable solutions for small water and 
waterwater  treatment  systems,  19‐22  April  2010,  Girona, 
Spain. 
Winker,  M.,  Tettenborn,  F.,  Faika,  D.,  Gulyas,  H.,  Otterpohl,  R. 
(2008b):  Comparison  of  analytical  and  theoretical 
pharmaceutical  concentrations  in  human  urine  in  Germany. 
Water Res, 42(14), 3633‐3640. 
 
 
e‐mail: martina.winker@gtz.de 
Name: Martina Winker
Organisation: German Technical Cooperation 
(GTZ) GmbH, Sustainable sanitation – ecosan 
program 
Town, Country: Eschborn, Germany 
 
Sustainable Sanitation Practice  25  Issue 3 /2010 
 
 
 
implementing 
organisation: 
 
Backyard Urine Recycling in the United 
States of America: An Assessment of 
Methods and Motivations  
This  paper  discusses  the  newly  emerging  urine  harvesting  movement  in  the 
United States of America. 
Authors: L. Allen, J. Conant
 
Abstract 
In  the  United  States  of  America  awareness  and  practice of  ecological  sanitation  is  in  its  infancy.  In this  article 
we  briefly  assess  the  urine  harvesting  practices  of  a  small  group  of  individuals  in  the  San  Francisco  Bay  Area, 
California, Portland, Oregon, and coastal Massachusetts. Though there are no coordinated or sponsored urine 
harvesting projects, a few Americans, learning primarily from the international urine harvesting community, as 
well  as  from  historic  practices,  are  beginning  to  implement  individual‐scale,  “backyard”  urine  harvesting 
projects. We found that urine reuse is gaining in popularity, is accepted in certain social groups, and that urine 
harvesters  have  seen  exceptionally  beneficial  results  from  using  the  urine  fertilizer.  Urine  harvesting  seems  a 
good  first  step  towards  ecological  sanitation  practices  because  it  is  legal  in  the  United  States,  whereas  other 
practices are not. Some U.S. regulations are now changing around ecological sanitation practices, which bodes 
well for a trend toward greater acceptance of urine recycling and other ecological sanitation practices. 
 
 
Introduction 
In  the  United  States  of  America,  despite  advanced 
technology,  high  levels  of  education,  and  growing 
concern  about  environmental  sustainability, 
awareness  and  practice  of  ecological  sanitation  is 
in  its  infancy.  In  this  article  we  briefly  assess 
residential‐scale  ecological  sanitation  practices  in 
the  USA  by  focusing  on  the  urine  harvesting 
practices of a small but active, and representative, 
group of individuals in the San Francisco Bay Area, 
California, Oregon, and Massachusetts.  
 
Urine  harvesting  practices  in  the  USA  are  growing 
from  the  grassroots  level.  Though  there  are  no 
coordinated  or  sponsored  urine  harvesting 
projects,  a  few  Americans,  learning  primarily  from 
the  international  urine  harvesting  community,  as 
well  as  from  historic  practices,  are  beginning  to 
implement  individual‐scale,  “backyard"  urine 
harvesting  projects.  We  believe  there  is  similar 
interest  and  practice  of  urine  harvesting  in  other 
parts of the USA as well. 
 
The  USA  have  a  long  history  of  composting  toilet 
use,  mainly  in  rural  areas  that  do  not  have  sewer 
or  septic  systems.  Traditionally,  American 
composting  toilets  have  not  separated  urine.  All 
manufactured  American  composting  toilets  today 
combine urine, except one, "Nature's Head", which 
is  designed  for  use  on  boats  and  has  only  been 
available  since  2007  (Nature's  Head,  2010).  The 
most  popular  book  on  the  subject,  The  Humanure 
Handbook,  by  Joseph  Jenkins  (Jenkins,  2005;  first 
edition  1994,  now  in  its  3
rd
  edition),  advocates 
combined  sources,  though  most  rural  compost 
toilet users encourage people to "pee outside" and 
not in the toilet.
 
There is only one book about urine 
harvesting  from  the  USA  (Steinfeld,  2004)  which 
includes information on the global urine harvesting 
Key messages: 
 Urine reuse is practiced in the United States of America even though there are no coordinated projects 
 Urine is socially accepted in certain social groups  
 Urine recycling is gaining popularity  
 Regulations are changing around sustainable sanitation practices 
 Urine recycling is legal, contrary to popular belief 
 International information on urine recycling could spur growth of USA's urine adoption 
Backyard urine recycling in United States of America 
Sustainable Sanitation Practice  26  Issue 3 /2010 
movement,  as  well  as  a  few  examples  from  the 
USA  s.  A  few  public  examples  of  urine  diverting 
toilets  are  found  across  the country,  including one 
at  the  office  of  2020  Engineering  in  Bellingham, 
Washington. Currently, there are plans to build the 
largest  urine  diverting  project  in  the  U.S.  in  a 
future  six  story  building  in  Seattle,  Washington,  at 
the  headquarters  of  the  Bullitt  Foundation  (Pryne, 
2010). 
 
During  January  2010,  we  conducted  interviews 
with  seven  individuals  in  the  San  Fransisco  Bay 
Area, California, and two individuals in other states 
who  practice  some  form  of  urine  recycling 
(capturing  and  using  urine  to  fertilize  plants). 
Systems  ranged  in  sophistication  from  a  simple  5 
gallon  (18.9  liter)  bucket  (Figure  1)  to  collection 
from  urine‐diverting  compost  toilets. Interviews 
with  urine  recyclers  covered  basic  quantitative 
aspects  (quantities  of  urine  collected  and  specific 
collection  methods),  as  well  as  qualitative  aspects 
(individuals’  motivation,  sources  of  information, 
observed  benefits,  and  social  acceptance  of  the 
practice). 
 
The  results  of  the  interviews  show  that  people 
have  learned  from  a  variety  of  sources,  with  the 
international  ecological  sanitation  movement 
being  a  major  one. Urine  recyclers  expressed  the 
belief  that  American  society  in  general  holds  an 
unfavorable view of the practice, but reported that 
among  their  friends  and  colleagues  there  is  much 
interest  and  acceptance.  Though  the  scope  of  this 
study  is  extremely  limited  by  the  small  number  of 
interviews  conducted,  the  information  about 
successes  and  challenges  leads  to  a  few 
preliminary  suggestions  for  best  management 
practices,  and  highlights  an  undocumented 
segment  of  the  ecological  sanitation  movement: 
Americans. 
 
Urine  reuse  is  gaining  attention  at  the  global  level 
as scientists, agronomists, backyard gardeners, and 
development  professionals  look  to  this  universally 
available  substance  for  solutions  to  a  variety  of 
water  and  sanitation  problems.  Urine  collection 
reduces  toilet  water  use  by  as  much  as  80%  by 
decreasing    flushes  (Larsen,  et.  al.,  2001),  and 
reduces energy needed by sewer treatment plants 
to  remove  nitrogen  (Wilsenach  and  van 
Loosdrecht, 2006). Plant nutrients, mainly nitrogen 
and  phosphorus,  can  be  captured  from  urine  and 
used as agricultural fertilizer, reducing demand for 
chemical  fertilizers.  Composting  toilets  that 
separate urine from feces can be easier to manage 
and  have  fewer  odor  problems  than  non‐
separating  composting  toilets,  as  they  contain  less 
liquid.
  
 
As  a  matter  of  public 
policy,  urine  reuse  can 
reduce  infrastructure 
costs  and  conserve 
energy.  Recent  research 
also shows that urine may 
be  an  efficient  source  of 
hydrogen  for  energy 
(Boggs et al. 2009). 
Figure 1: Fertilizing roses with 
urine. 
 
Urine  harvesting  projects  funded  by  international 
or  national  agencies  are  found  all  over  the  world, 
from  urine  diverting  flush  toilets  in  apartments  in 
Sweden  (Esrey,  S.  et  al.  1998),  and  the  GTZ 
headquarters  in  Germany  (GTZ,  2005),  to 
community‐scale  urine  collection  in  Tepoztlan, 
Mexico  (Esrey,  S.  et  al.  2001)  and  city‐scale  urine 
diverting dry toilets in Dongshen, China (SEI, 2004). 
 
For  backyard  gardeners,  urine  diverting  toilets 
provide  a  free  source  of  fertilizer  while  reducing 
household  water  consumption  due  to  fewer  toilet 
flushes. Each adult produces an estimated 1.5 liters 
per day, (WHO, 2006) which contains about 4 kg of 
nitrogen,  0.36  kg  phosphorus,  and  1  kg  potassium 
per  year.  This  amount  is  enough  to  fertilize  about 
300‐400  square  meters  of  crop  for  each  person 
(Jonsson  et.  al.  2004).  The  range  of  low‐cost 
options  for  collection  makes  backyard  urine  reuse 
accessible for all income levels and for both renters 
and homeowners.  
Legal aspects 
In  Alameda  County,  California,  where  we 
conducted most of our interviews, there is no legal 
code  that  specifically  prohibits  use  of  urine  or 
regulates  backyard  urine  use,  although  public 
perception  generally  views  it  as  unacceptable  or 
perhaps  illegal.  The  two  legal  regulatory  bodies 
that  could  potentially  regulate  backyard  urine  use 
are  the  state  plumbing  code,  which,  in  California, 
mandates one toilet per dwelling unit connected to 
either  a  private  septic  system  or  to  municipal 
sewerage  (IAPMO,  2007),  or  the  Environmental 
Health  Department,  which  regulates  a  large  range 
of concerns related to health and the environment. 
Staff  in  California’s  Environmental  Health 
Departments  reported  that  they  had  no 
regulations  on  urine,  and  had  never  been  asked 
about it's use before (Allen, 2010).  
Regulations  in  the  United  States  that  historically 
prohibited  legal  ecological  sanitation  practices  are  
changing.  In  2009  the  California  state  plumbing 
code,  which  regulates  greywater  reuse,  was 
revised  to  allow  for  simple  and  legal  grey  water 
reuse,  allowing  irrigation  of  edible  crops,  reducing 
Backyard urine recycling in United States of America 
Sustainable Sanitation Practice  27  Issue 3 /2010 
discharge depth, and waiving permit requirements 
for  very  simple  systems  from  washing  machines. 
Since  2001,  beginning  with  the  state  of  Arizona, 
drought‐affected  states  like  Arizona,  Texas,  and 
New  Mexico  have  revised  grey  water  standards, 
and  wetter  states  such  as  Oregon  are  revising 
standards  to  allow  for  legal  rainwater  reuse.  In 
addition,  composting  toilet  use  has  been  on  the 
rise  for  many  years  (While  there  is  a  lack  of 
quantified  growth  trends,  reports  in  the  media 
affirm  the  growth  in  use  and  interest  in  compost 
toilets:  see 
http://www.treehugger.com/files/2009/07/compo
sting‐toilets‐us‐cities.php,  and  http://www.carol‐
steinfeld.com/compostingtoilets.html  though  the 
regulations  around  it  in  most  states  remain 
prohibitive at worst, and unclear at best.  
 
Given  California’s  history  as  a  region  of  “early 
adopters”  and  cultural  visionaries,  it  is  not 
surprising  that  a  fledgling  ecological  sanitation 
movement should emerge here. It is also timely at 
the  current  moment,  as  California  has  been  in 
drought  for  three  consecutive  years.  According  to 
the  California  Drought  Center  the  last  two  water 
years  have  resulted  in  63  and  72  percent  of 
average  annual  precipitation  (CA  Department  of 
Water Resources, 2009). 
 
The  change  in  state  regulations  on  greywater 
reflects  a  growing  awareness  of  the  need  for 
increasing  water  efficiency  practices,  while  the 
practices  of  individual  urine‐recyclers  reflect  a 
growing  desire  for  more  progressive 
environmental policies. Urine harvesting is an easy 
first  step  for  individuals  concerned  about reducing 
water use and restoring natural cycles.  
 
The  law  presents  a  major  barrier  in  the  USA  to 
adoption  of  many  ecological  practices.  Many 
sustainable  practices,  like  greywater,  rainwater, 
and  composting  toilets,  are  illegal  under  local  and 
state  building  regulations.  Because  of  this,  early 
adopters  of  ecological  practices  in  the  United 
States  are  often  breaking  local  or  state  laws. 
Though  most  do  so  without  consequence,  there  is 
a  history  of  a  few  "pioneers"  being  fined,  losing 
property,  and  being  forced  to  remove  the 
unpermitted  projects  (Kettmanm,  2009).
  
Organizations are hesitant to attempt projects that 
break local laws, thus further slowing the progress 
of ecological sanitation implementation in the U.S. 
Residential urine harvesting falls outside of existing 
laws; with increasing knowledge about its benefits, 
and  legality,  more  users  will  be  able  to  implement 
the practice without fear of legal consequence. 
Motivation 
Nine  urine  recyclers  were  interviewed  during 
January  and  March,  2010.  Since  there  are  no 
sanctioned  urine  recycling  projects  in  the  USA, 
the  authors  found  the  participants  through 
networks  of  environmental  organizations.  The 
participants had a diverse range of occupations: a 
director  of  a  small  ecological  justice  non‐profit 
organization,  an  "eco‐artist"  and  dog  border,  an 
architect  specializing  in  green  design,  a  gardener 
and  public  park  employee,  a  supervisor  in  a 
construction  company,    an  ecological  designer,  a 
medical  program  manager,  a  small  businessman, 
and a statistician. 
 
The  nine  individuals  surveyed  range  between  27 
and  60  years  of  age;  live  in  cities  of  the 
metropolitan  Bay  Area:  Oakland,  Berkeley,  and 
San Francisco, or in Portland, Oregon, and coastal 
Massachusetts.    Five  of  the  nine  own  their 
homes,  while  four  are  renters.  The  average 
period  they  have  practiced  urine  recycling  is 
around  two  years,  though  one  individual  has 
maintained  the  practice  over  a  period  of  twelve 
years.  All  nine  survey  participants  voluntarily 
practice  other  forms  of  residential‐scale 
ecological  resource  stewardship,  including 
recycling  and  composting,  both  locally  common 
practices.  Most  are  innovators  in  other  ways: 
seven  of  the  nine  practice  some  form  of 
unregulated  grey  water  reuse,  while  two  of  the 
nine  collect  and  channel  some  portion  of  the 
rainwater  on  their  property  (also  an 
unsanctioned and unregulated practice). 
 
Given  the  propensity  of  this  group  to  engage  in 
ecological  practices,  it  is  not  surprising  that  their 
 
Figure 2: This "Pee‐pee‐ponics" system uses urine 
to water Figure and fertilize plants. Credit: Nik 
Bertulis 
Backyard urine recycling in United States of America 
Sustainable Sanitation Practice  28  Issue 3 /2010 
motivations  are  fairly  similar;  all  cited  “saving 
water”  or  “problems  with  sewers”  as  a  prime 
motivating  factor;  seven  cited  “fertilizer”  as  a 
primary factor, while four spoke of the importance 
of having a “free and available,” fertilizer, and that 
the  practice  itself  is  “simple  and  accessible,” 
“makes  sense,”  and  is  “a  good  way  to  turn  a 
problem  into  a  solution.”  One  cited  feeling  good 
that  "my  nutrients  are  being  cycled  without 
compromising further our stressed watershed" and 
"saving  energy  at  pumps  and  processing  at  the 
waste treatment facility." 
 
  
Due  to  the  lack  of  public  U.S.‐based  urine  reuse 
projects,  the  majority  of  individuals  learned  about 
and  were  inspired  to  practice  urine  harvesting 
from  ecological  sanitation  projects  in  other 
countries.  Five  attended  a  workshop  or  lecture 
where  they  learned  about  urine  recycling  projects 
in Mexico, Zimbabwe, Sweden, and China. The rest 
came  to  the  practice  through  the  experience  of 
“living rurally” (where regulations are more lax and 
outdoor  latrines  are  common),  growing  up  on  "a 
family  farm,"  or  simply  “not  wanting  to  flush  the 
toilet”  due  to  ecological  concerns.  These  people 
learned  about  the  fertilizing  benefits  later  on, 
through  informal  conversations  with  friends.  One 
person  began  collecting  urine  while  living  without 
a  flush  toilet  during  a  home  remodel,  but  didn't 
reuse  it  (he  poured  it  down  a  shower  drain)  until 
he  attended  a  lecture  and  learned  about  other 
people around the world fertilizing with urine.  
Figure 3: Urine cured this formerly sick 
lemon tree in San Francisco. 
Materials and methods 
A  variety  of  low‐tech  methods  were  used  to 
separate  the  urine.  Three  of  the  respondents  use 
pre‐fabricated  Separrette  urine‐diverting  inserts  in 
custom made compost toilets as shown in Figure 4 
and  5  (most  of  the  prefabricated  composting 
toilets  made  in  the  U.S.  do  not  separate  urine), 
while  the  other  five  use  homemade  systems 
ranging  from  “a  plastic  bucket”  (Figure  1)  and  “a 
yogurt  container”  to  “an  antique  urinal  that  was 
used  on  trains.”  One  uses  a  self‐made  urine 
diverting  toilet  and  one  respondent  uses  a  "pee‐
pee ponics" system (shown in Figure 2): an outdoor 
urinal  that  directly  fertilizes  a  planted  container 
(with a soil medium of 2/3 fine wood chips and 1/3 
potting  soil).  Four  respondents  are  the  sole  users 
of  their  systems;  two  (who  both  live  alone)  use 
their  systems  with  one  or  two  guests,  while  the 
remaining three maintain systems that are used by 
three  or  more  people  (a  family  of  two  and  three 
and a collective house of five, respectively).  
 
All  of  the  respondents  use  the  urine  to  fertilize 
garden  plants  and  fruit  trees.  Respondents’ 
answers  showed  a  general  lack  of  concern  with 
precise  dilution  ratios;  dilution  ratios  range  from 
undiluted  use  to  a  ratio  of  8:1.  No  one  stored  the 
urine  for  longer  than  a  week,  and  did  not  report 
any issues with odors.  
 
Seven  of  the  nine  reported  seeing  significant 
results  from  using  urine  as  fertilizer.  They  were 
delighted  in  “roses  blooming  all  winter  long,” 
“luxuriant  plant  growth,”  "super  happy  bamboo," 
and  that  their  "bougainvillea  really  took  off  and 
started  blooming  much  more  [after  receiving 
urine]."  Their  reports  on  edible  plants  reported  a 
“citrus tree perked up,” “I grew very large broccoli, 
and  had  happy  trees,”  “my  kale  and  tomatoes 
were  really  happy,”  “I  cured  a  sick  lemon  tree” 
(Figure 3), and “after fertilization my peppers took 
off.” Only one respondent observed no results, but 
reported  that  he  started  “only  recently”  and  the 
trees  he  fertilizes  are  currently  dormant,  and 
another  respondent  said  he  "hadn't  done  any 
formal  trials  and  the  results  were  merely 
psychological  benefits  at  this  point."  One  person 
noted a dramatic reduction in family water use. His 
family  of  three,  who  also  maintain  many  other 
ecological  practices  including  reuse  of  grey  water 
from the laundry and a composting toilet in one of 
the  two  bathrooms,  has  measured  its  water 
savings “from 130‐140 gallons (492‐ 530 liters) per 
day  down  to  60‐70  gallons  (227‐265  liters)  per 
day.” 
Social acceptance 
Cultural  acceptability  is  an  important  indicator  of 
the adoption potential of any sanitation practice or 
technological  change;  because  urine  collection  is 
largely  unfamiliar  in  the  United  States,  peoples' 
reactions  to  it  show  a  particular  sensitivity.  One 
person  “only  talks  about  it  to  people  [she]  thinks 
will  be  interested,  like  other  gardeners,”  and 
“sometimes  worries  what  people  will  think”; 
Another, who works in the building trade, “doesn’t 
Backyard urine recycling in United States of America 
Sustainable Sanitation Practice  29  Issue 3 /2010 
talk  about  it  with  her  co‐workers,”  and  cites 
“respecting  the  other  people  who  live  on  [her 
property]”  as  a  concern.  A  third  also  cites 
“personal  challenges:  a  roommate  didn’t  like  it,” 
and another says that his friends “seem to feel like 
its  something  they’d  feel  uncomfortable  doing.” 
The  final  person,  who  uses  an  antique  urine  pot, 
cited  perhaps  the  most  extreme  concerns  over 
acceptability,  saying,  “I  have  to  decide  what  to  do 
when  company  comes  over,  usually  I  hide  [the 
system]  when  guests  come  over  for  a  party,”  and 
“at first I didn't tell my girlfriend.” 
 
At  the  same  time,  each  of  the  respondents 
reported  clearly  positive  reception  from  those  to 
whom  they've  revealed  their  practice,  ranging 
from  “bemusement”  and  “generally  positive”  to 
“intrigue”  and  “inspiration.”  One  person  says  that 
after seeing his system, “Some [friends] have even 
built  their  own  [urine  diverting  composting] 
toilets.” 
 
Four  of  the  nine  cited  small  technical  challenges, 
such as difficulty emptying the urine container and 
minor  odor  issues,  but  none  found  these 
challenges insurmountable. 
 
Reporting  other  insights  into  their  practices,  one 
said  the  ability  to  make  the  change  to  urine 
collection  “speaks  to  how  adaptable  we  are  as 
humans.  Our  cultural  norms  are  socially 
constructed,  we  have  such  a  phobia  around  pee 
and  poo,”  but  it’s  “easy  to  adapt.”  The  architect 
who  specializes  in  green  design  and  tries  to 
incorporate  other  ecological  practices  into  his 
buildings,  expressed  concern  that  public  health 
norms  in  the  United  States  have  “made  living 
sustainably  illegal”  and  are  so  rigid  as  to  have 
“made the perfect the enemy of the good.” 
 
All  of  the  nine 
respondents 
demonstrated  a  sense 
that  urine  collection  as 
they practice it is neither 
legal  nor  illegal,  with 
comments  ranging  from 
“I’m  sure  it’s  illegal”  to 
“There’s  no  law  against 
it  to  my  knowledge,”  to 
“I  try  not  to  know  the 
law.”  These  responses 
demonstrate at once the 
lack  of  regulation  of  the 
practice,  the  lack  of 
information about it, and 
the  spontaneous, 
“grassroots” approach of 
these  individuals  in 
addressing  the  perceived  problem.  One 
respondent said she felt secretive about it and did 
not  want  her  neighbours  to  know,  though  she 
wasn't sure if it was actually illegal.  
Conclusion 
As  a  major  world  power  and  an  exporter  of  both 
culture  and  technology,  the  United  States  of 
America  has  a  unique  ability  to  affect  the 
perception  and  acceptance  of  sanitation 
technologies  globally.  Given  the  widespread 
acceptance  of  the  flush  toilet  as  the  “gold 
standard”  of  sanitation  technology  and  the 
increasing  scarcity  of  both  fresh  water  and  fertile 
agricultural  soils,  we  believe  that  wide  acceptance 
of  ecological  sanitation  in  the  United  States  can 
both  conserve  resources  locally  and  play  a  crucial 
role  in  shifting  perceptions  of  these  practices 
worldwide.  
 
From  this  small  sample  of  ecological  sanitation 
practitioners in one region of the United States we 
can  draw  several  conclusions:  acceptance  of  these 
practices  is  minimal,  with  practitioners  made  up 
largely  of  people  who  share  both  a  high  level  of 
ecological  awareness  and  a  willingness  to  engage 
in practices that diverge from the perceived norm. 
At  the  same  time,  the  material  benefits  (water 
savings  and  fertilization)  are  so  considerable  as  to 
be  observable  almost  immediately,  and 
acceptance,  while  slow,  is  growing,  as 
demonstrated  by  the  fact  that  the  average  period 
of  practice  among  the  nine  people  surveyed  is  a 
mere two years. 
 
The  recent  change  in  California’s  state  plumbing 
regulations  to  better  accommodate  residential 
grey  water  reuse  bodes  well  for  a  trend  toward 
 
 
Figure 4: Urine and faeces collection 
from toilet in Figure 4. 
Figure 5: Composting toilet 
with Separrette diverting 
insert. 
Backyard urine recycling in United States of America 
greater  acceptance  of  urine  recycling  and  other 
ecological sanitation practices. Given that concerns 
among  our  respondents  to  issues  of  social 
acceptance  appear  to  weigh  more  heavily  than 
technological  or  infrastructure  challenges  and 
those  empirical  benefits  are  readily  apparent,  it 
appears  almost  certain  that  more  progressive 
regulatory frameworks will lead inevitably to wider 
cultural  acceptance  of  ecological  sanitation  in  the 
United States. 
IAPMO,  (2007):  California  Plumbing  Code  (2007):  Chapter  29 
Plumbing Systems, IAPMO, Ontario, CA,  p 410 
Jenkins,  J.,  (2005):    The  Humanure  Handbook,  3rd  Edition, 
Joseph Jenkins, Grove City, PA.  
Josson,  H.,  Richert  Stintzing,  A.,  Vinneras,  B.,  and  Salomon,  E. 
(2004)  Guildelines  on  the  use  of  urine  and  faeces  in  crop 
production,  EcoSanRes  Publications  Series,  Report  2004‐2, 
Sweden.  
Kettmanm, M. (2009): Getting Grief for Going Green, The Santa 
Barbara Independent, Sep. 10th, 2009 
Larsen,  T.,  Peters,  I.,  Alder,  A.,  Eggen,  R.,  Maurer,  M.,  and 
Muncke,  J.  (2001):  Re‐engineering  the  toilet  for  sustainable 
wastewater  management.  Environ  Science  Technology  May 
1, 2001 / Volume 35 , Issue 9 / pp 192 A – 197 A. T. 
 
The  increased  exposure  and  awareness  of  global 
ecological  sanitation  practices,  including  urine 
harvesting,  will  help  promote  increasing  ecological 
sanitation practices in the United States.  
Nature's  Head  (2010):  Composting  Toilets  for  Marine,  RV, 
Cabins,  and  Trucks.  A  Nature's  Head  Composting  Toilet, 
http://www.natureshead.net/store/index.phpmain_page=pr
oduct_info&products_id=1  (date of visit: 3 February, 2010). 
 
Pryne,  E.  (2010):  Rain,  even  urine,  would  help  make  Bullitt  HQ 
city's  'greenest  building  ever',  Eric  Pryne,  March  15th,  2010, 
The Seattle Times.  
Recommendations 
SEI,  (2004)  SEI  EETP  Office,  2004,  China  –  Sweden  Erdos  Eco‐
Town Project Document, Erdos, Inner Mongolia, China 
There  is  a  lack  of  studies  and  projects  on  urine 
recycling  in  the  United  States.  We  believe  there 
should be U.S.‐focused studies and organized urine 
recycling projects. 
Steinfeld,  C.  (2004):  Liquid  Gold:  The  Lore  and  Logic  of  Using 
Urine to Grow Plants, Carol Steinfeld, Sheffield, Vermont.  
WHO,  (2006):  Guidelines  for  the  Safe  Use  of  Wastewater, 
Excreta and Greywater. Volume 4: Excreta and greywater use 
in  agriculture.  World  Health  Organization,  Geneva, 
Switzerland.  
 Americans can be socially accepting of urine use. 
 Urine  harvesting  is  a  good  first  step  toward 
ecological sanitation practices. 
Wilsenach,  J.,    and  Van  Loosdrecht,  M.,  (2006):  Integration  of 
Processes to Treat Wastewater and Source‐Separated Urine‐ 
Journal of Environmental Engineering, vol 132, p 331 
 Increased  knowledge  that  urine  harvesting  is 
legal  in  the  USA  can  increase  numbers  of 
adopters of the practice.  
 
 Increased  exposure  of  the  international 
ecological  sanitation  practices  can  positively 
affect practices in the USA. 
 
 
References 
Allen,  L.  (2010):  Phone  conversation  with  staff  at  Berkeley 
Environmental  Health  Division  and  Alameda  County 
Environmental  Health  division  on  Jan  28th,  2010  by  Laura 
Allen.  
Boggs, B., King, R., and Botte, G. (2009): Urea electrolysis: direct 
hydrogen  production  from  urine‐  Chem.  Commun.,  2009, 
4859 ‐ 4861, DOI: 10.1039/b905974a 
CA Department of Water Resources (2009): California's Drought 
Update  Sep.  30th  2009.  Retrieved  from 
http://www.water.ca.gov/drought/ on 1 February, 2010. 
Esrey, S. et al. (1998): Ecological Sanitation. Esrey,  S. Gough, J., 
Rapaport,  D.,  Sawyer,  R.,  Simpson‐Hebert,  M.,  Vargas,  J., 
Winblad,  U.,  Swedish  International  Cooperative 
Development Agency, Stockholm, Sweden.  
Esrey, S. et al. (2001): Closing the Loop: Ecological Saniation for 
Food Security. Esrey, S., Anderson, I., Hillers, A., and Sawyer, 
R.,  Swedish  International  Cooperative  Development  Agency, 
Mexico.  
Name: Laura Allen
Organisation: Greywater Action  
GTZ  (2005):  "Urine  separation  and  reuse  project  at  the  main 
building  of  GTZ  GmbH”.  –  data  sheets  for  ecosan  projects 
016.  Syahril,  Sonny,  Räth,  Nicola,  Klingel,  Florian;  Werner,  
Christine  and  Bracken,  Patrick,  ecosan  sector  project, 
Gesellschaft  für  Technische  Zusammenarbeit  (GTZ)  GmbH, 
Eschborn,  Germany  ,  digitally  available  at: 
http://www.gtz.de/de/dokumente/en‐ecosan‐pds‐016‐
germany‐gtz‐eschborn‐2005.pdf 
Town, Country: Oakland, California; USA 
e‐mail: laura@greywateraction.org 
Name: Jeff Conant
Organisation: Greywater Action  
Town, Country: Oakland, California; USA 
e‐mail: jeff.otherworlds@gmail.com 
Sustainable Sanitation Practice  30  Issue 3 /2010 
 
Sustainable Sanitation Practice  31  Issue 3 /2010 
 
 
 
organisation: 
 
Food Security and Productive Sanitation; 
Practical guideline on the use of urine in crop 
production  
This paper describes an upcoming publication containing a practical guideline 
on the use of urine in crop production. 
Authors: A. Richert, R. Gensch, H. Jönsson, L. Dagerskog, T. Stenström, M. Bonzi 
Abstract 
The publication “Practical Guideline on the Use of Urine in Crop Production”, is a collaborative effort of several 
international  organisations  and  institutions  active  in  the  field  of  sustainable  sanitation  and  agriculture  under 
the  aegis  of  the  Sustainable  Sanitation  Alliance  (SuSanA)  working  group  on  Food  Security  and  Productive 
Sanitation with Stockholm Environment Institute (SEI) as the lead. It will be launched during 2010. 
The  Guideline  is  directed  towards  decision  makers,  professionals  and  extension  workers  in  the  sectors  of 
agriculture,  water  &  sanitation,  planning  and  environment  as  well  as  the  donor  community.  The  main  target 
group is professionals in the sector of agriculture. The text gives practical guidance on the use of urine in crop 
production as a vital component of sustainable crop production and sanitation systems. It covers key aspects of 
how to use urine as a fertiliser  in productive sanitation systems and also includes guidance on how to initiate 
activities  that  will  facilitate  the  introduction  of  new  fertilisers  to  the  agricultural  community.  The  handbook 
should  help  in  establishing  links  between  research  and  professionals  interested  in  implementation  of 
sustainable sanitation systems. It is easy to read and informative, with examples from case studies and tips on 
further reading for those interested. 
 
Use of urine in crop production 
Consumed  plant  nutrients  leave  the  human  body 
with  excreta,  and  once  the  body  is  fully  grown 
there is a mass balance between consumption and 
excretion. This has three important implications: 
1. The amount of excreted plant nutrients can be 
calculated  from  the  food  intake,  for  which 
data  is  better  and  more  easily  available  than 
for excreta. 
2. If  all  excreta  and  biowaste,  as  well  as  animal 
manure  and  crop  residues,  is  recycled,  then 
the  fertility  of  the  arable  land  can  be 
maintained,  as  the  recycled  products  contain 
the  same  amounts  of  plant  nutrients  as  were 
taken up by the crops. 
3. Differences in composition of excreta between 
different  regions  reflect  differences  in  the 
uptake of the consumed crops and thus in the 
plant  nutrient  supply  needed  for  maintained 
crop  fertility  in  the  region.  Irrespective  of  the 
amounts and concentrations of plant nutrients 
in  the  excreta,  one  important  fertilising 
recommendation is thus to strive to distribute 
the excreta fertilisers on an area equal to that 
used for producing the food.  
 
Source  separation  and  safe  handling  of  nutrients 
from the toilet systems is one way to facilitate the 
recirculation and use of excreta in crop production. 
Urine  contains  most  of  the  macronutrients  as  well 
as smaller fractions of the micronutrients excreted 
by  human  beings.  Nitrogen,  phosphorus, 
potassium  and  sulphur  as  well  as  micronutrients 
are all found in urine in plant available forms. Urine 
Key massages: 
 Urine used as a fertiliser can help in the mitigation of poverty and malnutrition, and improve the trade balance 
of countries importing chemical fertilisers.  
 Food security can be increased with a fertiliser that is available free for all.  
 Safe  handling  of  urine  including  treatment  and  sanitisation  before  use  is  a  key  component  of  sustainable 
sanitation as well as sustainable crop production.  
 The "Practical Guideline on Use of Urine in Crop Production" will be published during 2010 and will be available 
from the EcoSanRes and SuSanA webpages, i.e. www.ecosanres.org and www.susana.org, respectively. 
Food Security and Productive Sanitation, guideline coming up 
Sustainable Sanitation Practice  32  Issue 3 /2010 
is a well balanced nitrogen rich fertiliser which can 
replace  and  normally  gives  the  same  yields  as 
chemical fertiliser in crop production (Figure 1). 
 
Figure 1. The yield and size of vegetables improves 
with urine use (Picture from Moussa Bonzi, 
CREPA, Burkina Faso).
 
The  urine  from  one  person  during  one  year  is 
sufficient to fertilise 300‐400 m2 of crop to a level 
of about 50‐100 kg N/ha. Urine should be handled 
in  closed  tanks  and  containers  and  should  be 
spread directly onto the soil, not on the plant, in N 
doses equivalent to what is recommended for urea 
and  ammonium  fertilisers.  In  the  small  scale, 
plastic watering cans are suitable for spreading the 
urine,  while  in  larger  scale,  spreaders  for  animal 
slurry are suitable. Air contact should be minimised 
in  order  to  avoid  ammonia  losses  and  the  urine 
should  be  incorporated  into  the  soil  as  quickly  as 
possible.  
Economics 
The  economical  value  of  the  urine  can  be 
calculated  by  comparing  with  the  price  of  mineral 
fertiliser  on  the  local  market  or  by  calculating  the 
value  of  the  increased  yield  of  the  fertilised  crop. 
An  example  from  Burkina  Faso  gives  at  hand  that 
the annual amount of plant nutrients in the excreta 
from one family is roughly equal to the quantity in 
one  50  kg  bag  of  urea  and  one  50 kg  bag  of  NPK. 
According to Dagerskog and Bonzi (2010) the value 
of  this  per  person  is  approximately  10 US$,  while 
the  value  of  the  increased  yield  of  maize  is 
approximately  50 US$  per  person.  The  value  of  a 
20 litre jerrycan of urine was estimated to be 25 US 
cents.  
Barriers  protect  producers,  workers 
and consumers 
Health  risks  associated  with  the  use  of  human 
urine in plant production are generally low. Source 
separation  of  urine  is  a  strong  barrier  against 
pathogen  transmission  since  most  pathogens  are 
excreted  with  faecal  matter.  The  amount  of  faecal 
cross‐contamination  is  directly  related  to  the 
health  risk  in  the  system  for  urine  use  in  crop 
production.  Collection  systems  for  urine  should be 
designed  to  minimise  the  risk  of  faecal  cross‐
contamination.  Groups  that  are  potentially  at  risk 
are  collection  personnel  and  field  workers, 
households,  local  communities  and  product 
consumers.  As  regards  other  contaminating 
substances  excreted  with  human  urine  (heavy 
metals,  hormones  and  pharmaceuticals)  possible 
health  risks  are  far  smaller  than  those  associated 
with  the  common  sanitation  system  and  the  risk 
for  negative  effect  on  the  quantity  and  quality  of 
the crops is negligible. 
 
The  WHO  guidelines  for  safe  use  of  excreta  in 
agriculture  (WHO,  2006)  promote  a  flexible  multi‐
barrier  approach  for  managing  the  health  risks 
associated  with  the  use  of  excreta  in  agriculture. 
This  concept  is  comprised  of  a  series  of 
measures/barriers  from  ‘toilet  to  table’.  Each  of 
the  barriers  has  a  potential  to  reduce  health  risks 
associated  with  the  excreta  use  and  it  is 
recommended  by  WHO  to  put  in  place  several  of 
these  barriers  if  needed  in  order  to  reduce  the 
health risk to an acceptable minimum (Figure 2). 
 
Barriers  include  for  example  storage,  crop 
restrictions,  withholding  periods  and  reduced 
contact,  correct  handling  and  cooking  of  the  food 
crop. The practical guideline gives examples of how 
urine  can  be  handled  in  a  safe  way  in  order  to 
minimise  risk  of  pathogen  transmission  based  on 
the WHO Guidelines for safe use of excreta in crop 
production. 
Institutional aspects for up‐scaling 
Economic  and  institutional  aspects  are  important 
as  productive  sanitation  systems  become 
mainstream.  A  challenge  is  to  integrate  use  of 
excreta in existing regulatory frameworks. Initially, 
the  following  activities  are  suggested  when 
productive sanitation systems are implemented: 
 Identify all stakeholders and clarify drivers 
and restrictions for each of these groups in 
relation to the implementation of urine 
separation, storage, transport and use; 
 Include and target the end users (the farmers) 
in the planning process; 
 Organise an arena for joint analysis, planning 
and monitoring of the stakeholders; 
 Organise local communities so that there is a 
structure for implementation and a structure 
for monitoring  
Food Security and Productive Sanitation, guideline coming up 
Figure 2. Barrier concept for safe use of urine as a fertiliser.
Very  important  in  dissemination  and  up‐scaling  of 
the  use  of  urine  as  a  fertiliser  are  participatory 
local  demonstrations  involving  all  parties.  Urine  as 
a fertiliser needs to be introduced in the same way 
as any new fertiliser to the agricultural community.  
Logistics  for  handling  of  urine  are  discussed  in  the 
guidelines  and  examples  are  given  for  large  and 
small  scale  handling  of  urine.  The  logistics  are  a 
challenge  and  there  are  environmental  as  well  as 
practical  and  economical  implications  of 
transporting  urine  if  there  is  no  reuse  possible  on 
site.  However,  as  is  pointed  out  in  the  text,  local 
reuse  is  often  possible  and  urban  agriculture 
provides  possibilities  for  recycling  of  human 
excreta. 
 
Sustainable Sanitation Practice  33  Issue 3 /2010 
Although  there  is  a  wealth  of  location  specific 
information  in  this  guideline,  every  location  is 
unique  and  further  translation  and  adaptation  of 
the  guidelines  is  required.  The  last  chapter  of  the 
guideline  gives  recommendations  on  how  local 
guidelines  can  be  developed  and  reasonably 
structured.  Existing  local  guidelines  from  Burkina 
Faso and the Philippines are provided as an annex. 
 
 
References 
Dagerskog,  L.,  Bonzi,  M,  (2010):  Opening  minds  and  closing 
loops  –  productive  sanitation  initiatives  in  Burkina  Faso  and 
Niger. Sustainable Sanitation Practice 3, pp.4‐11. 
WHO  (2006):  Guidelines  for  the  safe  use  of  wastwater,  excreta 
and  greywater;  Volume  4:  Excreta  and  greywater  use  in 
agriculture. World Health Organisation, Geneva, Switzerland. 
http://www.who.int/water_sanitation_health/wastewater/g
suweg4/en/index.html, pp.295‐306. 
Reinoso R., Torresa L.A., Bécares E. (2008): Efficiency of natural 
systems  for  removal  of  bacteria  and  pathogenic  parasites 
from  wastewater.  Science  of  the  Total  Environment  395,  80‐
86. 
 
Name: Moussa Bonzi
Organisation: CREPA HQ 
Town, Country: Burkina Faso 
Name: Thor‐Axel Stenström 
Organisation: Stockholm Environment Institute 
Town, Country: Sweden 
Name: Linus Dagerskog
Organisation: CREPA HQ 
Town, Country: Burkina Faso 
Name: Håkan Jönsson
Organisation: Stockholm Environment Institute 
Town, Country: Sweden 
Name: Anna Richert
Organisation: Stockholm Environment Institute 
Country: Sweden 
e‐mail: anna@richert.se 
Name: Robert Gensch
Organisation: Xavier University 
Country: Philippines 
Stockholm Environment Institute, EcoSanRes Series, 2009-1
Practical Guidance on the Use of
Urine in Crop Production
Anna Richert, Robert Gensch, Håkan Jönsson,
Thor-Axel Stenström and Linus Dagerskog
Stockholm Environment Institute, EcoSanRes Series, 2010-1
Practical Guidance on the Use of
Urine in Crop Production
Anna Richert
(1)
, Robert Gensch
(2)
, Håkan Jönsson
(1)
,
Thor-Axel Stenström
(1)
and Linus Dagerskog
(1),(3)
With contributions from:
Elisabeth von Muench
(4)
, Martina Winker
(5)
, Claudia Wendland
(6)
,
Marianne Kjellén
(1)
, Moussa Bonzi
(3)
, Cofie Olufunke
(7)
,
Almaz Terrefe
(8)
and Peter Morgan
(9)
(1)
Stockholm Environment Institute
(2)
Sustainable Sanitation Center, Xavier University, Philippines; CIM; lead of SuSanA
working group 5
(3)
Centre for Low Cost Water Supply and Sanitation (CREPA)
(4)
Deutsche Gesellschaft für Technische Zusammenarbeit (GTZ)
(5)
Hamburg University of Technology
(6)
Women in Europe for a Common Future (WECF)
(7)
International Water Management Institute (IWMI)
(8)
Society for Urban Development in East Africa (Sudea)
(9)
Aquamor
EcoSanRes Programme
Stockholm Environment Institute
Kräftriket 2B
106 91 Stockholm
Sweden
Tel: +46 8 674 7070
Fax: +46 8 674 7020
Web: www.sei-international.org and www.ecosanres.org

This publication is downloadable from www.ecosanres.org
ISBN 978-91-86125-21-9
Head of Communications: Robert Watt
Publications Manager: Erik Willis
Research and Communications Manager, EcoSanRes Programme: Arno Rosemarin
Layout: Richard Clay
Cover Photo: Application of urine on eggplants during a comprehensive
urine application field testing study at Xavier University, Philippines
© William Vergara Repulo
This publication may be reproduced in whole or in part and in any form
for educational or non-profit purposes, without special permission from
the copyright holder(s) provided acknowledgement of the source is made.
No use of this publication may be made for resale or other commercial
purpose, without the written permission of the copyright holder(s).
Copyright © September 2010
Contents
Foreword vii
Reading instructions viii
Executive summary ix
PART I · General information and recommendations for the use of urine in crop
production 1
Characteristics of human urine 1
Macronutrients – amounts and plant availability 1
Excreted amounts and volume 3
Analyzing human urine 4
Chemical pollutants 4
Salinization 5
Economic value of urine 7
Crop fertilization with urine – research results and practical experiences 10
Cereals in Northern Europe 10
Cereals in India 10
Vegetables in South Africa 11
Vegetables in Western Africa 11
Vegetables in Eastern Africa 11
Vegetables in Northern Europe 12
Vegetables in Central America 13
Fruit in India 13
Application strategies 15
Application time 15
Application rate 16
Storage techniques 18
Storage in soil 20
Application techniques 20
Odour when using urine as a fertilizer 22
Combined application of urine and organic fertilizers 22
Treatment and sanitization 23
Health risks 23
Multi barrier concept 23
Handling system for use of urine as fertilizer 29
Larger scale systems 29
Gender aspects 33
Institutional aspects of agricultural use of urine 35
Regulatory framework 36
Urine use in organic agriculture 37
Crop experiments using urine as a fertilizer 38
Demonstration experiments 38
Controlled experiments to test the fertilizing potential 38
Controlled experiments to test the real life fertilizing effect 39
Farm and crop rotation experiments 39
Statistical considerations 39
Dissemination of results 39
Web-based tools for calculation 40
PART 2 · How to develop local guidelines 41
The productive sanitation approach 41
Local site conditions 41
Plant requirements and nutrient content in urine 42
Application recommendations 42
Risk management 44
PART 3 - Example of a local guideline 46
Guideline for application of sanitized urine (Takin Ruwa) in the agricultural conditions
of Niger 46
Excerpts from the guideline 47
References 52
vi i
stockholm envi ronment i nsti tute
Foreword
T
his book gives practical guidance on the use of
urine in crop production as a vital component of
sustainable crop production and sanitation systems. It
also includes guidance on how to start activities that
will facilitate the introduction of new fertilizers to the
agricultural community. The handbook should help in
establishing links between research and professionals
interested in implementation of sustainable sanitation
systems. It is easy to read and informative, with
examples from case studies and hints on further reading
for those interested.
The target group is mainly professionals and extension
workers in the agricultural sector. In addition, the authors
would like to see this text used by water and sanitation,
planning and environment professionals in order to
establish cross-sectoral links since the use of urine in
crop production touches on several of these areas at the
same time. Important readers are also decisionmakers
on all levels, as well as the donor community.
The text has been produced as a collaborative process
within the Sustainable Sanitation Alliance (SuSanA
1
)
Working Group 05 on Food Security and Productive
Sanitation Systems. Stockholm Environment Institute
has taken the lead in the authorship, and important
contributions have been made by the following people
and institutions:
Anna Richert (SEI; lead author), Robert Gensch
(Xavier University, Philippines; chair of SuSanA
working group on food security), Håkan Jönsson
(SEI), Thor-Axel Stenström (SEI), Linus Dagerskog
(CREPA and SEI), Elisabeth von Muench (GTZ),
Martina Winker (Hamburg University of Technology),
Claudia Wendland (WECF), Marianne Kjellén (SEI),
Dr Moussa Bonzi (CREPA), Cofe Olufunke (IWMI),
Almaz Terrefe (Sudea), Peter Morgan (Aquamor),
workshop participants.
The document has been peer reviewed by Dr Ralf
Otterpohl and Mr Christopher Buzie at Hamburg
University of Technology.
1 http://www.susana.org/
vi i i
practi cal gui dance on the use of uri ne i n crop producti on
reading instruCtions
T
he text is based on scientifc knowledge as well as
practical experiences on the of urine as a fertilizer
and will focus on the urine use in crop production
only. Other technical aspects related to the supporting
sustainable sanitation technologies and how urine
is fnally collected are only included if they have an
implication for the use of urine as a fertilizer. For further
information on technical components of the supporting
sanitation systems please see for example ’Technology
Review – Urine Diversion Components’ (von Münch
and Winker 2009) or the ’Compendium of Sanitation
Systems and Technologies’ (Tilley et al., 2008).
The guideline is divided into three major parts:
PART 1 of the guidelines gives general information and
recommendations on the use of urine in crop production
including information on urine composition, value
and use in crop production, health risk management
based on World Health Organization (WHO)
recommendations as well as institutional aspects and
knowledge development for the implementation of
urine use in crop production on local level. The frst part
acts as a generic resource base related to the use of urine
in agricultural production.
PART 2 gives an introduction on how this wealth of
information can be translated further to the respective
local site/country specifc needs and conditions by giving
recommendations on how locally adapted guideline
versions can be developed and reasonably structured.
It summarizes the most important factors that directly
or indirectly infuence the farming activities related to
the urine use.
PART 3 is an annexed local guideline from Niger
translated into English to give a colorful example of
such a local guideline.
It is the intention of the authors that this guide should be
used as a general resource book and as a support tool for
the development of local guidelines on the use of urine
in crop production. At the beginning of key chapters of
Part 1 there is a short box headed “practical guidance”
with practical tips indicating what is most important,
and what could be included in a simplifed guideline. If
time for reading the entire guideline is a constraint, it is
recommended to focus on the executive summary and
the boxes introducing each chapter and then proceed to
Part II on how to develop local guidelines.
i x
stockholm envi ronment i nsti tute
exeCutive summary
T
he Practical Guidance on the Use of Urine in Crop
Production is directed towards decision makers,
professionals and extension workers in the agriculture,
water and sanitation, planning and environment sectors,
as well as the donor community. The main target group
is professionals in the agricultural sector. The text gives
practical guidance on the use of urine in crop production
as a vital component of sustainable crop production and
sanitation systems. It covers key aspects of how to use
urine from productive sanitation systems as fertilizer
in crop production and also includes guidance on how
to initiate activities that will facilitate the introduction
of new fertilizers to the agricultural community.
The handbook is intended to help in establishing
links between researchers in the feld of sustainable
sanitation and agricultural practionners, as well as end-
users interested in implemented sustainable sanitation
systems. It is easy to read and informative, with
examples from case studies and tips on further reading
for those interested.
Urine used as a fertilizer can help in the mitigation
of poverty and malnutrition, and improve the trade
balance of countries importing chemical fertilizers
if adopted at large scale. Food security can be
increased with a fertilizer that is available free for all,
regardless of logistic and economical resources. Safe
handling of urine including sanitization before use is
a key component of sustainable sanitation as well as
sustainable crop production.
Consumed plant nutrients leave the human body with
excreta, and once the body is fully grown there is a mass
balance between consumption and excretion. This has
three important implications:
The amount of excreted plant nutrients can be calculated
from the food intake, for which data is better and more
easily available than for excreta.
If all excreta and biowaste, as well as animal manure
and crop residues, is recycled, then the fertility of the
arable land can be maintained, as the recycled products
contain the same amounts of plant nutrients as were
taken up by the crops.
Differences in composition of excreta between different
regions refect differences in the uptake of the consumed
crops and thus in the plant nutrient supply needed for
maintained crop fertility in the region. Irrespective of
the amounts and concentrations of plant nutrients in the
excreta, one important fertilizing recommendation is
therefore to strive to distribute the excreta fertilizers on
an area equal to that used for producing the food.
Source separation and safe handling of nutrients from
the toilet systems is one way to facilitate the recirculation
and use of excreta in crop production. Urine contains
most of the macronutrients as well as smaller fractions
of the micronutrients excreted by human beings.
Nitrogen, phosphorus, potassium and sulphur as well as
micronutrients are all found in urine in plant available
forms. Urine is a well balanced nitrogen rich fertilizer
which can replace and normally gives the same yields
as chemical fertilizer in crop production. Table I shows
an example of yields from feld research in Burkina
Faso, where yields of urine-fertilized crops did not
differ from mineral fertilized crops.
The urine from one person during one year is suffcient
to fertilize 300-400 m
2
of crop to a level of about 50-
table 1: yield of vegetables as an average of three years of field trials in Burkina Faso.
Source: CREPA
Egg plant
(t ha
-1
)
Gombo
(t ha
-1
)
Tomato
(t ha
-1
)
Unfertilized control 2.8
a
1.7
a
2.1
a
Mineral fertilizer 17.8
b
2.7
b
5.7
b
Stored urine 17.7
b
2.4
b
5.2
b
Urine (b) and mineral fertilizer (b) gave a statistically significant yield increase compared to unfertilized control (a). However, there is no
statistical difference between yields using urine (b) or mineral fertilizer (b)
x
practi cal gui dance on the use of uri ne i n crop producti on
100 kg N/ha. Urine should be handled in closed tanks
and containers and should be spread directly onto the
soil, not on the plant, in N-doses equivalent to what is
recommended for urea and ammonium fertilizers. In the
small scale, plastic watering cans are suitable for spreading
the urine, while in larger scale, spreaders for animal
slurry are suitable. Air contact should be minimized in
order to avoid ammonia losses and the urine should be
incorporated into the soil as quickly as possible.
The economical value of the urine can be calculated
by comparing with the price of mineral fertilizer on the
local market or by calculating the value of the increased
yield of the fertilized crop. In Burkina Faso the value of
a 20 l jerrycan of urine can be estimated to 25 US cents.
A person produces around 500 litres of urine per year
corresponding to ~ 6-7 dollars. Including the nutient
value of faeces the annual value reaches approximately
10 $US. However the increased maize yield from using
this amount of fertilizer is estimated to 50 $US.
Figure i: the yield and size of vegetables improves with urine use.
Photo: CREPA, Burkina Faso, Dr Moussa Bonzi
An example from Niger shows that the annual amount
of plant nutrients in the excreta (urine + faeces) from
one family is roughly equal to the quantity in one 50
kg bag of urea and one 50 kg bag of NPK, see fgure 2.
The majority of these nutrients are in the urine, which
is relatively easy to collect.
Health risks associated with the use of human urine in
plant production are generally low. Source separation
of urine is a strong barrier against pathogen
transmission since most pathogens are excreted
with faecal matter. The amount of faecal cross-
contamination is directly related to the health risk in
the system for urine use in crop production. Collection
systems for urine should be designed to minimize the
risk of faecal cross-contamination. Groups that are
potentially at risk are mainly collection personnel
and feld workers, groups that come in direct contact
with the excreta. Other categories where risks
xi
stockholm envi ronment i nsti tute
exist, however diminished, are households, local
communities and product consumers.
Urine is a high quality fertilizer with low levels of heavy
metals. Regarding hormones and pharmaceuticals
excreted with urine, the risk of negative effects to
plants or human beings is low if urine is spread on
Figure 2: the annual amount of nutrients in excreta from one family in niger is equal to nutrients
in the two bags of fertilizers. Photo: Linus Dagerskog, CREPA/SEI
agricultural land at levels corresponding to the plants
needs.
The World Health Organization (WHO) guidelines
for safe use of excreta in agriculture (2006) promote a
fexible multi-barrier approach for managing the health
risks associated with the use of excreta. This concept
Figure 3: Barrier concept for safe use of urine as a fertilizer.
xi i
practi cal gui dance on the use of uri ne i n crop producti on
comprises a series of measures/barriers from ‘toilet to
table’. Each of the barriers has a potential to reduce
health risks associated with the excreta use and it is
recommended by WHO to put in place several of these
barriers, if needed, in order to reduce the health risk to
an acceptable minimum, see fgure 3.
Barriers include, for example, storage, crop restrictions,
withholding periods and reduced contact, correct
handling and cooking of the food crop. The text gives
examples of how urine can be handled in a safe way in
order to minimize risk of pathogen transmission based
on the WHO Guidelines for safe use of excreta in crop
production.
Institutional aspects are increasingly important as
productive sanitation systems become mainstream.
A challenge is to integrate use of excreta in existing
regulatory frameworks. Initially, the following activities
are suggested when productive sanitation systems are
implemented:
• Identify stakeholders and clarify drivers and
restrictions for each one in relation to the
implementation of urine use in crop production.
• Include and target the farmers in the initial planning.
• Organize an arena for feed-back and interaction
between stakeholders.
• Organize local communities so that there is a
structure for implementation and a structure for
monitoring.
Dissemination and knowledge development on urine as
a fertilizer is best gained through local demonstration
experiments involving organizations that work with
small scale farmers and local communities as well
as local research organizations. The new fertilizer
should be introduced with the same methodology as
when introducing any new fertilizer in the agricultural
community.
In order to be implementable in a local context there
is often an additional need to further translate or adapt
the wealth of information given in this text to the
respective local site conditions. Part two of the book
gives recommendations on how local guidelines can be
developed and structured and it summarizes the most
important factors that directly or indirectly infuence
farming activities related to urine use. It is complemented
by an example of an existing local guideline from Niger
that is annexed to the publication.
1
stockholm envi ronment i nsti tute
Part i · general inFormation and reCommendations For
the use oF urine in CroP ProduCtion
CharaCteristiCs oF human urine
T
he text in the following section presumes that the
urine is handled according to the WHO (2006)
guidelines for the safe use of wastewater, excreta and
greywater in agriculture and aquaculture.
Consumed plant nutrients leave the human body with
excreta, and once the body is fully grown there is a
mass balance between consumption and excretion, see
fgure in box 1. This has three important implications:
The amount of excreted plant nutrients can be calculated
from the food intake, for which the data are better and
more easily available than for excreta.
If all excreta and biowaste, as well as animal manure
and crop residues, is recycled, then the fertility of the
arable land can be maintained, as the recycled products
contain the same amounts of plant nutrients as were
taken up by the crops.
Differences in composition of excreta between different
regions refect differences in the uptake of consumed
crops and thus in the plant nutrient supply needed for
maintaining crop fertility in the region.
Irrespective of the amounts and concentrations of
plant nutrients in excreta, one important fertilizing
recommendation is to strive to distribute the excreta
fertilizers on an area equal to that used for growing the
crop.
Urine is an aqueous solution made up of more than
95 per cent water, with the remaining constituents
made up of urea, creatinine, dissolved ions (chloride,
sodium, potassium, etc), inorganic and organic
compounds or salts. Most of these remain in solution,
but there can be a tendency for phosphorus-rich
substances to sediment in containers that are stored for
hygienization. This substance has a syrupish texture,
and if urine is collected in a piping system, this “urine
syrup” can sediment in pipes if the inclination is not
suffcient.
MACRoNUTRIENTS – AMoUNTS ANd
PlANT AvAIlAbIlITy
Urine contains signifcant quantities of the main macro
nutrients required by plants; nitrogen (N), phosphorus
(P) and potassium (K). Nitrogen occurs in high
concentration (mostly as urea), whereas phosphates
and potassium occur in comparatively lower
concentrations, in dissolved plant available forms.
Urine used directly or after storage is a high quality,
low cost alternative to the application of N-rich
mineral fertilizer in plant production. The nutrients
in urine are in ionic form and their plant-availability
compares well with chemical fertilizer (Johansson et
al., 2001; Kirchmann and Pettersson, 1995; Simons
and Clemens 2004). Urine also contains large amounts
of phosphorus, potassium, sulphur and micronutrients,
but due to its high content of N, its P/N and K/N ratios
are lower than in many mineral fertilizers used for
crop production, and lower than what many crops need
according to fertilizer recommendations.
An advantage of urine in comparison with organic
fertilizers is that the phosphorus exists in forms
that are plant-available. This means that urine is
quite effcient as a phosphorus fertilizer, which has
implications for the future with regard to the concept
of Peak Phosphorus and the fact that phosphorus is a
fnite resource.
Practical guidance:
Urine is a well-balanced nitrogen-rich quick-
acting liquid fertilizer. The nutrient content in
urine depends on the diet. If the nitrogen content
in urine is not known, then as a rule of thumb, a
concentration of 3-7 grams of N per litre of urine
can be expected. Phosphorus in urine is excreted
in a plant-available form making urine an efficient
phosphorus fertilizer as well. The quantity of urine
produced by an adult depends on the amount of
liquid a person drinks, a common figure is 0.8-1.5
litres per adult per day.
2
practi cal gui dance on the use of uri ne i n crop producti on
Since it is quite diffcult to analyze human urine
for nutrient content, there is a need for a method to
calculate the composition of urine from easily available
data. Such a method, which uses the FAO statistics
(see www. fao.org) on the available food supply in
different countries, has been developed by Jönsson and
Vinnerås (2004). This method uses equations derived
from the FAO statistics and an estimation of the average
excretion by the Swedish population (table 2), where
many measurements on excreta have been made.
Based on this estimate of average excretion, on the
food supplied to the Swedish population according to
the FAO statistics and on statistical analysis of different
foodstuffs, relationships (equations 1 and 2) have been
developed between the food supplied according to FAO
and the excretion of N and P.
N = 0.13* (Total food protein)
……..............Equation 1
table 2: Proposed default values for excreted mass and nutrients. Vinnerås et al., 2006
Parameter Unit Urine Faeces Toilet paper
blackwater
(urine+faeces)
Wet mass kg/person,year 550 51 8.9 610
Dry mass kg/ person,year 21 11 8.5 40.5
Nitrogen g/ person,year 4000 550 4550
Phosphorus g/ person,year 365 183 548
P = 0.011* (Total food protein + vegetal food protein)
..................... Equation 2
In equations 1-2 the units of N and P are the same as
those of the food protein. As is shown by equation
2, there is a strong positive correlation between the
contents of protein and phosphorus in the food stuffs.
Furthermore, vegetal food stuffs contain on average
twice as much phosphorus per gram of protein as animal
ones, which is why the vegetal protein is counted twice
in equation 2.
These equations are useful for estimating the average
excretion of N and P in different countries. The input
to such estimates are FAO statistics on food supplied,
found on the FAO website. Examples of inputs and
results of such estimates for a few countries are given
in tables 3 and 4.
These estimates assume that the loss between the
food supplied and the food actually consumed, i.e.
table 3: Food supply (crops primary equivalent) in different countries in 2000. FAO 2003
Country
Total energy
kcal/cap,day
vegetal energy
kcal/cap, day
Total protein
g/cap, day
vegetal
protein
g/cap, day
China, Asia
3029
2446 86 56
Haiti, West Indies 2056 1923 45 37
India, Asia 2428 2234 57 47
South Africa, Africa 2886 2516 74 48
Uganda, East Africa 2359 2218 55 45
3
stockholm envi ronment i nsti tute
the food waste generated, is of the same relative size
in the different countries. This assumption is verifed
by Chinese data. The total excretion reported by Gao
et al., (2002) for China was 4.4 kg of N and 0.5 kg of
P. These values agree quite well with those calculated
in table 4, considering how diffcult it is to carry out
representative measurements of the excretion of a
large population.
Basic data on urine composition can also be found in
the following: NASA Contractor Report No. NASA
CR-1802, D. F. Putnam, July 1971. This document is
available online at:
http://ntrs.nasa.gov/archive/nasa/casi.ntrs.nasa.
gov/19710023044_1971023044.pdf
Table 5 below shows the calculated N, P and K
values of urine and faeces and urine + faeces for the
10+ age group of rural households in the Limpopo
province of South Africa (CSIR, 2008). The table
table 4: estimated excretion of nutrients per capita in different countries. Jönsson and Vinnerås 2004
Nitrogen (kg/cap, year) Phosphorus (kg/cap, year) Potassium (kg/cap, year)
China 3.5 0.4 1.3
Haiti 1.9 0.2 0.9
India 2.3 0.3 1.1
South Africa 3.0 0.3 1.2
Uganda 2.2 0.3 1.0
Sweden 4.0 0.4 1.0
shows that in these areas urine could provide a
nitrogen rich fertilizer of the ratio 10:1:4 and faeces
a more evenly balanced 2:1:1 fertilizer. The weighted
average nutrient content, which would be the result of
application of these two fertilizers derived from the
same number of people during the same time, yields
approximately a 7:1:3 fertilizer ratio.
ExCRETEd AMoUNTS ANd volUME
The quantity of urine produced by an adult mainly
depends on the amount of liquid a person drinks and
perspires. Children produce approximately half as
much urine as adults. Excessive sweating results
in concentrated urine, while consumption of large
amounts of liquid dilutes the urine. Vinnerås et al.,
(2006) suggested a design value for urine generation
to be 1500 g/p,d based on measurements in Sweden,
while Schouw et al., (2002) found that in Southern
Thailand between 0.6-1.2 L/p,d of urine was produced.
table 5: n:P:K excretion of nutrients per capita per annum and the ratio for urine, faeces and
urine + faeces fertilizer in south africa CSIR, 2008
Product kg/p/yr Ratio
N P K N P K
Urine 3.56 0.34 1.26 10 1 4
Faeces 0.42 0.24 0.21 2 1 1
Urine + faeces 3.98 0.58 1.47 7 1 3
4
practi cal gui dance on the use of uri ne i n crop producti on
ANAlyzING HUMAN URINE
Correct sampling and analyzing of urine is diffcult,
and results of single analysis of unpooled samples
should be interpreted with care. Laboratory analyses
will give the most correct answers, however, such
analyses may not always be possible for feld
conditions and absence of laboratory equipment.
Simple analytical methods are available, but
these have not been validated for human urine.
Measurements of conductivity have been suggested,
which may be an interesting possibility. A tool that
has been developed for analysing animal slurry has
been used successfully for human urine, however,
calibration may be necessary. The method is based
on the fact that ammonium dissolved in the fertilizer
reacts with an additive to form gaseous ammonia.
The tool measures the gas pressure that results, and
indicates a rough fgure for the content of ammonia
nitrogen in the fertilizer (See www.agros.se).
Sampling of urine should be carried out with stringency.
Urine should be well mixed because phosphorus-rich
subsances in urine tend to sediment in a container
during storage of urine.
A comment on the content of P and K in urine is
relevant. In many countries, the K content is expressed
as K
2
O, and the P content as P
2
O
5
. Table 6 below gives
conversion factors for use when needed in order to
convert the formulas.
table 6: Conversion factors for major nutrients
To Convert To Multiply by
K K
2
O 1.2
K
2
O K 0.83
P P
2
O
5
2.29
P
2
O
5
P 0.436
CHEMICAl PollUTANTS
The information in this section is mostly based on
Winker (2009). The publication of Larsen and Lienert
(2007) is also recommended.
Hormones and pharmaceuticals
2
Hormones and pharmaceutical residues are two
types of micro-pollutants which occur in urine
(concentration levels are available in Winker,
2009), as human beings excrete them with their
urine and faeces (as a rule of thumb: two thirds of
pharmaceutical residue substances are excreted with
the urine, one third with faeces, although the fgures
can vary widely for individual substances).
There is the possibility that if urine is reused in
agriculture, these micro-pollutants would be taken up
by plants and thereby enter the human food chain.
This is a risk, but a small one: a full evaluation of the
potential toxic effects of pharmaceuticals ingested by
humans with crops is very diffcult and has not yet
been done. The risks need to be put in perspective
compared to pharmaceutical residues contained in
animal manure, or the risks resulting from pesticide
use. In sewer-based sanitation systems, these micro-
pollutants are discharged from sewage treatment
plants into surface water bodies and can reach the
groundwater in the long run. For example, detected
concentrations of pharmaceutical residues in
groundwater lay in the range of 50 ng/l in Germany
(Heberer et al., 2000).
2 From von Münch and Winker (2009)
Practical guidance:
Source separation of urine results in one of the
safest and cleanest fertilizers available to the
agricultural community. Pharmaceuticals and
hormones are excreted with urine, but the risk of
negative effects to plants or human beings is low.
When excreta is processed in a sweage treatment
plant contaminants from industries, traffic and
grey water are added resulting in a product of
much lower quality. The following text gives some
answers to frequently posed questions regarding
chemical pollutants in urine. However, it needs to
be noted that the risk when using urine is far lower
than when using wastewater treatment sludge,
and also lower than when using farmyard manure.
5
stockholm envi ronment i nsti tute
When comparing the two approaches (mixing urine
with water in conventional wastewater management
versus urine application to soil), it is likely to be safer
to discharge urine to soil, rather than to let it pass
the conventional system. The micro-pollutants can
be degraded better in the aerobic, biologically active
soil layers (high concentration of micro-organisms
per cubic centimetres) with long retention times than
in water bodies whose ecosystems are much more
sensitive. Soil is considered a more suitable medium
for natural degradation of pharmaceuticals than water
because:
• The oxygen levels, promoting biodegradation, are
around 50,000 times higher than in water
• Exposure to UV light also helps to degrade
pharmaceuticals, although this only applies to the
surface (1-2 cm soil depth) and crops can shade the
ground.
• Terrestrial systems are much better equipped to
degrade organic compounds than aquatic ones. The
high specifc surface of soil particles maximises
the exposure of adsorbed chemicals, maximising
the kinetics of degradation such as oxidation,
reduction, enzymeenhanced diagenesis, etc.
• The wide biodiversity of the fungal and bacterial
fora of soil are also adapted to degrade various
sorts of organic molecules, both complex and
simple.
Ultimately, the potential risks from consuming
crops fertilised with urine need to be compared with
the risks related to pesticide use on crops, as well
as antibiotics and hormones given to farm animals
(poultry and cattle) which can be traced e.g. in
milk and eggs. The human use of pharmaceutical
substances is small compared to the amount of
pesticides (insecticides, fungicides, bactericides
and herbicides) used in agriculture, which are just
as biologically active as pharmaceutical substances.
Substance fow studies have confrmed that the dose
of natural and synthetic hormones and of many
pharmaceutical substances is larger when applying
manure than when applying human urine (Magid,
2006; Hammer & Clemens, 2007). Although it has
to be mentioned that the variety of pharmaceutical
residues applied via urine is higher than via animal
manure.
Urine is strongly toxic to earthworms as reported
from a PhD study (Muskolus, 2008). Urine
fertilization has been found to give a temporary
set-back to the population of earth worms, but the
effect is not permanent and after about 6 months,
the population had recovered (Muskolus, 2008). It
was investigated whether this response was related
to ammonia or pharmaceuticals in urine, however,
no such connections could be made. Soil microbial
enzyme activities were not infuenced by urine used
as a fertilizer. (Muskolus, 2008)
Trace metals
Human faeces and to a small extent urine contain
trace metals. The amounts of harmful heavy metals in
urine are miniscule and much lower than wastewater
sludge or even farmyard manure (WHO, 2006). This
is a result of the biological uptake being small and
their excretion being even smaller (Vinnerås, 2002).
Essentially all the heavy metals in the excreta from
a normal population come from the food ingested
and a large proportion of these metals will have been
removed from the felds with the crop. Thus, it is
possible to recycle excreta fertilizers, provided that
they have not been polluted when handled, without
threatening the sustainability of the agricultural soil
(Jönsson et al., 2004).
SAlINIzATIoN
The concentration of soluble salts in urine depends on
the amount of salts excreted as well as the amount of
liquid that passes through the body. A fgure reported
in Ganrot 2007 gives at hand that human urine
contains approximately 150 mM of NaCl (sodium
chloride), corresponding to a concentration of 8.8 g
per litre (Ganrot et al., 2007). Salt stress from sodium
chloride can be a major constraint in crop production,
especially in arid conditions. Salt sensitivity varies
Practical guidance:
Urine use in areas where salinization is an issue
should be monitored. Urine is a solution of
salts, and salt stress can be a major constraint
to plant production in arid areas. When urine is
used in these areas, irrigation practices should
be adapted, the urine should be watered down,
and application of urine should regularly be
interchanged with applications of water only.
6
practi cal gui dance on the use of uri ne i n crop producti on
with factors such as plant species and temperature.
Bernal et al., (1974) reported growth depression of
10 to 50 per cent grain yield of wheat when treated
with a solution of 50 mM NaCl. Salt-affected soils
are distributed all over the world but most of them are
found in arid and semi-arid regions
Fertilizers are to a large extent soluble salts and if
they are not managed properly they can contribute
to or cause salinization. For example, a study made
to investigate salinity and nitrogen rate effects on
the growth and yield of chile pepper plants by Villa-
Castorena et al., (2003) showed that high amounts of
nitrogen application, 140 kg ha
-1
and more, increased
soil salinity and in turn decreased plant growth and
yield.
In a South African study on the evaluation of human
urine as a source of nutrients for vegetables by Mnkeni
et al., (2005) it was found that under South African
table 7: the relative tolerance of common plants to salinity. Brady and Weil, 1999
Tolerant Moderately tolerant Moderately sensitive Sensitive
Barley (grain) Ash (white) Alfalfa Almond
Bermuda grass Aspen Broad bean Apple
Black cherry Barley (forage) Cauliflower Apricot
Cotton Beet (garden) Cabbage Bean
Date Broccoli Celery Blackberry
Olive Cow pea Clover Boysenberry
Rosemary Fescue (tall) Corn Carrot
Fig Cucumber Celery
Harding grass Grape Grapefruit
Kale Lettuce Lemon
Orchard grass Pea Onion
Oats Peanut Orange
Pomegranate Radish Peach
Rye (hay) Rice (paddy) Pear
Ryegrass (perennial) Squash Pineapple
Safflower Sugar cane Potato
Sorghum Sweet clover Raspberry
Soybean Sweet potato Strawberry
Squash (zucchini) Turnip Tomato
Wheat
conditions, very high rates of urine application
lowered yields. This was due to increased salinity of
the soil that led to high levels of sodium in plant tissue.
However the rates of N-application in the study were
extreme: 1600 kg N/ha, which increased the electrical
conductivity of the soil, resulting to classifcation of
the soil as a very strong saline soil after harvest. The
use of this level of application is never recommended.
It was also suggested that the salinity status of soils
fertilized with urine should be monitored in order to
detect possible salt-build up, which is reasonable.
Monitoring in arid regions would be advisable in order
to get long-term data on possible salt build-up in soils
and/or to keep rates of urine fertilization at a level that
is well adapted to the climate and crop. Plants vary in
their ability to tolerate salinity and a good selection of
crop is therefore an important part of optimizing the
crop yield in arid areas (table 7).
7
stockholm envi ronment i nsti tute
• the proft of the systems can be infuenced
signifcantly by a variety of factors. Among them
transport distance, project lifetime and nutrient/fuel
prices showed the largest effects;
• the distance between residential and agricultural
area should be minimised;
• economic tools are likely to help change people’s
perceptions and behaviours sustainably and present
an option to increase the implementation effciency
of the proposed systems;
• a fertilizer will not be purchased and used by
farmers if it is not competitive in terms of nutrient
content and plant availability, handling/managing
effort/costs and product price.
The text in box 1 (pages 8 and 9) describes a method
developed by CREPA using the monetary argument to
promote productive sanitation in Burkina Faso and Niger.
Cost/benefit analyses
Carrying out a cost/beneft analysis can provide support
for planning a sanitation system including the recycling
of urine and faeces to agricultural land. One such
analysis has been made in a project in South Africa
(CSIR, 2008) where costs and benefts of using urine as
a fertilizer were compared to costs and benefts of using
no fertilizer at all or using mineral fertilizer. The analysis
was based on interviews with subsistence farmers in
rural areas. Despite the higher installation construction
cost of a urine diverting toilet, this technology option
had a greater economic beneft irrespective of the
manner of management of the contents of the vaults.
This implies that the urine diverting toilet technology is
a better option for subsistence farming areas which are
attempting to improve soil fertility.
Another cost/beneft analysis was carried out in Niger
(Dagerskog, personal communication), where the cost
of constructing a toilet was compared to the value of the
fertilizer generated in the toilet. This small comparison
of fgures showed that the family using the urine as
fertilizers could, if they sold it on a market at slightly
less than the nutrient value in the liquid, get back the
money they paid to build the toilet in less than two
years.
A
ssessing the economic value of urine has many
dimensions. The value of reusing urine in crop
production is often much higher than the mere value
of the nutrients contained in urine. The yield increase
that can be attributed to the application of nutrient
rich urine compared to no fertilizer application
at all makes a strong case for the resource reuse
in agriculture and sustainable sanitation systems.
Monetary arguments are helpful when creating
awareness of the potential of productive sanitation.
Health and environment benefts are quite diffcult
to evaluate in monetary terms, while the economic
value of excreta in chemical fertilizer equivalents is
easier. This can be done by comparing the quantity
of the plant nutrients in excreta to the price of the
same nutrients in chemical fertilizers such as urea,
phosphate and different NPK fertilizers.
Dimensions on the economic and fnancial value of soil
nutrients have been explored by for example Drechsel
et al (2004). The two main models used in developing
countries focus on either the value of introduced
fertilizers, which will be further developed in the text
to follow; and the value of products from the studied
farming systems. Both methods have limitations and
potential, and the choice should be based on a decision
regarding target group, quality of in-data and desired
result.
A study on the marketing of urine and faeces from
residential areas in Kampala, Uganda, was carried out
by GTZ (Schroeder, 2010). Among the conclusions
were:
• the larger the systems are designed, the higher is
the economical proft;
eConomiC value oF urine
Practical guidance:
The value of the nutrients in urine can be calculated
by comparing the quantity of plant nutrients in
urine to the price of the same nutrients in chemical
fertilizers on the local market. Depending on the
current local fertilizer prices, the value of the urine
produced by one person per year will usually
be within the range of 4-7 Euros. To illustrate
the potential of the urine use this figure can be
multiplied by the number of household or village
members, or even by the entire population.
8
practi cal gui dance on the use of uri ne i n crop producti on
How much nutrient is there in human excreta
per year?
The amount of nitrogen and phosphorus in excreta
is calculated using the FAO statistics for food sup-
ply (equations 1 and 2). Due to the uncertainty of
FAO’s statistics for individual countries, the data in
figure 4 is based on the average for the ten West
African countries.
The excreta generated by a family represent a sub-
stantial quantity of fertilizers. The average family
in the Aguié province in Niger has nine members.
Urea and NPK (15:15:15; %N: %P
2
O
5
: %K
2
O)
are the common fertilizers. Interestingly, the annual
amount of plant nutrients in the excreta from one
family is roughly equal to the quantity in one 50 kg
bag of urea and one 50 kg bag of NPK.
table 8: annual amounts of nutrients in
excreta compared with mineral fertilizers.
Nutrient
Excreta
Kg per
person
Excreta
Kg per
family (9)
Urea (50kg) +
NPK15:15:15
(50kg)
N 2.8 25 27
P 0.45 4 3.2
(K) (1.3) (11.7) (6.2)
Most families cannot afford two bags of fertilizers.
No surprise then that the message “one family pro-
duces the equivalent to two bags of fertilizer” has
been met with great interest by the populations in
rural Niger. Locally, two bags of chemical fertilizer
cost roughly 80 $.
For Burkina Faso with 13.5 million inhabitants, the
annual amount of plant nutrients in excreta is in the
same order of magnitude as the annual amount in
imported fertilizer (table 9)
Figure 5: the family in niger produces as
much nutrients in urine and faeces as there
are in the two bags of mineral fertilizers.
table 9: amount of plant nutrients per year
in imported fertilizers compared to the
amount in excreta for Burkina Faso.
N (tons/
year)
P (tons/
year)
K (tons/
year)
Fertilizer imported* 22 632 8 801 14 801
Excreta produced 38 024 5 780 19 265
Ratio excreta/
fertilizer
1.68 0.66 1.30
*FAO statistics 2005
box 1: Calculating the economic value of urine - experiences from burkina Faso
Figure 4: the nutrient content in the excreta from an average person in west africa (based
on Fao data on food intake from 10 countries).
9
stockholm envi ronment i nsti tute
How much is it worth?
Calculating the market price for the different nutri-
ents can be straightforward.
table 10: the price of different nutrients in
Burkina Faso.
Nutrient Fertilizer
Price for
50 kg
(CFA)
Kg
nutrient
per 50
kg
Price / kg
nutrient
(CFA)
N Urea 20000 23 870
P TSP 20500 9.86 2079
K KCl 22500 24.8 907
However, this kg-price is based on single nutrient
fertilizers. Using this kg-price for the formula of the
most common NPK fertilizer, shows that buying the
nutrients individually is around 10% more expen-
sive than buying them as complex NPK fertilizer.
To take this fact into account, the excreta value is
reduced by 10 % in table 11.
table 11: the annual value of nutrients from
one person in Burkina Faso.
Nutrient N P K ToTAl
kg/person/year 2.8 0.43 1.3
Price/kg 870 2079 907
Value (CFA) 2400 900 1300 4600
Value - 10 % 4100 (~10 $)
For Burkina Faso with 13.5 million people, the hu-
man fertilizer value corresponds to 135 million $ per
year. In many countries chemical fertilizers are heav-
ily subsidized. A discussion based on the figures in
this text could be initiated to investigate the potential
of subsidizing toilets instead of chemical fertilizers.
The incentive to use a fertilizer is primarily that
the value of the extra crop produced will exceed
the cost of the fertilizer. The following calculation
can show this: Maize needs around 60 kg of N/ha
which is possible to provide with the excreta from
~ 20 persons. A well fertilized field (60 kg N/ha)
can yield 3 tons/ha, compared to 0.5 tons for the
traditional field. A surplus of 2.5 tons due to the
application of excreta from 20 people, or 125 extra
kg of maize for each of these 20 persons. 125 kg
of maize is worth around 50 $ US on the market
in Burkina Faso. This can be compared with the
nutrient value of the excreta (10 $ US) and with the
average annual income in Burkina Faso.
What is the value of a specific quantity of
urine?
In Burkina Faso the most common container for
urine storage is the 20 litre jerry can. The fertilizer
value of the urine can be estimated to 120 CFA or
0.25 $ US. It should be remembered that for cor-
rect analysis of the nutrient content of urine, the
urine and its sediment has to be well mixed, and
care has to be taken so that ammonia is not lost
from the urine.
table 12: the value of nutrients in one
jerrycan of urine.
Nutrient g/l
Kg/jerry
can
Price/
kg
value/jerry
can
N 5 0.1 870 87
P 0.5 0.01 2079 21
K 1.5 0.03 907 27
TOTAL 136
TOTAL -
10 %
~ 120 FCFA
The content of secondary macronutrients such as
sulphur, magnesium and calcium, and micronutri-
ents are seldom calculated, however, they contrib-
ute to the value of the urine since they make the
urine a full fertilizer.
10
practi cal gui dance on the use of uri ne i n crop producti on
R
esearch on urine as a fertilizer is carried out all over
the world, in settings ranging from very applied
demonstration trials to rigorous scientifc studies.
The following text describes some of the ongoing or
concluded activities. The examples are intended to give
a broad picture of results and research setup, and to
inspire future work in this area.
The yield achieved when fertilizing with urine varies
depending on many factors. One important aspect is
the soil condition. The effect of urine, just as that of
chemical fertilizers, is probably somewhat lower on a
soil with a low content of organic substances than on
a soil with a high organic content. Experience shows
that it is benefcial for soil fertility to use both urine and
faeces or other organic fertilizers on the soil, but they
can be used in different years and for different crops.
Human urine has been used frequently as fertilizer in
small scale gardening, though mostly not documented
(fgure 6).
CEREAlS IN NoRTHERN EURoPE
Urine was tested as a fertilizer to barley in Sweden
during 1997 to 1999 (Johanssson et al., 2001; Rodhe
et al., 2004). Results showed that the N effect of urine
corresponded to about 90 per cent of that of equal
amounts of ammonium nitrate mineral fertilizers,
which is estimated to correspond to about 100 per
cent of equal amounts of ammonium fertilizers, after
accounting for the N lost in the form of ammonia from
the urine.
Urine has been tested as a fertilizer to barley and ley in
both greenhouse and feld trials in Germany (Simons
and Clemens, 2004). The urine in some treatments was
acidifed in order to reduce ammonia emissions and
microbial contamination. The results from feld trials
showed that the fertilizing effect of urine was higher
than that of mineral fertilizer in production of barley.
There was no difference in yield between plots fertilized
with acidifed urine and untreated urine (Simons and
Clemens, 2004).
CroP Fertilization with urine – researCh results and
PraCtiCal exPerienCes
Figure 6: small scale gardening using urine in
niger. Photo: Linus Dagerskog
Figure 7: spreading of urine to barley.
Photo: Ebba af Petersens, WRS Uppsala
CEREAlS IN INdIA
Field experiments were conducted in farmers felds at
Nagasandra village, Doddaballapura Tq, Bangalore
district in India for one year to study the response of
maize to human urine when applied to meet the nitrogen
requirement (Sridevi, 2009). The treatments were
11
stockholm envi ronment i nsti tute
control, recommended dose of fertilizers, recommended
dose of nitrogen through human urine with and without
gypsum and fertilizer applied to soil and different
combinations of human urine and fertilizers. The results
of the feld experiment revealed that recommended
dose of nitrogen through human urine in 6 split doses
with irrigation water + gypsum increased the grain
(8.10 t ha
-1
) and stover (33.88 t ha
-1
) yield of maize.
Signifcant increase in the nitrogen, phosphorus and
potassium content of plant samples was observed in
the crops. The outcome of the investigation revealed
that urine diverting toilet systems help to provide better
sanitation, help farmers to save the cost on fertilizers
without negatively affecting the crop yields and thus
help to achieve food security.
vEGETAblES IN SoUTH AFRICA
Pot trials were conducted in South Africa where the
use of human urine on cabbage, spinach, maize and
tomato was studied (Mkeni et al., 2006). Yield, nutrient
content in soil and leaves as well as soil electrical
conductivity was monitored. The urine was diluted
1:3 (urine:water). The treatments were replicated four
times and arranged in a randomized complete block
design. Diluted human urine was found to be a good
source of nutrients, especially nitrogen, for cabbage and
spinach. Maize responded more or less equally to urea
and urine. Added N up to 200kg/ha in the form of urea
or urine resulted in signifcant increase in biomass dry
matter yield. However, above 200 kg N/ha there was
little or no signifcant increase in yield. As observed for
maize, tomato growth responded more or less equally to
added urea and human urine. The application strategy
is important, however, as risk of elevated salinity was
identifed in the research. Results showed that urine is
to be considered as effective agronomically as urea or
ammonium sources of nitrogen.
vEGETAblES IN WESTERN AFRICA
A research project was carried out in Ghana during
2004 and 2005 to investigate the nutrient effciency of
urine in comparison with mineral fertilizer and compost
and to estimate the value of cereal fertilization under
local conditions (Germer et al., 2006). The trials were
carried out north-east of Accra within Ghana’s coastal
savannah zone. Urine treatment was compared with
unfertilized control and compound fertilizer, compound
fertilizer plus water (same amount as supplied by
urine) as well as compost treatment on the performance
of cereals. The nutrient supply was based on the
application of 667<kg ha
-1
NPK 15:15:15 compound
fertilizer (100<kg N, 44<kg P and 83<kg<K). Urine
and compost were adjusted by the addition of TSP, KCl
and Urea to provide the same amount of N, P and K. In
both years the yield of the urine and compost treatment
were signifcantly higher than in the control (p<0.05). It
is concluded that the fertilization with P and K enriched
urine increases the yield of sorghum about 3.5 times
under the given conditions. Therefore, as a nutrient
source the effciency of urine is at least comparable to
mineral fertilizer. The additional sorghum grain yield of
1.4 t ha
-1
has locally a current market value of 1.000€
and sets off manifold the equivalent NPK fertilizer cost
of 100€ (200€ without subsidies).
vEGETAblES IN EASTERN AFRICA
Plant trials with urine have been carried out with
various vegetables in Zimbabwe (Morgan, 2003 and
Plant, growth period and
number of repetitions (n)
Unfertilized
plants
(g)
Fertilized, 3:1 water/urine
application 3x per week
(g)
Relative yield
fertilized to unfertilized
Lettuce, 30 days (n = 3) 230 500 2.2
Lettuce, 33 days (n = 3) 120 345 2.9
Spinach, 30 days (n = 3) 52 350 6.7
Covo, 8 weeks (n = 3) 135 545 4.0
Tomato, 4 months (n = 9) 1680 6084 3.6
table 13: average yields (grams fresh weight) in plant trials with urine as a fertilizer to
vegetables in zimbabwe. Morgan, 2003
12
practi cal gui dance on the use of uri ne i n crop producti on
2008). The following text reports one of the manyfold
trials that have been carried out. Plants were grown
in 10-litre cement basins and fed with 0.5 litres of a
3:1 water/urine mix three times per week. Unfertilized
plants were cultivated as a comparison. The increase
in production was large but no statistical analysis was
performed.
taste of sauerkrauts were similar in cabbages from
all three fertilization treatments. The results show
that human urine could be used as a fertilizer for
cabbage and does not pose any significant hygienic
threats or leave any distinctive flavor in food
products.
In a field trial in Sweden in 2002, different
application strategies for urine as a fertilizer to
leeks were tested (Båth, 2003). Fertilizing with
urine gave a three-fold yield increase. Neither yield
nor nutrient uptake were significantly affected by
whether the same total amount of urine was applied
in two doses or whether it was divided into smaller
doses applied every 14 days. The N efficiency (i.e.
(N yield – N yield in unfertilized plots)/added N),
when using human urine was high, ranging from 47
per cent to 66 per cent. This is on the same level
as when mineral fertilizers are used. N efficiency
for most other organic fertilizers, e.g. compost, is
normally between 5 and 30 per cent.

Human urine obtained from separating toilets was
tested as a fertilizer for cultivation of outdoor cucumber
(Cucumis sativus L.) in a Nordic climate (Heinonen-
Figure 8: the spinach to the right was
unfertilized. the spinach to the left was
fertilized with urine diluted with 3 parts of
water to one part of urine applied two times
per week. Photo: Peter Morgan, Aquamor
Figure 9: Cabbage from field trials in Finland.
Photo: Helvi Heinonen Tanski
vEGETAblES IN NoRTHERN EURoPE
Human urine was used in trilas carried out in Finland
as a fertilizer in cabbage cultivation in comparison
with industrial fertilizer and nonfertilizer treatments
(Pradhan et al., 2007). The main objectives of the
study were to evaluate the use of urine fertilizer
on (1) growth and pest-resistance of a crop plant,
(2) chemical and microbial quality of the crop,
and (3) flavor quality of a vegetable food product
prepared with natural lactic acid fermentation.
Urine achieved equal fertilizer value to industrial
fertilizer when both were used at a dose of 180
kg N/ha. Growth, biomass, and levels of chloride
were slightly higher in urine-fertilized cabbage
than with industrial-fertilized cabbage but clearly
differed from nonfertilized. Insect damage was
lower in urine-fertilized than in industrial-fertilized
plots but more extensive than in nonfertilized
plots. Microbiological quality of urine-fertilized
cabbage and sauerkraut made from the cabbage
was similar to that in the other fertilized cabbages.
Furthermore, the level of glucosinolates and the
13
stockholm envi ronment i nsti tute
Tanski et al., 2007). The urine used contained high
amounts of nitrogen with some phosphorus and
potassium, but numbers of enteric microorganisms
were low even though urine had not been preserved
before sampling. The cucumber yield after urine
fertilization was similar or slightly better than the yield
obtained from control rows fertilized with commercial
mineral fertilizer. None of the cucumbers contained
any enteric microorganisms (coliforms, enterococci,
coliphages and clostridia). In the taste assessment, 11
out of 20 persons could recognize which cucumber of
three cucumbers was different but they did not prefer
one over the other cucumber samples, since all of them
were assessed as equally good.
vEGETAblES IN CENTRAl AMERICA
Urine has been tested as a fertilizer to greenhouse-
grown lettuce in Mexico (Guadarrama et al., 2002).
There were treatments comparing urine with compost,
a urine-compost mixture, and no fertilizer at all. The
application rate was 150 kg of total N per hectare in
all treatments, except for the unfertilized control. Urine
gave the best yield of lettuce, due to its high availability
of N.
Urine has been tested as a fertilizer to amaranth in
Mexico (Clark, personal communication). Results show
that a combination of urine and poultry manure gave the
highest yield, 2 350 kg/ha. Chicken manure alone gave
a yield of 1 900 kg/ha. Human urine alone gave a yield
of 1 500 kg/ha and the unfertilized control gave a yield
of 875 kg/ha. The amount of N applied was 150 kg N/
ha for the three treatments. Soil sampling showed no
differences between treatments regarding physical or
chemical characteristics.
FRUIT IN INdIA
At Musiri near Trichy, Tamil Nadu, the organization
SCOPE established urine diverting toilets and the
National Research Centre for Banana started its
research experiments, using collected human urine as
fertilizer through a drip irrigation system (Jeyabaskaran,
2010). More information can be found at http://www.
scopetrichy.com/banana_research.asp .In the study,
Poovan banana was grown with 30, 40, 50 and 60 litre/
plant of human urine applied with irrigation water (1:10)
along with graded levels of commercial potassium
fertilizers. Yield (number of bunches and bunch weight)
was studied, as well as nutrient content in leaves, height
of plants and total amount of soluble solids in banana.
The number of fruits per bunch varied signifcantly
with application of graded levels of urine along with
different levels potassium Urine application at the rate
of 50 litres/plant recorded the highest average number
of fruits per bunch (185) and the control (without urine
application) recorded 110.3 fruits per bunch. Among
the treatment combinations, application of 50 litres of
urine/plant along with 75 per cent recommended dose
of potassium recorded the highest number of fruits per
table 14: results of a field trial using human
urine as a fertilizer for leeks. there was no
statistically significant difference between
treatments a, B and C. After Båth, 2003
Treatment N rate yield N yield
kg/ha* ton/ha** kg/ha *
A Urine every 14 days 150 54 111
B Urine twice 150 51 110
C
Urine every 14 days
+ extra potassium
150 55 115
D Unfertilized 0 17 24
* kg/ha= gram/10 m
2
Figure 10: Bananas from field trials in trichy.
Source: www.scopetrichy.com
14
practi cal gui dance on the use of uri ne i n crop producti on
bunch (223.4), which was 47.7 per cent more than that
applied with mineral fertilizer.
Application of 50 litres of human urine per plant with
75 per cent of recommended dose of potassium was
superior by recording 32.1 per cent more plant height,
25.6 per cent more pseudostem girth, 71.5 per cent
more number of leaves and 68.8 per cent more leaf
area, 25 per cent more leaf nitrogen concentration, 52.6
per cent more phosphorus concentration and 6.5 per
cent more leaf potassium than normally grown banana
plants without urine application (control).
Application of 50 litres of urine per plant along with 75
per cent recommended dose of potassium alone could
give an additional net proft of Rs. 45,175/- per hectare
when compared to mineral fertilizer alone, ie., normally
grown Poovan banana without urine application.
Field experiments were also conducted in farmers’ felds
at Nagasandra village, Doddaballapura Tq, Bangalore
district for one year to study the source separated human
urine as a source of nutrients for banana cultivation
(Musa paradisica) to meet the nitrogen requirement of
this crop (Sridevi et al., 2009). The treatments were
absolute control, recommended dose of fertilizers,
recommended dose of nitrogen through human urine
with and without gypsum and fertilizer applied to
soil and different combinations of human urine and
fertilizers. The results of the feld experiment revealed
that the highest bunch yield (30.0 t ha
-1
) of banana was
recorded in the treatment which received RDN through
human urine (After 30 days of planting) + Gypsum
applied to soil when compared to control, and other
treatment combinations. The available nutrient content
of harvest soil viz., N, P and K had signifcant infuence
on it. Signifcant increase in the nitrogen, phosphorus
and potassium content of plant samples was observed
in the crop. The highest total soluble solids (25.85 per
cent), reducing sugars (20.93 per cent) and total sugars
(23.87 per cent) were recorded in banana grown using
human urine. The outcome of the present investigation
revealed that ecosan system helps to provide better
sanitation, help farmers to save the cost on fertilizers
without affecting the crop yields and thus help to
achieve food security.
15
stockholm envi ronment i nsti tute
W
hen fertilizing plants, the yield first increases
up to a certain application rate, and then
decreases if the application rate is increased. If
the optimal application rate is not known, then the
application of the urine from one person during a
full day per square metre (approx 1.5 litres of urine/
m
2
, corresponding to 40-110 kg N/ha) and cropping
season can be used as a rule of thumb. If there is
a restriction in plot size, it is usually possible to
increase the fertilization up to three or four times
without any negative effects on crops or environment
and even larger amounts can beneficially be applied
if there is no or low risk of salinization. However,
both the quantity and the quality of the yield are
important and high rates of available N can affect the
quality, positively and negatively. For example, the
quality of wheat is generally improved by a high N
dose, while the quality of for example Irish potatoes
may decrease since the tubers can become watery.
The timing of the application is also important here
since the nutrient uptake by most crops decreases
after the crop enters the generative phase, such as
ear setting in maize.
The practical application strategies are a part of
the safe barrier approach introduced in the chapter
on safe handling of urine. The following sections
present different ways to apply urine in crop
production.
APPlICATIoN TIME
In the early stages of cultivation, good availability of all
nutrients is important to enhance growth. If fertilizer is
applied only once, this should normally be carried out so
that nutrients in urine are available during the frst half
of the time between sowing and harvest. If the crop is
fertilized twice, the second fertilization can be performed
after approximately 1/4 of the time between sowing and
harvest, but depending on the needs of the crop. The
crop can also be continuously fertilized, e.g. if the urine
is collected in smaller containers and used more or less
directly. However, once the crop enters its reproductive
stage most crops do not take up substantial amounts of
nutrients. An example is maize; fertilizer applied until
aPPliCation strategies
Practical guidance:
The urine from one person during one year
suffices to fertilize 300-400 m
2
of crop to a level of
about 50-100 kg N/ha. Urine should be handled
in closed tanks and containers and should be
spread directly onto the soil, not on the plant, in N
doses equivalent to what is recommended for urea
and ammonium fertilizers. Air contact should be
minimized and the urine should be incorporated
into the soil as quickly as possible.
Figure 11: urine fertilized sorghum to the left.
Photo: Linus Dagerskog
Practical guidance:
Urine should be applied according to the needs
of the plants. Good availability of nutrients is
important in the early stages of cultivation, though
once the crop enters its reproductive stage nutrient
uptake diminishes. From a health perspective this is
good since increased time between application and
harvest decreases risk of pathogen transmission. A
waiting period of one month between fertilization
and harvest should always be observed. In regions
where there is heavy rainfall during the cropping
season, repeated applications of urine may be an
insurance against losing all the nutrients in one
rainfall event.
16
practi cal gui dance on the use of uri ne i n crop producti on
the plants are setting ears is well utilised, but after this
stage the uptake of nutrients from the soil declines.
After this stage the nutrients are mainly relocated within
the plant (Marschner, 1995). This is fully appreciated in
recommendations on use of chemical fertilizers. E.g.
in Zimbabwe, where maize is harvested 3-5 months
after planting, the recommendation is to fertilize it
three times, but no later than 2 months after planting.
As a rule of thumb, fertilization should stop after 2/3 to
3/4 of the time between sowing and harvest. Crops not
entering the generative stage, e.g. lettuce, spinach, as
well as roots and tubers, e.g. Irish potatoes and sweet
potatoes continue to take up nutrients throughout their
growth period. However, a waiting period of 1 month
between fertilization and harvest is recommended
from a hygiene point of view for all crops eaten raw
(Schönning and Stenström, 2004; WHO, 2006).
An often stressed aspect is the risk of leaching of
nutrients. In regions where there is heavy rainfall during
the cropping season, repeated applications of urine may
be an insurance against losing all the nutrients in one
rainfall event. However, from a eutrophication point of
view, it should be remembered that the leaching after
fertilization is small compared to the leaching from a pit
latrine or from just letting diverted urine leach into the
ground close to the toilet.
The total applied amount of urine and whether it should
preferably be applied once or several times also depends
on the N need of the plant and its root size. Root size
varies widely between different crops. Plants with
ineffcient or small root systems, e.g. carrots, onions and
lettuce, can beneft from repeated applications of urine
throughout the cultivation time (Thorup-Kristensen,
2001).
APPlICATIoN RATE
A starting point for the estimation of suitable urine
application is the local recommendations for use of
commercial mineral N fertilizers, especially of urea or
ammonium fertilizers. If such recommendations are not
available, another starting point can be to estimate the
amounts of nutrients removed by the crop, where the
removal of nutrients has to be adjusted for the expected
yield level. Urine can be recommended for most crops.
The productive area (e.g. grass, fower beds, vegetable
garden, trees) necessary per person for use of all the
urine on household level depends on several factors:
• the nitrogen demand and tolerance of the crop;
• the concentration of nitrogen in the collected urine;
• the ammonia loss when applying the urine;
• how many harvests that can be taken per year;
• whether the soil already is saline or has a high risk
of becoming saline.
Rules of thumbs are useful when the exact fgures
for the above factors are unknown. The nitrogen
demand for common crops varies between 100 – 200
kg/ha, depending on type of crop and the yield. The
box 2: I have a flower bed the size of 1 m
2
,
how much urine do I need to fertilize it?
The flower bed really only needs about 1.5 litres
of urine for one season, but this amount can be
increased by up to four times as needed, depend-
ing on the type of flower. Summer flowers (annu-
als) demand a good soil structure and quite a
good nutrient status in the soil. Roses need low
amounts of nutrients in the autumn in order to
survive the winter. A good strategy would be to
apply urine on a few occasions during the flow-
er season, for example with 2-3 decilitres each
time, and to water down the urine afterwards.
Figure 12: application of diluted urine in early
stages of cultivation. Photo: Linus Dagerskog
17
stockholm envi ronment i nsti tute
days (weeks)
after planting
or emergence
of first plant
from seedling
Eggplant Tomato onion/carrot lettuce Pepper
Sor-
ghum/
millet
Corn
14 (2) 0.5
litres
per
plant
0.4 litres
per plant
(when
the plant
starts to
flower)
1 litre /m
2

(assuming 20
plants per and
dilution: 1part
urine to 1 part
water)
0.5 litre
/ plant
0.5
litre per
plant
before
seeding
0.6 litre
21 (3) 1 litre of urine per m
2

(assuming 50 plants
per m
2
and 1 part
urine to 1 part water)
28 (4) 0.4 litre
per plant
1 litre /m
2

(assuming 20
plants per m
2

and dilution:
1part urine to
1 part water)
0.6 litre
per plant
(when
first fruits
appear)
35 (5) 0.5 litre
per plant
0.5
litre per
plant
0.6
litre per
plant
42 (6) 1 litre of urine per m
2

(assuming 50 plants
per m
2
and 1 part
urine to 1 part water)
0.5 litre
per plant
56 (8) 0.5 litre
per plant
table 15: application levels and intervals for specified crops in Burkina Faso.
Source : Moussa Bonzi, CREPA, Burkina Faso
A family of five has a plot size of 300 m
2
on which
they want to use the urine they collect in their urine
diversion toilet. The family lives in a climate allow-
ing for two yearly crops. If we assume that they ap-
ply 4 l per m
2
for the first crop, and 2 l per m
2
for
the following crops, how many m
2
do they need to
use their urine in their garden?
Answer:
Since they live in an area where two crops can
be taken per year and 6 l/m
2
can be applied
yearly. Each person excretes about 550 l, but as-
suming that some of the time is spent outside the
home, about 300 l per person is collected yearly.
The result is 1,500 l of urine from a family of
five. This will fertilize 250 m
2
since each m
2
will
receive 6 l m
2
/ on a yearly basis, giving a quite
high level of nitrogen fertilization. Thus, the plot
size would be more than sufficient to productively
use the collected urine.
box 3: Calculation of necessary productive area in garden to maximize nutrient use in urine.
box 4: My 20 litre container for urine is full.
How do I use it in the garden?
Twenty litres of urine is sufficient for 4-13 square
metres of cropping area, depending on how
much nitrogen is needed or beneficially toler-
ated.
concentration of nitrogen in urine depends on diet.
Undiluted urine will usually contain between 3 – 7 g
N/l. A person excretes about 300-550 l urine per year,
depending on liquid intake, climate etc. The excreted
amount of N per person per year with urine varies
between about 1.6 kg – 3.8 kg. If the nitrogen demand
of the crop is 100 kg/ha and the N concentration in the
urine is 7 g/l the urine from one person can fertilize
18
practi cal gui dance on the use of uri ne i n crop producti on
385 m
2
(1.5 l of urine per m
2
), if one single crop is
taken per year. If there is a restriction in plot size, it
is usually possible to increase the fertilization up to
three - four times, thus using up to 6 l per m
2
without
any negative effects on crop or environment and even
larger amounts can benefcially be applied, if there is no
or low risk of salinization. Such large applications of
urine can be benefcial for the crop yield, if excessive
ammonia is lost in the application and especially on
phosphorus defcient soils as the phosphorus application
is increased. However, care should be taken on soils and
in regions prone to eutrophication of watercourses to
use nutrients in urine in the most effcient manner.
dIlUTIoN
Urine can be applied neat (without dilution) or diluted
with water, which is practised in many places. The level
of dilution varies between approximately 1:1 (1 part
water to 1 part urine) to 1:15 (one part urine to ffteen
parts water ), and 1:3 seems common. Dilution involves
increasing the volume to be spread and thus the labour,
the equipment needed, the energy use and the risk for
soil compaction are all increased.
Dilution has the advantage of decreasing, or
eliminating, the risk of applying urine at such high
rates that it becomes toxic to the crop. However,
irrespective of whether the urine is applied diluted or
neat, urine is a fertilizer and should, just as the much
more concentrated chemical fertilizers, be applied at the
rate corresponding to the desired application rate of N,
while additional water should be applied according to
the needs of the plants. Thus, urine can be applied neat,
or even concentrated to the soil, which then is irrigated
according to crop water requirements. The urine can
also be diluted into the irrigation water at a rate that
depends on the need for nutrients and water by the crop.
The application of a water/urine mix normally needs to
be interspersed with irrigation with water only.
Diluted urine should be handled in the same way as urine.
In order to avoid smells, loss of ammonia, generation of
aerosols, burns and possible contamination on plants by
remaining pathogens, urine should be applied close to,
on or incorporated into the soil. Foliar fertilization is
not recommended due to odour, loss of N, risk of plant
toxicity and hygiene risks.
Concentrated urine has a higher pH, and consequently,
dilution means that the effect of storage on pathogen
content in urine will be lowered. Keep the urine
concentrated during storage, and if dilution is chosen
as a strategy, this should be carried out as close to
application as posssible. It has been observed that if
diluted urine is stored in open containers (which is not
recommended), this may become a breeding site for
mosquitoes that can act as disease vectors. This has
never been seen in concentrated urine.
SToRAGE TECHNIqUES
Urine needs to be stored in order to achieve proper
hygienization, especially if collected from many
households. There is also need of storage if urine is
collected when there is no cropping season. One thing
that all storage systems have in common is the fact that
urine must be stored in closed containers in order to
avoid ammonia losses.This section presents different
techniques for storage of urine. There is a need to
develop low-cost storage methods for small and large
scale collection of urine.
Jerry cans are the most common way of collecting
urine, and a very good way to store urine for a short
period. A good example was introduced by CREPA
Burkina, where the jerry cans used for collection of
urine were yellow, and jerry cans used for transportation
of hygienized urine from storage to feld were green, see
fgure 14.
Practical guidance:
Urine can be applied neat or diluted with water.
There is no standard recommendation for dilution/
non-dilution and the existing recommendations
vary depending on the local conditions. Levels
of dilution can vary between 1:1 (1 part urine to
1 part water) and 1:15 (one part urine to fifteen
parts water). Most common dilution ratios are 1:3
or 1:5. However urine should always be applied at
the rate corresponding to the desired application
rate of N, while additional water should be applied
according to the water needs of the plants.
Practical guidance:
Storage of urine should always take place in
a closed container in order to avoid ammonia
emissions.
19
stockholm envi ronment i nsti tute
One cubic metre tanks are also quite common in small
and medium scale collection systems, fgure 13. The
advantage is that the tanks are also readily available,
they can easily be flled and emptied, and they are
durable.
For large scale storage, slurry tanks can be used
(fgure 16). However, these seldom have a cover that
minimizes ammonia losses, and such a cover needs to
be built. Ready-made tanks can also be bought for large
scale storage of urine, as has been shown in Sweden
(fgures 15 and 17).
Figure 13: storage of urine in one cubic metre
tank. Photo: Anna Richert
Figure 14: yellow container for fresh urine,
green container for stored urine to be sold to
farmers. Photo: Linus Dagerskog, CREPA/SEI
Figure 15: ready-made large scale storage of
urine in Bornsjön, sweden.
Photo: Ebba af Petersens, WRS Uppsala
Figure 16: slurry tank in wintertime, sweden.
this slurry tank will be used for human
urine, and it will be equipped with a cover to
minimize ammonia losses.
Photo: Lennart Qvarnstrzöm
Figure 17: storage tank during construction of
housing area in Kullön, sweden. each tank is
12 m
3
. Photo: Mats Johansson, VERNA
20
practi cal gui dance on the use of uri ne i n crop producti on
SToRAGE IN SoIl
Storage of urine may be a constraint in settings
where low-cost options are a neccessity. Therefore
different methods to avoid storage containers have
been developed. In regions where the inter-cultivation
periods are dry, storage of urine nutrients in soil is an
alternative for extending the storage capacity and also
the labor intensive fertilization period. This is carried
out by applying and incorporating the urine into the
soil during the dry inter-cultivation period, followed by
normal cultivation of the already fertilized soil during
the cropping season. The idea is that the main portion
of the nutrients remain in the soil and will be available
for the plants during the growing season. Further
investigations are needed to determine the loss and
availability of nutrients, especially N and P, to crops
during and after such storage. Results from SUDEA
in Ethiopia (Terrefe, personal communication), as
well as from an ongoing project in Niger (Dagerskog,
personal communication) indicate that the method
is an interesting alternative where storing the urine
in containers until the cropping season is impossible,
even though the N loss might be fairly high. During
one measurement where the urine nutrients were stored
28 days in the soil, the loss of mineral N was found
to be 37 per cent (Sundin, 1999). There is also a risk
that some P might be bound in forms that are less plant-
available during the storage, but K and S should remain
fully available. An additional advantage of soil storage
is that the labour of applying the urine is carried out
during the dry season, which is normally less labour-
intensive than the cropping season.
APPlICATIoN TECHNIqUES
Manual application techniques
The choice of application technique varies for different
types of crops. For crops that are grown in rows, urine
can be spread in a trench right next to the crop row. For
crops that are planted in rows, with spacing between
the plants, urine can be applied in a dug hole next to
the crop. For trees, urine shoud be spread in a circle
Practical guidance:
For best fertilizing effect and to avoid ammonia
losses, urine should be incorporated into the soil
as soon as possible after application, instantly if
possible. This also limits potential health risks of
direct exposure A shallow incorporation is enough,
and different methods are possible. One is to
apply urine in small furrows that are covered after
application. When spreading urine, it should not
be applied on leaves or other parts of the plants,
as this can cause foliar burning. Spraying urine
in the air should also be avoided due to the risk
of nitrogen loss through gaseous emissions of
ammonia and the hygiene risk through aerosols.
Drip irrigation with urine is another possible
application technique. However, when this
technique is used, measures must be taken to
avoid clogging of emitters. In the larger scale,
equipment for spreading of animal slurry is used.
Figure 18: different application techniques for
urine. Photos: Linus Dagerskog
Practical guidance:
Urine can be stored in the soil if storage capacity
is lacking. Storage in soil is carried out by applying
urine where is will be used during a dry inter-
cultivation period.
21
stockholm envi ronment i nsti tute
around the tree that corresponds to the circumference
of the branches. All these application recommendations
are also benefcial from a health perspective since they
avoid direct contact of urine with the planted crops.
For best fertilizing effect and to lower ammonia losses
and odour, the urine should be incorporated into the
soil as soon as possible after the application, instantly if
possible (Rodhe et al., 2004). A shallow incorporation
is enough, and different methods are possible. One is
to apply urine in small furrows that are covered after
application. Washing the nutrients into the soil with
subsequent application of water is another option.
When spreading urine, it should not be applied on
leaves or other parts of the plants, as this can cause
foliar burning due to high concentrations of ammonia
and salts when drying as well as hygiene considerations.
Spraying urine in the air should also be avoided due
to the risk of N loss through gaseous emissions of
ammonia (Johanssson et al., 2001; Rodhe et al., 2004),
odour and the hygiene risk through aerosols.
Some crops, e.g. tomatoes, are sensitive to having all
their roots exposed to urine, at least when plants are
small, while on many crops no negative effect at all
is seen. Therefore, before the sensitivity of a crop is
known, it is wise not to simultaneously expose all the
roots of the plant to urine, be it neat or diluted. Instead,
urine can be applied either prior to sowing/planting or
at such a distance from the plants that the nutrients are
within reach of the roots, but not all of them are soaked.
For annual plants this distance may be about 10 cm.
large scale application techniques
Urine application in the larger scale is best done with
equipment ordinarily used for farmyard slurry. In areas
where soil compaction is an issue, care must be taken to
keep the urine as concentrated as possible. No dilution
with water is receommended here, and application is
best done just before light rainfall.
drip irrigation
Drip irrigation using urine as a fertilizer is another
possible application technique. However, when this
technique is used, measures must be taken to avoid
blockages due to precipitation of salts forming sludge
as the total amount of precipitation often increases
after dilution, since the dilution water normally
contains magnesium and calcium. Thus, when using
drip irrigation, it might be a good idea, instead of
mixing urine and water, to apply the neat and fltered
(desludged) urine for some time and then for the rest of
the time to apply only water
Drip irrigation of rice, vegetables and yam has been
tested by CREPA, Ivory Coast (Comoe, personal
communication). Polyethylene piping, with 30 cm
between the holes, is tested on a feld of 500 m
2
. The
urine fows with gravity fom a tank, through a flter,
and directly to the crop. No blocking of pipes has
been reported. The piping is rinsed with water after
each urine application. Urine application is carried out
during rainfall to facilitate urine introduction into the
soil.
Figure 19: large scale application of urine on
agricultural land.
Photo: Ebba af Petersens, WRS Uppsala
Figure 20: drip irrigation of cassava in Cote
d´ivoire.
Source: Bernard Comoe 2009, CREPA Cote d´Ivoire 2009
22
practi cal gui dance on the use of uri ne i n crop producti on
odoUR WHEN USING URINE AS A
FERTIlIzER
Bad odour is culturally associated with pathogens.
However, smell may also signal that urine contains
nutrients since ammonia smells strongly. Experience
shows that if the urine is spread close to and directly onto
the soil and watered down there is little smell. Handling
of urine is naturally a smelly activity and procedures
minimizing air exposure, e.g. by using closed containers,
application close to soil and immediate incorporation
or irrigation, are strongly recommended. All of these
measures will also contribute to minimizing ammonia
losses and protecting health.
CoMbINEd APPlICATIoN oF URINE ANd
oRGANIC FERTIlIzERS
The combined use of urine and organic fertilizers
such as faeces, compost, farmyard manure or slurry is
benefcial, especially in cases where the soil is depleted
and defcient in nutrients and organic matter. Organic
fertilizers improve the structure of the soil, and increase
microbial activity. This in itself will facilitate the
uptake of nutrients inte the plant since microorganisms
participate in transforming nitrogen into forms that are
taken up by the plant.
When faecal matter is used, care should always be
taken to follow guidelines for safe use of faeces in
order to render the food chain safe and minimize the
risk emanating from pathogens in the faeces. Faeces
should be properly treated and hygienized.
Practical guidance:
Urine has a distinctive smell. However, this is seldom
a problem if urine is stored in closed containers
and spread according to the information in this
text.
23
stockholm envi ronment i nsti tute
treatment and sanitization
diminishes this risk. Again, a storage time for a week or
longer will substantially reduce the risk, the longer the
better. More information on storage times is found in
the sections below. Groups that are potentially at risk
comprise collection personnel and feld workers, local
communities and product consumers. Here the handling
and application practices in the feld is of importance.
As regards other contaminating substances in human
urine (heavy metals, hormones and pharmaceuticals)
there are many indications that possible health risks
are far smaller than those associated with the common
sanitation system and that it is reasonable to believe that
the risk for negative effect on the quantity and quality of
the crops is negligible.
MUlTI bARRIER CoNCEPT
The World Health Organization (WHO) guidelines for
safe use of wastewater, excreta and greywater (2006)
recognize the potential of using excreta in agriculture
and promote a fexible multi-barrier approach for
managing the health risks associated with the use of
excreta in agriculture. This multi-barrier concept is
comprised of a series of measures/barriers along the
entire sanitation system from ‘toilet to table’. Each of
the barriers has a certain potential to reduce health risks
associated with the excreta use and it is recommended
by WHO to put in place several of these barriers if
needed in order to reduce the health risk to an acceptable
minimum. The reduction from each of the barriers can
be added together, which then give both enhanced total
risk reduction and also ensure that variabilities and
insecurities in each step are balanced in the long run.
Thus even insuffciently treated excreta can be reused
U
rine is essentially sterile when it leaves the body.
The main issue for urine use in agriculture is how
to avoid faecal cross-contamination. In addition, there
are diseases that in some regions in the world are spread
with urine. The following section gives hints on how to
handle urine in order to minimize the risk of using urine
as a fertilizer. It should be noted that the advantages
of using urine for food production outweighs the risk
of disease transmission by far. There are a number of
easily undertaken activities that will render the use of
urine safe, so read on.
HEAlTH RISKS
Health risks associated with the use of human urine
in crop production are generally low. However
during source separation in the toilet faecal cross-
contamination of urine can occur. The amount of
faecal cross-contamination is directly proportional to
the health risks. If faecal matter enters urine, the urine
will contain different types of enteric pathogens that
can represent a potential health risk. Their presence is
naturally dependent on whether the users are infected
or carriers of the organisms in question. In the case
of diarrhoea the risk of faecal cross-contamination is
higher.
In addition a few organisms of health concern may be
excreted with the urine. One example is Salmonella
typhi/paratyphi. These bacteria have a short survival in
stored urine, there is reduction of the risk of pathogen
transmission by at least 1000 times after a week of
storage. Therefore never use unstored urine when
typhoid/paratyphoid cases are suspected. Another
example is Schistosomiasis Haematobium, which is a
parasite found only in Africa. However, in order to pose
a risk, the eggs need to reach a watercourse and fnd
a suitable snail-host. Use of urine in agriculture with
spreading techniques recommended in this book greatly
Practical guidance:
Health risks associated with the use of human
urine in plant production are generally low if there
is no or little faecal cross-contamination. Storage
of urine in closed containers will lower health risks
substantially.
Practical guidance:
The WHO guidelines for safe use of excreta in
agriculture (2006) promote a flexible multi-barrier
approach for managing the health risks associated
with the use of excreta in agriculture. This multi-
barrier concept contains a series of measures/
barriers along the entire sanitation system from
‘toilet to table’. Each of the barriers has a certain
potential to reduce health risks associated with the
excreta use and it is recommended by WHO to put
in place several of these barriers in order to reduce
the health risk to an acceptable minimum.
24
practi cal gui dance on the use of uri ne i n crop producti on
as long as the emanating risks can be managed with
subsequent barriers. Effective barriers for safe use of
urine in agriculture can be found in the graphic below.
For more information visit the WHO website: http://
www.who.int/water_sanitation_health.
Source Separation
Source separation is an effcient barrier to reduce the
risks compared to a combined wastewater system. A
key objective of urine collection is to minimize faecal
cross-contamination. Urine diverting toilets should be
designed in a way to minimize the cross-contamination.
If urine is collected from urinals, the risk of cross-
Figure 21: the multi Barrier approach. Figure by Robert Gensch
box 5: Example of risk assessment and
ablution water.
In a school in Tanzania a very well designed san-
itation system was implemented with separate
collection of faecal material and urine to be used
in an agricultural plot within the school. Howev-
er, from a risk reduction point of view there were
still substantial problems since the ablution wa-
ter was lead untreated to an area that was used
for the pupils to play in (direct contamination as
transmission) and to a part of the agricultural
plot (transmission from the produce). The ablu-
tion water normally constitutes a minor volume
(100 – 500 ml/washing). If this water instead
had been lead through a pipe directly into the
ground to a small soak-pit the risk for ground-
water contamination would have been very small
due to the small volume.
contamination is negligible. The ablution water for
washers should also be considered. If this water is
combined with the urine the risk of cross-contamination
is increased, especially if the users have diarrhea.
The mode of collection, transport and emptying of the
urine may also create situations where an exposure to
humans can occur. If the urine collection chamber is
fowing over, the cross-contaminated urine will be on
the ground where direct contact may occur to playing
children (design – have an overfow with a soak
away). The containers for urine should not be used
for other purposes such as fetching water or brewing
beer. Transport to the feld or to a secondary storage
container should avoid spill. Containers for transport
should have a tight-ftting lid.
Storage and Treatment
It is recommended that prior to application urine should
be treated in order to sanitize the urine and reduce
microbial health risks. Storage at ambient temperature is
considered a viable treatment option. The storage times
should be based on temperature and the likelihood of
faecal cross- contamination as well as the vulnerability
of the exposed population. A single family will most
probably transmit disease between each other through
direct routes and not through the use of collected urine.
Thus in a family, when the urine is used in a local garden
and the produce is used for family purpose only, a less
strict storage regime can be applied. A less strict storage
(1-2 weeks) can also be applied for urinals where the
faecal cross-contamination is excluded. When urine is
collected from many different users as well as when the
25
stockholm envi ronment i nsti tute
produce is sold/transferred to a third party, the microbial
risk increases substantially. In these situations a longer
storage time should be used, rendering the used
urine safer and increasing the reduction of potential
pathogens present. Recommended storage times vary
depending on the system type (large-scale systems:
1-6 months, households/urinals: 0-1 month). If cross-
contamination is likely to occur the storage time can
be adjusted upwards, exceeding 1 month. This also
applies for cold climates since the temperature is also
a governing factor in the die-off. As a rule: The longer
the storage the better.
Urine should be stored in sealed containers in order to
prevent direct contact with the urine for humans and
animals. Urine should not be diluted while stored, to
provide a harsher environment for microorganisms
and increase die-off rate of pathogens. Examples exist
where the washing water of the toilet room has been
mixed with the urine, resulting in a high dilution. This
again has resulted in mosquito breeding in the highly
diluted urine with open lids as well as a lowered
pathogen reduction.
An interesting example of the introduction of new
fertilizers to the agricultural community comes from
Burkina Faso. Urine from over 1 000 households in the
capital Ouagadougou is collected in yellow jerry cans
(see fgure 22). The urine is taken to a treatment station
where it is stored in tanks for a specifed amount of time.
table 16: recommended storage times for urine
a
based on estimated pathogen content
b
and
recommended crop for larger systems
c
. WHO, 2006
Storage temperature Storage time
Possible pathogens in the
urine mixture after storage
Recommended crops
4°C >1 month Viruses, protozoa
Food and fodder crops that are to be proc-
essed
4°C >6 months Viruses
Food crops that are to be processed, fod-
der crops
d
20°C >1 month Viruses
Food crops that are to be processed, fod-
der crops
d
20°C >6 months Probably none All crops
e
a Urine or urine and water. When diluted it is assumed that the urine mixture has at least pH 8.8 and a nitrogen concentration of
at least 1 g/l.
b
Gram-positive bacteria and spore-forming bacteria are not included in the underlying risk assessments, but are not normally
recognised for causing any of the human infections of concern.
c
A larger system in this case is a system where the urine mixture is used to fertilize crops that will be consumed by individuals
other than members of the household from which the urine was collected.
d
Not grasslands for production of fodder.
e
For food crops that are consumed raw it is recommended that the urine be applied at least one month before harvesting and
that it be incorporated into the ground if the edible parts grow above the soil surface.
When hygienization is fnished, the liquid is tapped into
green jerry cans, fgure 14, and sold to farmers under
the name Birg Koom which means liquid fertilizer in
the local language. The same concept is being used in
Niger in a similar project. This is one way to demystify
urine as a fertilizer and to signal that the product is safe
to use in agriculture.
The storage intervals stated in table 16 are for urine
collected in toilet systems where there is a risk of
faecal contamination. If urine is collected from urinals,
shorter storage intervals (1-2 weeks, see above) are
recommended due to lower risk.
Figure 22: Collection of urine from
households in ouagadougou, Burkina Faso.
Photo: Linus Dagerskog
26
practi cal gui dance on the use of uri ne i n crop producti on
table 17: risk levels in relation to crop and handling strategy.
Crop Example
Inherent
risk
People exposed
to risk
Application time****
Urine
storage***
Slow growing crops Pineapple Low Workers In early stages
No storage
needed
Ornamental flowers, garden
plants
Low Workers
Up until one month
before harvest
No storage
needed
High growing crops not picked
off the ground and with “cover”
Banana. Low Workers
Up until one month
before harvest
No storage
needed
Grain crops processed before
eating
Millet, Rice,
Sorgum,
Maize
Low Workers
Up until one month
before harvest
No storage
needed
Hanging plants not in direct con-
tact with the ground and usually
not eaten raw
Egg plant Medium
Consumers and
workers
Up until one month
before harvest
Storage
needed
Fruits likely picked from the
ground and eaten directly*
Mango,
passion
fruit, orange
Low Workers
Outside the fruiting sea-
son**
No storage
needed
Hanging plants partly or fully in
contact with the soil and eaten
raw
Tomatoes High
Consumers and
workers
Up until one month
before harvest
Storage
needed
Root crops processed/cooked
Cassava,
potatoes
Low
Protection of
workers
Up until one month
before harvest
No storage
needed
Root crops eaten raw Carrots High
Consumers and
workers
Up until one month
before harvest
Storage
needed
Leafy crops on the ground that
are cooked
Spinach Low Workers
Up until one month
before harvest
No storage
needed
Leafy crops eaten raw
Lettuce,
cabbage
High
Consumers and
workers
Up until one month
before harvest
Storage
needed
Energy or fibre crops
Cotton, oil
crops
Low Workers
Up until one month
before harvest
No storage
needed
* If vegetables are grown under fruit trees then the measures of precaution or barriers for vegetables need to be observed.
** If fertilization takes place close to the fruiting season, then precautionary measures or barriers need to be observed such as
storage of urine.
*** The storage time for urine is not indicated, since this also depends on local factors such as temperature or design of collection
system (degree of faecal contamination).
****Urine application should take place considering crop needs and common practice in the region. Continuous application can
take place where so noted, from a barrier point of view. A waiting period of one month should always be observed.
Crop restrictions
When treated urine is used no particular crop restrictions
need to be applied. However, as an additional
precautionary measure the urine use may be restricted
to non-food crops (e.g. cotton), crops that are processed
(e.g. wheat) or cooked before consumption (e.g. potato)
as well as crops/trees that allow for a distance between
soil and harvested part of the crop. In general it can
be stated that the longer the time between application
and harvest – the less risky. Thus for crops with short
rotation times, like spinach, salad crops and radish the
risk will be higher, and pretreatment is recommended,
i.e. storage is required, but in the case of pineapples,
for example, (rotation time 1-2 years) the risk is non-
existent from the urine if it is spread at amounts and
timing corresponding to the needs of the plants,
consequently minimum 3 months before harvest.
One goal when constructing systems for the use of
urine in crop production should be to reach a reasonable
level of risk reduction for persons involved in the use
of the system, such as feld workers, households or
consumers. The following matrix suggests strategies
for crop choice and fertilization in order to minimize
risk and maximize utilization of nutrients.
27
stockholm envi ronment i nsti tute
Withholding period
A withholding period between the last urine application
and the harvest is a barrier that provides time for
pathogen die-off. Risk calculations have shown that a
1 month withholding period results in substantial risk
level reduction and combined with the other barriers in
the multiple barrier approach the result will be a risk far
below 10-6 DALY for pathogenic bacteria, viruses and
parasitic protozoa (WHO 2006). Therefore, a withholding
period of 1 month between last urine fertilization and
harvest is always recommended. The withholding time is
based on the die-off of organisms due to external factors
like drying, temperature and UV-light on the surface of
leafy plants. The die-off may be lower in the soil. This
does not contradict the recommendation to apply the
urine in the soil. For root-crops that are eaten raw (radish,
carrots, onions etc), the post-harvest handling is of
importance. However, it needs to be strongly stated that
in these situations use of urine still constitutes a lower
risk than sludge, manure, wastewater or irrigation with
contaminated surface water.
Application techniques
Urine application close to the ground is recommended.
This reduces the direct contact with the edible parts
of the plants. For example – do not apply urine with a
watering can on the edible or foliar parts of vegetables).
The urine should be incorporated into the soil either
mechanically or by subsequent irrigation with water.
If urine is applied before or during sowing/planting
a further die-off will occur of potential remaining
pathogens (see with-holding period) and thereby the
risk will be reduced.
Protective Equipment
Although there is little risk associated with treated
urine it is recommended if possible that agricultural
feldworkers wear appropriate protective clothing
(shoes and gloves) as an effective barrier to reduce
potential health risks. This is of importance when
heavy faecal cross-contamination has occurred and
is of less concern for urine than wastewater or sludge
application. A heavy faecal load can lead to exposure
through bare skin by hook-worms and during direct
contact and subsequent contact with the mouth (the
faecal-oral route) while touching the face, eating and
smoking. In these situations gloves reduce the risk.
Protective clothing is of concern not just for the workers
but also so that contaminants are not transported to the
households/families.
Handwashing with soap after urine handling
Washing hands with soap after urine handling can be
considered an additional barrier in the system. Self-
evidently basic recommended health and hygiene
practices like hand washing after toilet use and prior to
meals should always be observed.
Practical guidance:
The time between urine application and harvest
should be at least one month.
Figure 23: application of urine using
protective equipment. Photo: Linus Dagerskog
Practical guidance:
Urine application close to the ground is
recommended in order to reduce contact with edible
parts and minimize spreading of urine drops.
28
practi cal gui dance on the use of uri ne i n crop producti on
Food handling and cooking
Harvested crops should always be washed before
consumption. Cooking or peeling of fruits/vegetables
is another effective measure to considerably reduce
the associated health risks since pathogen reduction
between 2-6 log units can be achieved.
Health and hygiene promotion
Effective hygiene education and promotion should
be conducted in order to inform local growers and
food handlers in markets, restaurants, home and
food kiosks how and why they should wash produce
fertilized with urine.
Microbial treatment of urine
Microbial treatment of urine has been introduced in
order to lower smell and increase the nutrient value of
urine. This has been studied in Mexico since the 1990´s
(Arroyo, 2005), and in ongoing (2010) projects in the
Philippines (Terra Preta Sanitation, Xavier University).
The concept is to introduce microorganisms into the
urine at storage. Microbial inoculation liquid or ordinary
compost/vermicompost is added to the urine container
prior to storage. The fermentation prevents the bacterial
urease process that hydrolyses urea into ammonia
and bicarbonate, which usually happens during urine
storage. Added benefts may be less volatile ammonia
and lower smell.
29
stockholm envi ronment i nsti tute
handling system For use oF urine as Fertilizer
T
he following section describes the handling chain
for urine from toilet to feld, for different settings.
Regarding the household, a handling system is easy
to construct and major points of consideration have
already been covered in the text. A good example of
small scale use of urine as a fertilizer and the handling
system is from the Phillipines where an allotment
garden manual has been compiled (PUVeP, 2008).
But for large scale settings there are few functioning
examples and many see the need to explore this subject
in order to move urine diversion systems into full scale
and mainstream function. The text below presents two
major such systems, both functioning, but with their
respective drawbacks. Further development in this area
is neccessary.
lARGER SCAlE SySTEMS
This section presents two cases to demonstrate the
complexity of handling systems for urine. One case
is from Sweden, where urine is collected from 250
households for use in agriculture, and one case is from
Burkina Faso where more than 1 000 toilets have been
built in urban Ouagadougou and urine is used in crop
production.
Important aspects to consider when planning
transportation of urine are choice of technique,
entrepreneur, hygiene and documentation.
Municipalities usually have companies that are
contracted to transport waste fractions generated within
the municipality, see fgure 24. An interesting alternative
is to contract the farmer who will be using the urine
for transportation services. This way the farmer can
generate some additional income from handling the
urine. The hygiene aspect must be considered, and the
entrepreneur must have information about measures
such as proper hand hygiene after handling of urine.
A mouth cover is not necessary, more important is to
eleminate spill and to maintain good hand hygiene. All
transport should be documented as a part of a quality
control system.
An important challenge for the sustainability of large
scale urine handling systems is to minimize the costs
of the system towards the goal that no subsidies would
be needed. Experience from Sweden and Burkina Faso
show that the fertilizer value of urine, when valued as
chemical fertilizer, is not suffcient to pay for additional
costs in the handling system such as transportation or
storage, and thus an emptying fee is probably needed
from the household and/or a subsidy by the municipality
to pay for the handling system. The cost of handling
and applying the urine as a fertilizer is in many cases
lower than the cost of fushing the urine to a wastewater
treatment plant where the N and P are removed.
box 6: quality control and certification
One need for the farmers is to insure that the
company buying the crops does not have objec-
tions to the choice of human fertilizers. Recent
development has seen quality control systems
for crop production evolving, and this is appli-
cable for the fertilizers as well. In Sweden, certi-
fication schemes have been developed for sew-
age sludge, as well as digested and composted
household waste, supporting the use of these fer-
tilizers in agriculture. A similar setup for source
separated urine is proposed, which would sim-
plify more widespread use of urine in Swedish
agriculture.
Figure 24: a conventional “honey-sucker”,
collecting sludge from on-site waste-water
systems. Photo: Västerviks Municipality, Sweden
30
practi cal gui dance on the use of uri ne i n crop producti on
Case one: reuse of urine in vaxholm, Sweden
Kullön is located on an island in the municipality of
Vaxholm, not far from Stockholm. 250 households
have one or two urine diverting double fushing
toilets installed. Urine is collected in groups of 10-
20 m
2
tanks that serve from 5 to 40 houses each. The
system has been described in ESR report 2006:1 by
Kvarnström et al; http://www.ecosanres.org/pdf_fles/
Urine_Diversion_2006-1.pdf
Two times a year urine is collected by lorry, on
commission by the household owners organised in a
collective. This is a service that the household owners
pay for outside their normal taxes for waste and
wastewater collection which has caused conficts in the
area.
The urine is taken to a farmer where it is stored for
more than 6 months. The farmer is paid for the storage
and treatment by the housing collective at Kullön,
and has entered this project as a part of the business
diversifcation of his agricultural enterprise.
The stability of the system is at stake since the
municipality, who has the responsibility for collection
and treatment of household waste, has not fully taken
the responsibility for this. Increased costs in the system
have been imposed on the households, whereas the
households do not see why their sanitation system
which has been proved more environmentally friendly,
should cost them more.
The farmer using the urine needs to show a certifcate
to the buyers of his products in order to guarantee the
quality and traceability of the used fertilizers. This
demands documentation and analyes of the urine in
initial stages.
Overall the system has taken much much work to initiate
and an overlying conclusion is that the handling system
from an institutional point of view was not fully taken
into account when the housing area was planned, which
has caused problems. However, a functional system for
the use of urine in agriculture exists, and the farmer is
quite content with the business that he is running.
Case 2: Urine collection and use in urban
ouagadougou
During 2006 to 2009, a project was implemented in
Ouagadougou, Burkina Faso, with fnancing from the
EU, GTZ and CREPA (Coulibaly, 2009). Through a
broad range of activities the project aimed to support
1,000 households in obtaining appropriate and
affordable closed-loop sanitation. A key point in this
urban project is that it established an urban supply chain
for urine and faeces from urine diverting dry toilets
(UDDT). The project has so far:
• built 1000 UDDT;
• supported the establishment of two supply chains
for the collection, transport and distribution of the
raw and the treated excreta;
• trained 1,000 gardeners to use these products as
fertilizers;
• supported 20 SMEs (small to medium enterprises)
who are now involved in system operation;
Figure 25: inhabitants of Kullön inspecting the
urine tanks. Photo: Anna Richert
Figure 26: the slurry spreader comes to fill up
urine for application to winter sown wheat in
spring. Photo: Anna Richert.
31
stockholm envi ronment i nsti tute
• trained 100 artisans (masons etc.) to provide
the necessary infrastructure, in particular the
construction of the toilets.
The physical infrastructure of the ecosan system
consists of:
• UDDTs at household level and at public places in
four sectors of Ouagadougou;
• four treatment sites called eco-stations for urine
and faeces in the same four sectors, each run by a
separate association;
• collection, transport and delivery of urine, dried
faeces, sanitised urine and of sanitised dried faeces;
• the use of sanitised urine and faeces in peri-urban
gardening.
The vaults are emptied by the collection service workers
and urine and faeces are brought to an eco-station for a
further drying/storage period and for fnal packaging.
For the transport to the eco-stations, urine is collected
in 20 L yellow jerricans, and faeces are transported
in plastic bags. Every full 20-L jerrican collected is
replaced by an empty one. A central point of the urban
ecosan system is the treatment site, or eco-station,
which connects the households with the gardeners/
smallscale farmer. Two of the four ecostations are built
near the sites of market-gardening. The eco-stations
are equipped with the sanitizing equipment required
(plastic tanks for urine and storage pits for faeces) and
accompanying infrastructure such as a hangar for the
working material, space for the donkeys which pull
trolleys of urine jerricans and a storage room for the
fnished fertilizer products. The number of plastic urine
tanks varies from 6 (in small sectors 19 and 27) to
12 (large sectors 17 and 30). For sanitisation, urine is
transferred to the eco-stations and stored for one month
in closed 1 m
3
plastic tanks, while faeces from double
vault UDDTs are stored and kept dry in chambers (total
volume: 6 m
3
) for two months.
To facilitate the collection in the households, the sectors
are divided into smaller areas. Each team of collectors
has to visit all latrines within 2 weeks. The collectors
may have to cover distances of up to 12 km (the daily
work time is estimated to 5-6 hours). In total, the four
associations operate with approx. 28 people, 10 donkeys
and 10 donkey carts.
At the beginning of the project, the technical team
and facilitators informed the households and farmers
Figure 27: Components of urine collection system in ouagadougou, Burkina Faso. Photos: CREPA
32
practi cal gui dance on the use of uri ne i n crop producti on
about the benefts of using ecosan products for crop
production. To raise acceptance among the users
(gardeners, farmers and consumers), it was decided
to rename the urine and faeces. Thus, sanitised urine
is sold in green 20-L cans labelled “birg-koom” in the
local language which means liquid fertilizer, while
sanitised dried faeces are sold in bags labelled “birg-
koenga” meaning solid fertilizer.
One important aspect of the project was to ensure the
quality and the safety of the ecosan products which
are to be sold to the farmers. The gardeners and
small-scale farmers were trained to use the treated
urine and faeces on different vegetables (e.g. Tomato,
cabbage, cucumber, zucchini, carrot, salad, aubergine,
strawberry, etc.). Moreover, samples of sanitised urine
und dried faeces are sometimes taken and analysed by
the National Water Laboratory (Laboratoire National
des Eaux) for N, P and K values, and for pathogens
such as E. coli. Results shown that sanitized urine is
safe (without pathogens) and, used as fertilizer, has no
negative impact on the environment and the health.
One important question has been the economic
stability of the supply chain. As established, the costs
for running the collection system are higher than the
fnances that are generated in the system, through a fee
to the household and through selling urine and faeces at
market prices. The fee for households was $US 0.60 per
month and the urine was sold to the farmers from the
eco station at $US 0.20 per jerry can of 20 litres, faeces
at $US 0.10 per kg. This means that there is a need to
cut costs without risking the safety of the reuse system.
The project is described in the SuSanA case study
format: http://www.susana.org/images/documents/06-
case-studies/en-susana-cs-burkina-faso-ouagadougou-
uddt-2010.pdf
33
stockholm envi ronment i nsti tute
gender asPeCts
T
he process to integrate a gender perspective
in institutions and operations is called gender
mainstreaming, a process to insure that intervention
effects on women and men are anticipated and
deliberate. Well planned, this should lead to additional
benefts that go beyond good water and sanitation
performance, such as economical gain, empowerment
of women, increased equality and benefts to children
(African Development Bank, 1998).
The gender aspect of ecological sanitation has been
described in Dankelmann (2009) and in SuSanA 2009,
Working Group 12. However, regarding the specifc
question of how use of urine in crop production
infuences the gender question, very little has been done.
There are important gender perspectives in agriculture
linked to ecological sanitation, and further research and
documentation would be valuable.
Women are responsible for basic household food
security in many countries in the world. With agriculture
based on ecological sanitation, families could save
money by growing their own fruit and vegetables and/
or selling some of the produce. This, however, has to be
weighed against the signifcant time constraints faced
by many women, particularly those who are the main
or sole income- earners for their households. Moreover,
women are often constrained by lower access to
formal education and training, relative to men, and
are often confned to the informal sector. Small scale
agriculture, as a means of ensuring greater food security
and potential supplementary income, is particularly
attractive to women as it allows them to work close
to their homes and facilitates the carrying out of other
traditionally important roles, such as care of children,
the elderly and the sick. The importance of ensuring
that women as well as men are involved in planning
and decision-making on agricultural initiatives, and
have equitable access to training and extension services
needs, however, to be emphasized.
Both women and men need access to cash incomes and
would be assumed to welcome the potential economic
benefts of ecological sanitation, if the opportunities
for small-scale entrepreneurship in construction and
operation of latrines and collection systems as well as
starting small market gardens are made available to both
women and men. It has not yet been documented, but
a potential confict between household food production
and the production of cash crops may arise as the
knowledge increases of urine as a fertilizer. How this
would affect the gender balance is unclear but in many
situations, the household garden with implications for
food security is the responsibility of the woman, and the
cash crop production is the responsibility of the men in
the family. There is also a question relating to the value
of the urine. If urine is sold as a fertilizer, who in the
family will access this fnancial input? Traditionally,
women take responsibility for waste products in the
household, but if they have a value, will this change?
With regard to the issue of waste handling, to what
extent will reuse of urine affect the traditional roles in
this area? To what extent will the labor involved increase
the women’s, men’s or children’s work burden? How
are such issues affected by whether there is a market
for urine or not? Further documentation and research is
recommended.
Specifc attention is also needed for the hygienic needs
of women and girls. During a menstrual cycle, blood
will enter the urine and faeces chambers when women
use a urine diverting toilet. Usually, the amount of
Practical guidance:
In order to achieve sustainable use of urine in crop
production the gender perspective needs to be
included in implementation. This can for example
mean to consider the different roles of men and
women regarding the production of cash crops
and food for the household.
Figure 28: harvest of urine fertilized tomatoes.
Photo: Linus Dagerskog, CREPA/SEI
34
practi cal gui dance on the use of uri ne i n crop producti on
menstrual blood is small in comparison to the amount
of urine in a container. The urine may be slightly more
reddish in color, but its properties are unchanged by
the addition of menstrual blood and there is no threat
to the sanitizing or composting process or to its future
use as agricultural fertilizer. A more pressing issue is
most likely the impression of the urine when it contains
menstrual blood, which is closely linked to the issue of
dignity and well-being of those using the system and
handling the urine.
35
stockholm envi ronment i nsti tute
institutional asPeCts oF agriCultural use oF urine
U
se of human excreta often falls outside existing
regulatory frameworks. This is increasingly
evident for agricultural application, where the new
fertilizers are often not defned in the legislatory or
advisory texts of many countries. The weak legal and
institutional framework in many countries makes it
diffcult to implement and scale up innovative sanitation
solutions. The following text gives some support in the
work to establish an institutional setup for use of urine
in crop production.
Key aspects for establishing an institutional setup for
the use of urine in agriculture
Institutional aspects include how to organize a system.
This organization is done by defning roles, setting up
a legal framework, policies and institutions to manage
the system. The following points suggest activities that
are of importance when implementing an institutional
setup for use of urine.
Identify stakeholders and clarify drivers and
restrictions for each stakeholder.
There are many stakeholders in a recycling sanitation
system and it is important that the drivers and restrictions
of each stakeholder are understood. This is especially
important for farmers as they are key stakeholders.
Farmers are businessmen and the recycling system can
often become more sustainable if the farmers are also
used as entrepreneurs for the collection and handling of
the products, as this can give benefts corresponding to
their business potential.
Include the farmers in the initial planning
When sanitation systems are planned, farmers are
frequently not involved from the start. If farmers
are allowed to infuence the implementation of
sustainable sanitation systems from the start,
problems can be avoided that would otherwise lead to
sub-optimization and economic problems. If farmers
are involved from the beginning, then for example the
implementation of storage and collection systems can
be adapted to the possibilities and constraints of the
farming community.
Practical guidance:
The following activities can help to establish an
institutional setup for urine use in agriculture.
- Stakeholder analysis: Identify stakeholders and
clarify drivers and restrictions for each one in
relation to the implementation of urine use in
crop production
- Include and target the farmers in the initial
planning
- Organize an arena for feed-back and
interaction between stakeholders
- Organize local communities so that there is a
structure for implementation and a structure for
monitoring
Figure 29: small scale entrepreneur using
urine as a fertilizer.
Photo:Linus Dagerskog, CREPA/SEI
Figure 30: information about productive
sanitation in niger. Photo:Linus Dagerskog
36
practi cal gui dance on the use of uri ne i n crop producti on
Organize an arena for feed-back and interaction
It is also important that there is an arena where
the different stakeholders of the system meet and
communicate. This is especially so, since the systems
are new and thus their improvement potential is
large. An arena where agriculture stakeholders can
meet stakeholders within the domains of sanitation,
environment, planning, technical implementation, etc,
is of vital importance.
Organize local communities so that there is a
structure for implementation and a structure for
monitoring.
Local government has a key role as facilitator and
regulator, fnding ways to promote innovation while
box 7: Case study regulatory aspects of urine
use in agriculture in Sweden
The Swedish legislation embraces the idea of nutri-
ent reuse and includes sustainability and protection
of the environment in different pieces of legisla-
tion and policies. The Environmental Code (http://
www.naturvardsverket.se/en/In-English/Menu/
Legislation-and-other-policy-instruments/The-En-
vironmental-Code ), dating from 1999, contains
several opportunities for the implementation of
closed nutrient loop oriented sanitation technolo-
gies for on-site sanitation in Sweden. Recycling
and efficient use of natural resources are integral
objectives of the Code as is the precautionary prin-
ciple; the polluter pays principle and the concept
of “Best Available Technology”. These principles
are, however, not always used by the local envi-
ronmental authorities when specifying the require-
ments for on-site sanitation system. In accordance
with the Environmental Code, urine is considered a
household waste fraction and the responsibility for
collection and treatment falls on the municipality.
This fact has made the municipal departments (of-
ten the technical departments) responsible for solid
waste in Sweden look closer into their responsibility
for urine and the implications of urine collection
and reuse. The Planning and Building Act gives the
municipalities the ability to single-handedly decide
on the spatial planning and infrastructure develop-
ment in the local situation but this has never been
used to enable closed-loop approaches for waste-
water systems.
In parallel to the Environmental Code, National
Environmental Quality Standards were estab-
lished in 1999 (http://www.naturvardsverket.se/
en/In-English/Menu/Legislation-and-other-policy-
instruments/Environmental-quality-standards ).
Sweden’s Environment Policy is based on sixteen
environmental quality standards for different are-
as. These describe what quality and state of the en-
vironment should be to be sustainable in the long
term. Recirculation of natural resources (including
nutrients) is included and one of the targets states
that by 2015 at least 60% of phosphorus com-
pounds present in wastewater should be recovered
for use on productive land, out of which half should
be returned to arable land1. Another example of
the mainstreaming of nutrient recycling is the re-
vision of the agricultural use of sludge statutes ,
issued by the Swedish Environmental Protection
Agency in 1995, which also will regulate the use of
human urine in agriculture as well as other waste-
water fractions. The proposal is expected to be de-
cided on in 2010. The background to the statutes
proposal and also the background to the target of
60% P recovery are described in Kvarnström et al
(2002).
The conclusion is that there is a relatively enabling
legislative environment for recycling and reuse of
nutrients from sanitation systems in Sweden. What
is missing are economic incentives that could un-
leash the on-site sanitation market, and the inte-
gration of reuse aspects in the strategic municipal
planning.
1 http://www.miljomal.nu/Environmental-Objectives-
Portal/
holding service providers accountable and achieving a
degree of protection to the environment and health
REGUlAToRy FRAMEWoRK
The regulatory framework is often not well developed
regaring the implementation of systems for recycling
of nutrients from sanitation systems. The question may
often be whether there is anything that specifcally
prohibits the use of urine in crop production, such as
there is in Germany, or if the use is simply unregulated
and therefore possible. Ideally, a regulatory framework
facilitates the recirculation of nutrients from sanitation
systems, and sets targets for environment or health that
use of urine in crop production can help in meeting.
37
stockholm envi ronment i nsti tute
URINE USE IN oRGANIC AGRICUlTURE
Urine is a perfect fertilizer for organic production,
where synthetic mineral fertilizers are not allowed.
However, there are certain barriers to the use of urine
in production systems when labelling for organic
production is used. These barriers are expressed
for example in regulations by the European Union.
Organic agriculture is governed by the European
Union regulation (EEG) 2092/91 which applies
to all certifed European organic agriculture. This
regulation regulates among other things the inputs
allowed in organic agriculture. Human urine is at
present not included as a fertilizer in the EU regulation
which makes it diffcult for organic farmers in Europe
or exporting to a European market to use human
urine. The Swedish Organic Agriculture Certifying
Organization (KRAV) has achieved an exemption
for one farmer, who has a closed loop system where
nutrients are recycled and food delivered in the same
community, resting on the assumption that if there is a
proximity between the community and the farmer, the
risk of contamination or unsustainble practices will
be diminished.
The International Federation of Organic Agriculture
Movements, IFOAM, indicates that source
separated human excreta which is monitored for
contamination is not to be directly applied on edible
parts of plants. In addition, there is a restriction
in the use of human excreta on food crops, but
exceptions may be made where detailed sanitation
requirements are established by the standard-
setting organization to prevent the transmission
of pathogens (http://www.ifoam.org/about_ifoam/
standards/norms/norm_documents_library/Norms_
ENG_V4_20090113.pdf ).
Practical guidance:
Key activities to establish a regulatory framework
that enables and facilitates use of urine in crop
production:
- establish use of excreta in local, regional and
national legislative texts for health, sanitation,
environment and agriculture
- establish correct terminology on use of excreta
in regulatory texts
- invite legislators on local, regional and national
level to discuss the question of reuse of excreta
from toilet systems
- start work in setting up policy and targets
regarding use of excreta at local, regional and
national level.
38
practi cal gui dance on the use of uri ne i n crop producti on
CroP exPeriments using urine as a Fertilizer
W
hen planning a crop fertilization experiment
the first and most important question is to
define the objective of the experiment. The answer
to this question has a decisive influence on how
the experiment should be planned, its costs and
complexity. If the answer is that the desired result
is increased knowledge among local population,
a simple demonstration trial showing yields with
urine, with mineral fertilizer and without fertilizer
can be used. If the answer is increased knowledge
in the farming community and for extension
professionals, a more extensive experiment
allowing statistical analysis is needed. The
following sections describe different strategies to
increase knowledge about cropping systems where
urine is used as a fertilizer.
dEMoNSTRATIoN ExPERIMENTS
Demonstration experiments are very useful and
fexible tools as they are cheap, quick and easy to
set up. They can be small pot experiments or large
feld experiment. A good idea is often to set up small
demonstration trials just outside the entrance doors
to the extension offce, in schools or other places in
the centre of the society where many persons can be
reached. There is no need for repetition and the need
for documentation is small. But it is good if the results
are clearly visible and therefore the fertilization level
should preferably be large and the water factor well
controlled. The photos below show pot experiments
by Peter Morgan Zimbabwe and feld experiments in
Rwanda.
CoNTRollEd ExPERIMENTS To TEST THE
FERTIlIzING PoTENTIAl
In this type of experiments, as many factors as possible
should be controlled e.g. the amount of water , weeds,
insects and fungi, and maybe even climate, and the
crop should be established in the optimal way. These
experiments can be done on a very small scale, pot
or lab scale, and they often yield good, repeatable
and reliable results. Due to this small scale, this type
of experiment is actually the cheapest one for getting
repeatable and reliable results. To get statistically
signifcant and conclusive results several repetitions
should be done, which due to the small scale often is
fairly easy and cheap.
Figure 31: spinach (swiss Chard) fertilized
with urine (left) and without fertilizer (right).
Photo: Peter Morgan
Figure 32: Field trials from niger. urine
fertilized millet to the right. Photo: Linus Dagerskog
Practical guidance:
Crop experiments should be started on local
level in order to establish the use of urine as a
fertilizer in the local agricultural community. The
level of experimentation can range from simple
demonstration trials to scientifically rigorous
research. In any case, demonstration trials should
be started in a place that is easily accessible to
farmers and househols owners.
39
stockholm envi ronment i nsti tute
The advantage of this type of well controlled
experiment is that the variation between years is small
even if it is performed outdoors. This means that after
just one experimental season the result can be fairly
representative. Another advantage that this type of
experiment shows the full fertilizing potential of urine
to the crop in question. One disadvantage however,
is that this full potential might not at all show the
fertilizing effect that a farmer will experience in a real
situation.
CoNTRollEd ExPERIMENTS To TEST THE
REAl lIFE FERTIlIzING EFFECT
This type of experiment is much more realistic, as the
same crop management procedures are followed for
the experimental plots as are usually followed by the
farmers. This means that if the year is very dry and
the crop is not irrigated, then the crop might suffer
severely and the fertilizing effect might be negligible
as it is the water factor that decides the yield. Likewise,
other years it might be weeds, fungi or insects, that has
decisive infuence on the crop yield. These experiments
are often participatory and carried out on farms.
Repetitions in order to carry out statistical analysis
increase the possibility of drawing conclusions from
this type of research, but it is often a challenge to ensure
that the treatment actually is the same on the different
farms involved. .
This type of experiment has the clear advantage that
its results are much more realistic and more easily
transferred to, and scaled up by the farmers than the
fully controlled experiments previously described. It,
however, also has the clear disadvantage that the yield
results are very much infuenced by the weather and
season, which vary between years. This means that to
be fairly sure to get any type of representative results
normally at least 3 years and preferably 4-5 years of
crop experiments are needed.
FARM ANd CRoP RoTATIoN ExPERIMENTS
This is the most complex, realistic and most diffcult
and expensive type of experiment. While the two
previous types of experiments normally are confned to
one crop at a time, in this type of experiment, the full
range of crops normally grown by a farmer each year
is included in the experiment, and the effect on farm
economy of fertilizing these crops is evaluated. This is
a highly relevant type of experiment, especially under
marginal farming conditions, but these experiments are
very resource demanding, as they include several crops
and need to be repeated at least 3-5 years.
STATISTICAl CoNSIdERATIoNS
For all types of controlled crop experiments (not
including demonstration trials), the experimental
plots should be as even as possible, but even so, the
comparison between the treatments should be repeated
several times, if possible 3-5 times in the same feld.
The order of the treatments should be randomized
within each repetion.
table 18: example of experimental layout.
Repetition 1 T4 T3 T2 T5 T1
Repetition 2 T4 T1 T2 T3 T5
Repetition 3 T2 T1 T3 T5 T4
Repetition 4 T1 T5 T4 T2 T3
In table 18, 4 repetitions with 5 treatments (T1-T5)
in randomized order in each repetition are shown in
a simplifed experimental layout. While the whole
blocks should be treated according to the plan, it is
only the harvest of the central area that should be
measured and allowed to infuence the results, in
order to minimize the edge effects of the small plots.
dISSEMINATIoN oF RESUlTS
The volume of published results from projects where
urine has been introduced as a fertilizer is rapidly
increasing. However, there are numerous knowledge
gaps, and therefore it is important to capitalize on
experimentation that is done by publishing results
in fora that reach as many professionals as possible.
It is quite important to reach not only agricultural
professionals, but also professionals within sanitation,
sociology, environment, etc. as well as the general
public and local target groups.
40
practi cal gui dance on the use of uri ne i n crop producti on
weB-Based tools For CalCulation
A
simple excel-based tool has been developed
for calculation of collected amounts as well as
nutrient content and value. The tool is available at
http://www.sanergy-net.de/calculator.php. Similar tools
can well be developed for the extension level in order to
get a view of the potential for nutrient reuse when urine
is used as a fertilizer.
A simple calculator has been created (2010) to provide
information on crop productivity increases from using
treated urine (Takin Ruwa) as fertilizer compared to
unfertilized, for millet growing in Niger. http://www.
ecosanres.org/aguie/model.htm The model is built
in Excel. The model requires two input variables to
function. The input variables are a combination of
number of people, amount of urine, cropping area and
application rate. Using these input variables, the model
calculates the potential crop productivity for millet. The
output is given in two groupings, one for millet without
fertilizer and one for millet with Takin Ruwa fertilizer.
Both the crop productivity and the yield are given,
including a range that is based on the standard deviation
for the source data.
Figure 33: a sample page from the aguie calculator for providing information on crop
productivity increases from using treated urine. AP-Aguie 2009
41
stockholm envi ronment i nsti tute
Part 2 · how to develoP loCal guidelines
I
n order to be implementable in a local context the
wealth of information given in this book so far needs
to be further translated or adapted to respective local
site conditions. The following chapter provides some
recommendations on how local guidelines can be
developed and structured and it summarizes the most
important factors that directly or indirectly infuence
farming activities related to urine use. Not all of the
listed aspects necessarily need to fnd their way into
the fnal guideline version at a local level and it is very
much up to local experts to fnally decide on what needs
to be included. However the listed aspects set the frame
of what generally needs to be considered for successful
local adaptation. Examples of local guidelines for urine
use in crop production are presented in annexes.
The main aim of a local guideline as presented in this
text is to be a national, regional or local support tool
that is clearly targeted at agricultural extension workers
and not the farmers. For farmer level frequently more
simplifcation is needed, which can be done by the
extension workers on the basis of the local guidelines
developed using these instructions.
THE PRodUCTIvE SANITATIoN APPRoACH
A general understanding of the concept of reuse-
oriented productive sanitation is a prerequisite for
successful local implementation. If the concept is well
known no further explanation is necessary. Otherwise
a brief introduction on the reuse-oriented sustainable
sanitation approach, the link between sanitation
and agriculture, the global limitations in synthetic
fertilizer production, the resource value of urine and
its productive potential should be included prior to the
more practical oriented recommendations.
Links to more information:
- SuSanA WG 05 fact sheet (food security) ® http://
www.susana.org/images/documents/05-working-
groups/wg05/en-wg5-factsheet-2008-05-28.pdf
SuSanA vision document I (‘towards more sustainable
sanitation solutions’) ® http://www.susana.org/
images/documents/04-meetings/side-events/2009-
singapore/01-en-panesar-introduction-susana-wts-
singapore-2009.pdf
loCAl SITE CoNdITIoNS
Although people working in agriculture usually know
quite well how their respective local climate, soil and
water conditions are it might be relevant to include a
chapter that specifcally focuses on how this impacts
on urine use.
Climatic conditions
Information on climatic region, temperature, rainfall
pattern, humidity and seasonal specifcs. For example,
in arid regions with low rainfall and high temperature
evaporation might be very high or in tropical areas with
high rainfall it should be recommended to apply urine
more often in smaller doses.
Water situation
General information on availability, sources and
potential contamination of water that is used for
plant irrigation. If data is locally not available
the water situation should be at least described
qualitatively.
Soil conditions
Basic information on soil quality and general soil
conditions that infuence the foreseen agricultural
activity. This includes soil type and texture (e.g. if
soil is more sandy then more frequent fertilization
is needed) soil ph (acidity/alkalinity that affects the
availability of nutrients in the soil), as well as organic
matter content (fertilizing effect of urine lower on soils
with low organic matter content) and salinity (e.g.
if soil is saline organic material should be added as a
buffer or more water needs to be added). In many cases
this information is locally available. In any case good
agricultural practises should be observed in order to
maintain the soil fertility.
PEOPLE
SOIL
Urine + faeces
Safe fertiliser
Food
Crops
Figure 34: Closing the loop.
42
practi cal gui dance on the use of uri ne i n crop producti on
PlANT REqUIREMENTS ANd NUTRIENT
CoNTENT IN URINE
This section of the local guideline gives instructions on
type of crops, nutrient requirements, need for urine as
a fertilizer and the benefts of using urine as a fertilizer.
The section on benefts is especially important, and can
be used as an advocacy text not only for agricultural
extension personnel.
Type of crops
The type of crop(s) determines the farming system, soil
requirements as well as amount of nutrients and water
required for optimal plant growth. If only urine will be
used as a fertilizer it is recommended to give priority to
crops that have high value and respond well to N (e.g.
maize, spinach).
Plant nutrient requirements
Demand of primary macronutrients (N,P,K) that are
required for optimal plant growth and harvesting results.
It will determine the amount of urine (depending on
its respective local nutrients content) that needs to be
applied during the planting season.
Plant density and distance
Recommended number of plants per area and distance
between crops that affects area productivity and
determines the degree of competition between the
plants.
Amount of urine produced
The estimated total amount of urine that can be used
for crop production should be presented since it
directly affects the area size that can be fertilized
and the potential value for the farmers. Depending
on the amount of water consumed and on the climate
conditions one adult person produces around 1 - 1.5
litre of urine per day. It should be kept in mind that in
some cases only part of this amount can be collected
(e.g. other sorts of toilets or no toilets are used during
the day, local habits of peeing in the shower etc.)
Nutrient content in urine
Content of macro- and micronutrients in human urine
that determine the amount of urine to be applied to
plants. If local data is not available the following
average amounts of primary macronutrients can be
assumed for the following countries:
table 19: Food supply (crops primary
equivalent) in different countries in 2000.
FAO 2003
Nitrogen
(kg/cap/a)
Phosphorus
(kg/cap/a)
Potassium
(kg/cap/a)
China 3.5 0.4 1.3
Haiti 1.9 0.2 0.9
India 2.3 0.3 1.1
South Africa 3.0 0.3 1.2
Uganda 2.2 0.3 1.0
Sweden 4.0 0.4 1.0
value of urine as a fertilizer
The monetary value of the nutrients in urine can be
calculated by determining the synthetic fertilizer
equivalent of the basic macronutrients (N,P,K) in
urine times the current local synthetic fertilizer prices.
To make it more demonstrative and more impressive
illustrate the potential of the urine use this fgure can be
multiplied with the number of household members or
even with the entire population.
value of yield increase that can be attributed
to urine use
The value of reusing urine in crop production is much
higher than the mere value of the nutrients contained
in urine. The yield increase that can be attributed to
the application of nutrient rich urine compared to no
fertilizer application can make a case for the resource
reuse in agriculture. Data based on local feld trials if
there are any such available.
APPlICATIoN RECoMMENdATIoNS
Application rate
Amount of urine that should be applied per cropping
season. Because of its high nitrogen content urine
should be applied at a rate corresponding to the
desired N requirements of the plant. A starting
point for estimating the urine application are local
recommendations for use of commercial mineral
N fertilizers (Urea or Ammonium fertilizers). If
these crop and region specifc recommendations
43
stockholm envi ronment i nsti tute
are available the amount of urine needed can then be
calculated by using the data of the respective local urine
nutrient content. Another option is to back-calculate
the amount of urine needed from the estimated amount
of nutrients removed by the crops at harvest. However,
a lot of this information might not be available
particularly on small-scale household level. In this
case it is recommended to conduct experiments prior to
the actual implementation to gain frst experiences on
appropriate application levels. Most farmers anyway
will soon get a feel for the right amount of urine that is
needed for optimal plant growth.
dilution
Urine can be applied neat or diluted with water
and advice should be given on appropriate dilution
ratios (or non-dilution respectively) depending
on the local conditions. There is no standard
recommendation for dilution/non-dilution and the
existing recommendations vary widely depending on
the local conditions. Dilution increases the volume
to be spread and thus also increases labour, transport
expense, equipment needed etc. particularly in larger-
scale systems. Advantages of dilution include a
noticeable odour reduction and a decreased risk of
over-application, in order not to be toxic to the plants.
Pros and cons should be properly weighed. Levels
of dilution can vary between 1:15 (1 part urine to 15
parts water) and 1:1. Most common dilution ratios are
1:3 or 1:5. However urine should always be applied
at the rate corresponding to the desired application
rate of N, while additional water should be applied
according to the water needs of the plants.
Application time
Recommendations on when and how often the urine
should be applied should ideally be given in an easy
to understand schedule. Good availability of nutrients
is particularly important in early stages of cultivation.
Once the crop enters its reproductive stage it hardly
takes up any more nutrients. As a rule of thumb,
fertilization should stop after between 2/3 and 3/4
of the time between sowing and harvest. A waiting
period of one month between fertilization and harvest
should always be observed. As regards the risk of
nutrients leaching particularly in regions where there
is heavy rainfall during the cropping season, repeated
applications of urine may be an insurance against
losing all the nutrients in one rainfall event. The
total applied amount of urine and whether it should
preferably be applied once or several times also
depends on the nitrogen need of the plant and its root
size. Root size varies widely between different crops
and plants with ineffcient or small root systems (e.g.
carrots, onions and lettuce) can beneft from repeated
applications of urine.
Application technique
Detailed recommendations on how the urine should be
applied should be given. For best fertilizing effect and
to avoid ammonia losses, urine should be incorporated
into the soil as soon as possible after application,
instantly if possible. A shallow incorporation is
enough, and different methods are possible. One is
to apply urine in small furrows that are covered after
application. Washing the nutrients into the soil with
subsequent application of water is another option.
When spreading urine, it should not be applied on
leaves or other parts of the plants, as this can cause
foliar burning. Spraying urine in the air should also
be avoided due to the risk of nitrogen loss through
gaseous emissions of ammonia and the hygiene risk
through aerosols. Drip irrigation with urine is another
possible application technique. However, when this
technique is used, measures must be taken to avoid
clogging of emitters. Some plants (e.g. tomatoes) in
their early stages are sensitive to having their roots
exposed to urine, while on many crops no negative
effect is seen at all. Therefore, before the sensitivity
of a crop is known, it is wise not to simultaneously
expose all the roots of the plant to urine, be it neat or
diluted. Instead, urine can be applied either prior to
sowing/planting or at such a distance from the plants
that the nutrients are within reach of the roots. For
annual plants this distance may be about 10 cm.
Combined application
Urine is a valuable nutrient source (particularly for
N) but due to its comparably high N and low organic
matter content it is often recommended to complement
urine application with other nutrient and organic
matter sources. The most obvious source that can be
recommended would be, of course, source-separated
faeces due to its high organic matter content and the
high P and K concentrations given that it is acceptable
for the users and associated health risks can be
properly managed. Another organic matter source
would be humus/compost that could be applied prior
to planting time. If the P and K demand of the plant
cannot be met with urine alone other P- and K-rich
mineral fertilizers might be a good complementary
solution.
44
practi cal gui dance on the use of uri ne i n crop producti on
RISK MANAGEMENT
Health risks
Health risks associated with the use of human urine in
plant production are generally low. The objective of a
section on health risks is to present credible information
on how to minimize the health risks when using urine as
a fertilizer. Groups that are potentially at risk comprise
collection personnel and feld workers, households,
local communities and product consumers. As regards
other contaminating substances in human urine (heavy
metals, hormones and pharmaceuticals) possible health
risks are far smaller than those associated with the
common sanitation system and the risk for negative
effect on the quantity and quality of the crops is
negligible.
WHo Multi-barrier approach
In local guidelines it can be relevant to mention that the
WHO has presented international guidelines on the use
of urine in agriculture. The ‘WHO guidelines for the
safe use of wastewater, excreta and greywater use in
agriculture and aquaculture (2006) promote a fexible
multi-barrier approach for managing the health risks
associated with the use of excreta in agriculture. This
concept comprises a series of measures/barriers from
‘toilet to table’. Each of the barriers has the potential
to reduce health risks associated with the excreta use
and it is recommended by WHO to put in place several
of these barriers if needed in order to reduce the health
risk to an acceptable minimum. The local guidelines
should then present barriers that are relevant to the local
context, see section in Part 1 of this book. For more
information visit the WHO website: http://www.who.
int/water_sanitation_health.
Barrier I: Source separation
Source separation is an effcient barrier for reducing
the risks compared to a combined wastewater system.
A key objective of urine collection is to minimize faecal
cross-contamination.
Barrier II: Storage and treatment
It is recommended that prior to application urine should
be treated in order to sanitize the urine and reduce
microbial health risks. Storage at ambient temperature
is considered a viable treatment option. Recommended
storage times vary depending on the system type. This
also applies for cold climates since the temperature is
also a governing factor in the die-off. As a rule: The
longer storage, the better.
Urine should be stored in sealed containers in order to
prevent direct contact with the urine for humans and
animals . Urine should not be diluted while stored, to
provide a harsher environment for microorganisms and
increase die-off rate of pathogens.
Barrier III: Application techniques
Urine application close to the ground should always
be recommended. This reduces the direct contact with
the edible parts of the plants. For example – do not
apply urine with a water can on the edible or foliar
parts of vegetables. The urine should be incorporated
into the soil either mechanically or by subsequent
irrigation with water. If urine is applied before or during
Figure 35: Barrier concept for safe use of urine as a fertilizer.
45
stockholm envi ronment i nsti tute
sowing/planting a further die-off will occur of potential
remaining pathogens and thereby the risk.
Barrier IV: Crop restriction
When treated urine is used no particular crop restrictions
need to be applied. However as an additional safety
feature the urine use may be restricted to non-food
crops (e.g. cotton), crops that are processed (e.g. wheat)
or cooked before consumption (e.g. potato) as well as
crops/trees that allow for a minimum distance between
soil and harvested part of the crop. In general it can
be stated that the longer the time between application
and harvest – the less risky. Thus for crops with short
rotation times, like spinach, salad crops and radish the
risk will be higher, and the pretreatment should be better,
but in the case of for example pineapples (rotation time
1-2 years) the risk from urine is nonexistent.
Barrier V: Withholding period
A withholding period of one month between the
last urine application and the harvest is a barrier that
provides time for pathogen die-off, and is always be
recommended.
Barrer VI: Protective equipment
Although there is no high risk associated with treated
urine it is recommended if possible that agricultural
feldworkers wear appropriate protective clothing
(shoes and gloves) as an additional effective barrier to
reduce potential health risks.
Barrier VII: Handwashing with soap after urine
handling
Washimg hands with soap after urine handling can be
considered an additional barrier in the system. Self-
evidently basic recommended health and hygiene
practices like hand washing after toilet use and prior to
meals should always be observed.
Barrier VIII: Food handling and cooking
Harvested crops should always be washed before
consumption. Cooking or peeling of fruits/vegetables
is another effective measure to considerably reduce the
associated health risks (pathogen reduction between 2-6
log units)
Barrier IX: Health and hygiene promotion
Effective hygiene education and promotion should be
conducted in order to inform local growers and food
handlers (in markets, restaurants, home and food kiosks)
how and why they should wash produce fertilized with
urine.
Handling systems
Information should be given here on the specifcs of
the locally used collection, treatment and transport
components of the sanitation system.
demonstration experiments and
dissemination strategy
Information should be taken and summarized from
local experimentation and the generic chapter.
46
practi cal gui dance on the use of uri ne i n crop producti on
Part 3 - examPle oF a loCal guideline
guideline For aPPliCation oF sanitized urine (taKin ruwa)
in the agriCultural Conditions oF niger
April 2010
SUMMARy
1 Introduction
2 Aim
3 The potential of human urine as a fertilizer
3.1 The quantity of fertlizers excreted by humans
3.2 The charcteristics of urine as a fertilizer
4 Urine collection
5 Mode of Takin Ruwa (sanitized urine)
application
5.1 Application material
5.2 Application to crops with space between the
plants
5.3 Application to crops planted densely
5.4 Fruit trees
6 Application of sanitized urine (takin Ruwa) -
recommended periods and doses for different
crops
7 Security measures
8 Bibliography
Foreword
This guide was put together within the project
“Productive Sanitation – Aguié” which was executed
from October 2008 to February 2010. The project was
mainly fnanced by IFAD. CREPA, PPILDA and SEI
have been project partners during the implementation
phase.
This guide was put together by professor Moussa
Baragé, independant consultant, in collaboration with
the SEI. It is destined towards agriculture extention
offcers as well as other persons and organizations
interested in the possibilities of reuse of human urine as
a fertilizer the Niger context.
Figure 36: urinals.
Different simple urinals that allow for urine collection. The three photos to the left show the “bidur“ (jerry can with urine ). It is
made of a jerry can, funnel and a light bulb that avoids odors and nitrogen losses. The urinal can be off the ground or dug down
according to preference.
47
stockholm envi ronment i nsti tute
ExCERPTS FRoM THE GUIdElINE
Urine collection
Urine is easy to collecte either from urinals (fgure 36) or from latrines (fgure 37) that allow for separation of urine
and faeces.
Method for Takin Ruwa (sanitized urine) application
Application technique
Takin Ruwa can be applied with a watering can, bucket or directly from the jerry can. Metal easily rusts in contact
with urine, and should be well washed after use. Use a recipient of known volume to facilitate the application of the
recommended dose
Figure 37: latrines.
During defecation, only the urine is canalized towards the recipient (jerry can) outside the toilet. The separation facilitates the
treatment and reduces problems with odors and flies in the toilets.
Application using a
watering can
Application with bucket
and cup
Direct application using
the jerry-can
48
practi cal gui dance on the use of uri ne i n crop producti on
Application to crops with space between the plants
To apply to single plants, make a furrow beside or around the plant or just a hole around 10 cm from the plant. Apply
the Takin Ruwa, and close the furrow or hole. The application is followed by watering to avoid toxicity effects
(option 1). The alternative is to apply the Takin Ruwa after a good rain (option 2)
option 1: application of takin ruwa followed by generous watering
Makea furrow or hole
10cm from the plant
Apply the Takin Ruwa
in the furrow/hole
Close the
furrow/hole
Water down using generous
amounts of water
option 2: apply the takin ruwa after a good rainfall
For crops grown during the rainy season (millet, sorghum etc…) the applications can be done after a good rainfall
of at least 15 mm.
Makea furrow or hole
10cm from the plant
Apply the Takin Ruwa
in the furrow/hole
Close the
furrow/hole
Wait for a rainfall of
at least 15mm
49
stockholm envi ronment i nsti tute
Application to crops planted densely
If possible make furrows in a quadratic fashion with
a hoe, and apply the Takin Ruwa before closing the
furrows. If the crops are very dense, dilute the Takin
Ruwa at least 200 per cent (at least two volumes of
water for every volume of Takin Ruwa), and apply in
a uniform manner immediately followed by abundant
watering of the leaves (see drawings).
Dilute the Takin
Ruwa with water
Apply the dilution
to the plants
Water the plants
immediately after the
Takin Ruwa application
Fruit trees
For fruit trees, make a furrow 5-10
cm deep around the tree starting
from the distance of the canope
line. The width of the furrow can
be half the canope width, measured
from the edge towards the centre.
The application of Takin Ruwa
should be combined with compost
or manure application to supply
enough oligo elements.
The roots generally
have the same length
as the branches.
Make a furrow
around the tree pro-
portional to the line
of the canopy. The
furrow should not
reach the trunk.
Apply Takin Ruwa in
the furrow all around
the tree.
Cover the Takin Ruwa
with some soil.
Water abundantly in
the furrow.
50
practi cal gui dance on the use of uri ne i n crop producti on
Application of sanitized urine (Takin Ruwa)
– recommended periods and doses for
different crops
The different doses and franctions presented in the table
on this page is based on the reults obtained from two
stations as well as the recommendations for nitrogen
fertilization in Niger, the nitrogen concentration of
Takin Ruwa being around 4.5 gN/l (the content of P,
Applica-
tion period
Tomato
Auber-
gine
Pepper Potatos lettuce
onion,
garlic
Gombo
Melon
/mar-
row
Cucum-
ber
Two weeks
after sow-
ing or
planting
0.5 litre
/ plant
0.5 litre
/ plant
0.6
litre /
plant
2.5 litres /
m
2
Sandy soil:
1 litre / m
2
Clayey soil:
0.7 litre /
m
2
1 litre /
m
2
0.5
litre /
plant
0.5
litre /
plant
0.5 litre /
plant
Start of
the flow-
ering (3
weeks
after the
first appli-
cation)
0.5 litre
/ plant
0.7 litre
/ plant
0.7
litre /
plant
2.5 litres /
m
2
applied
at the start
of the of
tuberiza-
tion (around
4 weeks
after the first
application)
Sandy soil:
1 litre / m
2
Clayey soil:
0.7 litre /
m
2

(2 weeks
after the first
application)
1.5 litres
/ m
2
(at
the start of
the bulb
forming,
around
4 weeks
after the
first appli-
cation)
0.7
litre /
plant
1
litre /
plant
0.7 litre /
plant
During
fructifica-
tion (3
weeks
after the
2nd appli-
cation)
0.3 litre
/ plant
0.3 litre
/ plant
0.5
litre /
plant
0.3
litre /
plant
0.5
litre /
plant
0.3 litre /
plant
K and oligoelements is lower) and fnally the plants
nitrogen need. Bear in mind however that Takin Ruwa
is mainly a fast acting N-fertliizer and should be
complemented by the addition of P and K or an organic
base fertilizer. These Takin Ruwa recommendations
are also preliminary ; ongoing research will enrich this
technical guideline.
table 20: Periods and doses of sanitized urine for different crops.
51
stockholm envi ronment i nsti tute
(table 20 cont…) Periods and doses of sanitized urine for different crops.
Appli-
cation
period
Cab-
bage
Carrot Millet Sorghum Mango orange Goyava Papaya banana
Two
weeks
after
sow-
ing or
plant-
ing
2
litres
/ m
2
1
litres
/ m
2
0.8
litre*
/
plant
(start
of
tiller-
ing)
0.7 litre*
/ plant
(start of
tillering)
Growth fer-
tilizer (tree
aged 0-4
years): apply
2 litres/tree
4 times per
year. (start of
rainy season,
during the
rainy season,
start of cold
season and
during the
cold season).
Growth
fertilizer
(tree aged
0-4 years):
apply 1.5
litres/tree
4 times per
year. (start
of rainy sea-
son, during
the rainy
season,
start of cold
season and
during the
cold sea-
son).
Growth fer-
tilizer (tree
aged 0-2
years): apply
1 litres/tree
4 times per
year. (start of
rainy season,
during the
rainy season,
start of cold
season and
during the
cold season).
3 litres
/ tree 1
month
after sow-
ing
3 litres /
pied en
couronne
1 mois
après
plantation
Start
of the
flower-
ing (3
weeks
after
the first
appli-
cation)
2
litres
/ m
2

1.25
litres
/ m
2

0.7
litre*
/
plant
(Fin
mon-
tai-
son
0.7 litre*
/ plant
(Fin
mon-
taison
– début
épiai-
son,
soit 4
Produc-
tion ferti-
lizer (trees
aged >
4 years) :
Apply 6 litres
per tree, 4
times per
year (start of
rainy season,
during the
rainy season,
start of cold
season and
during the
cold season).
Produc-
tion ferti-
lizer (trees
aged >
4 years) :
Apply 5
litres per
tree, 4 times
per year
((start of
rainy sea-
son, during
the rainy
season,
start of cold
season and
during the
cold sea-
son).
Produc-
tion ferti-
lizer (trees
aged >
2 years) :
Apply 4 litres
per tree, 4
times per
year (start of
rainy season,
during the
rainy season,
start of cold
season and
during the
cold season).
4 litres /
tree 1.5
months
after the
1st appli-
cation
(NB: make
the same
application
for the next
production
cycle)
4 litres /
tree 1.5
months
after the
1st appli-
cation
(NB: make
the same
applica-
tion for
the next
produc-
tion cycle)
At the
start
of the
fructifi-
cation
4 litres /
tree 1.5
months
after the
2nd appli-
cation
3 litres /
tree 1.5
months
after the
second
applica-
tion
*The recommended doses for millet and surghum, are based on the results from the first tests in Torodi. In Aguié the dose has
been 0.5 litres, fractioned into 0.25 litres per application. This is aligned with the local recommendations for urea as a source of
nitrogen.
52
practi cal gui dance on the use of uri ne i n crop producti on
reFerenCes
ADB (1998) Gender Guidelines in Water Supply and
Sanitation. Checklist. Asian Development Bank,
Manila.
Arroyo (2005) Organoponics - the Use of Human Urine
in Composting. RUAF Urban Agriculture Magazine
10 - Appropriate (Micro) Technologies for Urban
Agriculture. http://www.ruaf.org/sites/default/fles/
Organoponics.pdf.
Bernal, C.T., Bingham, F.T. and Orehi, J. (1974) Salt
tolerance of Mexican wheat. ll. Relation of Variable
Sodium chloride and length of growing season. Proc.
Soil Sci. Soc. Am., 38: 777-780.
Brady, Nyle C., Weil, Ray R. (1999) The nature and
properties of soils: twelfth edition. Upper Saddle
River, NJ: Prentice Hall.
Båth, B. (2003) Field trials using human urine
as fertilizer to leeks (In Swedish). Manuscript,
Department of Ecology and Plant Production
Science, Swedish University of Agricultural
Sciences. Uppsala, Sweden.
Clark, G.A. (2003) A test of the production of organically
fertilised amaranth in Tehuixtla, Morelos, Mexico.
Manuscript available from esac@laneta.apc.org.
Coulibaly, Chiaka. (2009) Management of EcoSan
System in Urban Areas: “EcoSan_UE Project
Case Study’’ in four sectors of Ouagadougou, BF.
Presentation to the West Africa Regional Sanitation
and Hygiene Symposium, Accra, Ghana, 10-12
November 2009.
CSIR (2008) Human Excreta and Food Security in
South Africa. Project report Nr 59P1039, Submitted
to L Austin, CSIR – Built Environment, PO Box 395,
Pretoria, South Africa, 0001.
Dankelman, I. (2009). Making Sustainable Sanitation
Work for Women and Men. Integrating a Gender
Perspective into Sanitation Initiatives, eds. J.
Muylwijk, C. Wendland and M. Samwel. Utrecht,
Annemasse and Munich: WECF, Women in Europe
for a Common Future).
Drechsel, P., Giordano, M., Gyiele, L. (2004) Valuing
Nutrients in Soil and Water: Concepts and
Techniques with Examples from IWMI Studies in the
Developing World. IWMI Research Report nr 82.
International Water Management Institute, P O Box
2075, Colombo, Sri Lanka.
FAO (2003) FAOSTAT Nutrition data – Food Supply –
Crops Primary Equivalent. http://apps.fao.org/page/
collections?subset=nutrition , visited 2003-02-28.
Ganrot, Z., Dave, G., Nilsson, E. (2007) Recovery
of N and P from human urine by freezing, struvite
precipitation and adsorption to zeolite and active
carbon. Bioresource Technology 98, 3112-3121.
Gao, X. Zh., Shen, T., Zheng, Y., Sun, X., Huang, S.,
Ren, Q., Zhang, X., Tian, Y. and Luan, G. (2002)
Practical manure handbook. (In Chinese). Chinese
Agriculture Publishing House. Beijing, China.
Germer, J., Sauerborn, J., (2006) Exploring the Potential
for Recycling Nutrients from Waste Water to Enhance
Agricultural Productivity - the Example of Valley
View University in Accra, Ghana. Presentation at the
Tropentag 2006 - International Research on Food
Security, Natural Resource Management and Rural
Development. University of Bonn, October 11-13.
Guadarrama, R. O., Pichardo, N. A., Morales-Oliver,
E. (2001) Urine and Compost Effciency Applied to
Lettuce under Greenhouse Conditions in Temixco,
Morales, Mexico. In Abstract Volume, First
International Conference on Ecological Sanitation
5-8 November 2001, Nanning, China.
Hammer, M. and Clemens, J. (2007) A tool to evaluate
the fertilizer value and the environmental impact
ofsubstrates from wastewater treatment. Water
Science and Technology 56 (5): 201-209.
Heberer, Th., Fuhrmann, B., Schmidt-Bäumler,
K., Tsipi, D., Koutsuba, V., Hiskia, A. (2000)
Occurrence of Pharmaceutical Residues in Sewage,
River, Ground and Drinking Water in Greece
and Germany. In Symposia Papers: Issues in the
Analysis of Environmental Endocriine Disruptors.
53
stockholm envi ronment i nsti tute
American Chemical Society, San Francisco March
26-30, 2000.
Heinonen-Tanski, H., Sjöblom, A., Fabritius, H.,
Karinen, P. (2007) Pure human urine is a good
fertilizer for cucumbers. Bioresource Technology,
Volume 98, Issue 1, January 2007, Pages 214-217.
Jeyabaskaran, K.J. (2010) Utilization of human urine
as liquid organic manure in banana cultivation.
National Research Centre for Banana, Tiruchirapalli
– 620 102 Tamil Nadu, India.
Johansson, M., Jönsson, H., Höglund, C., Richert
Stintzing, A. and Rodhe, L. (2001) Urine separation
– closing the nutrient cycle. Stockholm Water
Company. Stockholm, Sweden. Available at: http://
www.swedenviro.se/gemensamma_se/documents/
Urinsep_eng.pdf.
Jönsson, H. and Vinnerås, B. (2004) Adapting the
nutrient content of urine and faeces in different
countries using FAO and Swedish data. In: Ecosan –
Closing the loop. Proceedings of the 2nd international
symposium on ecological sanitation, incorporating
the 1st IWA specialist group conference on
sustainable sanitation, 7th-11th April 2003, Lübeck,
Germany. Pp 623-626.
Kirchmann, H. and Pettersson, S. (1995) Human urine
– chemical composition and fertilizer effciency.
Fertilizer Research 40:149-154.
Kvarnström, E., Emilsson, K., Richert Stintzing,
A., Johansson, M., Jönsson, H., af Petersens, E.,
Schönning, C., Christensen, J., Hellström, D.,
Qvarnström, L., Ridderstolpe, P. and Drangert, J.-
O. (2006) Urine Diversion - One Step Towards
Sustainable Sanitation. Report 2006-1, EcoSanRes
Programme, Stockholm Environment Institute,
Stockholm, Sweden, http://www.ecosanres.org/pdf_
fles/Urine_Diversion_2006-1.pdf.
Larsen, T. A. and Lienert, J. (2007) Novaquatis fnal
report. NoMix – A new approach to urban water
management. Eawag, Dübendorf, Switzerland,
www.novaquatis.eawag.ch/ publikationen/fnal_
report_E.
Magid, J. (2006) Estrogen in the Environment. In:
Blackwater systems – Nordic Inventory. Full report
in Swedish, English summary in Appendix 2. www.
nmr.org.
Marschner, H. (1995) Mineral nutrition of higher
plants. Academic Press, Second Edition.
Mkeni, P; Jimenez Cisneros, B; Pasha, M; Austin, L.
(2006) Use of Human Excreta from Urine Diversion
Toilets in Food Gardens. Agronomical and Health
Aspects. Volume 3, Report to the Water Research
Commission. WRC Report No 1439/3/06.
Morgan, P. (2003) Experiments using urine and humus
derived from ecological toilets as a source of
nutrients for growing crops. Paper presented at 3rd
World Water Forum 16-23 March 2003. Available at:
http://aquamor.tripod.com/KYOTO.htm.
Morgan, Peter. (2008) Toilets that make compost. http://
www.ecosanres.org/toilets_that_make_compost.htm
SEI 2008.
von Münch and Winker (2009) Technology Review
- Urine diversion components: Overview of urine
diversion components such as waterless urinals,
urine diversion toilets, urine storage and reuse
systems. Available at: http://www.gtz.de/en/
dokumente/gtz2009-en-technology-review-urine-
diversion.pdf.
Muskolus, A. (2008) Anthropogenic plant
nutrients as fertilizer. PhD thesis, Institut
für Pfanzenbauwissenschaften, Humboldt-
Universität zu Berlin, Berlin, Germany. URL:
http://edoc.hu-berlin.de/dissertationen/muskolus-
andreas-2008-04-18/PDF/muskolus.pdf.
PUVeP (2008) Philippine allotment garden manual with
an introduction to ecological sanitation. Periurban
Vegetable Project (PUVeP), Xavier University
College of Agriculture, Cagayan de Oro City,
Philippines, http://puvep.xu.edu.ph/publications.htm
or http://www2.gtz.de/Dokumente/oe44/ecosan/en-
philippine-allotment-garden-manual-2008.pdf.
Pradhan, K.S., Nerg, A., Sjöblom, A., Holopainen, J.,
Heinonen-Tanski, H. (2007) Use of Human Urine
Fertilizer in Cultivation of Cabbage (Brassica
oleracea)––Impacts on Chemical, Microbial, and
Flavor Quality J. Agric. Food Chem., 55 (21), 8657-
8663• DOI: 10.1021/jf0717891.
54
practi cal gui dance on the use of uri ne i n crop producti on
Rodhe L., Richert Stintzing A. and Steineck S., (2004)
‘Ammonia emissions after application of human
urine to clay soil for barley growth’. Nutrient Cycling
in Agroecosystems, 68:191-198.
Schouw, N.L., Danteravanich, S., Mosbaeck, H., Tjell,
J.C. (2002) Composition of human excreta—a case
study from Southern Thailand. The Science of the
Total Environment 286, 155–166.
Schroeder, E. (2010) Marketing human excreta, a study
of possible ways to dispose of urine and faeces
from slum settlements in Kampala, Uganda. GTZ,
Eschborn, Germany.
Schönning, C. and Stenström, T.-A. (2004) Guidelines
for the safe use of urine and faeces in ecological
sanitation systems. EcoSanRes Publications Series,
Report 2004-1, www.ecosanres.org/pdf_fles/ESR_
Publications_2004/ESR1web.pdf.
Simons J. and Clemens J. (2004) The use of separated
human urine as mineral fertilizer, 595-600; in (eds.)
Werner et al.: ecosan-closing the loop, 7.-11. April,
2003, Lübeck, Germany, ISBN 3-00-012791-7.
Sridevi, G., Srinivasamurthy, C.A., Bhaskar, C.,
Viswanath, S. (2009) Evaluation of Source Separated
Human Urine (ALW) as a Source of Nutrients for
Banana Cultivation and Impact on Quality Parameter.
Journal of Agricultural and Biological Science Vol.
4, No. 5, September 2009 ISSN 1990-6145 ARPN.
Sridevi, G., Srinivasamurthy, C. A., Bhaskar, S. and
Viswanath, S. Studies on the effect of anthropogenic
liquid waste (human urine) on soil properties,
growth and yield of maize. Crop Res. 38 (1, 2 and
3) : 11-14 (2009). Department of Soil Sciences and
Agricultural Chemistry University of Agricultural
Sciences, GKVK, Bangalore (Karnataka), India.
Sundin, A. (1999) Humane urine improves the growth
of Swiss chard and soil fertility in Ethiopian urban
agriculture. Thesis and Seminar projects No 112,
Department of Soil Science, Swedish University of
Agricultural Sciences.
SuSanA (2009) Working Group 12 Draft Fact Sheet:
Integrating a gender perspective in sustainable
sanitation, http://www.susana.org/images/
documents/05-working-groups/wg12/en-fact-sheet-
wg12-gender-frst-draft-2009-01-20.pdf.
Thorup-Kristensen, K. (2001) Root growth and soil
nitrogen depletion by onion, lettuce, early cabbage
and carrot. Acta Horticulturae. 563: 201-206.
Tilley, et al., (2008) Compendium of Sanitation
Systems and Technologies. http://www.eawag.ch/
organisation/abteilungen/sandec/publikationen/
compendium_e/index_EN.
WHO (2006) Guidelines for the safe use of wastewater,
excreta and greywater use in agriculture and
aquaculture. Socio cultural, environmental and
economic Aspects.3 (7). World Health Organisation
(Online access 2006-10-26). www.who.int/sites.
Villa-Castorena, M., Ulery, A.L., Catalán-Valencia,
E.A., Remmenga, M.D. (2003) Salinity and Nitrogen
Rate Effects on the Growth and Yield of Cile Pepper
Plants. Soil Science Society of America Journal
67:1781-1789. Soil Science Society of America.
Winker, M. (2009) Pharmaceutical residues in urine
and potential risks related to usage as fertilizer
in agriculture. PhD thesis, Technical University
of Hamburg-Harburg, Institute of Wastewater
Management and Water Protection, Germany, http://
doku.b.tu-harburg.de/volltexte/2009/557.
Vinnerås, B. and Jönsson, H. (2002) The potential of
faecal separation and urine diversion to recycle plant
nutrients in household waste water. Bioresource
Technology 84:3, 275-283.
Vinnerås, B., Palmquist, H., Balmer, P. and Jönsson, H.
(2006) The characteristics of household wastewater
and biodegradable solid waste—A proposal for new
Swedish design values. Urban Water, 3(1): 3-11.
The Stockholm Environment Institute

SEI is an independent, international research institute. It has been
engaged in environment and development issues at local, national,
regional and global policy levels for more than a quarter of a century.
SEI supports decision making for sustainable development by
bridging science and policy.
sei-international.org
SEI - Stockholm
Kräftriket 2B
SE -106 91 Stockholm
Sweden
Tel: +46 8 674 7070
SEI - York
University of York
Heslington
York YO10 5DD
UK
Tel: +44 1904 43 2897
SEI - U.S.
11 Curtis Avenue
Somerville, MA 02144
USA
Tel: +1 617 627-3786
SEI - Tallinn
Lai 34, Box 160
EE -10502, Tallinn
Estonia
Tel: +372 6 276 100
SEI - Oxford
Suite 193
266 Banbury Road,
Oxford, OX2 7DL
UK
Tel: +44 1865 426316
SEI - Africa
Institute of Resource Assessment
University of Dar es Salaam
P.O. Box 35097, Dar es Salaam
Tanzania
Tel: +255-(0)766079061
SEI - Asia
15th Floor Witthyakit Building
254 Chulalongkorn University
Chulalongkorn Soi 64
Phyathai Road Pathumwan
Bangkok 10330
Thailand
Tel: +(66) 22514415
ISBN 978-91-86125-21-9
S
E
I
R
i
c
h
e
r
t
,

G
e
n
s
c
h
,

J
ö
n
s
s
o
n
,

S
t
e
n
s
t
r
ö
m

a
n
d

D
a
g
e
r
s
k
o
g
P
r
a
c
t
i
c
a
l

G
u
i
d
a
n
c
e

o
n

t
h
e

U
s
e

o
f

U
r
i
n
e

i
n

C
r
o
p

P
r
o
d
u
c
t
i
o
n
Toepassingsmogelijkheden voor urine in de landbouw
in Friesland
In opdracht van provincie Fryslân zijn de potenties van urine
voor de landbouw in beeld gebracht





Toepassingsmogelijkheden voor
urine in de landbouw in Friesland
Ìn opdracht van de provincie Fryslân zijn de potenties van urine voor de
landbouw in beeld gebracht
Definitief

Grontmij Nederland bv
Drachten, 1 juli 2008

03/4428
Pagina 3 van 75



¡nhoudsopgave
1 Samenvatting................................................................................................................ 6
2 Ìnleiding......................................................................................................................... 8
3 Relevante vragen........................................................................................................ 10
4 Welke eisen worden er nu aan een uit urine vervaardigde meststof gesteld? Ìn welke
sectoren van de landbouw licht toepassing het meest voor de hand?....................... 12
4.1 Ìnleiding....................................................................................................................... 12
4.2 Eisen aan meststoffen ................................................................................................ 12
4.3 Urine en op urine gebaseerde meststoffen................................................................. 13
4.4 Op urine gebaseerde meststoffen .............................................................................. 14
4.4.1 Urevit........................................................................................................................... 14
4.4.2 Struviet ........................................................................................................................ 14
4.5 Onderzoek naar en huidige toepassingen van urine en op urine gebaseerde
meststoffen in de landbouw........................................................................................ 15
4.5.1 Zuivere urine............................................................................................................... 15
4.6 Urine producten .......................................................................................................... 16
4.6.1 Urevit........................................................................................................................... 16
4.6.2 Struviet ........................................................................................................................ 16
4.7 Potenties toepassing urine in Nederlandse landbouw................................................ 16
4.7.1 Algemeen.................................................................................................................... 16
4.7.2 Zuivere urine............................................................................................................... 16
4.8 Ten behoeve van het toepassen van zuivere urine zijn er nog enkele leemten in
kennis en gewenst onderzoek [2]. .............................................................................. 17
4.8.1 Urevit........................................................................................................................... 17
4.8.2 Struviet ........................................................................................................................ 17
4.9 Literatuur ..................................................................................................................... 18
4.10 Bijlage 1. Samenstelling urine, Urevit en Struviet....................................................... 19
5 Perspectieven voor humane urine als meststof in de Nederlandse landbouw........... 21
5.1 Geschiktheid van urine als meststof ........................................................................... 21
5.2 Kansen op de mestmarkt ............................................................................................ 22
5.3 Glastuinbouw.............................................................................................................. 23
5.4 Vollegrondsgroententeelt ............................................................................................ 23
5.5 Akkerbouw en melkveehouderij .................................................................................. 24
5.6 Fruitteelt ...................................................................................................................... 25
5.7 Biologische landbouw................................................................................................. 25
5.8 Vervluchtiging ............................................................................................................. 25
5.9 Urine bij compostering ................................................................................................ 25
5.10 Terugwinning via processing / varia ........................................................................... 26
5.11 Nieuwe productieketens.............................................................................................. 26
5.12 Wettelijke vereisten meststoffen................................................................................. 26
5.13 Conclusie .................................................................................................................... 26
5.14 Onderzoek................................................................................................................... 27
5.15 Referenties.................................................................................................................. 27

Inhoudsopgave (vervoIg)

03/4428
Pagina 4 van 75

6 De mogelijkheden van humane urine in aquacultuur ................................................. 29
6.1 Ìnleiding....................................................................................................................... 29
6.2 Achtergrond................................................................................................................. 29
6.3 Aquacultuur in Europa, Nederland en Noord-Nederland............................................ 30
6.4 De vraag naar humane urine vanuit de aquacultuur .................................................. 30
6.5 De toepassing van humane urine in schelpdierenkweek ........................................... 31
6.6 Andere toepassingen van humane urine.................................................................... 31
6.7 Conclusie .................................................................................................................... 32
6.8 Bronnen....................................................................................................................... 32
7 Benodigde logistiek bij gebruik van urine als meststof ............................................... 33
7.1 Ìnleiding....................................................................................................................... 33
7.2 Randvoorwaarden voor het gebruik van urine als meststof ....................................... 33
7.3 Ìnzameling en opslag van urine op de plaats van productie....................................... 34
7.4 Transport van tussenopslag naar eindgebruiker Transport per as............................. 35
7.5 Concentreren of precipiteren voorafgaand aan transport per as................................ 35
7.6 Transport per leiding................................................................................................... 35
7.7 Preventie van scaling in leidingsystemen................................................................... 36
7.8 Oppervlakte-eigenschappen van de leiding................................................................ 36
7.9 Transportafstand en energievraag.............................................................................. 37
7.10 Andere milieuaspecten van opslag en transport......................................................... 37
7.11 Kansen, uitdagingen en aanknopingspunten.............................................................. 38
7.12 Gebruikte literatuur ..................................................................................................... 38
8 Kosten en baten van gescheiden inzameling van urine in het licht van gebruik in de
landbouw..................................................................................................................... 39
8.1 Urinescheiding in Nederland en daarbuiten................................................................ 39
8.2 Kosten voor inzameling van urine............................................................................... 39
8.3 Baten van gescheiden inzameling van urine .............................................................. 40
8.4 Factoren die kosten beïnvloeden................................................................................ 41
8.5 Kansen en uitdagingen ............................................................................................... 41
8.6 Literatuur ..................................................................................................................... 41
8.7 Bijlage 1 ...................................................................................................................... 42
9 Maatschappelijke acceptatie van het gebruik van menselijke urine als meststof in de
landbouw..................................................................................................................... 44
9.1 Achtergrond................................................................................................................. 44
9.2 Ìnhoud en doel ............................................................................................................ 44
9.3 Acceptatie van urinebemesting door consumenten.................................................... 45
9.3.1 Zwitserland.................................................................................................................. 45
9.3.2 Nederland.................................................................................................................... 46
9.3.3 Conclusies................................................................................................................... 47
9.4 Acceptatie van urinebemesting door boeren .............................................................. 48
9.4.1 Zwitserland.................................................................................................................. 48
9.4.2 Zweden ....................................................................................................................... 48
9.5 Acceptatie van urine in de landbouw: wat vinden de andere actoren? ...................... 48
9.6 Kansen, uitdagingen en aanknopingspunten.............................................................. 49
9.7 Hoe verder? ................................................................................................................ 49
9.8 Gebruikte literatuur ..................................................................................................... 50
9.9 Bijlage 1. Ìnformatieblad het Nieuwe Plassen uitgevoerde enquêtes ........................ 51
9.10 Bijlage 2 Acceptatie urine als meststof ÷ enquête...................................................... 53
9.11 Bijlage 3 Reactie van personeelsleden Grontmij op de vraag ¨Verwacht u dat No Mix
technologie een goede toekomst heeft?¨.................................................................... 54
9.11.1 Zo ja waarom: ............................................................................................................. 54
9.11.2 Zo nee, waarom niet? ................................................................................................. 56



Inhoudsopgave (vervoIg)

03/4428
Pagina 5 van 75

10 Ìn welke gebieden ligt het gebruik van urine in de landbouw het meest voor de hand
en waarom? ................................................................................................................ 57
10.1 Ìntroductie ................................................................................................................... 57
10.2 Randvoorwaarden....................................................................................................... 57
10.2.1 Kennis ......................................................................................................................... 57
10.2.2 Aanbod........................................................................................................................ 58
10.2.3 Afzet. ........................................................................................................................... 59
10.2.4 Acceptatie. .................................................................................................................. 60
10.3 Selectie potentiële pilotgebieden. ............................................................................... 60
11 Zware metalen in meststoffen ÷ vergelijking van urine en zwart water met in
Nederland toegepaste meststoffen............................................................................. 62
11.1 Samenvatting.............................................................................................................. 62
11.2 Besluit Overige Organische Meststoffen (BOOM) ...................................................... 62
11.3 Vergelijking.................................................................................................................. 68
11.4 Referenties.................................................................................................................. 68
11.5 Bijlage - Aanvoer van zware metalen met kunstmest en compost in het jaar 2000... 70
12 Synthese ..................................................................................................................... 71
12.1 Ìnleiding....................................................................................................................... 71
12.2 Tot slot ........................................................................................................................ 74
12.3 Conclusie ÷ aanbeveling............................................................................................. 74





03/4428
Pagina 6 van 75


1 8amenvatting
Sinds een aantal jaren wordt er veel onderzoek gedaan naar nieuwe sanitatietechnieken. Het
gehele stelsel wordt daarbij beschouwd. De wijze van inzameling, het transport, de verwerking
en de mogelijkheden tot hergebruik van waardevolle elementen. Dit heeft geleid tot een groot
aantal projecten die zich veelal richten op enerzijds scheiding van afvalwaterstromen en ander-
zijds op kleinschaliger behandelsystemen. Ìn Nederland wordt het onderzoek gecoördineerd
door de Koepelgroep Ontwikkeling Nieuwe Sanitatie Systemen (ONSS) die door de Stowa in
het leven is geroepen. Ìn 2008 heeft de koepelgroep haar tweede strategienota uitgebracht.
Hierin is bijvoorbeeld naast een effectiever verwijdering van medicijnresten, hergebruik en
terugwinning van grondstoffen nadrukkelijk als belangrijke doelstelling opgenomen. Daarbij
wordt gedacht aan mineralen als N, P en K en het gebruik ervan als meststof. Urine is de
belangrijkste bron van deze mineralen.

De eventuele toepassing van urine in de landbouw is omgeven door tal van vragen. Om hierop
antwoord te krijgen, heeft de provincie Fryslân, Wetsus en Grontmij verzocht in beeld te
brengen wat de potenties zijn van urine voor de landbouw. Om binnen de beperkte tijd zoveel
mogelijk kennis te vergaren is gekozen voor een vorm waarbij aan een aantal deskundigen
wordt gevraagd in een essay bepaalde onderwerpen te belichten. De vragen zijn geselecteerd
op grond van een expertmeeting waar vertegenwoordigers van WUR/PRÌ, Wetsus, van Hall-
Larenstein, Wetterskip Fryslân, LTO, de provincie Fryslân, Stowa en Grontmij aanwezig waren.
De door de deskundigen geleverde essay's zijn onverkort in deze rapportage opgenomen. Op
basis van die informatie worden tot slot conclusies getrokken en aanbevelingen gedaan voor
het vervolg.

De volgende vragen zijn beantwoord:
1. Welke eisen worden er nu aan een uit urine vervaardigde meststof gesteld en welke bewer-
king is daartoe nodig? Ìn welke sectoren van de landbouw licht toepassing het meest voor
de hand?
2. Hoe ziet in de toekomst de hoogwaardige meststof eruit? Wat betekent dat voor de
huidige wet- en regelgeving?
3. Wat zijn de mogelijkheden in Aquacultuur?
4. Wat betekent het gebruik van urine (of urineproducten) in logistiek opzicht? Geef een LCA
van de verschillende opties.
5. Welke kosten moeten worden gemaakt en welke baten zijn er (beschrijvend)?
6. Welke maatschappelijke gevoeligheden zijn er verbonden met het gebruik van humane
urine in de landbouw?
7. Ìn welke gebieden zou het gebruik van urine in de landbouw het meest voor de hand liggen
en waarom?
Aan de essay's is een rapportage toegevoegd die door Stowa is opgesteld omtrent zware
metalen in de verschillende meststoffen.

De teneur van essays is positief. Geen van de essayisten schiet de mogelijkheid van urine als
meststof in de landbouw vanuit zijn eigen expertise op grond van argumenten af. Sterker! Alle
essayisten zien nadrukkelijk de kansen, de nieuwe gebruiksmogelijkheden. Dat is natuurlijk
veelbelovend. Het inspireert om na te gaan welke stappen er nu moeten worden gezet. Maar
we weten nog niet alles en de komende tijd zal dan ook besteed moeten worden aan het
beantwoorden van de meest relevante vragen.

Urine (en de stoffen die er in zitten) zijn nu reeds breed toepasbaar in de hedendaagse land-
bouw. Er is ook al de nodige ervaring mee opgedaan. Met name veel stikstof vragende gewas-
Samenvatting

03/4428
Pagina 7 van 75


sen lijken baat te hebben bij urine als meststof. Er zijn ook een aantal belangrijke ontwikkelin-
gen die het gebruik van urine in de landbouw positief zouden kunnen beïnvloeden. Cradle to
Cradle, het uitputten van de fosfaatvoorraden en precisielandbouw kunnen de hierin een
belangrijke rol spelen.
Een apart aandachtsveld vormen de in urine aanwezige medicijnresten en hormonen. Hoe met
de factor medicijnen en hormonen in de toekomst moet worden omgegaan zal sterk afhankelijk
zijn van de toepassingen die worden gezocht en de eisen die het gewas stelt.

Uit de studie blijkt dat urine op zich als meststof voldoende marktpotentie. Technologisch
gezien lijken er geen belemmeringen te zijn. Ook maatschappelijk wordt nu reeds het gebruik
van urine als meststof geaccepteerd.

ConcIusie en aanbeveIingen
Urine is in potentie een goede meststof die in verschillende takken van de landbouw kan
worden gebruikt. Primair is het daarbij van belang dat vraag en aanbod op elkaar worden afge-
stemd. Beiden zijn nog niet aanwezig.
Op onderdelen ontbreekt nog kennis. Deze kennis zal de komende periode geleidelijk aan
beschikbaar komen of dient met gerichte onderzoeksvragen te worden beantwoord.
De ontbrekende kennis straat evenwel een verantwoorde implementatie niet in de weg.

Voorgesteld wordt om samen met alle betrokken partijen een grootschalig demonstratieproject
op te zetten dat er toe moet leiden dat over enige jaren op grotere schaal in Fryslân urine
separaat wordt gewonnen, bewerkt en wordt gebruikt in de landbouw. Aan de ontwikkeling van
dit project dienen in iedergeval Wetterskip Fryslân, LTO, Wetsus en van Hall een belangrijke
bijdrage te leveren. Bij de ontwikkeling kan gebruik worden gemaakt van de kennis die beschik-
baar is bij Stowa, WUR/PRÌ en Grontmij.
Het doel van dit demonstratie project zal zijn:
Een impuls geven aan de uitvoering van het provinciaal beleid op gebied van de transitie in de
waterketen, de ontwikkeling van watertechnologie en een verdergaande duurzame ontwikkeling
van het landelijk gebied.
Het versterken van de agrarische sector door het ontwikkelen van duurzame meststoffen die
ook gebruikt kunnen worden in de biologische landbouw en in nieuwe innovatieve landbouw-
methoden (aquacultures).

Ìn het kader van de voorbereiding van dit demonstratieproject is het gewenst op korte termijn:
• Ìnitiatieven te nemen om te komen tot (een) grootschalige inzamellocatie(s). Een goede
kans doet zich voor bij de ontwikkeling van de Kenniscampus van het VanHall instituut.
• Samen met LTO na te gaan bij welke gewassen urine (of urineproducten) toepassing het
meest voor de hand ligt. Hierbij kan een samenwerking worden gezocht met de proefboer-
derij inde Kollummerwaard of Nieuw Bosmazathe.
• Na te gaan (op grond van de eisen/wensen die door de landbouw worden gesteld) aan wel-
ke kwalificaties het de meststof zou moeten voldoen (samenstelling, kwaliteit,
concentratie/verdunning, continuïteit, etc). Daarna zou moeten worden nagegaan hoe aan
die kwalificaties kan worden voldaan. Ìn dit project zou een samenwerking tussen LTO, PRÌ
en Grontmij de basis kunnen vormen.
• Ìn ÌPO-verband onderzoeken op welke manier zowel de afvalstoffenwet- en regelgeving als
de meststoffenwet- en regelgeving zodanig kunnen worden aangepast dat het hergebruik
van waardevolle mineralen uit afvalstoffen op een goede manier kan worden gestimuleerd.
Daarbij kan samenwerking worden gezocht met de Unie van Waterschappen de Stowa.

Bij het beantwoorden van die vragen zou aansluiting moeten worden gezocht bij lopende
onderzoeks- en pilotprojecten van de Koepelgroep ONSS en zouden nieuwe onderzoeks- en
pilotprojecten in samenwerking met de Koepelgroep/Stowa moeten worden opgesteld.

Om de gewenste ontwikkelingen te coördineren is het gewenst dat de provincie een regierol
vervult en de verschillende betrokken partijen stimuleert om de nodige voorbereidingen te
treffen.




03/4428
Pagina 8 van 75


2 ¡nleiding
Ons afvalwatersysteem heeft zich vanaf het midden van de 19
de
eeuw geleidelijk aan ont-
wikkeld. Het rioolstelsel, oorspronkelijk bedoeld om het met cholera en tyfus besmette afval-
water buiten de stad te brengen, werd met de komst van de drinkwaterleiding en doordat steeds
meer hemelwater moest worden afgevoerd, steeds meer belast. Tegelijkertijd werden er
geleidelijk aan steeds hogere eisen gesteld aan het zuiveren van het water. Werden eerst voor-
al de organische stoffen verwijderd, later moesten ook de nutriënten in steeds hogere mate
verwijderd worden. Die lijn zet zich door.

Steeds meer komen we er achter dat ons afvalwater stoffen bevat die we liever niet in ons
milieu willen hebben. Stoffen die er nu door de huidige zuiveringsystemen niet of niet in vol-
doende mate uit worden gehaald. De eerste reactie daarbij is om de extra zuiveringsstappen
aan het huidige zuiveringsproces toe te voegen. Die lijn is een aantal jaren geleden doorbroken
met de gedachte dat het wellicht beter is om het gehele afvalwaterconcept nog eens tegen het
licht te houden.

De verschillende onderzoeken, pilotprojecten en de discussies die daar omheen zijn gevoerd
werpen inmiddels toch een geheel nieuw licht op het toekomstig afvalwaterbeheer. Een aantal
voorbeelden:
• Het mengen en verdunnen van verschillende afvalwaterstromen maakt het verwijderen van
bijvoorbeeld medicijnresten, hormonen en hormoonverstorende stoffen problematisch.
• Binnen het maatschappelijke thema duurzaamheid en Cradle to Cradle is hergebruik, ook
van afvalwater, een belangrijk aandachtspunt, schone en onverdunde afvalwaterstromen
zijn dan gewenst. Met name het mineraal P (fosfaat) geldt als een eindige grondstof waar-
van de huidige voorraden op termijn uitgeput zullen raken.
• De huidige zuiveringssystemen blijken met de uitstoot van lachgas en CO
2
in niet onbelang-
rijke mate bij te dragen aan het broeikaseffect; bovendien baart het energieverbruik dat met
name nodig is voor het verwijderen van de N uit het afvalwater, in verband met de stijgende
energieprijzen, de nodige zorg.

Sinds een aantal jaren wordt er, zoals al opgemerkt, zowel in Nederland als daarbuiten veel
onderzoek gedaan naar nieuwe sanitatietechnieken. Het gehele stelsel wordt daarbij
beschouwd. De wijze van inzameling, het transport, de verwerking en de mogelijkheden tot her-
gebruik van waardevolle elementen. Dit heeft in Nederland geleid tot een groot aantal projecten
die zich veelal richten op enerzijds scheiding van afvalwaterstromen en anderzijds op klein-
schaliger behandelsystemen. Ìn Nederland wordt het onderzoek gecoördineerd door de
Koepelgroep Ontwikkeling Nieuwe Sanitatie Systemen (ONSS) die door de Stowa in het leven
is geroepen. Ìn 2008 heeft de koepelgroep haar tweede strategienota uitgebracht.
Hierin is bijvoorbeeld naast een effectiever verwijdering van medicijnresten, hergebruik en
terugwinning van grondstoffen nadrukkelijk als belangrijke doelstelling opgenomen. Daarbij
wordt met name gedacht aan mineralen als N, P en K en het gebruik ervan als meststof.

Uit analyses van de afvalwaterstroom blijkt dat urine de belangrijkste bron is van deze
mineralen. Urine beslaat slechts 1 % van het totale volume aan afvalwater maar bevat 85 %
van alle N en 48 % van alle P's die in ons afvalwater aanwezig is. Bij het zoeken naar mogelijk-
heden om afvalwater als grondstof aan te wenden wordt de aandacht dan ook vrij snel gericht
op urine. Ìnmiddels worden er in Nederland verschillende pilotprojecten uitgevoerd die zich
richten op het separaat inzamelen, behandelen en hergebruiken van urine.

Inleiding

03/4428
Pagina 9 van 75


De belangrijkste zijn:
• Ambachtshuys, Meppel: onderzoek naar en ervaring opdoen met urinescheidingstoiletten.
• Waterschapskantoor Reest en Wieden, Meppel: ervaring opdoen met urinescheidings-
toiletten.
• Windesheim, Zwolle: onderzoek doen naar urinesteenafzettingen in leidingen.
• De Schoel, Sleen: onderzoek naar de verwijdering van medicijnresten en hormonen uit
urine.
• Woonzorgboerderij, Anderen: onderzoek naar de toepassing van urine bij de teelt van
energiegewassen.
• Haagse Kunstmest, Den Haag: onderzoek doen naar de winning van struviet (een fosfaat-
meststof) uit urine.
• Mesten met struviet, Almelo: onderzoek doen naar de mogelijkheid struviet toe te passen op
sportvelden.
• Urine voor algen, Vlissingen: onderzoek naar de mogelijkheden om urine te gebruiken voor
de productie van algen.
Meer en uitgebreidere informatie is te vinden op de website van Stowa (www.stowa.nl).

Het gebruik van een afvalstof als meststof mag dan misschien zeer Cradle to Cradle zijn, het is
de vraag of de landbouw wel op nog meer mest zit te wachten. We hebben immers al een
mestoverschot! Het is een terechte opmerking. Toch lijken er wel kansen te zijn. Ìmmers, er
worden in Nederland nog steeds stikstof- en fosfaatmeststoffen geïmporteerd.
Door (kunst)meststoffen uit urine te winnen zou de totale kunstmestimport in Nederland moeten
kunnen verminderen en daarmee de totale mestbalans. Maar ligt het wel zo simpel? Het is
daarom goed na te gaan wat eigenlijk de potentie is van humane urine in de landbouw. Heeft
het nu of in de toekomst een toegevoegde waarde? Zou urine geïmporteerde kunstmest kunnen
vervangen? Ìn welke vorm moet je het dan aanbieden? Waar en in welke sectoren doen zich de
beste kansen voor? En wil de landbouw het product überhaupt hebben? Het zijn zeer relevante
vragen die het waard zijn om voordat op grotere schaal urine separaat gaat worden ingezameld
toch eens te belichten.

Om antwoord te krijgen op deze vragen, en daarmee bij te dragen aan de algemene ontwikke-
ling van Nieuwe Sanitatie in Nederland, heeft de provincie Fryslân Wetsus en Grontmij verzocht
in beeld te brengen wat de potenties zijn van urine voor de landbouw. Om binnen de beperkte
tijd zoveel mogelijk kennis te vergaren is gekozen voor een vorm waarbij aan een aantal des-
kundigen wordt gevraagd in een essay bepaalde onderwerpen te belichten. Deze zijn geselec-
teerd op grond van een expertmeeting waar vertegenwoordigers van WUR/PRÌ, Wetsus, van
Hall-Larenstein, Wetterskip Fryslân, LTO, de provincie Fryslân, Stowa en Grontmij aanwezig
waren.
De door de deskundigen geleverde essay's zijn onverkort in deze rapportage opgenomen. Op
basis van die informatie worden tot slot conclusies getrokken en aanbevelingen gedaan voor
het vervolg.



03/4428
Pagina 10 van 75


3 Relevante vragen
Uit de discussie in de expertmeeting kwamen de volgende 7 vragen als meest relevante vragen
naar voren:

1. WeIke eisen worden er nu aan een uit urine vervaardigde meststof gesteId en weIke
bewerking is daartoe nodig? In weIke sectoren van de Iandbouw Iicht toepassing het
meest voor de hand?
Daarbij kunnen de volgende deelvragen worden gesteld:
• Welke eisen worden er in het algemeen aan meststoffen worden gesteld?
• Ìn welke mate kan urine (dan wel urine producten) daar aan voldoen?
• Wat zijn de voordelen (al dan niet na bewerking) van urine (bijvoorbeeld nat versus droog)
en welke nadelen?
• Op welke wijze zou urine bewerkt / behandeld moeten worden om een geschikte meststof te
worden?
• Ìn welke sectoren ligt toepassing het meest voor de hand (glastuinbouw, akkerbouw, grove
groenteteelt, aquacultures etc.)?

2. Hoe ziet in de toekomst de hoogwaardige meststof eruit? Wat betekent dat voor de
huidige wet- en regeIgeving?
Daarbij kunnen de volgende deelvragen worden gesteld:
• Welke ontwikkelingen treden er op in de productie en het gebruik van meststoffen?
• Ìn welke mate kan urine (dan wel urine producten) daar aan bijdragen?
• Op welke wijze zou urine bewerkt / behandeld moeten worden om een geschikte meststof
te worden?
• Ìn welke sectoren ligt toepassing het meest voor de hand (glastuinbouw, akkerbouw, grove
groenteteelt, aquacultures etc.)?
• Wat betekent de eventuele toepassing van urine voor de meststoffenwet?

3. Wat zijn de mogeIijkheden in AquacuItuur?
Daarbij kunnen de volgende deelvragen worden gesteld:
• Wat zijn de ontwikkelingen ten aanzien van aquacultures?
• Waarom zou urine juist in deze branche een goede toepassing kunnen vinden?
• Met welke aspecten zou rekening gehouden moeten worden?

4. Wat betekent het gebruik van urine (of urineproducten) in Iogistiek opzicht? Geef een
LCA van de verschiIIende opties.
Daarbij kunnen de volgende deelvragen worden gesteld:
• Welke mogelijkheden zijn er om urine/urineproducten van de productieplaats naar de
gebruiksplaats te krijgen?
• Welke milieuaspecten (LCA) zijn daarbij in het geding?
• Wat is de meest duurzame vorm van transport en bij welke afstand ligt het omslagpunt naar
een andere vorm?
• Ìn welke mate speelt schaal een rol?
• Ìn welke mate spelen volumereducerende maatregelen een rol?




Relevante vragen

03/4428
Pagina 11 van 75


5. WeIke kosten moeten worden gemaakt en weIke baten zijn er (beschrijvend)?
Daarbij kunnen de volgende deelvragen worden gesteld:
• Wat zijn de kosten van het separaat inzamelen van urine bijv. per m3 stikstof?
• Wat zijn de kosten van het (eventueel) aanvullend bewerken/zuiveren?
• Wat zijn de baten bijvoorbeeld op de zuivering?
• Wat zijn de factoren die de kosten het meest beïnvloeden (schaal, locatie, situatie huidige
afvalwatersysteem)?

6. WeIke maatschappeIijke gevoeIigheden zijn er verbonden met het gebruik van humane
urine in de Iandbouw?
Daarbij kunnen de volgende deelvragen worden gesteld:
• Hoe ervaart de maatschappij het gebruik van humane urine in de landbouw?
• Ìs daarbij onderscheid te maken tussen primaire voedselproductie en overige gewassen?
• Ìs er onderscheid tussen directe toepassing van urine en indirecte (bewerkte) urine?
• Hoe kan er op deze perceptie worden gestuurd?
• Ìn welke mate is daarbij gebruik te maken van de C2C (afval is voedsel) hype?
• Welke partijen zijn bij die perceptie de belangrijkste te bewerken stakeholders?

7. In weIke gebieden zou het gebruik van urine in de Iandbouw het meest voor de hand
Iiggen en waarom?
Daarbij kunnen de volgende deelvragen worden gesteld:
• Welke factoren maken een gebied tot een goede (proef)locatie? En waarom?
• Ìn welke gebieden doen zich deze factoren voor?
• Welke knelpunten zouden er eventueel kunnen zijn?
• Welke gebieden zijn om meer dan 1 reden een goede locatie?

Voorts werd vastgesteld dat over andere relevante onderwerpen kort geleden reeds het een en
ander is gepubliceerd of in onderzoek zijn. Begin dit jaar is in opdracht van Stowa een
rapportage gepubliceerd naar de gehalten en vrachten zware metalen in de verschillende mest-
stromen. Dit stuk is ook aan dit rapport toegevoegd. Onderzoek naar medicijnresten en
hormonen in urine vindt op dit moment in verschillende onderzoeken en pilotprojecten plaats.
Waar dat relevant is zal in de essay's en in de synthese aan deze onderzoeken worden
gereserveerd.



03/4428
Pagina 12 van 75


4 Welke eisen worden er nu aan een uit
urine vervaardigde meststof gesteld? ¡n
welke sectoren van de landbouw licht
toepassing het meest voor de hand?
Lideke Vergouwen, RonaId Muntjewerff en Jaap de Wit
Grontmij
Houten
juni 2008


4.1 InIeiding
Ìn het kader van het onderzoek naar de marktpotenties voor toepassing van humane urine en
daarvan afgeleide producten voor de landbouw (in Friesland), wordt eerst ingegaan op de eisen
die in het algemeen aan meststoffen ten behoeve van de landbouw worden gesteld. Humane
urine en afgeleide producten (Urevit en Struviet) worden op basis van de gegevens uit beschik-
bare literatuur getoetst aan de beschreven eisen. Daar waar de voor- en nadelen van genoem-
de (deels) humane meststoffen bekend zijn, worden deze eveneens aangegeven. Tot slot volgt
een beschouwing waarbij wordt ingegaan op de sectoren waar het gebruik van humane urine
en daarvan afgeleide producten de meeste potentie in de landbouw biedt.

4.2 Eisen aan meststoffen
Voor een voldoende gewasgroei is het van belang dat voldoende voedingsstoffen voor de plan-
ten beschikbaar zijn. Waar sprake is van tekorten aan opneembare voedingsstoffen zullen deze
door uitvoering van een gericht bemestingsprogramma worden aangevoerd.
Daarnaast worden door het geteelde gewas voedingsstoffen uit de bodem opgenomen. Deze
dienen door bemesting te worden teruggebracht.

Afbeelding 1 Stikstof, Fosfor en Kalium, de belangrijkste elementen voor de plant.





N (Stikstof) Eén van de belangrijkste componenten
voor de plant. Stikstof wordt gebruikt
voor de vorming van eiwitten en zorgt
voor de groei. Bij een gebrek stagneert
de groei
P (Fosfor) Een vitale voedingsstof welke belangrijk
is voor de groei van de plant. Tevens
bevordert het de wortelontwikkeling.
K (Kalium ) Belangrijk voor de fotosynthese en
transport van voedingsstoffen. Tevens
regelt het de waterhuishouding.

Welke eisen worden er nu aan een uit urine vervaardigde meststof gesteld? In welke sectoren van de landbouw licht
toepassing het meest voor de hand?

03/4428
Pagina 13 van 75


Niet elk gewas en elke bodem is gelijk; dit betekent dat de aan te brengen voedingsstoffen
(nutriënten) kunnen verschillen. Van belang bij het toedienen van de meststof is dat deze aan
de behoefte van pIant en bodem voIdoet. Een gewasspecifiek bemestingsadvies zal veelal
aan de basis liggen voor het gedurende het groeiseizoen uit te voeren bemestingsprogramma.

Om een gelijkmatig effect te realiseren dient de aan te brengen meststof een homogene sa-
mensteIIing te hebben. Ook is het van belang dat de meststof gelijkmatig, en in de juiste
dosering, over het perceel of gewas te verspreiden is. Dit betekent dat de meststof doseerbaar
en verdeeIbaar moet zijn.
Bijkomend aspect is dat voor het opslaan de juiste voorzieningen, en voor het aanbrengen van
de meststof de daarvoor geschikte apparatuur aanwezig moeten zijn.

Om zoveel mogelijk de voedingsstoffen uit de meststof te kunnen benutten, dient de meststof
niet (te) gevoeIig te zijn voor vervIuchtiging en uitspoeIing.

Meststoffen moeten vrij zijn van onkruiden, bacteriën en ziekteverwekkers om ongewenste
effecten tegen te gaan. Tevens dient de meststof geen ongewenst bij-effect te hebben op
bodemeigenschappen als zuurgraad en bodemleven. Ook mag de meststof geen schade aan
het gewas veroorzaken (verbranding, beschadiging, verdroging etc.) en dient deze geen stank-
overlast te veroorzaken.

4.3 Urine en op urine gebaseerde meststoffen

Zuivere urine
Menselijke urine is van nature rijk aan stikstof en andere nutriënten [1]. De samenstelling van
menselijke urine is weergegeven in bijlage 1. Nutriënten zijn als ionen beschikbaar in urine en
de voor de plant opneembare nutriënten komen goed overeen met chemische kunstmeststoffen
[2]. Stikstof is in de vorm van ureum aanwezig in urine. Dit element is nuttig voor planten en
vaak toegepast als bestanddeel in gangbare kunstmeststoffen [4].
De concentratie van voor de plant benodigde elementen (N,P, K) is in menselijke urine laag (zie
bijlage 1). De stikstofconcentratie in zuivere urine varieert naar verwachting ongeveer van ca. 3
tot 7 g/l. Urine bevat tevens grote hoeveelheden fosfor en kalium, maar vanwege de hoge stik-
stofconcentratie is de verhouding P/N en K/N lager vergeleken met traditionele minerale mest-
stoffen. Vanwege het relatief hoge stikstofgehalte is zuivere urine vooral geschikt voor bemes-
ting bij de teelt van stikstofbehoeftige gewassen.

Menselijke urine is niet geheel steriel, maar de hoeveelheid enterogene micro-organismen
kunnen zo laag zijn dat het toevoegen van urine aan de bodem geaccepteerd kan worden [4].
Urine van gezonde personen is vrijwel steriel, vrij van bacteriën of virussen [1]. De urine kan
wat geur veroorzaken, maar deze is niet weerzinwekkend [4].

Zuivere urine is gevoelig voor vervluchtiging. Het is niet wenselijk de urine te roeren of mixen
tijden het aanwenden in verband met vervluchtiging en geur [4].
Ìn Duitsland zijn bij proeven met urine sommige giften zuurder gemaakt om vervluchtiging en
micro-biële contaminatie te voorkomen [2]. Om ammoniumverliezen te beperken dient de urine
zo snel
mogelijk na aanbrengen in de grond te worden ingewerkt, danwel direct in de grond te worden
ingebracht. Een ondiepe inwerking is al voldoende. Enkele methoden om dit te realiseren zijn:
• het maken van smalle geultjes welke na aanbrengen van de urine worden bedekt;
• na aanbrengen de urine inspoelen middels beregening (irrigatie);
• druppelirrigatie (druppelbevloeiing).

Bij sommige gewassen o.a. tomaten, is het niet gewenst dat alle wortels aan urine worden
blootgesteld [2]. De wortels van de plant zijn gevoelig voor direct contact met urine.
Wanneer urine oppervlakkig wordt aangebracht dient te worden voorkomen dat het op de
bladeren of andere delen van de plant terecht komt. Dit vanwege de kans op verbranding van
de plant, emissies en hygiënische risico's (aerosols) [2].

Welke eisen worden er nu aan een uit urine vervaardigde meststof gesteld? In welke sectoren van de landbouw licht
toepassing het meest voor de hand?

03/4428
Pagina 14 van 75


Ìn verband met de grote kans op vervluchtiging dient urine te worden opgeslagen in afgesloten
kelders of tanks. Vanwege de lage concentraties van de elementen N, P en K in zuivere urine
zullen er veel kubieke meters aan inhoud benodigd zijn. Tevens betekent dit hoge transport-
kosten.


4.4 Op urine gebaseerde meststoffen

4.4.1 Urevit
Urevit is een op urine gebaseerde vloeibare meststof die is ontwikkeld door Eawag in Zwitser-
land [9]. Urevit wordt uit urine gemaakt door een proces van ultrafiltratie en electrodialyse. De
samenstelling is weergegeven in bijlage 1.Urevit is stabieler dan zuivere urine De samenstelling
van Urevit wijkt significant af van zuivere urine (zie tabel B3 in bijlage 1). De vloeistof bevat
namelijk een viervoudige concentratie van stikstof, fosfaat, kalium en andere zouten.
Daarnaast is het product vrij van bacteriën, virussen en microverontreinigingen.

Urevit is een in Zwitserland gecertificeerde meststof en wordt daar toegepast in de groenvoor-
ziening. Bij proeven met deze meststof zijn goede resultaten behaald.
De voornaamste meerwaarde ten opzichte van zuivere urine is dat Urevit relatief hoge en
constante concentraties aan NPK bevat, dat aanzienlijke voordelen en besparingen oplevert bij
transport, opslag en verwerking van de meststof.

4.4.2 Struviet
Uit urine kan Struviet gewonnen worden door er magnesiumoxide aan toe te voegen. Struviet is
een vaste korrelvormige meststof waarbij de voedingsstoffen langzaam worden afgegeven
(slow releasing fertilizer). De gehalten aan nutriënten en zware metalen in een Struviet-meststof
zijn weergegeven in bijlage 1 (tabel B4). Uit de tabel blijkt dat Struviet hoofdzakelijk veel fosfaat
en magnesium bevat.



Nutriënten (fosfaat en stikstof) zijn in een geconcentreerde vorm in de meststof aanwezig [6].
Struviet bevat geen resten van medicijnen, hormonen e.d. Uit analyses blijkt dat de gehalten
aan zware metalen lager zijn dan die in conventionele kunstmeststoffen.
Planten zijn beter in staat P uit Struviet op te nemen dan uit commerciële meststoffen [12].
Ìn onderzoek is of Struviet mogelijk ook op sportvelden als fosfaat meststof toegepast kan
worden. De eerste onderzoeksresultaten laten zien dat fosfaat in Struviet een vergelijkbare
werking heeft als fosfaat in een traditionele meststof. Om de effecten van struvietbemesting op
een langere termijn te beoordelen wordt aanvullend gemonitord [6].

Bij de productie van één ton struviet wordt 4 tot 6 ton aan broeikasgassen (greenhouse gas
credits) geproduceerd [8].


struviet = MgNH4PO4 . 6H
2
O ofwel Magnesium-Ammonium-Phosphate (MAP)
Welke eisen worden er nu aan een uit urine vervaardigde meststof gesteld? In welke sectoren van de landbouw licht
toepassing het meest voor de hand?

03/4428
Pagina 15 van 75


Afbeelding 2 Toepassing Struviet op grassportvelden


4.5 Onderzoek naar en huidige toepassingen van urine en op urine gebaseerde
meststoffen in de Iandbouw

4.5.1 Zuivere urine
Urine kan bij de meeste gewassen worden toegepast. Vanwege de hoge stikstofgehalten ver-
dienen hoog-salderende gewassen, welke goed reageren op stikstof, de voorkeur. Dergelijke
gewassen zijn spinazie, bloemkool, sierbloemen en maïs [2].

Urine is als kunstmest beproefd in slateelt (in kassen) in Mexico. De resultaten (opbrengst)
waren goed en dat gold ook voor andere gewassen.
Ìn Zweden is urine getest in gerst. Uit de resultaten bleek dat het stikstofeffect van urine
ongeveer 90% was van het gebruik van ammioniumnitraat-kunstmest. Ìn veldproeven is tevens
urine getest in voorjaarsgraan en wintertarwe [2].

Ìn Duitsland is het gebruik van urine beproefd op gerst in kassen. Bij sommige giften was de
urine zuurder gemaakt om vervluchtiging en microbiële contaminatie te voorkomen.
De resultaten lieten een hogere productie zien bij het toepassen van urine ten opzichte van
minerale kunstmest [2].

Het toepassen van urine is onder andere getest in snijbiet (Ethiopië), katoen en kafferkoren
(Mali), amaranth (Mexico), prei (Zweden), sla, spinazie en tomaten (Zimbabwe) [2]. Daarnaast
wordt het tevens gebruikt in tuinen. [2]. Bij de verschillende proeven waren de resultaten goed
(opbrengst).

Met water verdunde urine bleek een goede bron van nutriënten (met name van stikstof) voor
kool en spinazie (Zuid Afrika). De gift (hoeveelheid en frequentie) is belangrijk aangezien
frequente giften kunnen leiden tot opbrengstdaling als gevolg van verzilting. Er werden ook
goede resultaten behaald in maïs en tomaat [3].

Ìn Finland hebben twee komkommerkwekers (buitenteelt) de toepassing van urine getest. Hier-
uit bleek dat vergeleken met minerale kunstmest een gelijke opbrengst werd behaald.
Er werden ook geen indicatoren voor micro-organimsen in de komkommers gevonden. Ook
werd er geen verschil in smaak gevonden bij toepassen van urine of minerale kunstmest [4].

Ìn Finland is onderzoek uitgevoerd naar het toepassen van menselijke urine in koolgewas.
Daarvoor is een proef uitgevoerd waar bij het toepassen van menselijke urine is vergeleken met
traditionele kunstmest. De resultaten lieten bij toepassen van menselijke urine een betere groei
en een hogere biomassaproductie zien vergeleken met traditionele kunstmest. Daarnaast werd
er geen verschil in voedingswaarde van de kool waargenomen. De onderzoekers concluderen
dat menselijke urine als kunstmest voor koolgewas kan worden toegepast en dat het geen
significante hygiënische bedreiging vormt en tevens geen aparte smaak afgeeft [1].

VoetbaIcIub gebruikt urine aIs kunstmest
UTRECHT/HENGELO - PIassen op het voetbaIveId
mag natuurIijk niet. Maar bij HVV Tubantia in Hen-
geIo komt menseIijke urine er uiteindeIijk toch
terecht. Sterker nog, het wordt er met opzet op-
gegooid. Want struviet, een werkzaam stofje in
urine, bIijkt een zeer geschikte kunstmest, die
ook nog eens miIieuvriendeIijk is. ANP Video ©
RTVOost

Welke eisen worden er nu aan een uit urine vervaardigde meststof gesteld? In welke sectoren van de landbouw licht
toepassing het meest voor de hand?

03/4428
Pagina 16 van 75


Menselijke urine is met name interessant voor de biologische landbouw, waar een grote vraag
bestaat naar bemestingsoplossingen met een snel effect [13].

4.6 Urine producten
4.6.1 Urevit
Het onderzoeksinsitituut Biologische landbouw (FiBBL) in Frick (Zwitserland) onderzocht de
effectiviteit van Urevit als kunstmest voor voedermaïs. De studie liet zien dat Urevit een ge-
schikte meststof is voor dit gewas. Er werd echter een lagere opbrengst verkregen vergeleken
met ammoniumstikstof. Dit verschil wordt vermoedelijk veroorzaakt doordat bij het aanbrengen
van Urevit ammonium vervluchtigt.

4.6.2 Struviet
Struviet kan (mogelijk) worden afgezet in de glastuinbouw, aanleg en beheer van sportvelden
en in de grondsector [10]. Onderzoek heeft uitgewezen dat het als meststof mogelijk op sport-
velden kan worden toegepast [6].
Een proef met het toepassen van struviet in graan toonde aan dat de meststof waarde had voor
de productie van graan [7]. Onderzoek in Egypte naar het toepassen van struviet in bonen
(broad beans) liet zien dat deze meststof effectief werkt. Bij potproeven met Chinese kool
werden eveneens positieve resultaten behaald [8].

4.7 Potenties toepassing urine in NederIandse Iandbouw
1


4.7.1 Algemeen
Bij het toedienen van een meststof dient te worden voorkomen dat er wordt overbemest. Over-
bemesting kan o.a. schade aan het milieu veroorzaken (nutriëntenbelasting van grond- en
oppervlaktewater). Een te hoge stikstofgift moet tevens worden voorkomen, aangezien de kans
bestaat dat groenten een te hoog nitraatgehalte krijgen. Een nadeel van een vloeibare meststof
op grasland is dat het nitraatgehalte van het gras te hoog wordt. Dit veroorzaakt een te hoog
ureum-getal.

Urineproducten in korrelvorm genieten de voorkeur in verband met transport, opslag en ver-
werking met traditionele machines (voor vollegrondsteelt). Voor de glastuinbouw is wellicht ook
een oplosbare/ vloeibare variant toepasbaar. Een voordeel van vloeibare meststoffen is dat
nutriënten beter en meer beschikbaar voor gewas worden gesteld.

Ìn het algemeen zijn de perspectieven voor vloeibare meststoffen het grootst op mineraalarme
droogte- en uitspoelingsgevoelige zandgronden. Ìn de rij geïnjecteerde vloeibare meststoffen
zijn bij droogte in het voordeel omdat ze onder of naast de wortels worden geplaatst.
Bespuitingen met vloeibare meststoffen als bijbemesting hebben als voordeel dat een deel van
de meststof direct via het blad wordt opgenomen [11]
Vloeibare stikstofmeststoffen bieden het meest perspectief bij najaarsteelten en/of gewassen
met een slecht ontwikkeld wortelstelsel. Voor de typische akkerbouwgewassen is het perspec-
tief het grootst voor aardappelen, ongeacht de gebruikte toepassing [11].

4.7.2 Zuivere urine
Zuivere humane urine bevat voor de landbouw nuttige elementen (stikstof, fosfaat en kalium).
De gehalten aan nutriënten in zuivere urine zijn echter relatief laag en de verhouding P/N en
K/N is lager vergeleken met traditionele meststoffen. De gehalten aan nutriënten in zuivere
urine kunnen variëren. Vanwege de lage concentratie zijn de kosten voor transport, in ver-
houding tot andere stikstofmeststoffen, vrij hoog.

1
Ìn dit hoofdstuk komt niet aan de orde welke mogelijkheden en beperkingen er zijn voor toepassing van urine op basis
van de mestwetgeving. Ìn principe worden op basis van de mestwetgeving alle mengsels met dierrijke mest en alle
producten die gemaakt zijn uit dierlijke mest beschouwd als dierlijke mest. Voor dierlijke mest is er op basis van de stik-
stof- en fosfaatgebruiksnormen beperkte gebruiksruimte beschikbaar in de landbouw. Deze gebruiksruimte wordt al
opgebruikt, zodat er al sprake is van een mestoverschot. De vraag is of menselijke urine en producten daarvan als dier-
lijke mest worden beschouwd in de zin van de mestwetgeving. Ìn dat geval leidt toepassing van menselijke urine tot een
groter overschot van dierlijke mest.
Welke eisen worden er nu aan een uit urine vervaardigde meststof gesteld? In welke sectoren van de landbouw licht
toepassing het meest voor de hand?

03/4428
Pagina 17 van 75


Tevens is de opslag van zuivere urine, indien het niet direct te verwerken is, een belangrijk
aandachtspunt.

De toepassing van urine biedt het meeste perspectief voor stikstofbehoeftige gewassen. Moge-
lijk biedt het kansen in de biologische landbouw, waar het gebruik van kunstmeststoffen niet is
toegestaan. Om het economisch te kunnen laten renderen (met het oog op opslag, transport en
aan-wenden) zal de urine moeten worden ingedikt. Tevens dienen er maatregelen te worden
getroffen om vervluchtiging van stikstof te voorkomen.

Aangezien elke teelt een eigen bemesting vraagt en bij een te hoge gift aan stikstof een te hoog
nitraatgehalte kan veroorzaken, dient de samenstelling van urine te worden aangepast. Wense-
lijk is het om de verhouding P/N en K/N te verhogen. Dit is chemisch mogelijk (bijvoorbeeld door
biologische stikstofverwijdering).
Urine dient bij aanwenden te worden ingewerkt of ingeregend. Mogelijk dat in de toekomst de
spaakwielbemester kan worden toegepast. Ìn de glastuinbouw kan urine mogelijk worden toe-
gediend middels druppelirrigatie (toevoegen aan bevloeiingswater). Aandachtspunt is dat er bij
het toepassen van deze systemen verstoppingen kunnen ontstaan (door neerslaan van zouten).











Afbeelding 3 Spaakwielbemester voor injectie van vloeibare meststoffen

4.8 Ten behoeve van het toepassen van zuivere urine zijn er nog enkeIe Ieemten
in kennis en gewenst onderzoek [2].
• Nutriënteffecten van urine op gewas en bodem.
• Bemestingsstrategie en toedieningstechnieken.
• Efficiency van de opslag van urine in de bodem.

4.8.1 Urevit
Urevit bevat de elementen die nodig zijn voor de groei van het gewas. Het kan gekenmerkt
worden als een stikstofmeststof.
Gezien de recente ontwikkeling van het product zijn weinig gegevens van onderzoeksresultaten
en praktijkproeven beschikbaar. De verwachting is dat het product het meeste perspectief biedt
voor stikstofbehoeftige gewassen (biologische landbouw).
Gezien de hogere concentratie aan elementen geniet deze meststof de voorkeur boven zuivere
urine (in verband met opslag, transport etc.)

4.8.2 Struviet
Struviet kan worden gekenmerkt als fosfaatmeststof. Ìn het algemeen is in Nederland de
bodemvruchtbaarheid zodanig hoog dat fosfaat 's zomers niet beperkend is voor de groei van
gewassen [11].
Gezien de recente ontwikkeling van het product zijn weinig gegevens van onderzoeksresultaten
en praktijkproeven beschikbaar.
Het product is het meest geschikt voor gewassen waarbij de nutriënten langzaam beschikbaar
mogen komen. Vooralsnog lijken toepassingen in de (pot)plantenteelt en containerteelt waarbij
de meststof door de potgrond wordt gemengd, de groenvoorziening en sportvelden het meest
voor de hand te liggen.
Aangezien de meststof in korrelvorm beschikbaar is, kan deze met traditionele bemestings-
apparatuur (schijvenstrooier, pendelstrooier) worden aangewend.

Welke eisen worden er nu aan een uit urine vervaardigde meststof gesteld? In welke sectoren van de landbouw licht
toepassing het meest voor de hand?

03/4428
Pagina 18 van 75


4.9 Literatuur

[1] American Chemical Society (2007, October 8). Human Urine As A Safe, Inexpensive
FertiIizer For Food Crops. ScienceDaily. Retrieved May.

[2] GuideIines on the Use of Urine and Faeces in Crop Production, Håkan Jönsson
Swedish University of Agricultural Sciences ÷ SLU, Anna Richert Stintzing VERNA Eco-
logy, Ìnc Björn Vinnerås, Swedish University of Agricultural Sciences ÷ SLU, Eva Salo-
mon The Swedish Ìnstitute of Agricultural and Environmental Engineering (JTÌ), Stock-
holm Environment Ìnstitute Stockholm, Sweden, 2004.

[3] Use of Human Excreta from Urine-Diversion ToiIets in Food Gardens: Agronomic
and Healt Aspects, Report No 1439/3/06, June 2006, ttp://www.fwr.org/wrcsa/, mei
2008.

[4] Human excreta for pIant production, Helvi Heinonen-Tanski a,*, Christine van Wijk-
Sijbesma, Department of Environmental Sciences, University of Kuopio, P.O. Box 1627,
FÌN-70211 Kuopio, Finland, ÌRC Ìnternational Water and Sanitation Centre, P.O. Box
2869, 2601 CW Delft, The Netherlands, Received 25 September 2003; accepted 22 Oc-
tober 2003.

[5] http://www.novaquatis.eawag.ch, mei 2008.

[6] Praktijkproef toepassing van struviet aIs meststof, Grontmij Nederland bv, Arnhem,
3 april 2008.

[7]. SCOPE Newsletter nr 69, augustus 2007, www.ceep-phosphates.org

[8] SCOPE Newsletter nr 70, februari 2008, www.ceep-phosphates.org

[9] FertiIizer from the Library, Eawag News 63
e
, March 2007, http://www.eawag.ch

[10] Haagse wiIdpIassers Ieveren grondstof voor kunstmest , 7 juni 2007,
http://www.themas.stowa.nl/

[11] ToepassingsmogeIijkheden van vIoeibare NPK-meststoffen in de akkerbouw, Olga
A. Clevering, Praktijkonderzoek Plant & Omgeving, Sector AGV, Projectrapport nr.
1125246, Januari 2002.

[12] Kujawa-Roeleveld, K., Zeeman, G., Lettinga, G., Literatuurstudie en primair ontwerp
van de behandeIing van verdunde afvaIwaterstromen, Ìn:, Wageningen Universiteit,
Agrotechnologie en Voedingswetenschappen, Sectie Milieutechnologie, Decentrale
Sanitatie en Hergebruik op Gebouwniveau (DESAH); Eindverslag EET kiemproject
98115, Wageningen, 2000a, p. 55 - 80.

[13] Anoniem, 2001. MenseIijke urine Iijkt goede meststof bioIogische Iandbouw.
Agrarisch Dagblad 29 juni.

[14] The use of separated urine as mineraI fertiIizer, J. Simons, G. Schirmer en
J. Clemes, Ìnstitute of Plant Nutrition, University of Bonn, Wupperverbandsgesellschaft
für integrale Wasserwirtschaft mbH-WiW, Wuppertal, Germany, http://www.wiwmbh.de,
mei 2008.

[15] Urine can be used as fertiIiser. http://glwww.mst.dk/publica/projects/, mei 2008.

[16] SimuItaneous removaI of human and veterinary pharmaceuticaIs and nutrients,
conceptrapport, E. Koetse, G.J. Notenboom, M. Theunissen, Grontmij Nederland bv, 30
mei 2008.
Welke eisen worden er nu aan een uit urine vervaardigde meststof gesteld? In welke sectoren van de landbouw licht
toepassing het meest voor de hand?

03/4428
Pagina 19 van 75


4.10 BijIage 1. SamensteIIing urine, Urevit en Struviet

Tabel B1 Landbouwkundige beschrijving (samenstelling) van urine [15]

Total nitrogen 2,5 g/l
Ammonium 2,2 g/l
Total phosphorous 0,17 g/l
Potassium 1,2 g/l
Sulphur 0,13 g/l
Copper 0,30 mg/l
Manganese 5,2 µg/l
Magnesium 0,82 mg/l


Tabel B2 Samenstelling menselijke urine [16].










Welke eisen worden er nu aan een uit urine vervaardigde meststof gesteld? In welke sectoren van de landbouw licht
toepassing het meest voor de hand?

03/4428
Pagina 20 van 75


Tabel B3 Samenstelling Urevit en onbehandelde urine [9].
























Tabel B4 Gehalten aan nutriënten en zware metalen in de struviet [6].
Parameter Eenheid BrutogehaIte Percentage GehaIte op ba-
sis van droge
stof
Percentage
gloeirest % 82
droge stof % 60 -

Nutriënten
stikstof-Kjeldahl
(N)
g/kg 38,4 3,8% 64 6,4%
totaalfosfaat
(P
2
O
5
)
g/kg 203 20,3% 339 33,9%
kalium (K) g/kg 4,70 0,5% 7,90 0,8%
magnesium (Mg) g/kg 119 11,9% 198,4 19,8%

Zware metalen
zilver mg/kg <0,5
arseen mg/kg 1,4
cadmium mg/kg <0,50
chroom mg/kg <10
koper mg/kg <10
kwik mg/kg <0,2
nikkel mg/kg 2,5
lood mg/kg <5
Zink mg/kg 59




03/4428
Pagina 21 van 75


5 Perspectieven voor humane urine als
meststof in de Nederlandse landbouw
Hein ten Berge
PIant Research InternationaI B.V.
Wageningen
18 juni 2008

5.1 Geschiktheid van urine aIs meststof
Humane urine bevat aanzienlijke hoeveelheden van de belangrijkste plantenvoedingsstoffen N,
P, K (Tabel 1). Gehalten variëren afhankelijk van dieet, verliezen tijdens opslag, en verdunning
met spoelwater. (Zie ook andere tabellen in deze bundel.) De 'macronutriënten' zijn aanwezig in
een vorm die goed opneembaar is voor planten. Menselijke mest en urine zijn - net als dierlijke
mest - al duizenden jaren als meststof in gebruik. Ook in recente jaren zijn voorbeelden te
vinden van urinegebruik in de landbouw; vaak betreft het sanitatie-projecten in ontwikkelings-
landen, waar andere mestsoorten
relatief duur en moeilijk verkrijgbaar zijn. Urine werd daar vaak wel gebruikt als meststof, maar
de effectiviteit werd niet onderzocht.
De bemestende waarde van humane urine is in de wetenschappelijke literatuur beperkt gedo-
cumenteerd. Kwantitatief onderzoek dateert vooral uit de jaren '90, en werd vooral in Scandina-
vië uitgevoerd. Klassiek zijn de pot-experimenten van Kirchmann en Petterson (1995) met
gerst. Daar werd voor urine een N-werking (effectiviteit ten opzichte van opgelost ammonium-
nitraat) gevonden van ca 80%. Gasvormige N-verliezen in de vorm van ammoniak waren 7% en
verklaren dus niet volledig de lagere werking. Fosfaat uit urine werd in deze studie even goed
opgenomen als opgelost K
2
HPO
4
. Een relevante veldstudie is Elmsquist et al. (1998) waar een
N-werking van 68% werd gevonden in gerst. Steineck et al. (1999) rapporteerden een hogere
N-werking, eveneens in gerst. Rodhe et al (2004) lieten zien dat ammoniakverliezen uit urine
sterk gereduceerd en daarmee de N-werking verhoogd kunnen worden door injectie in de
bodem. Veel 'internet'-aandacht kreeg de veldstudie van Heinonen-Tanski et al. (2007) met
komkommer. Zij toonden aan dat komkommers goed bemest
kunnen worden met verdunde urine, maar de N-werking ten opzichte van kunstmest kan uit hun
studie niet worden vastgesteld (doseringen verschilden sterk tussen mestsoorten). Zij vonden
een significant effect op de smaak van komkommer. Hygiënische aspecten werden onderzocht
en als goed beoordeeld: er werden geen enterische organismen gevonden.
Tabel 1. Gehalten aan macronutriënten stikstof (N), fosfor (P), en kalium (K) in humane urine
volgens diverse bronnen.
Totaal N (ammo-N)
g/l
Totaal P
g/l
Totaal K
g/l
bron
2.5 (2.2) 0.17 1.2 Elsebeth Kolby, Svanholm Gods 2001, Sweden
3.7 (3.4) 0.30 1.0 Elmsquist et al. 1998.
7-9 Guyton, 1986 (verse urine)
1.79-2.61 0.20-0.21 0.9-1.1 Kirchmann&Petterson 1995
10.3 0.69 1.56 hier afgeleid uit citatie van Wolgast 1993 door Heinonen-
Tanski 2005



Perspectieven voor humane urine als meststof in de Nederlandse landbouw

03/4428
Pagina 22 van 75


Adamsson (2000) liet tomaten groeien op verdunde urine en daarop gebaseerde (verrijkte)
media ÷ in een produktieketen met algen en Daphnia - maar gaf geen teeltkundige beoordeling
van de groei-media voor tomaat. Bij geen van bovengenoemde studies kan worden uitgesloten
dat een eventueel verlaagde N-werking veroorzaakt werd, naast N-verliezen, door P of K
effecten.
Er werden in deze beperkte studie geen aanwijzingen gevonden voor commercieel gebruik van
urine als meststof in geïndustrialiseerde landen, noch van specifieke eigenschappen die urine
tot een bijzonder aantrekkelijke meststof zouden maken. Toch zou - afgezien van sanitaire,
toxicologische (farma), en wettelijke beperkingen - urine vanuit technisch perspectief waar-
schijnlijk ook goed in de Nederlandse landbouw toegepast kunnen worden. Verontreinigingen
met zware metalen zijn relatief laag, vergeleken met grond, tuincompost, en faecaliën
(Zweden).

Ondanks de betrekkelijk geringe documentatie van de agronomische waarde, kan op grond van
de samenstelling gesteld worden dat humane urine in grote lijnen vergelijkbaar is met dierlijke
urine, en dus ook een goede meststof kan zijn, al verschillen nutriëntengehalten natuurlijk
tussen diverse meststoffen. Grote variatie wordt echter óók gevonden binnen de dierlijke mest-
soorten en mest-scheidingsprodukten, en binnen humane urine. Voorts is nog relevant hier te
vermelden dat gier van dierlijke oorsprong zowel op gras- als bouwland werd gebruikt, maar op
bouwland niet in alle gewassen. Gier werd vooral in de bieten gebruikt en soms in haver. Ìn
aardappel vreesde men smaakbederf (Kolenbrander en de la Lande Cremer, 1967). Of dit
terecht is, wàt daarvan dan de oorzaak is, en of dit aspect óók geldt voor humane urine zijn nog
onbeantwoorde vragen.

5.2 Kansen op de mestmarkt
De marktkansen voor urine worden bepaald door aanbod van vergelijkbare meststoffen zoals
gier en de dunne fractie van mestscheiding, en eventueel effluent van mestvergisting.
Dergelijke meststoffen zijn - in Nederland ÷ afvalproducten en zeer goedkoop. De marktkansen
voor urine hangen tevens af van de inzetbaarheid van organische natte mestsoorten ten op-
zichte van kunstmest. Kunstmest heeft voordelen (gerichte inzet van N of P of K; droge vorm
dus lichte toedieningsapparatuur; schoon; voorspelbaar) die ervoor zorgen dat in akker- en tuin-
bouw vaak een deel van de bemesting als kunstmest wordt gegeven. Dunne mestsoorten en
urine delen met kunstmest wel het voordeel van de snelle N-werking, al moeten er maatregelen
genomen worden om N-verliezen te beperken (aanzuring; injectie) die anders de N-werking
sterk kunnen verlagen. Ìn de Nederlandse landbouw wordt jaarlijks ca 460 miljoen kg N uit dier-
lijke mest, en 288 miljoen kg N uit kunstmest gebruikt. Voor fosfaat (P2O5) zijn deze cijfers 163
(dierlijke mest) en 48 (kunstmest) miljoen kg (CBS Statline 2006). Stellen we de Nederlandse
bevolking gemakshalve op 15 miljoen inwoners, met een jaarlijkse uitscheiding in urine (volgens
Kirchmann en Petterson, 1995) van 2.4-4.3 kg N en 1.6-2.3 kg fosfaat (0.7 ÷ 1.0 kg P) per per-
soon, dan produceert deze bevolking 36-65 miljoen kg N en 24-34 miljoen kg fosfaat. Wanneer
alle menselijke urine in NL ingezameld zou worden, zou deze hoeveelheid dus overeenkomen
met 5-9% van de jaarlijkse inzet van N meststoffen, en met 11-16% van de jaarlijkse inzet van P
meststoffen, in de Nederlandse landbouw. Om de kansen voor urine op de mestmarkt (wette-
lijke beperkingen daargelaten) te kunnen inschatten is relevant te weten waarom mestscheiding
gebeurt. Gegeven de arealen van de diverse gewassen, heeft een bedrijf met vee rekening te
houden met drie 'aanvoernormen' voor mest naar land (N-gebruiksnorm; P-gebruiksnorm; en de
gebruiksnorm dierlijke mest, dit is de toelaatbare N aanvoer in dierlijke mest). Eigen mest die
niet past in de 'gebruiksruimte' moet worden afgevoerd van het bedrijf. Daarmee zijn hoge
kosten gemoeid, afhankelijk van de regio in de range C10 tot C25 per m3. Door mestscheiding
kan mest gesplitst worden in een N-rijke dunne fractie en een P-rijke dikke fractie. Hierdoor
wordt de mestafvoer van het bedrijf beperkt. Ìn systemen met een relatief P overschot (ten op-
zichte van zijn normen) kan dan immers de P-rijke fractie afgevoerd worden, terwijl de afge-
splitste N rijke dunne fractie op het bedrijf blijft. Dit bespaart de veehouder afzet- en transport-
kosten. Ook vanuit de af-nemer, lees akkerbouwer, bezien is scheiding aantrekkelijk, omdat hij
zo een 'specifieker' product kan kiezen. De akkerbouwer neemt dierlijke mest af omdat deze
gratis N,P,K bevat ÷ die anders als kunstmest aangevoerd en betaald moet worden ÷ maar ook
voor de organische stof in mest.
En hij krijgt geld toe, en soms veel!
Perspectieven voor humane urine als meststof in de Nederlandse landbouw

03/4428
Pagina 23 van 75


De dikke fractie is aantrekkelijk voor telers die wel fosfaat en organische stof willen aanvoeren
(hoewel plantaardige composten dan nog beter scoren), maar niet hun N quotum willen belas-
ten met meegevoerde N (waarvan er meer in onbehandelde mest zit). Aanvoer van de dunne
fractie op een akkerbouwbedrijf ligt niet erg voor de hand, tenzij het prijsverschil tussen kunst-
mest-N en 'dunne fractie' erg groot zou worden. Bij een negatieve prijs van de dunne fractie
kunnen akkerbouwers hun N-gebruiksruimte deels opvullen met dunne mest, en zo cash ver-
dienen. Een beperking daarbij is de gebruiksnorm dierlijke mest. Voor de afzet van dunne mest
÷ en eventueel ook van urine ÷ zal in de toekomst belangrijk worden of deze aangemerkt mag
worden (EU regelgeving) als 'kunstmestvervanger' in de zin dat deze niet op het conto van de
'gebruiksnorm dierlijke mest' geschreven wordt. Ìn dat geval zal er in de akkerbouw en ook op
niet-intensieve melkveebedrijven veel ruimte kunnen ontstaan voor afzet.

Dit heeft een gunstig effect op afzetmogelijkheden en verlaagt daarom de afzetpremie.
Hoewel scheiding nog niet op grote schaal ingezet wordt, tekent zich dus de mogelijkheid af dat
de N-rijke natte fractie achterblijft in de intensieve zandgebieden, op het bedrijf of omgeving,
terwijl de dikke P rijke fractie naar de kleigebieden gaat, waar telers zo naast goedkoop fosfaat
ook organische stof kunnen aanvoeren. (Dit vereist wel dat het scheidingsproces goed wordt
uitgevoerd, wat nu vaak nog niet het geval is.) Door afscheiding van de dunne fractie gaan de
transportkosten per kg fosfaat en organische stof omlaag, en dit is gunstig voor zowel de af-
nemer als de producent, die tevens kunstmestkosten bespaart indien de dunne fractie op het
producerend bedrijf kan achterblijven. Zoals gezegd kunnen deze effecten versterkt worden
indien de wetgever de dunne fractie niet meer op het conto van de gebruiksnorm dierlijke mest
laat drukken.

5.3 GIastuinbouw
De vloeibare vorm van urine roept associaties op met voedingsoplossingen zoals gebruikt in de
substraatcultuur, die gangbaar is in de glastuinbouw. Ondanks dat de oorspronkelijke samen-
stelling van urine sterk kan variëren, kan wel gesteld worden dat urine inderdaad na verdunning
met water en na toevoeging van enkele relatief ontbrekende elementen (waaronder Mg, Fe),
een geschikte voedingsoplossing voor gewassen op water- en substraatcultuur kan zijn. Dat
vrijwel alle stikstof in ammoniumvorm is, in plaats van nitraat of ammoniumnitraat, wordt als een
nadeel beschouwd. Toch zal deze relatieve geschiktheid als voedingsoplossing naar verwach-
ting geen reden voor acceptatie in de glastuinbouw in Nederland zijn. Deze sector is sterk ge-
richt op efficiëntie en kwaliteit in alle aspecten van de bedrijfsvoering, en levert een kostbaar
product waarmee geen vermijdbare risico's genomen worden. Bemesting vormt een vrijwel ver-
waarloosbare kostenpost ÷ zowel in absolute zin als relatief ten opzichte van energie, gewas-
bescherming en investeringslasten - en moet vooral probleemloos en gemakkelijk verlopen.
Een 'vreemde' stof als urine waaraan tal van onzekerheden kleven, hoe klein en irrelevant die
uiteindelijk ook mogen blijken, zal niet gemakkelijk zijn ingang vinden in de 'mainstream' van
deze industrie. Men mag vermoeden dat zelfs zeer hoge afnamepremies hier niet tot
acceptatie van urine zouden leiden. Het is de vraag of er in de meststoffen voor de glastuin-
bouw nog veel ontwikkeling te verwachten is. Mogelijk zou die op het terrein van smaaksturing
kunnen liggen, smaak verheugt zich immers in steeds toenemende belangstelling. Hoe relevant
de mogelijke invloed van bemesting is ten opzichte van de (vaststaand) grote invloed van ras-
keuze, is niet duidelijk. Een verdere overweging die de kansen voor (onbehandelde) urine kan
beperken is de hoge N input
behoefte in de glastuinbouw. Om een (normale) N-afvoer in de orde van ruim 1.000 kg/ha per
jaar te compenseren met urine, zou bij een gehalte van 2 g N per liter een volume van 500 m
3

urine nodig zijn.

5.4 VoIIegrondsgroententeeIt
Ìn de vollegrondsgroenteteelt ligt het beeld wat anders. Daar zien we een sterke opkomst van
een scala aan duurdere, 'speciale meststoffen'. Dit wordt o.a. mogelijk door de soms wat
grotere marges in die teelten. Deze meststoffen worden door de handel aangeprezen wegens
hun speciale maar meestal niet gedocumenteerde eigenschappen. Samenstelling en
formulering worden vaak niet prijsgegeven. Ze zouden efficiënter zijn (betere benutting van wet-
telijke 'ruimte' binnen normen), of bepaalde aspecten van productkwaliteit stimuleren, bijvoor-
beeld vastheid, kleur, bewaarbaarheid.
Perspectieven voor humane urine als meststof in de Nederlandse landbouw

03/4428
Pagina 24 van 75


Vooral aan kwaliteit hechten groententelers veel waarde (want de retail of de consument doet
dat ook). Daarbij is ook de gelijkmatigheid waarmee een gewas opkomt en geoogst kan
worden, en de uniformiteit en stuurbaarheid van maatsortering en oogsttijdstip heel belangrijk.
Prijzen van groenten variëren sterk door het seizoen, maar er is vaak wel een verwacht verloop,
en telers proberen daar zo goed mogelijk op in te spelen. Bemesting speelt daarin een sturende
rol, die echter nog weinig wetenschappelijk onderbouwd is. Ìn onderzoek is de meerwaarde van
speciale meststoffen vaak moeilijk aantoonbaar. Hoe dan ook, de hoge eisen aan product-
kwaliteit en de wat hogere marges in de groententeelt verklaren de grote belangstelling voor
wat duurdere, 'speciale' meststoffen. Toch zal er voor onbehandelde urine ook hier waarschijn-
lijk geen rol zijn weggelegd; telers rijden niet graag met zware waterige vracht over hun bouw-
voor. Mits allerlei niet-bemestingstechnische risico's kunnen worden uitgebannen, kunnen
geconcentreerde vormen wel mogelijkheden bieden. Naast korrelvorm bieden vloeibare oplos-
singen perspectief in combinatie met precisiebemestingstechnieken, die nu echter nog niet vol-
op toegepast worden. Een interessante ontwikkeling in deze richting is injectie van vloeibare
meststoffen onder hoge druk ('Pulse-tech'), een techniek die door een loonwerker in het
zuidelijk zandgebied ontwikkeld wordt. Ook geautomatiseerde vormen van 'aangieten' voor
startgiften van stikstof en fosfaat kunnen in de toekomst interessant worden voor een aantal
geplante groentegewassen. Startgiften worden in de praktijk nu nog niet regulier gebruikt.
Bij verder aanscherpende stikstofnormen en dalende fosfaattoestand van de bodem, zoals ver-
wacht onder een regime van evenwichtsbemesting, zal de belangstelling voor startgiften wel
toenemen.
Recent onderzoek door A.L. Smit (PRÌ) laat een zeer hoge efficiëntie zien van geplaatste
fosfaatgiften. De 'snelle' beschikbaarheid van stikstof en de goede opneembaarheid van fosfaat
maken urine-concentraten waarschijnlijk tot een geschikte meststof voor dergelijke bijmest- en
precisiebemestingsystemen, maar urineproducten onderscheiden zich op dit punt niet duidelijk
van oplossingen verkregen uit dierlijke mest. Zij zullen zich daarom moeten voegen naar de
aanbodmarkt voor dierlijke mest. Verder speelt een rol dat land in de tuinbouwgebieden op
zand vaak niet gepacht kan worden zonder afname van mest van veehouders.
Als de veehouderij in Nederland in de toekomst sterk gereduceerd zou worden ÷ en de akker-
en tuinbouw niet - ontstaat natuurlijk een nieuwe situatie.

5.5 Akkerbouw en meIkveehouderij
De grootste arealen in Nederland liggen nog steeds in de reguliere akkerbouw en melkvee-
houderij, en hier liggen ook de beste perspectieven voor urine, al zijn die ook hier niet florissant
in eerste aanleg. Ook hier geldt op de eerste plaats de concurrentie van dierlijke mest en de
verwerkingsproducten daaruit. De potentiële afzetruimte voor dunne fractie en urine zal sterk
toenemen indien deze producten wettelijk gezien mogen worden als kunstmest. Op niet-
intensieve melkveebedrijven ontstaat dan relatief veel afzetruimte wegens de hoge stikstofgiften
die op grasland zijn toegestaan, en worden kunstmestgiften gereduceerd. Ook in de akkerbouw
neemt de potentiële afzetruimte flink toe ingeval deze producten 'als kunstmest' gelden.
Ìn beide sectoren zal er een afzetpremie blijven gelden zolang NL een hoog aanbod van dier-
lijke mest kent. Grootschalige afzet in de akkerbouw vereist waarschijnlijk een geconcentreerde
vorm; ook hier is het niet aantrekkelijk om met water rond te rijden. Ìn de aardappelteelt lijkt er
hernieuwde belangstelling voor bladbemesting met ureumhoudende vloeibare meststoffen te
zijn; dit is voor telers aantrekkelijk omdat aardappels toch al regelmatig bespoten worden
(phytophtora) en stikstof dan bijgemengd kan worden (geen extra werkgang). Voor urine heeft
deze ontwikkeling alleen betekenis als de stikstof in ureumvorm kan worden gehouden.
Ontwikkelingen in sensortechnologie en plaatsspecifieke toedieningstechnieken ('precisie-
bemesting') ondersteunen de mogelijkheid tot bijbemesting; je moet immers gemakkelijk aan
het gewas kunnen 'zien' hoeveel N er bijgegeven moet worden, en dan gericht (timing en plaat-
sing) kunnen toedienen. Hiermee kan de N benutting verhoogd worden. Vloeibare meststoffen
hebben hierbij voordelen, mits ze schoon en specifiek zijn. Ze zijn precies toe te dienen, en snel
opneembaar, je hoeft niet te wachten tot het regent. Een ander aspect van bemesting in akker-
bouw ÷ alsook groententeelt - op langere termijn is de koppeling tussen aanvoer van organi-
sche stof en van fosfaat. Aanvoer van organische stof gaat gepaard met aanvoer van fosfaat.
De lagere fosfaatnorm van de toekomst is dan snel gevuld, en telers zullen daarom niet graag
fosfaat aanvoeren waaraan geen organische stof gekoppeld is. Verder zullen in de akkerbouw
meststoffen vooral goedkoop en makkelijk toepasbaar moeten blijven.
Perspectieven voor humane urine als meststof in de Nederlandse landbouw

03/4428
Pagina 25 van 75



5.6 FruitteeIt
Het is bekend dat ureum-oplossingen geschikt zijn als N-meststof in de fruitteelt. Voorbeelden
zijn beschreven voor o.a. citrus en appel. Om urine voor bladbemesting te gebruiken moet het
uiteen-vallen van ureum voorkomen worden omdat juist de niet-polaire organische vorm ge-
makkelijk door de cuticula dringt. Formulering als Triazone-urea verlengt aanzienlijk de verblijf-
tijd op het blad en verhoogt daarmee de efficiëntie als meststof. Vooralsnog lijken urease-
remmers onvoldoende te werken om ureum goed te conserveren in urine-opslag. Bij blad-
bemesting gebruikte ureum concentraties zijn overigens meestal wel veel hoger dan in onbe-
werkte urine. Ook in de fruitteelt worden in Nederland hoge eisen gesteld m.b.t. productkwali-
teit, en zullen risico's zoveel mogelijk gemeden worden; de kansen voor urine in deze sector
lijken ook om die reden klein.

5.7 BioIogische Iandbouw
Anders dan in de gangbare landbouw, is sluiting van kringlopen een van de ambities van biolo-
gische landbouw. Het gebruik van humane urine past bij die ambitie. Daarnaast is er behoefte
aan zgn. hulpmeststoffen, die een snelle N beschikbaarheid garanderen. Urine voldoet daar
zeker aan, echter niet beter dan de dunne fractie van dierlijke mest. Tegelijk is men in deze
sector zeer kritisch over de oorsprong van meststoffen.
Zo is men in Nederland actief bezig met een eigen regelgeving, om vast te leggen dat tenminste
een zeker minimum aandeel van de gebruikte meststoffen 'van biologische oorsprong' moet
zijn. Aangezien de gemiddelde consument vooral producten eet die niet biologisch geteeld zijn,
zal urine zeker buiten die categorie vallen.

5.8 VervIuchtiging
Net als bij andere ammoniakhoudende meststoffen moet bij gebruik van onbehandelde urine
gelet worden op N-verliezen via ammoniakvervluchtiging. Deze verliezen kunnen hoog oplopen,
zoals ook bij dierlijke mest. Ìn NL geldt daarom een inwerkverplichting voor dierlijke mest: deze
moet in de bodem geïnjecteerd worden of direct na toepassing ondergewerkt worden. Dit zou
ook voor onbehandelde humane urine onverkort moeten gelden. Tenminste één studie laat zien
dat dit inderdaad ook bij humane urine effectief en afdoende is (Rodhe et al., 2004).
Er is veel onderzoek verricht aan middelen die aan dierlijke mest en gier (dit is urine waarin
ureum is ongezet in ammoniumcarbonaat) toegevoegd kunnen worden om vervluchtiging van
ammoniak te voorkomen. Het werk van Kolenbrander en De la Lande Cremer (1967), en een
recente review door Van der Meer (2006), bieden veel aanknopingpunten voor verbeterde
bewaring van humane urine ten behoeve van gebruikt als meststof. Verder hangen N-verliezen
÷ en dus de N-werking in het veld ÷uit dierlijke mest en gier sterk af van toedieningstijdstip ten
op zichte van het groeiseizoen, van temperatuur en wind bij toediening, en van het onder-
werken (Kolenbrander en De la Lande Cremer, 1967). Voor gier uit humane urine zal dit niet
anders zijn.

5.9 Urine bij compostering
Een mogelijke toepassing zou toevoeging van urine aan te composteren organische rest-
producten zijn. Houtrijke groenafval (gemeenten / plantsoenen) en maaisel van berm- en
natuurgras, hebben een te lage C:N verhouding om goed te composteren. Bovendien vraagt het
composteringsproces om regelmatige bevochtiging. Een vloeibare, goedkope en N rijke mest-
stof als urine zou hierbij een heel nuttige rol kunnen vervullen. Een vraag is wel weer hoe je hier
ammoniakverliezen kunt beperken. Hier speelt trouwens nog een ander wetgevingsaspect,
m.b.t. fosfaat. Composten waar dierlijke mest is bijgemengd, worden in de wetgeving be-
schouwd als dierlijke mest. Dit betekent dat de fosfaatinhoud geheel meetelt op conto van de
fosfaatgebruiksnorm (zoals bijv. champost), wat niet geldt voor plantaardige compost. Daarmee
zou 'urinecompost' voor telers weer minder aantrekkelijk kunnen worden.






Perspectieven voor humane urine als meststof in de Nederlandse landbouw

03/4428
Pagina 26 van 75


5.10 Terugwinning via processing / varia
Terugwinning van fosfaat uit urine als struviet door toevoeging van MgO is een bekend proces
(Lind et al., 2000). Op termijn zal het nodig zijn het 'kostbare want eindige en toch noodzake-
lijke' element P niet meer te verkwisten, zoals nu, maar terug te winnen. (Dit geldt overigens
ook voor faeces.) Nu is dit echter nog een kostbaar proces. Ook terugwinning van stikstof werd
onderzocht. Maurer et al. (2003) geven LCA berekeningen voor terugwinning van N en P uit
urine, met nadruk op energie-efficiëntie ten opzichte van kunstmestproductie. Het indikken van
urine (factor 10) is relatief efficiënt, maar komt met 35 MJ per kg N wel in de buurt van kunst-
mest-N productie. Ìn hoofdstuk 6 wordt overigens een veel hogere energiebehoefte genoemd.
Hellström en Johansson (1999) waarschuwen voor de energiekosten die gepaard gaan met
transport van urine naar de landbouw.
Dit probleem verdwijnt natuurlijk in geïntegreerde systemen waar produktie en gebruik niet sterk
ruimtelijk gescheiden zijn, zoals nu wel het geval is in Nederland.
Kortom, een grondige analyse van energie-behoefte van de diverse procedé's om urine te
concentreren of er stoffen uit terug te winnen, en een vergelijking met transportkosten, zijn
noodzakelijk om de duurzaamheid van urinegebruik als meststof te kunnen beoordelen.
Onzekerheid hierbij zit o.a. in de efficiëntie waarmee verdampingwarmte teruggewonnen kan
worden.

Hammer en Clemens (2007) ontwikkelden een rekenmodel om de aanvoer van microveront-
reinigingen in urine bij gebruik als meststof te vergelijken met dierlijke mestsoorten, en
concludeerden dat fluxen van zware metalen, antibiotica en hormonen bij urine relatief laag
waren, maar dat medicijnresiduen wel speciale aandacht vragen. Zie ook LCA/Modelstudies
door Tidaker et al (2007) voor substitutie van kunstmest door urine in tarweproductie.

5.11 Nieuwe productieketens
Op langere termijn bieden gespecialiseerde 'productieketens' nabij stedelijke gebieden mogelijk
perspectief voor de afzet van urine. Er zijn interessante voorbeelden in de literatuur te vinden,
waarbij algen, protozoën, kreeftachtigen en gewassen geproduceerd worden.
Dergelijke gekoppelde systemen zijn nog nauwelijks onderzocht. Zoals vaak vereist de ontwik-
keling van innovatieve systemen aanvankelijk veel kennis, en zijn commerciële toepassingen
nog ver te zoeken mede omdat energie nog altijd goedkoop is en andere eindige grondstoffen
(waaronder fosfaat) óók.

5.12 WetteIijke vereisten meststoffen
De Nederlandse wet (Uitvoeringsbesluit Meststoffenwet) staat het gebruik van afvalstoffen als
meststof in de landbouw niet toe, tenzij ze genoemd worden in een van de bijlagen bij het uit-
voeringsbesluit. Vooralsnog is urine een afvalstof die niet is opgenomen. Eisen die aan mest-
stoffen worden gesteld, zijn gedetailleerd vastgelegd in een protocol (Van Dijk et al, 2008) en in
het Uitvoeringsbesluit Meststoffenwet. Voor een achttal zware metalen zijn maximaal toelaat-
bare gehalten vastgesteld, die worden uitgedrukt per kg van het 'waardegevend bestanddeel'
(vooralsnog zijn dat m.i. N, P of K). Dit geldt ook voor een groot aantal (32) organische
microverontreinigingen. Verder is vereist dat het productieproces en de samenstelling precies
bekend zijn, en dat de landbouwkundige werking en milieu-aspecten wetenschappelijk
gedocumenteerd zijn.

5.13 ConcIusie
Humane urine is in principe een geschikte meststof, of een geschikt uitgangspunt voor de
productie van meststoffen, en is op dit punt vergelijkbaar met gier of de dunne fractie uit
scheiding van dierlijke mest. Voor de korte termijn is het realistisch om te onderkennen dat
gescheiden opvang en verwerking van humane urine zuiveringstechnisch grote voordelen heeft,
te becijferen hoeveel geld deze waard zijn (zie bijv. Maurer et al., 2003), en de kostenbesparing
deels als premie te gebruiken om urine (al dan niet behandeld) in de landbouw te kunnen afzet-
ten. De reguliere akkerbouw en extensieve melkveehouderij lijken dan de beste perspectieven
voor afzet te bieden, echter pas wanneer urine als kunstmest beschouwd mag worden, in de zin
van de gebruiksnorm dierlijke mest. En pas nadat andere dan bemestingstechnische knelpun-
ten (wettelijke, sanitaire, toxicologische, etc.) uit de weg geruimd zijn.

Perspectieven voor humane urine als meststof in de Nederlandse landbouw

03/4428
Pagina 27 van 75


Het is alleszins de moeite waard dit spoor ook in Nederland verder te verkennen, want er komt
een tijd dat schoon water en fosfaat wèl schaars dus duur genoeg zullen zijn om er zuinig mee
om te springen. Tot die tijd moeten systemen voor hergebruik worden geoptimaliseerd.

5.14 Onderzoek

Voordat humane urine gebruikt kan worden voor de bemesting van voedselgewassen, dient
onderzocht te worden of dit verantwoord is vanuit het oogpunt van voedselveiligheid, en of er
effecten op de smaak van geoogste produkten zijn. Ook dient onderzocht te worden ÷ en dit
ook bij andere toepassingen zoals sierteelten en sportvelden ÷ of er geen ontoelaatbare
emissies van hormonen of andere ongewenste stoffen optreden.
Daarnaast dient de bemestende waarde van al dan niet behandelde urine / gier, en daarvan
afgeleide producten, vastgesteld te worden voor de beoogde gewassen en teeltsystemen (toe-
dieningstechnieken en -tijdstippen; en grondsoorten).


5.15 Referenties

Adamsson, M. Potential use of human urine by greenhouse culturing of microalgae (Scene-
desmus acuminatus), zooplankton (Daphnia magna) and tomatoes (Lycopersicon). (2000)
Ecological
Engineering, 16 (2), pp. 243-254.
Behrendt, J., Arevalo, E., Gulyas, H., Niederste-Hollenberg, J., Niemiec, A., Zhou, J., Otterpohl,
R. Production of value added products from separately collected urine (2002) Water Science
and Technology, 46 (6-7), pp. 341-346.
Elmsquist, H., L.Rodhe, S.Steineck, B.Lindén, M.Blomberg, 1998. Human urine and effluents
from digestion of food refuse as fertiliser to barley ÷ crop yields, nitrogen utilisation, ammo-
nia
emissions, and nitrate leakage, a field trial in 1997. Swedish Ìnstitute of Agricultural Engi-
neering, JTÌ, Uppsala. Ms Thesis.
Hammer, M., Clemens, J. A tool to evaluate the fertiliser value and the environmental impact of
substrates from wastewater treatment (2007) Water Science and Technology, 56 (5), pp.
201-209.
Heinonen-Tanski, H., Van Wijk-Sijbesma, C. Human excreta for plant production. (2005) Biore-
source Technology, 96 (4), pp. 403-411.
Heinonen-Tanski, H., Sjoޠblom, A., Fabritius, H., Karinen, P. Pure human urine is a good fertil-
iser for cucumbers. (2007) Bioresource Technology, 98 (1), pp. 214-217.
Hellstroޠm, D., Johansson, E. Swedish experiences with urine separating systems (1999) Was-
ser und Boden, 51 (11), pp. 26-29.
Kirchmann, H. and S.Petterson, 1995. Human urine ÷ chemical composition and fertilizer use
efficiency. Fertilizer Research 40 (5), 157-162.
Kolenbrander G.J. en L.C.N. de la Lande Cremer. Stalmest en gier, waarde en mogelijkheden.
1967. Veenman en Zn., Wageningen. 188 pp.
Kolby Elsebeth. http://glwww.mst.dk/publika/projects/2001/87-7944-396-6.htm
Lind, B.-B., Ban, Z., Bydén, S. Nutrient recovery from human urine by struvite crystallization with
ammonia adsorption on zeolite and wollastonite (2000) Bioresource Technology, 73 (2), pp.
169-174.
Maurer, M., Schwegler, P., Larsen, T.A. Nutrients in urine: Energetic aspects of removal and
recovery (2003) Water Science and Technology, 48 (1), pp. 37-46.
Meer H.G. van der, 2006. Reduction of agricultural and rural pollution by innovative additives.
Quality of Life and management of living resources. Final Scientific Report of CRAFT Con-
tract QLK5-CT-2001-70429. Plant Research Ìnternational Note 415.
Rodhe, L., Stintzing, A.R., Steineck, S. Ammonia emissions after application of human urine to
a clay soil for barley growth (2004) Nutrient Cycling in Agroecosystems, 68 (2), pp. 191-198.
Steineck S., R.Stintzing, L.Rodhe, H.Elmsquist, C.Jacobsson, 1999. Plant nutrients in human
urine and food refuse. Use of municipal organic waste. Proc. Of NJF seminar no. 292, Nov
23-25, 1998. Agric. Res. Centre, jokioinen, Finland. DÌAS Report Plant Production 13, June
1999, 2
nd
volume, pp 125-130.
Perspectieven voor humane urine als meststof in de Nederlandse landbouw

03/4428
Pagina 28 van 75


Tidaޡker, P., Mattsson, B., Joޠnsson, H. Environmental impact of wheat production using human
urine and mineral fertilisers - a scenario study (2007) Journal of Cleaner Production, 15 (1),
pp. 52-62.
Van Dijk T.A., J.J.M.Driessen, P.A.Ì.Ehlert, P.H.Hotsma, M.H.M.M.Montforts, S.F.Plessius,
O.Oenema, 2008. Protocol beoordeling stiffen Meststoffenwet, Versie 1.1. WOT Na-
tuur&Milieu werkdocument 85.
Wolgast, M. 1993. Rena vatten. Om tankar i kretslopp. Crenom H B, Uppsala. (in Swedish).




03/4428
Pagina 29 van 75


6 De mogelijkheden van humane urine in
aquacultuur
Ir. Evert Jan van Nijen en drs. Lorette Verment
Grontmij
Drachten
Juni 2008

6.1 InIeiding
Ìn dit essay wordt ingegaan op de vraag: ¨Wat zijn de mogelijkheden van humane urine in
Aqua-cultuur?¨. Hiertoe wordt eerst uitleg gegeven over de achtergrond van deze vraag: ¨Wat is
aqua-cultuur en wat speelt er in deze sector?¨ Vervolgens wordt informatie gegeven over de
ontwikkelingen van aquacultuur in Europa, Nederland en Noord-Nederland. Daarna volgt de
kern van het essay, n
amelijk de mogelijkheden van humane urine in aquacultuur. Er wordt uitleg gegeven over de
reden voor de inzet van humane urine in aquacultuur. Vervolgens wordt de toepassing opge-
splitst in schelpdierenkweek - vanwege de ervaring die hier al mee is opgedaan - en andere
toepassingen, die nog meer in de kinderschoenen staan.

6.2 Achtergrond
Wat is aquacultuur en wat speelt er in deze sector? Onder aquacultuur wordt verstaan het
kweken van aquatische organismen waarbij enige vorm van menselijk ingrijpen in het natuurlijk
proces van het organisme plaatsvindt met het doel de productie ervan te vermeerderen. Het
gaat dus om het kweken van planten of dieren die in het water leven. (Uit: Aquacultuur in Zee-
land: de blauwe
revolutie, Provincie Zeeland). Denk hierbij aan zeekraal, zeewier, vis en schelpdieren.
Verschillende ontwikkelingen spelen de groei van aquacultuur in de kaart. Ten eerste hebben
we te maken met een ernstige terugval van belangrijke visbestanden. Het is daardoor nood-
zakelijk dat de visserij gaat verduurzamen. Aquacultuur kan daaraan een belangrijke bijdrage
leveren. Het mes snijdt wat betreft duurzaamheid en biodiversiteit aan twee kanten. Enerzijds
belooft de aquacultuur van-wege zijn gesloten keten het milieu te sparen. En anderzijds zal
kweekvis de vraag naar 'wilde' vis in belangrijke mate temperen; en dat is weer goed voor de
visbestanden en de biodiversiteit in de
wereldzeeën.
Ten tweede speelt het fenomeen verzilting een rol. Ìn de hele wereld en ook in Nederland zijn
veel kustgebieden aan het verzilten. Een belangrijke oorzaak hiervan is de door de klimaatver-
andering veroorzaakte zeespiegelstijging. Bodemdaling en drogere zomers versnellen het ver-
ziltingsproces. Ìnspelend hierop kan aquacultuur een nieuwe economische activiteit zijn voor de
verzilte binnendijkse gebieden in onder andere Friesland.

Ten derde hebben we te maken met veranderende consumptiepatronen. De wereldconsumptie
van vis stijgt met 8-10 % per jaar. Vis wordt over het algemeen gezien als gezond voedsel. Het
aandeel van gekweekte vis in de Nederlandse visconsumptie wordt snel groter. Ìn 2007 was het
aandeel van gekweekte producten in de visverkoop via Nederlandse winkels bijna een kwart.
De verwachting is dat het aandeel gekweekte producten snel zal toenemen gezien de wereld-
wijde ontwikkeling van aquacultuur. (Uit: ¨LNV Consumentenplatform Vis moet, kan dat?¨ 21
mei 2008).




De mogelijkheden van humane urine in aquacultuur

03/4428
Pagina 30 van 75


6.3 AquacuItuur in Europa, NederIand en Noord-NederIand
De aquacultuur maakt 19 % van de totale visserijproductie van de Europese Unie uit. Tegen
2030 zal de aquacultuur meer dan de helft van alle wereldwijd geconsumeerde vis leveren. (Uit:
Maritieme
Cijfers, Europese Commissie). Ìn Nederland is het project 'Zeeuwse Tong' een voorbeeld van
succesvolle ontwikkeling van aquacultuur. Ìn de provincie Zeeland is de kweek van organismen
die in het water leven ÷ vissen, schaal- en schelpdieren, wormen, hogere planten en wieren ÷
sterk in opmars (Uit: Aquacultuur in Zeeland: de blauwe revolutie, Provincie Zeeland).
Het productiemodel 'Zeeuwse tong' is een combinatie van kweek van jonge visjes binnen en
doorkweek in zoutwater-bassins buiten. Het project is duurzaam vanwege de natuurlijke
kringloop: vis produceert mest, mest doet algen en zilte gewassen zoals zeekraal en lamsoor
groeien, algen vormen het voedsel voor schelpdieren en zagers. Een deel van de zagers wordt
benut voor de voeding van de tong; een ander deel wordt verwerkt tot visvoer. Zo ontstaat een
gemengd zilt bedrijf. Ìn het projectplan de 'Zeeuwse Tong' is berekend dat in principe tien- tot
vijftienduizend hectare landbouwgrond zou kunnen worden omgezet in aquacultuur; dat is zo'n
tien procent van het provinciale landbouwareaal.





Binnen Noord Nederland is de Westergozone (het gebied van Leeuwarden tot Harlingen) een
gebied met potentie voor aquacultuur. Verschillende partijen, zoals projectbureau Westergo en
de NOM, hebben zich verenigd om in de vorm van aquacultuur een nieuwe economische
drager in dit gebied te realiseren. De aanpak bestaat uit een drietal fasen. Ten eerste de
begeleiding van de vestiging van twee pilotbedrijven. Ten tweede het opstellen van een ge-
biedsplan met aandacht voor functies als Harlingen Seaport en het glastuinbouwgebied. Ten
derde het starten van een proefboerderij. Andere gebieden zoals Lauwersland en Eemsmond
worden ook onderzocht.

6.4 De vraag naar humane urine vanuit de aquacuItuur
Zoals hierboven beschreven is er een toenemende interesse in en groei van de aquacultuur in
de wereld en in Nederland. Duurzaamheid is bij de ontwikkeling van aquacultuur een belangrijk
uitgangspunt. De sector staat in de kinderschoenen en kan leren van de lessen uit andere
sectoren in de landbouw. Aquacultuur is daarom op zoek naar kringlopen. Momenteel wordt bij
aquacultuur meestal gebruik gemaakt van kunstmest. Het gebruik van kunstmest is niet ge-
wenst. Kunstmest is geen natuurlijk product en past daardoor niet in de natuurlijke kringloop.
Aquacultuur in Zeeland
De mogelijkheden van humane urine in aquacultuur

03/4428
Pagina 31 van 75


Bovendien is het kostbaar in gebruik. Humane urine is een duurzaam alternatief voor kunst-
mest. Het is bovendien verkrijgbaar in grote hoeveelheden tegen een naar verwachting lage
prijs.

6.5 De toepassing van humane urine in scheIpdierenkweek
Een bekende vorm van aquacultuur is schelpdierenkweek. Dit is in Zeeland de snelst groeiende
vorm van aquacultuur. Voor de schelpdierenkweek zijn algen nodig.
Schelpdieren zijn zogenaamde 'filterfeeders', die het water filteren op algen, die als voedsel
dienen. Algen zijn eencellige organismen die zichzelf voorplanten in zonlicht. Gezien de toe-
nemende groei van aquacultuur zijn er op termijn grotere hoeveelheden van deze algen nodig
om in de voedselvraag te voorzien. Urine is rijk aan nutriënten en kan daardoor een potentiële
voedingsbron voor algen zijn.

Hierop inspelend is in Zeeland een onderzoek gedaan naar de mogelijkheden om algen te
kweken op humane urine als alternatief voor het gangbare (duurdere) medium.
Hieruit is gebleken dat algen inderdaad kunnen worden gekweekt met humane urine als mest-
stof. Voor een kweekvijver van 100m3 is de urine nodig van 48 mensen per dag. (Uit: ¨De
mogelijkheden van algenkweek op urine¨, 2007). Dit onderzoek in Zeeland is verkennend van
opzet geweest en gericht op één algensoort. Verder onderzoek is nodig om na te gaan of het
kweken van algen op urine op grote schaal mogelijk is en ook om de mogelijkheden van andere
algen te onderzoeken. De groeipotentie van algen op urine moet nader onderzocht worden.
Ìn Zeeland wordt momenteel ureum (een bestanddeel van urine) in algenkweek op wat grotere
schaal gebruikt (300 m3 vijvers). Deze vijvers kunnen als leerobject dienen, bijvoorbeeld voor
groeimetingen. Op dit moment worden er in die vijvers algen als voer voor mosselen gekweekt.
De algen blijven enkele weken groeien, maar vervuilen dan, daar moet verder aan gewerkt
worden. Bij het opzetten van onderzoeksprojecten kan samengewerkt worden met initiatieven
waarbij op grote schaal humane urine wordt ingezameld. Een project dat hiervoor momenteel
wordt opgestart is de nieuwbouw van een studentencampus in Leeuwarden. Hier liggen goede
mogelijkheden voor een combinatie met verder onderzoek naar de toepassing van humane
urine in de aquacultuur. Onderzoeksvragen die hierbij meegenomen kunnen worden betreffen
factoren als temperatuur, verdunning en schaalgrootte en het effect van toevoegingen zoals P,
N en vitaminen.






6.6 Andere toepassingen van humane urine
Zoals hierboven aangegeven kunnen algen gekweekt worden met humane urine als meststof.
Behalve voor de schelpdierenkweek kunnen algen ook ingezet worden voor andere doeleinden.
Hierbij kan binnen de voedingsmiddelensector gedacht worden aan gamba's, mosselen, oes-
ters, vitaminepillen, visolie en dierenvoeding. Voor de toepassing binnen de voedselsector is
het belangrijk dat onderzocht wordt wat er behalve de waardevolle stoffen aan mogelijke on-
gewenste en schadelijke stoffen (zoals medicijnresten en hormonen) in humane urine zit.
Algen voor biodiesel Vijver met ureum als meststof voor algen
De mogelijkheden van humane urine in aquacultuur

03/4428
Pagina 32 van 75


Onderzocht moet worden in hoeverre het gebruik van humane urine in de voedselketen accep-
tabel is voor consument en overheid. Buiten de voedingsmiddelensector speelt dit probleem
niet tot nauwelijks. Bovendien liggen hier nog veel meer mogelijkheden. Te denken valt aan
biodiesel, cosmetica, gewasbeschermingsmiddelen, afvalwaterzuivering en pigmenten voor
verfstoffen. Zowel de grote concerns als het midden- en kleinbedrijf storten zich momenteel op
de algenmarkt. Het plantaardige en milieuvriendelijke imago spreekt ze aan. Algenteelt met
gebruik van humane urine versterkt de duurzaamheid van de algenteelt. Bovendien kan het de
kosten ÷ die nu nog een probleem zijn bij bijvoorbeeld het produceren van biodiesel ÷ omlaag
brengen.

6.7 ConcIusie
Gezien de huidige ontwikkelingen van de aquacultuur en de algenindustrie is onderzoek naar
de inzetbaarheid van humane urine heel interessant. Het is duurzaam, in grote hoeveelheden
verkrijgbaar en relatief goedkoop. Een vraagstuk dat goed onderzocht moet worden is het voor-
komen van medicijnresten en hormonen in urine. Het valt aan te bevelen om te onderzoeken of
dit schadelijke gevolgen heeft voor de aquacultuur en de volksgezondheid. Daarnaast moet
verder onderzocht worden hoe algen op grote schaal gekweekt kunnen worden met humane
urine als meststof. Verder moet de inzet van de op humane urine gekweekte algen, gericht op
specifieke toepassingen, verder onderzocht worden.

6.8 Bronnen

Rapporten:
• Aquacultuur in Zeeland: de blauwe revolutie, Provincie Zeeland
• LNV Consumentenplatform ¨Vis moet, kan dat?¨ 21 mei 2008
• C.J. Blom en J.H. Jansen, ¨De mogelijkheden van algenkweek op urine, een verkennend
onderzoek¨ (2007)

Telefonische en schriftelijke informatie van:
• Dhr. J. Meulemans, Aquaphyto
• Dhr. B. Kole, Grontmij
• Dhr. E.J. van Nijen, Grontmij
• Dhr. D. Swart, Grontmij
• Mw. N. Dijkman, Aquaphyto



03/4428
Pagina 33 van 75


7 Benodigde logistiek bij gebruik van urine
als meststof
Iemke Bisschops en Adriaan MeIs,
LeAF en Wageningen Universiteit
Wageningen
Juni 2008


7.1 InIeiding
De toepassing van urine als meststof impliceert dat de urine getransporteerd moet worden van
de plaats van productie - de bebouwde omgeving - naar de plaats van gebruik ÷ de landbouw.
Dit kan zowel direct ÷ in ongeconcentreerde vorm ÷ of na een bewerkingsstap waarbij de urine
wordt geconcentreerd of waarbij meststoffen (kunstmest) wordt gewonnen.

Dit essay gaat specifiek over de logistieke aspecten van de verzameling, het transport en het
gebruik van urine (of urineproducten). Het essay gaat in op de vraag welke mogelijkheden zijn
er om urine / urineproducten van de productieplaats naar de gebruiksplaats te krijgen en hoe dit
geoptimaliseerd kan worden. Het maakt ook een (deels kwantitatieve en deels kwalitatieve)
evaluatie van de milieu-aspecten van het transport van urine.

Het essay maakt deel uit van een reeks die bedoeld is om de marktpotenties voor menselijke
urine en daarvan afgeleide producten voor de landbouw in Friesland in beeld te brengen. Ìn de
reeks wordt een aantal relevante vragen uitgewerkt en beantwoord. Het project wordt begeleid
door een expertgroep bestaande uit vertegenwoordigers van provincie Fryslân, Wetterskip
Fryslân, Wetsus, LTO-noord, WUR/Alterra, Grontmij en van Hall.

7.2 Randvoorwaarden voor het gebruik van urine aIs meststof
De mineralen in urine kunnen gebruikt worden door directe toepassing van de ingezamelde
mense-lijke plas. Dit is tot dusver de meeste gebruikte aanpak. Bij het direct gebruik van urine
is het belangrijk dat de hygiënische veiligheid ervan gegarandeerd is. De geaccepteerde
methode hiervoor is het gecontroleerd bewaren gedurende 6 maanden (Högland et al, 1998).
Tijdens de opslag vindt hydro-lyse van ureum plaats en stijgt de pH tot boven de waarde 9
(basisch). Hierdoor worden eventueel aanwezige ziektekiemen onschadelijk gemaakt.

De 6-maands opslag van de urine kan op verschillende punten in de keten plaatsvinden.
Ìn de meeste gevallen zal opslag bij of dichtbij de eindgebruiker (een landbouwbedrijf) kosten-
effectiever zijn omdat het realiseren van opslagcapaciteit in de bebouwde omgeving relatief veel
duurder is. Dit hangt ook samen met de verschillende schaalniveaus waarop naar urine-
inzameling gekeken kan worden. Een ander voordeel van het uitvoeren van de 6-maands
hygiënisering bij de gebruiker is dat dan de kwaliteit beter gegarandeerd kan worden. Voor het
transport van gehygiëniseerde urine van een opslagtank naar de gebruiker zouden gegaran-
deerd schone tankwagens (of pijpleidingen) gebruikt moeten worden, en dat is een risicofactor.

Er zijn ook combinaties mogelijk, bijvoorbeeld tijdelijke opslag op de plaats van productie en
daarna verdere opslag bij de gebruiker. Voor en na opslag moet er hoe dan ook transport
plaatsvinden, waarbij zowel aan transport per as als aan leidingen gedacht kan worden.



Benodigde logistiek bij gebruik van urine als meststof

03/4428
Pagina 34 van 75


7.3 InzameIing en opsIag van urine op de pIaats van productie
Urine komt vrij in de bebouwde omgeving en wordt tijdelijk op gebouw- of wijkniveau op-
geslagen in speciale tanks. Vanuit deze tanks wordt de urine in de tot dusver gerealiseerde
projecten getransporteerd naar de plaats van gebruik of verwerking met tankwagens. Hoewel
het slechts om kleine hoeveelheden gaat (minder dan 1% van de totale stroom stedelijk afval-
water) blijkt transport van urine met een pijpleiding over langere afstanden lastig. De reden
hiervoor is de vorming van zoutafzettingen (urinesteen) in de leidingen waardoor verstoppingen
kunnen optreden.

De meeste praktische ervaring met de inzameling van urine in wijken is opgedaan in Zweden.
Figuur 1 geeft als voorbeeld een ontwerpschema van de wijk Palsternackan in Stockholm
waarbij de urine tijdelijk wordt opgeslagen in tanks van 30 m
3
.
De Zweedse ervaringen leren dat stilstand van urine in leidingen zoveel mogelijk voorkomen
moet worden om verstoppingen te voorkomen. Voor vrij-vervalleidingen binnen woonwijken
adviseert Stockholm Vatten om te werken met een hellingshoek van tenminste 1% en een
leidingdiameter van minimaal 75 mm (Stockholm Vatten, 2001).


Figuur 1. Toepassing van urinescheiding in een appartementencomplex in Stockholm, Zweden, waarbij de urine wordt
opgeslagen in tanks van 30 m
3


Ìn het vlakke Nederland betekent een hellingshoek van 1% een beperking van de transportaf-
stand, aangezien de leidingen per 100 m een meter dieper uitkomen.
Als de opslagtanks ondergronds gebouwd worden is de maximale leidinglengte hierdoor enkele
honderden meters.

Uit verschillende haalbaarheidsstudies (o.a. Roorda et al, 2008) blijkt dat de opslagtanks sterk
kostenbepalend zijn voor de invoering van No Mix technologie. Ìn dichtbevolkte wijken is daar-
door de introductie van gescheiden inzameling van urine goedkoper omdat relatief meer
bewoners zijn aangesloten op één opslagtank. Het leeghalen van de tanks kan vergemakkelijkt
kunnen worden door het strategisch plaatsen van tussenopslagtanks langs doorgaande wegen,
zodat tankwagens niet de wijk in hoeven. Dit vermindert ook de overlast voor bewoners. Naast
opslag op wijkniveau zouden er ook bij grotere producenten (zoals grote instellingen of kantoor-
complexen) opslagtanks geplaatst kunnen worden.



Benodigde logistiek bij gebruik van urine als meststof

03/4428
Pagina 35 van 75




7.4 Transport van tussenopsIag naar eindgebruiker Transport per as
Vanuit de opslagtanks op wijkniveau moet de urine vervoerd worden naar de eindgebruikers
(landbouwbedrijven). De meest toegepaste vorm van transport is de afvoer per as.
Hiertoe worden de opslagtanks enkele malen per jaar geleegd met behulp van een tankwagen
of riolenzuiger. Deze hebben een capaciteit van 6 tot maximaal 30 m
3
.

7.5 Concentreren of precipiteren voorafgaand aan transport per as
Het wegtransport van relatief grote hoeveelheden urine (ten opzichte van de hoeveelheden
nutriënten die vervoerd worden) is een belangrijk nadeel van gescheiden inzameling. Om het
volume te verminderen zijn er verschillende technieken voor concentrering van de urine ontwik-
keld of in onderzoek. Tabel 1 geeft hiervan een overzicht.
Het indampen onder vacuüm is hierbij de verst ontwikkelde techniek en wordt in de ruimtevaart
toegepast. Het kan in principe op kleine schaal worden toegepast, bijvoorbeeld bij een opslag-
tank voor urine. Het energiegebruik van 400 MJ per m
3
is relatief gering.

Een nieuwe systeem met potentieel is het 'Urea Harvesting Device' dat ontwikkeld door de
firma Zonnewater en LeAF. Dit apparaat concentreert urine door gebruik te maken van afval-
ventilatie-warmte. Het is met name geschikt voor kantoorgebouwen. Door de urine over een
dragermateriaal te leiden terwijl er gelijktijdig ventilatielucht van het kantoor door wordt geleid,
kan de urine tegen een minimaal energiegebruik geconcentreerd worden. Binnenkort start een
R&D project met co-financiering van STOWA om dit systeem verder te ontwikkelen.

Een andere mogelijkheid om te komen tot een geconcentreerde meststof op basis van urine is
het uit laten vlokken van fosfaat en ammonium (gedeeltelijk). Hiertoe wordt magnesiumoxide
(MgO) aan de urine toegevoegd. Om ook al het ammonium uit de urine te precipiteren moet
extra fosfaat worden toegevoegd. Ook precipitatie kan in op decentrale schaal worden uitge-
voerd.
Tabel 1. Methoden voor concentrering van urine
Status
Volume na be-
handeling
(% van invoer)
Energieverbruik
(MJ/m
3
)
Ref.
Ìndampen onder vacuüm Bewezen techniek 5% 400
Uitvriezen Laboratoriumstudies 25% 1100
Omgekeerde osmose Laboratoriumstudies 20% bij 50 bar 1300
Maurer et
al., 2006
Urea harvesting device
(indampen met afvalven-
tilatiewarmte)
Laboratoriumstudies,
prototypeontwikke-
ling
< 10% gering
Zonne-
water
Precipitatie met MgO tot
struviet (Mg-NH-PO
4
)
Bewezen techniek nvt gering

7.6 Transport per Ieiding
Een logisch alternatief voor transport per as zou zijn om de verschillende tanks met leidingen te
verbinden en de urine periodiek naar een centrale opslag dichtbij de eindgebruikers te transpor-
teren. Ìn Zwitserland is daartoe een inzamelingsmethode voorgesteld gebaseerd op vrij verval
door gebruik te maken van de bestaande riolering (Larsen & Gujer, 1996). Ìdee is hierbij dat
gedurende de nacht wanneer er weinig afvalwater doorheen stroomt het riool wordt gebruikt
voor de opgeslagen urine. Door een kleppensysteem met tijdsschakeling worden de opslag-
tanks geopend en stroom de urine het riool in. Door de hoogteverschillen in Zwitserland kan de
urine snel op het eindpunt arriveren. Door het geringe verval in Nederland en de al eerder ge-
noemde problemen met afzettingen is deze aanpak voor Nederland geen optie.
Een mogelijk alternatief is het gebruik van persleidingen waarmee de opslagtanks eens per
tijdsperiode leeggepompt worden. Doordat deze leidingen maar voor korte tijd gevuld zijn met
urine is de afzetting waarschijnlijk gering.
Er zou gebruik gemaakt kunnen worden van bestaande persleidingen voor rioolwater waarbij
door een kleppensysteem het rioolwater voor korte tijd wordt afgekoppeld (en opgeslagen).
Benodigde logistiek bij gebruik van urine als meststof

03/4428
Pagina 36 van 75


Eventuele microbiële besmetting van de urine met resten rioolwater vormt geen probleem aan-
gezien er daarna 6 maanden opslag bij de eindgebruiker plaatsvindt. Als (duurder) alternatief
zouden er nieuwe persleidingen speciaal voor urine aangelegd kunnen worden. Het transport
van urine met persleidingen is tot dusver nooit onderzocht en een meer gedetailleerde evaluatie
is nodig.

7.7 Preventie van scaIing in Ieidingsystemen
Deze paragraaf gaat in op de vraag of scaling in de leidingsystemen voor afvoer van urine op-
gelost of voorkomen kan worden. Er zijn hiertoe verschillende methoden denkbaar:

Chemische en mechanische anti-scaling
Ìn industriële installaties wordt scaling vaak beperkt door het gebruik van chemische anti-
scaling methoden. Onder deze methoden vallen bijvoorbeeld het periodiek schoonmaken van
de leiding met sterk zuur, of het gebruik van chemicaliën die zouten in oplossing houden (bij-
voorbeeld EDTA).
Chemische anti-scaling is in principe eenvoudig toe te passen, maar produceert wel een afval-
stroom. Mechanische methoden, zoals het injecteren van water met een schuurmiddel onder
hoge druk, het toepassen van vibraties op de leidingen of het wegboren van de neerslag, zijn
moeilijker toe te passen in leidingnetwerken.

7.8 OppervIakte-eigenschappen van de Ieiding
Hoe gladder het oppervlak van de leiding, en hoe meer waterafstotend, hoe minder neerslag
zich kan vormen. Door leidingen een perfect gladde, waterafstotende binnenkant te geven, kan
scaling voorkomen worden. Hiertoe kan de binnenkant van de leiding bekleed worden met glas,
teflon, of een ander polymeer. Een ander interessante mogelijkheid is de toepassing van het
zogenaamde ¨lotus-effect¨. De bladeren van de lotus zijn zo waterafstotend dat geen enkele
waterbevattende vloeistof er grip op krijgt (zie Figuur 2). Dit effect wordt veroorzaakt door de
structuur van het bladoppervlak, dat bestaat uit vele waterafstotende bultjes van 5-10 ȝm hoog.
Verschillende bedrijven hebben producten ontwikkeld die het Lotuseffect nabootsen om zo zelf-
reinigende oppervlakken te maken (Gould 2003). Ìnmiddels zijn er bijvoorbeeld verschillende
zelfreinigende coatings op de markt, die bijvoorbeeld gebruikt worden voor het schilderen van
buitenmuren. Een praktisch toepasbaar product voor leidingen zou een interessante optie
kunnen zijn om scaling te voorkomen.

Figuur 2. Ìmpressie van waterdruppels op een lotusblad (Wikipedia)
Benodigde logistiek bij gebruik van urine als meststof

03/4428
Pagina 37 van 75



7.9 Transportafstand en energievraag
Een belangrijke vraag is hoe de energiebelasting bij de vervanging van kunstmest door urine
uitpakt als ook het energiegebruik voor transport wordt meegenomen. Om de stikstof uit 1 ton
van de kunstmestsoort NP26-14 te vervangen is ongeveer 40 m
3
urine nodig. Uitgaande van
een energieverbruik van ongeveer 50 MJ per kg N voor de productie van stikstofkunstmest
(Liska et al., 2008) en een verbruik van 0,65 MJ per ton-km voor wegtransport, werd de trans-
portafstand berekend waarbij het energieverbruik van de productie van 1 ton NP26-14 gelijk is
aan de transportenergie voor de hoeveelheid urine die de stikstof daarin kan vervangen.
Ìn onderstaande grafiek is deze relatie weergegeven. Het omslagpunt ligt in deze berekening bij
500 km. Binnen Nederland weegt het vervoer van urine dus op tegen de uitgespaarde energie
voor kunstmestproductie, ondanks dat het aantal transportbewegingen toeneemt. Er is nog
enige discussie over de gebruikte berekening van het omslagpunt van de transportafstand. Dit
behoeft nog nadere uitwerking.



Figuur 3. Energieverbruik voor de productie van 1 ton NP26-14 kunstmest en transportenergie voor ver-
voer van vervangende urine (berekend op N-basis).

7.10 Andere miIieuaspecten van opsIag en transport
De positieve milieueffecten van de toepassing van No Mix technologie en gebruik van urine als
meststof zijn gerelateerd aan de vermeden hoeveelheden kunstmest en de lagere stikstofbelas-
ting van rwzi's. Gescheiden inzameling van urine leidt tot:
• Verminderd energieverbruik voor de productie van kunstmest.
• Minder uitputting van fosfaaterts.
• Rwzi's kunnen kleiner gedimensioneerd worden / bestaande rwzi's hoeven niet of minder
uitgebreid te worden.
• Rwzi's gebruiken minder energie.

Benodigde logistiek bij gebruik van urine als meststof

03/4428
Pagina 38 van 75


Er zijn ook negatieve milieueffecten die zijn gerelateerd aan extra materialengebruik voor de
infrastructuur van inzameling en opslag, en voor transport:
• Bij de bouw van opslagtanks en leidingen in de bebouwde omgeving worden extra
materialen en energie gebruikt die in de bestaande situatie niet nodig zijn.
• Om dezelfde hoeveelheid stikstof op het land te krijgen is een veel groter volume urine
nodig dan kunstmest, en zullen er dus (zeker bij transport van onbehandelde urine) veel
meer transport-bewegingen nodig.
• Door concentrering kan het aantal transportbewegingen worden verminderd, maar er zal
nog steeds transport zijn in vergelijking met kunstmest.
• Transport in persleidingen zal gunstiger uit kunnen vallen dan transpor per as, zeker als
bestaande leidingen benut kunnen worden. Hierbij zijn wel opslagtanks nodig, en ook de
aanleg van de leidingen kost materialen en energie.

7.11 Kansen, uitdagingen en aanknopingspunten
Het transport van urine van het punt van opslag naar de eindgebruikers (landbouw) is nog een
relatief onontgonnen gebied. De meest beproefde methode is vooralsnog tanktransport van de
urine. De maximale transportafstand waarbij het energie voor transport gelijk is aan de
bespaarde energie tijdens de productie van kunstmest ligt op ongeveer 500 km. Er is nog enige
discussie over de gebruikte berekening van het omslagpunt van de transportafstand.
Dit behoeft nog nadere uitwerking.

Door het concentreren van urine kan aanzienlijk op transportenergie bespaard worden.
Ìndampen onder vacuüm is daarbij een beproefde techniek die relatief weinig energie vergt.
Een nieuwe veel-belovende techniek is het Urea Harvesting Device dat gebruik maakt van af-
valventilatiewarmte en dat een zeer gering energiegebruik heeft.

Als alternatief voor wegtransport vormt het transport per persleiding een interessant alternatief.
Het meest optimaal hierbij zou zijn om gebruik te maken van bestaande persleidingen en deze
eens per tijdsperiode te gebruiken voor urine. Ìn hoeverre dit technisch mogelijk is zal verder
verkend moeten worden. Ìn het Westland is al wel een soortgelijke methode in de praktijk toe-
gepast, waarbij het afvalwater van tuinders tijdelijk wordt opgeslagen om dan vervolgens tijdens
de nacht via het bestaande persleidingstelsel te worden afgevoerd.

7.12 Gebruikte Iiteratuur
Gould, L (2003) Smart, clean surfaces. Materials Today 6(11): 44-48

Höglund C., Stenstrom T.A., Jonsson H., Sundin A. (1998) Evaluation of faecal contamination
and microbial die-off in urine separating sewage systems. Water Science and Technology
38(6): 17-25(9)

Larsen, T.A., Gujer W. (1996) Separate management of anthropogenic nutrient solutions
(human urine). Water Science and Technology 34(3-4): 87-94

Liska, A.J., H.S. Yang, V. Bremer, D.T. Walters, G. Erickson, T. Klopfenstein, D. Kenney, P.
Tracy, R. Koelsch, K.G. Cassman. 2008. BESS: Biofuel Energy Systems Simulator; Life-Cycle
Energy and Emissions Analysis Model for Corn-Ethanol Biofuel. vers.2008.3.0.
www.bess.unl.edu. University of Nebraska-Lincoln.

Maurer, M, Pronk W., Larsen T.A. (2006) Treatment processes for source-separated urine.
Water Research 40(17): 3151-3166

Roorda, J.H. , E. Koetse, M. Kunst, A. Buunen-van Bergen, A. Mels, P. Piekema, R. Neef
(2008). Modern sanitation for the developed world: an example for new areas. Proceedings of
Conference 'the Sanitation Challenge', 19-20 mei.

Stockholm Vatten (2001). Urine separation ÷ closing the water cycle.


03/4428
Pagina 39 van 75


8 Kosten en baten van gescheiden inzame-
ling van urine in het licht van gebruik in
de landbouw
JeIIe Roorda
Grontmij
De BiIt
Juni 2008

8.1 Urinescheiding in NederIand en daarbuiten
De gescheiden inzameling van urine in plaats van de urine samen met feces, spoelwater en
ander afvalwater uit huishoudens in te zamelen, is een ontwikkeling die in Nederland pas sinds
2005 wordt onderzocht en sporadisch is toegepast. De projecten in Nederland variëren van
kleinschalige projecten, waarbij slechts enkele speciale urinescheidingstoiletten zijn geïnstal-
leerd, tot projecten op iets grotere schaal waarbij tot 120 toiletten zullen worden geïnstalleerd.
De eerste ervaring op de wat grotere schaal zal eind 2009 zijn opgedaan, in onder andere een
scholengemeenschap (Windesheim in Zwolle, met ruim 120 toiletten), een waterschapskantoor
(Waterschap Rijn&ÌJssel met 29 toiletten) en bijvoorbeeld in een ziekenhuis (Maasziekenhuis in
Boxmeer met circa 50 toiletten). Anno 2008 zijn er in Nederland op wijkniveau nog geen urine-
scheidingstoiletten geplaatst. Buiten Nederland is wel meer ervaring opgedaan, maar ook daar-
bij is de schaalgrootte beperkt. Een overzicht van enkele buitenlandse initiatieven is weergege-
ven in Bijlage 1.

Een opvallende omissie in de uitgevoerde studies is een goede kosten-baten analyse van de
gescheiden inzameling en verwerking van urine op grotere schaal. Dergelijke analyses zijn
buiten Nederland ook slechts in beperkte mate uitgevoerd en moeilijk te relateren aan de
Nederlandse situatie. Ìn enkele gevallen is in Nederland een meer uitgebreide analyse uit-
gevoerd, bijvoorbeeld rond de rwzi Hardenberg en rwzi de Grootte Lucht te Vlaardingen (STO-
WA, 2002), rond nieuwe woonkernen rond Meppel en een recreatiepark (Grontmij, 2005) en
tenslotte voor nieuwbouwwijken in het beheersgebied van Waternet (Grontmij/LeAF, 2007 en
2008). Ìn de meer recente studies is veel aandacht besteed aan mogelijkheden om een afval-
watersysteem gebaseerd op urinescheiding qua kosten en energie te optimaliseren. De getallen
die in deze bijdrage genoemd worden voor kosten en baten zijn gebaseerd op genoemde
studies, met name die voor Waternet (Roorda et al., 2008).

8.2 Kosten voor inzameIing van urine
De inzameling van urine in huishoudens vindt plaats middels apart daarvoor ontwikkelde
toiletten. Een voorbeeld van een viertal van dergelijke toiletten is in onderstaande figuur weer-
gegeven. De toiletten wijken qua vorm slechts in beperkte mate af van een conventioneel toilet,
zoals iedereen die thuis gebruikt. Het opvallende verschil is een apart compartiment voor in-
zameling van de urine. De kosten voor een dergelijk toilet zijn gemiddeld C300-500 hoger dan
voor een gewoon, conventioneel toilet, inclusief de extra kosten voor installatie (extra leiding
voor transport van urine uit het gebouw). Daarnaast worden kosten gemaakt voor transport en
verwerking van de urine.

Kosten en baten van gescheiden inzameling van urine in het licht van gebruik in de landbouw

03/4428
Pagina 40 van 75



Figuur 1. Verschillende soorten toiletten voor urinescheiding

De financiële baten zijn opgebouwd uit besparing op de rwzi (uitgaande van een 'groene weide'
situatie waarbij een nieuwe rwzi gebouwd zou moeten worden), energiebesparing (door minder
beluchting op de rwzi en verlaging drinkwaterverbruik) en een lager verbruik van drinkwater.
De laatste bepaald voor meer dan 65% de kostenbesparing. De netto kosten komen uit op een
bedrag in de ordegrootte van C 50,00 per inwoner per jaar voor minder intensief bebouwde
gebieden en minimaal C 5,00 per inwoner per jaar voor gecentraliseerde en dichtbevolkte
gebieden met hoogbouw. Per inwoner wordt per jaar ongeveer 2,5 kg N en 0,27 kg P via de
urine uitgescheiden (uitgaande van ongeveer 2,5 liter ingezamelde urine+spoelwater per
persoon per dag met daarin 3 g N en 0,3 g P per liter; het inzamelingsrendement is 85%). Op
basis van de kosten en baten voor inzameling van urine komen daarmee de kosten uit op C2-
C20 per kg N.

De kosten voor het zuiveren van urine ten behoeve van verder gebruik, bedragen naar schat-
ting ongeveer C 2,00 per m³ urine per jaar, bij een installatie met een schaalgrootte van 1 m³/h
of groter. Bij kleinere installaties nemen de kosten substantieel toe, onder andere door hoge
kosten voor onderhoud. Afhankelijk van de soort benodigde zuiveringsstappen, kunnen de
kosten variëren tussen de C 1,00 en C 5,00 per m³ urine.

8.3 Baten van gescheiden inzameIing van urine
Naast de genoemde financiële baten in de bovenstaande paragraaf is het goed om verschillen-
de andere baten ook de revu te laten passeren. Allereerst het verminderde drinkwaterverbruik
door gescheiden inzameling van urine. Ìn bestaande toiletten voor urinescheiding is veel minder
(drink)water nodig voor het spoelen van de toiletten. Bij gebruik van urinoirs kunnen zelfs water-
loze of waterarme urinoirs worden toegepast. Het vermeden drinkwaterverbruik wordt geschat
op ongeveer 20 liter per persoon per dag (per dag 15 liter spoelvolume in plaats van 35 liter
spoelvolume in conventionele toiletten), dit komt neer op ongeveer 7 m³ vermeden drinkwater-
verbruik per persoon per jaar. Op jaarbasis wordt gemiddeld per persoon 50 m³ verbruikt, door
urinescheiding kan dit dus met 15% verlaagd worden.

Naast een kostenvoordeel (bij C1,5 per m³ drinkwater is dit per persoon al C10,50 per jaar),
levert dit indirect ook een belangrijke energiewinst op. Voor productie en transport geldt een
totaal energieverbruik van 0,5 tot 0,75 kWh/m³ drinkwater, waardoor elke besparing in de drink-
waterverbruik energiewinst oplevert.

Het energieverbruik wordt verder verlaagd doordat bij aparte behandeling van de urine de vuil-
vracht van deze urine ook niet op de rwzi hoeft te worden behandeld. Daardoor is er minder
energie nodig voor beluchting van de rwzi's ten behoeve van nitrificatie van ammonium.
Voor aparte behandeling van urine is ook energie nodig, maar deze is maximaal 50% van de
benodigde energie op de rwzi. Ook voor transport van de urine per as is energie nodig, maar
netto blijkt dat de energiebalans positief uit pakt en gescheiden inzameling en behandeling van
urine in een lager energieverbruik resulteert dan conventionele systemen.

Als urine als kunstmestvervanger kan worden toegepast bedragen de vermeden kosten voor
kunstmest, omgerekend naar baten per urine van één persoon per jaar circa C10,00 (op basis
van struviet precipitatie).

Kosten en baten van gescheiden inzameling van urine in het licht van gebruik in de landbouw

03/4428
Pagina 41 van 75


Tenslotte kan de gescheiden inzameling van urine, bij nuttig hergebruik als kunstmestvervan-
ger, een belangrijk onderdeel vormen in een cradle-to-cradle benadering. Ìn de huidige situatie
wordt urine (samen met de feces en ander afvalwater) gezien als afval. Ìn het hier beschreven
systeem wordt afval weer voedsel en kan een kringloop gesloten worden.

8.4 Factoren die kosten beïnvIoeden
Tussen de regels door zijn al een aantal factoren die de kosten (en de baten) van systemen
voor gescheiden inzameling en behandeling en gebruik van urine beïnvloeden. Hieronder zijn
deze nogmaals kort samengevat:
• Aantal inwoners per hectare; hoe groter de bebouwingsdichtheid, hoe lager de meerkosten
per inwoner; dit effect wordt vooral veroorzaakt door kortere transportleidingen.
• Schaalgrootte; urinescheiding kan pas iets opleveren als de schaalgrootte voldoende is. Met
name de verwerking en bewerking is pas financieel aantrekkelijk bij debieten vanaf 0,5-1
m³/h, oftewel urine van 5.000 - 10.000 personen.
• Verwerking, opwerking, bewerking van urine (voor toepassing inde landbouw) moet zo dicht
mogelijk worden uitgevoerd nabij de locatie waar urine ingezameld. Transport per as is erg
kostbaar en energieverspillend. Als bijvoorbeeld gedacht wordt aan een vorm van op-
concentreren, is het volume van het eindproduct al veel kleiner en hoeft minder getranspor-
teerd te worden.
• Op het moment dat andere factoren er voor zorgen dat wordt overgegaan wordt op geschei-
den inzameling van urine, kan de urine wellicht kosteloos worden afgenomen. Ìn een der-
gelijk geval hoeven alleen kosten voor verwerking te worden gemaakt en kan urine als mest-
stof financieel ook gemakkelijker concurrerend worden voor kunstmest.

8.5 Kansen en uitdagingen
Tenslotte, waar liggen nu de kansen in Nederland? De ervaring met urinescheiding in Neder-
land is (zeer) beperkt. Pas bij grootschalige implementatie kan ook toepassing van urine in de
landbouw als volwaardig alternatief voor kunstmest worden uitgewerkt. De details van de hier
geschetste aspecten zullen pas bij realisatie volledig kunnen worden berekend en verder uitge-
werkt.

Ook de kosten voor sanitair (de toiletten) zullen bij grootschaliger implementatie kunnen dalen,
daarmee worden de meerkosten per woning/kantoor al snel beperkt en zal implementatie niet
meer geremd worden door te hoge kosten.

Als urine als volwaardige grondstof voor of alternatief voor kunstmest kan worden toegepast, is
het mogelijk om het kunstmestverbruik te verlagen en daarmee een extra positief argument
voor urinescheiding. Het is nodig dat daarvoor praktijkproeven worden uitgevoerd en de
discussie met de wetgever wordt aangegaan. Hiervoor zijn koplopers nodig die de nek boven
het maaiveld durven uit te steken.

Een belangrijke mogelijkheid die in dit stuk niet verder naar voren is gekomen, is de gecombi-
neerde verwerking van (natte) dierlijke meststromen met menselijke urine. Qua samenstelling
lijken deze stromen erg op elkaar. De dierlijke meststromen zijn in een overschot aanwezig in
Nederland en vragen om behandelingsmogelijkheden. Ìn één project in Noord-Brabant (SOUR-
CE) wordt door Waterschap Aa en Maas samen met de sector deze optie verder uitgewerkt en
lijkt vooralsnog kansrijk. Het eindproduct kan weer ingezet worden als alternatief voor kunst-
mest. Dergelijke initiatieven en oplossingsrichtingen moeten voor urine verder worden uitge-
werkt.

8.6 Literatuur
Grontmij (2005). Effect urinescheiding op afvalwaterzuivering in de toekomst; Gericht op het
beheersgebied van waterschap Reest en Wieden.
Grontmij/LeAF (2007). Nieuwe sanitatiesystemen voor de Bloemendalerpolder; Uitkomsten van
analyse
Grontmij/LeAF (2008). Afvalwatersysteem ÌJburg 2e Fase; Mogelijkheden voor moderne
sanitatie
Roorda, J.H., Koetse, E., Kunst, J.M., Buunen-van Bergen, A.H.M., Mels, A.R., Bisschops,
Ì.A.E., Piekema, P., Neef, R.(2008). Modern sanitation for the developed world: an example for
Kosten en baten van gescheiden inzameling van urine in het licht van gebruik in de landbouw

03/4428
Pagina 42 van 75


new areas. Proceedings Sanitation Challenge May 19-21 2008, Wageningen; Theme 1 ÷ Inno-
vation management in sanitation÷ Cases; no. 98a
STOWA (2002). Separate urine collection and treatment ÷ options for sustainable wastewater
systems and mineral recovery. STOWA 2001-39, Utrecht, november 2002.




8.7 BijIage 1


Project: GTZ hoofdkantoor
Land: Duitsland
Sinds: 2005
Omvang: voor het kantoor met 300 me-
dewerkers zijn 56 scheidingstoiletten en
25 watervrije urinoirs geplaatst.


Project: SolarCity, Linz
Land: Oostenrijk
Sinds: 2004
Omvang: 88 appartementen en een
school zijn voorzien van scheidingstoilet-
ten.

Project: Kullön village
Land: Zweden
Sinds: 2002
Omvang: 250 woningen zijn voorzien van
scheidingstoiletten
Kosten en baten van gescheiden inzameling van urine in het licht van gebruik in de landbouw

03/4428
Pagina 43 van 75



Project: Gebers Housing Project
Land: Zweden
Sinds: 1998
Omvang: 32 flatwoningen zijn voorzien
van scheidingstoiletten

Project: Palsternackan
Land: Zweden
Sinds: 1996
Omvang: 51 appartementen zijn voorzien
van scheidingstoiletten

Project: Ekoporten Norrköping
Land: Zweden
Sinds: 1996
Omvang: 18 appartementen zijn voorzien
van scheidingstoiletten

Project:Understenshöjden
Land: Zweden
Sinds: 1995
Omvang: 44 appartementen zijn voorzien
van scheidingstoiletten





03/4428
Pagina 44 van 75


9 Maatschappelijke acceptatie van het ge-
bruik van menselijke urine als meststof in
de landbouw
Adriaan MeIs,
LeAF en Wageningen Universiteit
Wageningen
Juni 2008

9.1 Achtergrond
Een nieuwe ontwikkeling in Nederland is 'het Nieuwe Plassen' waarbij urine gescheiden wordt
ingezameld door de toepassing van speciale toiletten of urinoirs. Veel waterschappen hebben
interesse in het Nieuwe Plassen omdat deze aanpak de emissies van probleemstoffen (nutriën-
ten, medicijnresten, hormonen) naar het oppervlaktewater aanzienlijk kan reduceren. Een ander
voordeel van urinescheiding is dat er veel energie bespaard kan worden op rioolwater-
zuiveringsinstallaties. Daarnaast blijkt ook dat No Mix toiletten gebruikers bewuster maakt van
de afvalwaterketen. Dit is iets wat goed past bij de beleidsvoornemens van de Europese Kader-
richtlijn Water.

De gescheiden ingezamelde urine kan gebruikt worden als meststof omdat deze zoveel stikstof,
fosfaat en kalium bevat. Hierdoor kan bespaard worden op kunstmest. Dit is in het bijzonder
interessant voor het mineraal fosfaat, omdat dit een eindige grondstof is waarvan de voorraden
sterk aan het slinken zijn. Verder wordt er indirect energie bespaard voor de productie van
kunstmest.

Urine kan direct worden toegepast. Uit onderzoek blijkt dat urine een relatief schone meststof is
en er verhoudingsgewijs aanzienlijk minder zware metalen op bouwland gebracht worden in
vergelijking met kunstmest en dierlijke meststoffen. Ìn Nederland moet voor de toepassing van
urine als meststof toestemming van het lokaal bevoegd gezag aangevraagd worden omdat
urine niet op de officiële lijst van toegelaten meststoffen staat.

Urine kan ook indirect worden toegepast. Er lopen diverse R&D trajecten om urine op te werken
tot kunstmest (struviet). Dit reduceert de transportkosten en is aantrekkelijk voor boeren omdat
zij met een handiger product kunnen werken.

9.2 Inhoud en doeI
Dit essay gaat in op de kwestie in hoeverre en onder welke voorwaarden de 'maatschappij' het
gebruik van menselijke urine als meststof in de landbouw accepteert. Het essay behandelt
daarbij voornamelijk de vraag óf en onder welke voorwaarden consumenten landbouwproduc-
ten willen kopen die bemest zijn met urine én of boeren urine als meststof accepteren.
Er is gebruik gemaakt van gegevens uit Zwitserland en Zweden. Daarnaast is speciaal voor het
essay een enquête gehouden. Op basis van de gegevens is een aantal denklijnen rond de
introductie van urine als landbouwkundige meststof uitgewerkt.

Het essay maakt deel uit van een reeks die bedoeld is om de marktpotenties voor menselijke
urine en daarvan afgeleide producten voor de landbouw in Friesland in beeld te brengen. Ìn de
reeks wordt een aantal relevante vragen uitgewerkt en beantwoord. Het project wordt begeleid
door een expertgroup bestaande uit vertegenwoordigers van provincie Fryslân, Wetterskip Frys-
lân, Wetsus, LTO-noord, WUR/Alterra, Grontmij en van Hall.
Maatschappelijke acceptatie van het gebruik van menselijke urine als meststof in de landbouw

03/4428
Pagina 45 van 75


9.3 Acceptatie van urinebemesting door consumenten
9.3.1 Zwitserland
Het Zwitsers instituut EAWAG heeft veel onderzoek gedaan naar de acceptatie van No Mix
technologie in Zwitserland en Duitsland en het gebruik van urine als meststof. Eén onderzoek
betrof een 'focus groep' studie waaraan 44 mensen deelnamen. Focus groepen zijn kleine
groepen geïnformeerde vrijwilligers die door interviews en groepsgesprekken worden gevraagd
naar hun mening over bepaalde nieuwe ontwikkelingen. De vrijwilligers in het Zwitserse onder-
zoek werden voorafgaand aan de vragen geïnformeerd over No Mix technologie door middel
van een interactief softwareprogramma en een bezoek aan een scheidingstoilet.

Het overgrote deel van de deelnemers uit de focusstudie stond positief tegenover No Mix tech-
nologie Meer dan 80% was bereid om in een appartement met urinescheidingstoiletten te gaan
wonen en 73% was bereid om met urine bemest voedsel te kopen. Tegelijkertijd bleek dat het
overgrote gedeelte van de ondervraagden niet bereid was extra kosten of inspanningen te
leveren. Ook was er terughoudendheid en zorg betreffende de aanwezigheid van hormonen en
medicijnresten in urine en de mogelijke effecten ervan op de gezondheid.
73%
51%
84%
79%
4%
5%
2%
14%
23%
44%
14%
7%
0% 20% 40% 60% 80% 100%
Zou u voedsel kopen dat is
bemest met urine?
Zou u een No Mix toilet kopen?
Zou u in een appartement gaan
wonen met een No Mix toilet?
Spreekt het idee van het No
Mix toilet u aan?

1 Acceptatie van No Mix toiletten en urinebemesting door 44 ondervraagden in Zwitserland (Pahl Wostl
et al, 2003). Groen: ja; geel: weet niet / geen mening; rood: nee.

Ìn een tweede onderzoek van EAWAG werd een enquête gehouden onder 501 bezoekers van
een bibliotheek in Liestal. Alle Wc's in deze bibliotheek zijn vervangen door No Mix toiletten.
Tweederde van de ondervraagden bleek positief te staan tegenover urinebemesting. Deze
groep was bereid om voedsel te kopen dat geteeld is met een op urine gebaseerde meststof.
De overige ondervraagden waren tegen het gebruik van urine als meststof, met als motivatie de
aanwezigheid van medicijnresten en / of pathogenen en gevoeligsmatige weerzin.

Uit een derde onderzoek van EAWAG wordt duidelijk hoe belangrijk het is dat gebruikers en
consumenten geïnformeerd zijn over de achtergronden van No Mix technologie. Ìn een enquête
onder 480 personen van een technische school en Eawag (beide deels uitgerust met No Mix
toiletten) werd gevraagd ¨Spreekt het idee van het No Mix toilet u aan¨. Vervolgens werd ge-
vraagd of zij de bijbehorende informatie gelezen hadden. De personen die de informatie hadden
gelezen waren duidelijk een stuk positiever over het No Mix toilet. Helaas is dit onderzoek niet
gevraagd of men ook bereid zou zijn om voedsel geteeld met een op urine gebaseerde meststof
te kopen.
Spreekt het idee van het No Mix toiIet u aan?
74%
41% 41%
10%
18%
16%
0% 20% 40% 60% 80% 100%
Ìnformatie wel gelezen
Ìnformatie niet gelezen

2 Correlatie tussen de acceptatie van No Mix toiletten en hoe geïnformeerd gebruikers zijn over No Mix
technology (Lienert en Larsen, 2006). 480 respondenten van een technische school en Eawag werd ook ge-
vraagd of zij de informatie gelezen hadden. Groen: ja; geel: weet niet / geen mening; rood: nee.
Maatschappelijke acceptatie van het gebruik van menselijke urine als meststof in de landbouw

03/4428
Pagina 46 van 75



9.3.2 Nederland
Ìn Nederland is tot dusver geen onderzoek gepubliceerd naar de acceptatie van urinebemesting
door consumenten. Daarom heeft de auteur van dit essay een onderzoek gedaan in zijn eigen
sociale omgeving (familie, vrienden, bekenden ÷ maar geen mensen die beroepsmatig met het
onderwerp bezig zijn). Hierbij werd gevraagd eerst een informatieblad over het Nieuwe Plassen
te lezen (zie Bijlage 1) en vervolgens de vragenlijst in te vullen (zie Bijlage 2).
Ìn totaal is de enquête aan 16 mensen voorgelegd in de leeftijd van 29 tot 63 jaar.
Van de ondervraagden was 63% vrouw en 37% man.

Op de vraag, ¨zou u landbouwproducten consumeren (kopen én nuttigen) die met urine zijn
verbouwd?¨ antwoordden alle 16 respondenten positief.

Ìn twee vervolgvragen werd meer specifiek gevraagd welke producten men bereid zou zijn te
consumeren bij directe bemesting met urine en welke producten bij gebruik van een uit urine
geproduceerde kunstmest. De voorgelegde producten waren sla, brood, appels, biodiesel en
groene stroom. De resultaten van beide vragen zijn weergegeven in figuur 3. Het grootste deel
van de respondenten vond zowel het directe als indirecte (via kunstmest) gebruik van urine
acceptabel voor alle producten. Wel bleek er een iets lagere acceptatiegraad te zijn voor de
consumptie van voedselproducten (sla, brood, appels) bij direct gebruik van urine (70-90%) in
vergelijking met indirect gebruik (90-100%. Tegen directe of indirecte bemesting van niet-
voedselproducten (biodiesel en groene stroom) had niemand bezwaar.
Acceptatie bij directe bemesting met urine
0%
10%
20%
30%
40%
50%
60%
70%
80%
90%
100%
Sla Brood Appels Biodiesel Groene
stroom

Acceptatie bij urine-gebaseerde kunstmest
0%
10%
20%
30%
40%
50%
60%
70%
80%
90%
100%
Sla Brood Appels Biodiesel Groene
stroom

3 Positieve reactie op de vraag: ¨zou u de volgende producten consumeren als u zeker weet dat dit
geen enkel schadelijk effect heeft op het product of uw gezondheid?¨ door 16 bekenden van de auteur van dit
essay

De laatste vraag was ¨Verwacht u dat het No Mix technologie een goede toekomst heeft?
Waarom?¨. De meeste mensen (11) beantwoordden deze vraag positief, maar meestal met een
kanttekening. Opvallend vaak werd genoemd dat de producten (en soms ook het toilet) niet
duurder mogen zijn dan vergelijkbare 'gewone' producten (7 respondenten). Verder werden een
goede voorlichting genoemd als randvoorwaarde (2). Enkele respondenten gaven aan te
twijfelen of No Mix technologie succesvol kan worden ingevoerd.
Maatschappelijke acceptatie van het gebruik van menselijke urine als meststof in de landbouw

03/4428
Pagina 47 van 75


Als barrières werden aangevoerd: het bestaande mestoverschot in Nederland, perceptie van
menselijke urine (¨pies is vies¨) en de overvloed aan al aanwezige milieuvriendelijke maat-
regelen en producten.

Ìn vervolg op bovenstaand onderzoek is door Grontmij (Bjartur Swart en Shanti Faber) dezelfde
enquête uitgezet in de eigen organisatie. Hierop reageerden 108 mensen met een ingevulde
vragenlijst (80% mannen en 20% vrouwen). Van de respondenten is 80% bereid landbouw-
producten te consumeren die met urine zijn verbouwd.

4 geeft de resultaten weer van de vraag welke producten men bereid zou zijn te consumeren bij
directe bemesting met urine. Verhoudingsgewijs blijkt de acceptatie onder de personeelsleden
van Grontmij iets lager te liggen dan in mijn eigen onderzoek. Voor sla, brood en appels ligt de
acceptatie tussen 61 en 75%, waarbij weinig verschil is te vinden tussen direct en indirect
gebruik van urine. De acceptatie van niet-voedselproducten (biodiesel en groene stroom) ligt
tussen 82 en 88%.
Acceptatie bij directe bemesting met urine
0%
10%
20%
30%
40%
50%
60%
70%
80%
90%
100%
Sla Brood Fruit Biodiesel Groene
stroom
Geen
enkel
product

Acceptatie bij urine-gebaseerde kunstmest
0%
10%
20%
30%
40%
50%
60%
70%
80%
90%
100%
Sla Brood Fruit Biodiesel Groene
stroom
Geen
enkel
product

4 Positieve reactie op de vraag: ¨zou u de volgende producten consumeren als u zeker weet dat dit
geen enkel schadelijk effect heeft op het product of uw gezondheid?¨ onder 108 personeelsleden van Grontmij

De vraag ¨Verwacht u dat het No Mix technologie een goede toekomst heeft? Waarom?¨
resulteerde een veelheid van reacties die op hoofdlijnen vergelijkbaar zijn mijn eigen onder-
zoek. Ìn Bijlage 3 zijn al deze reacties weergegeven ter informatie.

9.3.3 Conclusies
Zowel het Zwitserse onderzoeken als het eigen onderzoek laten zien dat er een hoge
acceptatiegraad is bij consumenten voor het bemesten van landbouwproducten met urine.
Tegen bemesting van niet-voedselproducten is nauwelijks bezwaar (> 80% acceptatie). Voor
voedselproducten is de acceptatiegraad ook hoog (60 ÷ 80%), maar komen wel een aantal
belangrijke randvoorwaarden naar voren:
- consumenten vinden de aanwezigheid van medicijnresten en hormonen in de urine een
zorgpunt;
- de producten mogen niet duurder worden;
- een goede voorlichting is belangrijk, met name om de perceptie te veranderen.



Maatschappelijke acceptatie van het gebruik van menselijke urine als meststof in de landbouw

03/4428
Pagina 48 van 75


9.4 Acceptatie van urinebemesting door boeren
9.4.1 Zwitserland
Door EAWAG is ook onderzoek gedaan naar de acceptatie van een op urine gebaseerde mest-
stof met behulp van een enquête onder 467 boeren in Zwitserland en Duitsland. De studie liet
zien dat de acceptatie door boeren hoog is. Het grootste deel van de 127 respondenten (57%)
gaf aan urine gebaseerde meststoffen een goed of zeer goed idee te vinden. 42% was geïnte-
resseerd in de aanschaf van een dergelijk product. De boeren gaven ook aan veel waarde aan
de afwezigheid van microverontreinigingen te hechten: 30 % van de respondenten gaf uit eigen
beweging aan dat ze bezorgd waren dat de urinemeststof medicijn- of hormoonresten zou
kunnen bevatten.
42%
57% 10%
58%
33%
0% 20% 40% 60% 80% 100%
Zou u een op urine gebaseerde
meststof aanschaffen?
Spreekt het idee van een op
urine gebaseerde meststof u
aan?

5 Mening van boeren in Zwitserland en Duitsland over het gebruik van op urine gebaseerde meststof-
fen (Lienert et al, 2003). Enquêtes werden verstuurd aan 467 boeren en antwoorden werden ontvangen 127.
Groen: ja; geel: weet niet / geen mening; rood: nee.

9.4.2 Zweden
Urinebemesting wordt in Zweden door een tiental boeren toegepast. Ìn alle gevallen wordt de
urine bij deze boeren afgeleverd. Soms ontvangen zij daarvoor betaling, in andere gevallen
nemen zij de urine gratis af. Onderzoekers van de landbouwuniversiteit van Upsalla hebben
interviews met deze boeren gehouden om na te gaan wat hun perceptie van de No Mix aanpak
was en in hoeverre zij de urine werkelijk als meststof gebruikten (Tidåker & Jönsson, 2007).

De meeste boeren gebruikten de urine bewust als meststof. Zij waren betrokken bij drie projec-
ten waarbij sprake was van een goede samenwerking tussen de organisaties die de urine op-
haalde (een waterbedrijf, een gemeente en een huurdersvereniging van een ecodorp). Ìn twee
gevallen leverden de urine-ophalende partijen meetgegevens mee over de samenstelling van
de urine en dachten actief mee over de wijze van bemesting. Ìn een derde geval was er geen
geld voor analyses, maar verminderde de betrokken boer wel zijn gebruik van kunstmest.

Eén van de geïnterviewde boeren bleek slecht geïnformeerd over de reden waarom urine ge-
scheiden werd ingezameld en gebruikten deze niet bewust al meststof. Deze boer bracht de
urine na het groeiseizoen op het land om bodemverdichting door het gebruik van de relatief
zware tankwagens voorafgaand aan de groei te voorkomen. Deze boer had ook de perceptie
dat de urine vooral gescheiden werd ingezameld om eutrofiëring te voorkomen (Zweden heeft
veel woningen op het platteland en in de nabijheid van meren).

9.5 Acceptatie van urine in de Iandbouw: wat vinden de andere actoren?
Behalve consumenten (eindgebruikers) en boeren (primaire producenten) zijn er natuurlijk meer
partijen betrokken in de verschillende landbouwketens, denk aan:
- de retailsector (grote inkopers, supermarkten)
- verwerkers (bakkers, levensmiddelenfabrieken)
- afzetkanalen (groenteboeren, supermarkten)

Voor het op grotere schaal introduceren van urinebemesting is samenwerking met één of meer-
dere partijen onmisbaar. Over de acceptatie van de bovengenoemde partijen zijn geen
statistische gegevens bekend. De mate van acceptatie kan voor een deel wel afgeleid worden
uit hun positie in de keten. Voor de meeste partijen in de keten is de consumentenvraag naar
producten van doorslaggevend belang. Het niet kunnen afzetten van producten en eventuele
negatieve publiciteit vormt voor hen een relatief groot afbreukrisico.
Maatschappelijke acceptatie van het gebruik van menselijke urine als meststof in de landbouw

03/4428
Pagina 49 van 75


Bij de marktintroductie van producten die bemest zijn met urine is het daarbij niet alleen van
belang dat de consument het accepteert, maar ook dat het voor marktpartijen een onder-
scheidende meerwaarde kan opleveren.

9.6 Kansen, uitdagingen en aanknopingspunten
Eerder in dit essay bleek al dat de consumentenacceptatie voor urinebemesting bij een goede
informatievoorziening hoog is. Voor niet-voedselproducten bestaat nagenoeg geen weerstand.
Het gebruik van urine voor bemesting van bijvoorbeeld koolzaad (grondstof voor biodiesel) of
energiemaïs (grondstof voor groene stroom) vormt daarmee een goede zeer goede mogelijk-
heid. Uiteraard is het belangrijk om voor de te betrekken marktpartijen en boeren een meer-
waarde te creëren. Deze meerwaarde kan bijvoorbeeld liggen in een besparing op de kosten
van kunstmest, in combinatie met een publiekscampagne die duidelijk maakt dat de biodiesel
geproduceerd is met een milieuvriendelijke, uit een afvalstof teruggewonnen meststof en dus
nóg schoner is.

Voor voedselproducten ligt het verhaal net iets complexer. De consumentenacceptatie voor met
urine bemeste voedselproducten is, bij een goede informatievoorziening, hoog. Voor een urine-
gebaseerde kunstmest ligt de acceptatie op 70-75%, terwijl dit voor directe bemesting met urine
op 61-73% van de ondervraagden ligt (resultaten van de enquête onder 108 personeelsleden
van de Grontmij). Ìn beide gevallen onder de voorwaarden dat het product geen schadelijke
effecten op de gezondheid door medicijnresten of hormonen heeft en niet duurder is.

Een lastig punt bij de resultaten is dat een aantal ondervraagden duidelijk aangeeft geen
producten te willen kopen die direct of indirect met urine zijn bemest. Dat betekent ÷ er vanuit
gaande dat we streven naar het informeren van de consument over de bemestingsbron - dat
deze mensen in de winkel een andere keuze willen kunnen maken.

Een mogelijkheid om keuzevrijheid te creëren is het opzetten van een aparte productenlijn voor
voedselproducten die bemest zijn met urine. Of deze optie realistisch en commercieel haalbaar
is, zal verder onderzoek vergen. Er zijn voor veel landbouwproducten al diverse productkeuzes
op de markt. Denk hier bijvoorbeeld aan de grote keuze in tomaten (gewoon, biologisch, tros-,
cherry, biologisch cherry, tasty tom, roma, etc.). Ìs het mogelijk dat daar in de toekomst nog een
speciale tomaat bij komt die bemest is met menselijke urine? Ìs deze tomaat voldoende onder-
scheidend en aantrekkelijk om voldoende marktaandeel te veroveren?

Een tweede mogelijkheid is om aansluiting te zoeken bij bestaande productlijnen met een 'eco-
uitstraling'. Bemesting met urine zou bijvoorbeeld heel goed passen in de biologische land-
bouw. Veel biologische landbouwbedrijven hebben een tekort aan snel-opneembare meststof-
fen zoals ammonium. Urine kan hierbij een prima aanvulling vormen op hun bestaande mest-
stoffen. Een knelpunt lijkt hier te zijn dat er op EU niveau momenteel regelgeving is die het
gebruik van meststoffen van menselijke oorsprong in de biologische landbouw verbiedt
(mondeling informatie Jönsson, 2007). Een nadere verkenning wat deze regels behelzen is
raadzaam.

Ook boeren blijken voor het merendeel positief over het gebruik van menselijke urine als mest-
stof, met als kanttekening dat er geen risico's mogen zijn voor de bodem of voor producten door
aanwezige medicijnresten of hormonen. Uit de Zweedse ervaringen kan opgemaakt worden dat
het voor boeren aantrekkelijker is om een handzame urine-gebaseerde kunstmest te gebruiken
dan om tankwagens met urine op het land te krijgen.

9.7 Hoe verder?
Een belangrijke keuze is te bepalen of gescheiden ingezamelde urine ingezet gaat worden voor
industriële gewassen of voor voedselgewassen. Een studie die hierbij ondersteuning kan
bieden is het in kaart brengen van het huidige en te verwachten toekomstige kunstmestgebruik
voor beide productgroepen. Door dit af te zetten tegen een mogelijk toekomstig aanbod - als
Nederland massaal zou overstappen op het No Mix toilet ÷ wordt duidelijk in hoeverre urine kan
bijdragen aan die kunstmestvraag. Een volgende stap is om in gesprek te gaan met relevante
marktpartijen.

Maatschappelijke acceptatie van het gebruik van menselijke urine als meststof in de landbouw

03/4428
Pagina 50 van 75


9.8 Gebruikte Iiteratuur
Lienert J., Haller M., Berner A., Stauffacher M., Larsen T.A. (2003): How farmers in Switzerland
perceive fertilizers from recycled anthropogenic nutrients (urine). Water Science and
Technology 48 (1), 47÷56.

Lienert, J., T.A. Larsen (2006) Considering user attitude in early development of environmental-
ly friendly technology: A case study of No Mix toilets. Environmental Science & Technology
40(16): 4838-4844.

Lienert, J., K. Thiemann, R. Kaufmann-Hayoz, T.A. Larsen (2006) Young users accept NoMix
toilets ÷ a questionnaire survey on urine source separating toilets in a college in Switzerland.
Water Science and Technology 54(11-12): 403-412.

Pahl-Wostl, C., A. Schönborn, N. Willi, J. Muncke, T.A. Larsen (2003) Ìnvestigating consumer
attitudes towards the new technology of urine separation. Water Science and Technology 48(1):
57-65.

Pernilla Tidåker & Håkan Jönsson (2007). Organising recycling of source separated sewage
products to farmland.
Maatschappelijke acceptatie van het gebruik van menselijke urine als meststof in de landbouw

03/4428
Pagina 51 van 75


9.9 BijIage 1. InformatiebIad het Nieuwe PIassen uitgevoerde enquêtes



Het Nieuwe Plassen

Een nieuwe ontwikkeling in Nederland is 'het Nieuwe Plassen' waarbij urine gescheiden wordt
ingezameld door de toepassing van speciale toiletten of urinoirs. Urinescheidende of 'No Mix'
toiletten hebben een aparte afvoer voor urine aan de voorkant van het toilet (Figuur 2). De in-
gezamelde urine wordt tijdelijk op gebouw- of wijkniveau opgeslagen in speciale tanks en ver-
volgens met een tankwagen afgevoerd naar een centrale plaats voor verwerking of hergebruik.

Menselijke urine is de grootste bron van stikstof, fosfaat en kalium (meststoffen) in stedelijk af-
valwater (Figuur 1). Ook kan urine medicijnresten en microverontreinigingen bevatten die via de
nieren worden uitgescheiden. Urine omvat ongeveer 1% van de totale hoeveelheid stedelijk
afvalwater. Door urine apart in te zamelen kunnen veel meststoffen en milieuvreemde stoffen
gescheiden worden ingezameld. Dit bespaart energie op rioolwaterzuiveringsinstallaties en kan
de lozing van probleemstoffen naar het oppervlaktewater verminderen. Om de ingezamelde
urine niet te veel te verdunnen hebben No Mix toiletten een lager spoelwatergebruik dan
conventionele WC's. Hierdoor wordt dagelijks 10 tot 15 liter spoelwater per persoon bespaard.

Stikstof (13 g/p/d)
80%
11%
9%
Urine
Feces
Grijswater
Fosfor (2 g/p/d)
53%
26%
21%
Kalium (4 g/p/d)
70%
20%
10%

Figuur 1. Bronnen van mineralen in stedelijk afvalwater

Het Nieuwe Plassen is ontwikkeld in Zweden. Hier zijn meer dan 10.000 No Mix toiletten ver-
kocht. Ìn Nederland is het systeem voor het eerst toegepast in een Woon-zorgcomplex in
Meppel in 2005. Er zijn in Nederland inmiddels meerdere kantoorgebouwen uitgerust met No
Mix toiletten. Momenteel worden verschillende haalbaarheidsstudies uitgevoerd om het Nieuwe
Plassen ook in woonwijken toe te passen (o.a. de Tweede Fase ÌJburg in Amsterdam). De firma
Sealskin heeft het eerste Nederlandse designtoilet met urinescheiding ontwikkeld en wil dit op
korte termijn op de markt brengen.

Veel waterschappen hebben interesse in het Nieuwe Plassen omdat deze aanpak de emissies
van probleemstoffen (medicijnresten, hormonen) naar het oppervlaktewater aanzienlijk kan
reduceren. Ongeveer 70-90% van de meeste medicijnen wordt via de urine uitgescheiden.
Rioolwaterzuiveringsinstallaties kunnen veel deze stoffen niet of niet volledig uit het afvalwater
verwijderen. Het Maasziekenhuis in Boxtel en het Waterschap Aa en Maas hebben in 2007 de
vierde internationale Maas-prijs ontvangen voor de voorgenomen urinescheiding in de nieuw-
bouw van het hospitaal. Het waterschap en het ziekenhuis willen hiermee de fosfaat- en stik-
stofbelasting op de rioolwaterzuiveringsinstallatie verminderen, maar ook voorkomen dat er
medicijnresten in de Maas terechtkomen. Een ander voordeel van urinescheiding is dat er veel
energie bespaard kan worden op rioolwaterzuiveringsinstallaties. Daarnaast blijkt ook dat No
Mix toiletten gebruikers bewuster maakt van de afvalwaterketen.
Dit is iets wat pas bij de huidige beleidsvoornemens in de Europese Kaderrichtlijn Water.




Maatschappelijke acceptatie van het gebruik van menselijke urine als meststof in de landbouw

03/4428
Pagina 52 van 75


Ìn Zweden wordt de gescheiden ingezamelde urine gebruikt als meststof omdat deze zoveel
stikstof, fosfaat en kalium bevat. Hierdoor kan bespaard worden op kunstmest. Dit is in het bij-
zonder interessant voor het mineraal fosfaat, omdat dit een eindige grondstof is waarvan de
voorraden sterk aan het slinken zijn. Verder wordt er indirect energie bespaard voor de
productie van kunstmest.

Ìn Nederland moet voor de toepassing van urine als meststof toestemming van het lokaal be-
voegd gezag aangevraagd worden omdat urine niet op de officiële lijst van toegelaten meststof-
fen staat. Wageningen Universiteit doet onderzoek naar de voor- en nadelen van toepassing in
de landbouw. Uit dit onderzoek blijkt dat urine een relatief schone meststof is en er ver-
houdingsgewijs aanzienlijk minder zware metalen op bouwland gebracht worden in vergelijking
met kunstmest en dierlijke meststoffen. Er lopen ook diverse R&D trajecten om urine op te
werken tot kunstmest.




Figuur 2. No Mix toilet in het Watermuseum in Arnhem (foto: Adriaan Mels) en toepassing van
urinescheiding in een appartementencomplex in Stockholm, Zweden


Maatschappelijke acceptatie van het gebruik van menselijke urine als meststof in de landbouw

03/4428
Pagina 53 van 75


9.10 BijIage 2 Acceptatie urine aIs meststof - enquête


Deze enquête gaat in de op de vraag in hoeverre u menselijke urine accepteert als meststof
voor landbouwproducten.

1. Bent uw vrouw of man?
O Vrouw
O Man

2. Wat is uw leeftijd?

3. Zou u landbouwproducten consumeren (kopen én nuttigen) die met urine zijn ver-
bouwd?
O Ja
O Nee

Het gebruik van urine kan door directe toepassing of door kunstmest uit de urine te maken.

4. Zou u de volgende producten consumeren als deze met urine zijn verbouwd indien u
zeker weet dat dit geen enkel schadelijk effect heeft op het product of uw gezondheid?
(meerdere antwoorden mogelijk)
O Sla
O Brood
O Appels
O Biodiesel
O Groene stroom

5. Zou u de volgende producten consumeren als deze met kunstmest zijn verbouwd die
gemaakt is uit urine? (meerdere antwoorden mogelijk)
O Sla
O Brood
O Appels
O Biodiesel
O Groene stroom

6. Verwacht u dat het No Mix technologie een goede toekomst heeft? Waarom?

.....................................
.....................................
.....................................
.....................................

Bedankt voor de medewerking

Maatschappelijke acceptatie van het gebruik van menselijke urine als meststof in de landbouw

03/4428
Pagina 54 van 75


9.11 BijIage 3 Reactie van personeeIsIeden Grontmij op de vraag "Verwacht u dat
No Mix technoIogie een goede toekomst heeft?"


9.11.1 Zo ja waarom:
• Alle acties die zijn gericht op hergebruik van reststoffen (i.p.v. afvalstoffen), dragen bij aan
beperking van het gebruik van primaire grondstoffen. O.a. door Al Gore zijn veel meer
mensen zich daarvan bewust geworden.
• Alle beetjes helpen.
• Als de urine niet op de verpakking staat geschreven hebben velen niet in de gaten dat het
een kunstmest uit urine is opgebouwd.
• Als het niet slecht is voor de gezondheid, is dit volgens mij geen probleem. Alleen maar
goed juist. Het is uiteindelijk een soort cradle tot cradle toch?
• Als het in zweden werkt waarom hier dan niet?! Zoals de romeinen al zeiden "Pecunia non
olet".
• Als het gemakkelijk te verkrijgen is en er geen verdere consequenties aan zitten tegenover
kunstmest of andere groeistoffen, waarom niet?
• Beter voor het milieu.
• Dat lijkt mij best een mogelijkheid. Probleem lijkt mij echter de stoffen van medicijnen die in
urine zitten en vervolgens weer in de landbouwproducten komen. Daar zit niemand op te
wachten.
• Deze technologie kan een goede toekomst hebben mits de uitsluiting van schadelijke stoffen
(medicijnresten en hormonen ) voldoende gewaarborgd is.
• Duurzaam gebruik van natuurlijke afvalproducten relatief eenduidige verwerking bij
meerdere productie lijnen.
• Duurzaam, eenvoudig.
• efficiënter omgaan met afval en grondstoffen
• Ervan uitgaande dat dit kostenbesparend werkt; volgens mij zijn de meeste mensen niet zo
bezig met het productieproces van wat zij consumeren. Hierom zal de wetenschap dat het
product wordt verbouwd m.b.v. een product o.b.v. urine slechts bij een minderheid duidelijk
zijn.
• Geeft energiebesparing en maakt je milieubewuster.
• Goede scheiding van afvalstromen.
• Heeft belangrijke milieuvoordelen, minder afval, minder koe- en kunstmest nodig. Afval-
waterzuivering wordt eenvoudiger.
• Het heeft veel voordelen, je verbruikt minder water en de afvalstoffen dienen nog voor
andere doeleinden.
• Het is een nuttige en wellicht zelfs uiteindelijk een noodzakelijke technologie.
• Het kan een goede stap zijn om de 'kring' rond te krijgen.
• Het klinkt smerig, met urine bereidde groente nuttigen. Maar elk land wordt besproeid met
gier of wel urine, alleen dan van koeien. Toch eet iedereen aardappels en andere groentes,
dus het zal uit eindelijk wel voeten in de aarde krijgen.
• Ìk denk dat het eerst enige weerstand zal krijgen, maar na verloop van tijd zal dit ver-
dwijnen. De boeren gebruiken nu toch ook dierlijke meststoffen voor het verbouwen van ge-
wassen en dit is algemeen bekend en geaccepteerd.
• Ìndien het werkelijk efficiënt kan gebeuren en er voldoende voordelen aanzitten. Acceptatie
zou een probleem kunnen zijn, aangezien niet iedereen zich over het idee heen zou kunnen
zetten. Feitelijk maakt het echter niets uit, urine van dier of mens.
• Ìs milieuvriendelijk.
• Ja, als duidelijk wordt gemaakt dat urine verder invloed heeft op de smaak/kwaliteit van het
product en duidelijk wordt gemaakt dat op deze wijze kostbare water wordt bespaard en er
verder geen negatieve gevolgen zijn op het milieu
• Ja, beter voor het milieu, minder spoelwater, minder medicijnen in oppervlaktewater enz.
• Ja, door urine apart in te zamelen kunnen veel meststoffen en milieuvreemde stoffen ge-
scheiden worden ingezameld. Dit bespaart energie op rioolwaterzuiveringsinstallaties en kan
de lozing van probleemstoffen naar het oppervlaktewater verminderen.
• Ja, effectiever scheidingsprincipe (bij de bron).
• Ja, er is voordeel te behalen in de bouw van rwzi's door het gescheiden inzamelen van
urine.

Maatschappelijke acceptatie van het gebruik van menselijke urine als meststof in de landbouw

03/4428
Pagina 55 van 75


• Ja, het is absurd om alle mineralen naar de zee te spoelen. Op deze wijze gescheiden
urineafvoer is schoon en geeft geen/nauwelijks overlast voor de gebruikers. Liefst zou ik het
nog zelf in een moestuin gebruiken.
• Ja, het is een belangrijke beperking van de afvalstroom. Wel moet er zekerheid gegeven
worden dat alle (schadelijke) resten van medicijnen uit het product verwijderd zijn
• Ja, het is een duurzame gedachte dat we afvalwater gebruiken om voedsel te produceren
• Ja, in geval de meerwaarde / besparingen / duurzaamheidaspecten / voordelen in de gehele
keten explicitiet kan worden gemaakt.
• Ja, Ìndien de voordelen zo veel groter zijn dan de nadelen. Er zal echter veel weerstand
moeten worden overwonnen en het vraagt een lange adem.
• Ja, indien het mogelijk zal blijken om dit op grotere schaal in te gaan voeren. Dit vergt echter
grote investeringen. Overheden zullen hierdoor wel subsidies moeten gaan geven hiervoor,
of het moet voor bedrijven lucratief gaan worden om een No Mix systeem aan te schaffen.
• Ja, kost tijd, gewenning, afhankelijk van prijs e.d.
• Ja, kringloopsluiting is noodzakelijk.
• Ja, later weer scheiden is duur en weinig duurzaam. Daarom waarschijnlijk een goede toe-
komst. Wel vraagt e.e.a. een nauwe en breed gedragen samenwerking met betrokken
partijen. Juist omdat er ook andere varianten en concurrenten zijn.
• ja, minder afval. Riolering en natuur minder belasten
• Ja, mits inderdaad buiten kijf staat dat de toepassing van urine als basismeststof een
minstens zo grote controle ondergaat als voor andere grondstoffen voor (kunst-)mest.
• Ja, omdat goed duidelijk wordt gemaakt wat de voordelen ervan zijn. "Probleem" is dat het
waarschijnlijk lange tijd zal duren omdat bij iedereen onder de pet te krijgen. Zoals dat gaat
bij alles wat nieuw en anders is.
• Ja, omdat je nu ook al niet weet waar je voedsel mee verbouwd wordt.
• Ja, omdat wij alle kansen zullen moeten benutten om met minder afvalstoffenopslag c.q. uit-
stoot etc. deze planeet ook voor onze "opvolgers" leefbaar te houden.
• Ja, scheiden bij de bron en daarmee bruikbare middelen inzetten is duurzaam, mits het
doelmatig gebeurt en de risico's worden onderkend en als zodanig behandeld.
• Jawel, nieuwe inzichten en technologieën kunnen het mogelijk maken, de kunst is om de
toekomstige gebruikers te overtuigen en om het systeem in de markt te krijgen (plaatsen in
alle nieuwe gebouwen e.d.)
• Mijn verwachting is dat voor acceptatie nog veel gedaan moet worden, zoals "vreemde
stoffen" bijvoorbeeld medicijnresten uit de urine te verwijderen. Als het voor de landbouw
(economische) voordelen oplevert, zal dit zeker gebruikt worden.
• Minder afval en kansen voor energie.
• Natuurlijke aanmaak van de mest lijkt mij een voordeel en een kans om het product succes-
vol te maken.
• Omdat de nutriëntenproblematiek steeds urgenter gaat worden, omdat energie steeds
duurder en schaarser wordt, omdat bij grootschalige toepassing de kosten in de keten om-
laag gaan.
• Past in plaatje duurzaamheid door: hergebruik afvalstoffen (mits medicijnen en hormonen
goed uit meststoffen en dus uit voedselketen zijn te halen) efficiëntere waterzuivering
resterend rioolwater
• Schaarste aan grondstoffen.
• Scheiden geeft ruimte voor specifieke manier van verwerken.
• Vanwege het onderscheppen van allerlei chemicaliën, medicijnenresten e.d.
• Vernieuwend en er is genoeg.
• Waterbesparing zodoende heeft dat toekomst. Tekort aan water zal een groot toekomstig
probleem zijn.
• We moeten toe naar een gesloten kringloop, en dit is een stap in goede richting.
• We zullen wel moeten, hergebruik van alle afvalstoffen is iets waar we in de toekomst veel
gebruik van moeten maken, tenzij deze stoffen de gezondheid schaden van mens en dier.
• Wel vanuit sociaal-maatschappelijk oogpunt






Maatschappelijke acceptatie van het gebruik van menselijke urine als meststof in de landbouw

03/4428
Pagina 56 van 75


9.11.2 Zo nee, waarom niet?
• Acceptatie bij gebruikers van toilet is nog lastig.
• Afwezigheid van infrastructuur. Hoge kosten van het achteraf realiseren, daardoor alleen
mogelijk als het bij eerste realisatie door de ontwikkelaar wordt meegenomen. Heeft de ont-
wikkelaar voldoende profijt van een dergelijke beslissing?
• Alleen als hormonen en andere chemische middelen goed uit de mest gehaald kunnen
worden heeft het naar mijn idee een toekomst.
• De aparte inzameling kan het lastig maken het op voldoende plaatsen te kunnen installeren.
Ìk vraag me af of de kwaliteit altijd hetzelfde is.
• Er moet wel goed onderzocht worden wat de invloed van de urine op groenten e.d. is, aan-
gezien ook 70-90% van de medicijnen door urine wordt afgescheiden
• Er zullen altijd onbekende stoffen, ook schadelijke, worden verspreid in het milieu waardoor
het praktisch onmogelijk wordt de oorzaak van allerlei afwijkingen te achterhalen. Een dood-
lopende weg dus.
• Gebruik van menselijke urine bij voedsel zal de meeste mensen weerhouden van gebruik
van dit voedsel.
• Hoe kan er worden gegarandeerd dat de stoffen van medicijnen (chemotherapie en andere
giftige medicijnen) niet in het geproduceerde voedsel terecht komen? De met menselijke
urine gevoede producten/groeten moeten wel een heel stuk goedkopper zijn.
• Ìn de bijlage wordt veel gezegd over de voordelen van het scheiden van medicijnsporen in
urine. Door urine dan toch in de voedselketen toe te passen, moet toch zeker eerst deze
sporen eruit gehaald zijn. Poep of pies, het is niet VÌES!
• Men vindt het 'vies'.
• Nee, als voordeel onvoldoende zichtbaar kan worden gemaakt.
• Nee, de beeldvorming is in mijn ogen te negatief, waardoor de acceptatie van urine als
gangbare meststof weinig toekomst heeft.
• Nee, ik denk dat mensen er heel erg aan het idee moeten wennen. Het idee dat er iemand
over je sla geplast heeft is nou niet zo lekker.
• Niet vanuit kostenoverwegingen.
• No Mix, op zich is goed, maar het zou nog wat beter kunnen door ook de ontlasting niet weg
te (met drinkwater) spoelen wanneer droge composttoiletten gebruikt worden. Ìk heb daar
ervaring mee, als goed gebruikt stinkt het niet.
• Omdat de mens een gewoonte dier is, die niet graag van verandering houdt. Een man die
altijd staand plast gaat niet zitten en een urinoir in een woning is niet bepaald de normaalste
zaak van de wereld.
• Omdat het niet eenvoudig is om een omslag in denken te bewerkstelligen, traditionele in-
zameling en behandeling zijn bekend, vertrouwd en bewezen. Omdat invoering alleen op
grote schaal zal zorgen voor een grootschalige invoering.
• Problemen met medicijnresten moeten wel opgelost worden.
• Te hoge investering tegen te laag rendement, een aanpassing van het riool met als op-
brengst een beetje mest (met medicijnresten en hormonen er in).
• Teveel "vies" reacties.
• Vast wel, maar niet voor voedsel.
• Zolang geen zekerheid is voor de veiligheid van de mens zal het een moeilijk verhaal
worden. Echter: wie weet op het eindpunt (consument) welke stoffen er in het productie-
proces zijn gebruikt?
• Zullen kosten opwegen tegen baten?





03/4428
Pagina 57 van 75


10 ¡n welke gebieden ligt het gebruik van
urine in de landbouw het meest voor de
hand en waarom?
Erik Luijendijk en Bjartur Swart
Grontmij
Drachten
Juni 2008

10.1 Introductie
Humane urine is in potentie een meststof die puur of in bewerkte vorm in de landbouw gebruikt
kan worden. Vooralsnog is er echter geen vraag naar urine, geen aanbod van urine en wellicht
nog niet voldoende kennis over de toepassingsmogelijkheden van urine. Toch lijken er wel de
nodige perspectieven te zijn, zoals ook uit de overige bijdragen in deze essaybundel blijkt.
De afgelopen jaren zijn in Nederland een aantal projecten gestart die zich richten op het benut-
ten van urine als meststof. Deze kwamen min of meer bij toeval tot stand. Soms werd met kunst
en vliegwerk voorzien in de noodzakelijke randvoorwaarden. Al deze projecten dragen bij aan
het inzicht dat we nu hebben en zijn alleen al vanuit die optiek waardevol gebleken.

Maar moeten we het tot stand laten komen van nieuwe projecten net zo laten bepalen door het
toeval of zijn er gebieden en locaties in Friesland die juist grote potenties hebben. Waardoor
worden die dan bepaald en waar liggen die dan? Ìn dit essay wordt daar op ingezoomd.

10.2 Randvoorwaarden
De toepassing van urine in de landbouw is een nieuwe ontwikkeling die niet zonder meer overal
toepasbaar is. Voor het uitvoeren van pilot-projecten zijn vier aspecten belangrijk:
1. De aanwezigheid van voldoende kennis.
2. Voldoende aanbod.
3. Voldoende afzet.
4. Maatschappelijke en institutionele acceptatie

10.2.1 Kennis
Kennis is met name beschikbaar bij de kennisinstellingen. Enkele daarvan, Wetsus en Van Hall-
Larenstein, zijn al betrokken bij onderzoek op het gebied van Nieuwe Sanitatie. Zij maken ook
deel uit van het netwerk ONSS. Andere kennisinstituten zoals het Carthesius instituut in
Franeker (dat richt zich op duurzaamheidsvraagstukken) en de Noordelijke Hogeschool
Leeuwarden, zijn nog niet betrokken bij de ontwikkeling van Nieuwe Sanitatie.
De betrokkenheid van kennisinstituten bij toekomstige pilotprojecten is om meer dan één reden
van belang. Niet alleen kunnen zij met hun contacten met onder andere de WUR en TUD de
bestaande kennis aanboren, zij zijn met name in staat antwoord te geven op de openstaande
onderzoeksvragen. De aanwezigheid van capaciteit in de zin van studentendagen, is daarbij
ook van belang.







In welke gebieden ligt het gebruik van urine in de landbouw het meest voor de hand en waarom?

03/4428
Pagina 58 van 75


De locatie van de kennisinstituten is weergegeven in figuur 1.















Figuur 1. kennis

10.2.2 Aanbod
Op dit moment wordt nog nergens in Friesland gescheiden urine aangeboden. Ìn woningen,
kantoren en andere gebouwen kan, om urine van de overige afvalwaterstroom te scheiden,
gebruik worden gemaakt van urineseparatie toiletten (voor mannen en vrouwen) of van urinoirs
(alleen mannen). Ìn beide gevallen is een aparte afvoerleiding en een opslagtank nodig. Het is
lastig en dus kostbaar om in bestaande gebouwen het gemengde afvalwatersysteem te ver-
anderen tot een gescheiden systeem. Bij nieuwbouw is dit gescheiden systeem relatief een-
voudig en tegen geringe meerkosten aan te brengen. Het lijkt dan ook voor de hand te liggen bij
het zoeken naar geschikte locaties vooral naar die gebieden te kijken waar grotere bouw-
projecten plaats vinden.
Daarbij is er overigens nog wel een verschil in rendement. Ìn gebouwen waar grote aantallen
mensen bijeenkomen, zoals voetbalstadions, kan met relatief geringe investeringen een grote
hoeveelheid urine worden ingezameld. Alleen al het apart afvoeren en opslaan van de urine uit
de urinoirs levert al een redelijke hoeveelheid urine op. Zo zal het Abe Lenstra stadion per
speelronde al snel zo'n 4 m3 urine opleveren.

Figuur 2. aanbod


















.






KENNIS

Kennisinstellingen

AANBOD

Nieuwbouwlocaties >60
woningen

Bedrijventerreinen

Stadions/sportaccommodaties

Evenementenplaatsen

Recreatieparken

Ziekenhuizen

Overig (Afsluitdijk en Zee-
vaartschool Harlingen)
In welke gebieden ligt het gebruik van urine in de landbouw het meest voor de hand en waarom?

03/4428
Pagina 59 van 75




Ook in kantoorgebouwen zijn de kosten ten opzichte van de opbrengst aan urine betrekkelijk
laag doordat de voorzieningen redelijk geconcentreerd liggen en er veel mensen van de voor-
zieningen gebruik maken. Gemiddeld zal een kantoor met 100 medewerkers per week zo'n
0,225 m3 urine opleveren. Urineseparatie in nieuwbouwwijken vergt, gerekend per m3 urine, de
hoogste investeringen. Een woonwijk van 100 woningen zal gemiddeld per week zo'n 1 m3
urine opleveren.

Ìn figuur 2 is aangegeven waar in Friesland grotere hoeveelheden urine zouden kunnen worden
ingezameld.

Er kan ook niet gebouwgebonden urine worden ingezameld. Daarbij moet worden gedacht aan
evenemententerreinen (de Sneekweek) waar veel urine met mobiele plaspalen kan worden in-
gezameld en aan bijvoorbeeld urine uit treinen of boten.
Met name het inzamelen van urine bij evenementen kan perspectief hebben indien daarover af-
spraken worden gemaakt met de bedrijven die de logistiek van de sanitaire voorzieningen ver-
zorgen (Eco-toilet / Dixie). Urine kan zonder noemenswaardige meerkosten worden inge-
zameld. (zoals dat nu ook in Den Haag gebeurt waar ieder weekend 4 ÷ 6 m3 urine wordt inge-
zameld)

10.2.3 Afzet.
Rekening houdende met het gestelde in de eerste drie essays zou urine (of urineproducten) in
de landbouw met name voordelen kunnen hebben bij:
• De bemesting van aardappelen (belangstelling voor bladbemesting met ureumhoudende
vloei-bare meststoffen.
• Glastuinbouw (potplanten / containerteelt).
• Aquacultures.
• Biologische landbouw.












Figuur 3. afzet






figuur 3 afzet

Grootschaliger pilotprojecten lijken met name in de nabijheid van deze gebieden kansrijk te zijn.
Zeker omdat hier een vraag kan ontstaan naar vloeibare nitraatrijke meststoffen.

Ìn figuur 3 zijn de belangrijkste gebieden van de aardappel, glastuinbouw en aquacultures aan-
geduid.
Biologische landbouw vindt verspreid in Friesland plaats.
De meeste stedelijke uitbreidingen vinden aan de rand van de bebouwde kom plaats; de af-
stand tot het regulier agrarisch gebied zal in de meeste gevallen beperkt zijn. Ìn de meeste
gebieden zal het daarom geen probleem zijn om urine binnen de landbouw af te zetten.
AFZET
Aardappelteelt
Aquacultures
Glastuinbouw
In welke gebieden ligt het gebruik van urine in de landbouw het meest voor de hand en waarom?

03/4428
Pagina 60 van 75



Charrette


Nieuwe Sanitatie
Project




10.2.4 Acceptatie.
Het is een pré als er al een zekere acceptatie is van het begrip Nieuwe Sanitatie. Deze situatie
doet zich voor in die gebieden waar reeds pilotprojecten zijn uitgevoerd. Betrokken overheden,
organisaties en bewoners zijn daar inmiddels bekend met het anders omgaan met afvalwater.
Zij zullen het zelfs toe juichen als de pilot waar zij zelf aan hebben meegewerkt een zinvol ver-
volg krijgt.


Ook in gebieden waar in het kader van duurzaamheid discussies zijn gevoerd over het beginsel
Cradle to Cradle kan de acceptatiegraad hoger liggen dan in andere gebieden in Friesland. Dit
soort discussies zijn bijvoorbeeld gevoerd in de Charrette die de afgelopen 2 jaar in Friesland
hebben plaatsgevonden.

Ìn figuur 4 zijn de locaties van de projecten Nieuwe Sanitatie en van de Charrette's weerge-
geven.














figuur 4: acceptatie

10.3 SeIectie potentiëIe piIotgebieden.

De driehoek Harlingen ÷ Leeuwarden ÷ Hallum.
Ìn deze noordwestelijke hoek van Friesland wordt aan verschillende randvoorwaarden voldaan.
De belangrijkste is misschien wel dat de ontwikkelingen in de agrarische sector hier wellicht ook
de ontwikkeling van nieuwe meststoffen zullen stimuleren. Met name de glastuinbouw en de
aquacultures lijken veelbelovend. Daarnaast is er veel kennis beschikbaar bij de diverse (voor
een deel agrarische) kennisinstituten. De regio Leeuwarden kent bovendien een groot aantal
grotere bouwprojecten waaronder de watercampus en de kenniscampus. Ìn deze regio zijn nog
geen Nieuwe Sanitatie-projecten uitgevoerd. Aan de andere kant zijn zowel Wetsus als Wetter-
skip Fryslân nauw betrokken bij de projecten in Sneek.

Sneek
Sneek heeft duurzaamheid hoog in haar vaandel. Zij was de eerste gemeente in Friesland die
daadwerkelijk bereid was te investeren in een Nieuwe Sanitatie-project.
Ìn de Charrette Harinxmaland is gebruik van urine in de landbouw nadrukkelijk als optie voor
een duurzame ontwikkeling van de noord-west zijde van Sneek genoemd. Ook Sneek kent de
komende jaren nog een aantal grotere nieuwbouwprojecten. De afstand tot de kennisinstituten
is uiteraard wat groter maar vanuit de bestaande projecten wordt nog steeds intensief samen-
gewerkt waardoor die afstand in de praktijk mee zal vallen.
ACCEPTATIE
Charette
Project Nieuwe Sanitatie
In welke gebieden ligt het gebruik van urine in de landbouw het meest voor de hand en waarom?

03/4428
Pagina 61 van 75



Kansrijke pilot-
gebieden
Ìn de omgeving van Sneek vindt vooral melkveehouderij plaats. Deze vorm van landbouw zal
het minst snel behoefte hebben aan urine als additionele meststof.





















Figuur 5. Potentiële pilot gebieden
















03/4428
Pagina 62 van 75


11 Zware metalen in meststoffen - vergelij-
king van urine en zwart water met in Ne-
derland toegepaste meststoffen
Adriaan MeIs (LeAF), Iemke Bisschops (LeAF) en Bjartur Swart (Grontmij)
ApriI 2008

11.1 Samenvatting
Deze notitie bevat een inventarisatie van de concentraties en vrachten zware metalen in urine
en zwart water in relatie tot andere meststoffen die in Nederland worden gebruikt. Het gaat
hierbij om de zware metalen die in het BOOM (Besluit Overige Organische Meststoffen) worden
genoemd. Urine en zwartwater zijn vergeleken met toegestane meststoffen (dierlijke mest,
compost en minerale kunstmest) en niet toegestane meststof (zuiveringsslib). Er is een ver-
gelijking gemaakt tussen de vrachten metalen die via reguliere bemesting op landbouwgronden
worden gebracht en de fictieve vrachten bij toepassing van urine en zwartwater. Hierbij is uit-
gegaan van een gemiddelde Nederlandse bemestingsnorm. De notitie is op verzoek van
STOWA door LeAFopgesteld .

De studie beoogde in beeld te brengen of er sprake is van een ongelijke beoordeling van de
kwaliteit van compost en afvalwaterstromen (urine, zwart water, zuiveringsslib) versus dierlijke
meststoffen. Het gebruik van dierlijke meststoffen is gereguleerd op basis van een maximale
jaarlijkse nutriëntgift per hectare, terwijl de overige meststoffen worden gereguleerd op basis
van maximale gehaltes aan zware metalen via BOOM.

Uit de vergelijking wordt duidelijk dat zuiveringsslib relatief de vuilste stroom is en dat bemes-
ting met slib tot de hoogste vrachten leidt. Het gebruik van zuiveringsslib als meststof wordt
door het BOOM in Nederland niet meer toegepast. Op basis van dit onderzoek lijkt dat ook
terecht. Door het gebruik van de wel toegestane runder- en varkensdrijfmest worden echter
eveneens relatief hoge vrachten zware metalen (behalve kwik) op landbouwgronden gebracht.
Opmerkelijk, maar niet geheel nieuw is dat kunstmest ook veel zware metalen bevat; het gaat
onder andere om cadmium, chroom, lood en
arseen. Tot slot valt op dat pure urine wat betreft metalen relatief gezien een zeer schone mest-
stof is.

11.2 BesIuit Overige Organische Meststoffen (BOOM)
Voor de toelating van organische meststoffen voor gebruik in de landbouw geldt in Nederland
het BOOM (Besluit Overige Organische Meststoffen). De Europese comissie heeft een richtlijn
opgesteld voor toelaatbare gehaltes zware metalen die aanmerkelijk minder streng is.
De Europese richtlijn is in het Nederlandse recht omgezet door middel van het BOOM, dat per
1 januari 1993 in werking trad. Het oorspronkelijke BOOM-besluit is in 1998 vervangen, en gaat
in een aantal opzichten verder dan de eisen die de EU stelt. Zo zijn de maximaal toegestane
gehaltes van zuiveringsslib voor gebruik in de landbouw aanzienlijk lager dan die van de Richt-
lijn, en staat het BOOM-besluit niet toe dat
zuiveringsslib op niet-landbouwgrond wordt toegepast.

Ìn Tabel 2 worden de maximale gehaltes zware metalen en het minimale organische stof
gehalte volgens EU richtlijn 86/278 en BOOM. Ter vergelijking staan ook de BOOM-eisen voor
compost vermeld.
Zware metalen in meststoffen ÷ vergelijking van urine en zwart water met in Nederland toegepaste meststoffen

03/4428
Pagina 63 van 75


Er zijn voor zover bekend nog geen richtlijnen opgesteld voor de toepassing van (vergiste)
menselijke urine en feces in de landbouw in Nederland of in de EU. De stroom waar wel een
richtlijn voor is en die het meeste raakvlak heeft met het dit type meststof is
zuiveringsslib.
Op het gebruik van zuiveringsslib zijn zowel Nederlandse als Europese richtlijnen van toepas-
sing.

Tabel 2 ÷ Eisen aan organische meststoffen voor wat betreft het minimale organische stof (OS) gehalte en de maximale
gehaltes zware metalen en arseen (in mg/kg DS) volgens EU richtlijnen en het BOOM-besluit.
EU richtlijn 86/278 BOOM BOOM BOOM
Zuiveringsslib Zuiveringsslib Compost Zeer schone compost
OS - 50% van DS 20% van DS 20% van DS
Cd 20-40 1,25 1 0,7
Cr - 75 50 50
Cu 1000-1750 75 60 25
Hg 16-25 0,75 0,3 0,2
Ni 300-400 30 20 10
Pb 750-1200 100 100 65
Zn 2500-4000 300 200 75
As - 15 15 5

Zware metaIen in meststoffen
De concentraties zware metalen uit het BOOM en waar beschikbaar ook die van arseen in
meststoffen zoals gevonden in verschillende bronnen worden op de volgende pagina's in ver-
schillende tabellen weergegeven.

ZuiveringssIib
Tabel 3 - Concentraties van N, P en zware metalen in zuiveringsslib in Nederland, gemiddelden van de periode 2001-
2005 (CBS, 2007) en in granulaat gemaakt van zuiveringsslib (GMB, 2006).
CBS GMB-granulaat
Mg/kg DS mg/kg N mg/kg P mg/kg DS mg/kg N mg/kg P
Cd 1,5 30 66 1,6 38 42
Cr 42,8 870 1885 52,0 1232 1358
Cu 389,4 7915 17154 584,5 13851 15261
Hg 1,1 22 48 1,2 27 30
Ni 29,7 604 1308 33,5 794 875
Pb 134,2 2728 5912 125,5 2974 3277
Zn 993,8 20199 43780 1151,0 27275 30052
As 9,0 183 396 9,3 219 242

Gescheiden huishoudeIijk afvaIwater (urine, feces en grijs water)

Tabel 4 - Procentuele verdeling van zware metalen over urine, feces en grijs water in Denemarken (Holtze en Backlund,
2002).
Urine (%) Feces (%) Grijs water (%)
Cd 0,6 5,4 94,1
Cr 0,3 0,7 99,0
Cu 1,4 15,3 83,3
Hg 3,0 46,1 51,0
Ni 0,3 3,6 96,1
Pb 0,06 0,66 99,28
Zn 0,1 24,4 75,5
As - - -

Zware metalen in meststoffen ÷ vergelijking van urine en zwart water met in Nederland toegepaste meststoffen

03/4428
Pagina 64 van 75


Tabel 5 - Concentraties zware metalen in urine en feces in Denemarken (Holtze en Backlund, 2002).
Urine Feces
Mg/kg DS mg/kg N mg/kg P mg/kg DS mg/kg N mg/kg P
Cd 0,02 0,1 1,0 0,2 6,8 20,2
Cr 0,2 0,9 10,1 0,4 13,3 39,9
Cu 1,7 9,2 101,4 22,3 733,6 2197
Hg 0,02 0,1 1,4 0,4 13,9 41,5
Ni 0,1 0,6 7,1 1,5 49,3 147,5
Pb 0,03 0,2 1,9 0,4 13,3 40
Zn 0,7 4,0 43,8 219 7193 21541
As - - - - - -

Tabel 6 - Concentraties zware metalen in urine met een weinig spoelwater, feces inclusief toiletpapier, en grijs water in
een blok van 80 inwoners* in Zweden (Palmquist en Jönsson, 2003).
Urine + beetje water Feces + toiletpapier Grijs water
Mg/kg N mg/kg P mg/kg N mg/kg P mg/kg N mg/kg P
Cd 0,02 0,31 8,1 23 10,6 27
Cr 0,04 0,66 69 196 292 739
Cu 4,5 68,6 889 2530 4566 11550
Hg 0,04 0,65 4,6 13 2,1 5,3
Ni 1,1 16,6 117 330 462 1170
Pb 1,1 16,9 19 54 168 425
Zn 28 426 24** 67700** 4891 12370
As - - - - - -
* Project met gescheiden inzameling te Gebers, Zweden.
** De hoge concentratie zink is waarschijnlijk te wijten aan corrosie van gegalvaniseerde pijpen in het systeem.

Zwart water
Tabel 7 - Concentraties zware metalen in zwart water, getallen zijn een compilatie van de gegevens uit verschillende
publicaties (Skjelhaugen, 1999; Svensson en Blom, 2001; Kujawa, 2005).
mg / kg N mg / kg P
Cd 1,1 ÷ 4,2 6,8 ÷ 28,6
Cr 10,4 ÷ 34,7 100 ÷ 238
Cu 113 ÷ 701 727 ÷ 4810
Hg < dl ÷ 0,7 < dl ÷ 4,7
Ni 18,8 ÷ 31,9 150 ÷ 219
Pb 15,0 ÷ 50,0 114 ÷ 343
Zn 753 - 2438 7685 ÷ 16714
As - -

DierIijke mest

Tabel 8 - Concentraties zware metalen in dierlijke mest in Nederland in mg/kg DS (Delahaye et al., 2003).
Cd Cr Cu Hg Ni Pb Zn As
Melkvee regio Noord en West 0,21 8,0 42 0,04 11,0 14,0 166 -
Vleesvarkens (droog voer) 0,31 14,0 381 0,03 22,0 18,0 619 -
Leghennenbandmest 0,20 6,2 61 0,02 9,7 11,4 394 -



Zware metalen in meststoffen ÷ vergelijking van urine en zwart water met in Nederland toegepaste meststoffen

03/4428
Pagina 65 van 75


Tabel 9 - Concentraties zware metalen in dierlijke mest, getallen uit van Dooren et al. 2005 (a), Kool et al. 2006 (b) en
McBride en Spiers, 2001 (c).
Mg / kg N (ref. a, b) mg / kg P (van P2O5) (ref. a, b) mg / kg P
tot
(ref. c)
Runderdrijfmest Varkensdrijfmest Runderdrijfmest Varkensdrijfmest Runderdrijfmest
Cd 5,6 5,3 32,7 19,1 25
Cr 194 1145 - 573
Cu 2444 5114 14397 18546 17310
Hg - - - - 2,5
Ni 250 - 1472 - 996
Pb 118 - 695 - 274
Zn 4406 13124 25947 47593 23786
As - - - - 162

Compost
Tabel 10 - Concentraties zware metalen in composten (Nicholson et al. 2006 (a), Delahaye et al., 2003 (b), Veeken,
1998 (c)).
Cd Cr Cu Hg Ni Pb Zn Ref.
Compost (mg/kg ds)
1
0.7 50 25 0.2 10 65 75 (a)
Gft-compost (mg/kg) 0,26 9,9 19,1 0,079 4,6 37,0 103,6 (b)
Gft-compost (mg/kg DS) 0,8 16 35 - 9 85 134 (c)
Champost (mg/kg) 0,13 4,8 9,9 0,016 1,0 4,2 48,0 (b)
Overige compost (mg/kg d.s.)
2
0,44 15,4 21,8 0,138 10,2 44,2 122,4 (b)
1
Aanname: 40% DS
2
Bloembollenafval, afval uit de glastuinbouw en heideplaggen.
Tabel 11 - Gehaltes zware metalen in gft-compost en champost gerelateerd en gemiddelde N- en P-waarden voor beide
composten (gehalte zware metalen uit Delahaye et al., 2003; gehalte N en P uit Kroonen en de Haan).
Gft-compost Champost
mg / kg N mg / kg P (uit P
2
O
5
) mg / kg N mg / kg P (uit P
2
O
5
)
Cd 30,6 161 22,4 93,0
Cr 1165 6128 828 3435
Cu 2247 11823 1707 7086
Hg 9,3 48,9 2,8 11,5
Ni 541 2847 172 716
Pb 4353 22903 724 3006
Zn 12188 64129 8276 34355
As - - - -

Tabel 12 - Vrachten zware metalen uit composten naar de bodem in het jaar 2000 (Delahaye et al., 2003).
Vracht (1000 kg)

Afzet
mln kg
Cd Cu Zn Pb Hg Cr Ni
Gft-compost 309 0,080 5,90 32,0 11,42 0,024 3,06 1,43
Champost 600 0,077 5,95 28,8 2,50 0,010 2,88 0,58
Overige compost 150 0,066 3,27 18,4 6,63 0,021 2,31 1,53
Totaal compost 0,22 15,1 79,2 20,5 0,05 8,2 3,5

Zware metalen in meststoffen ÷ vergelijking van urine en zwart water met in Nederland toegepaste meststoffen

03/4428
Pagina 66 van 75


Struviet
Tabel 13 - Concentraties zware metalen in struviet (Leeuw, 2007).
mg/kg DS µg/kg N µg/kg P
Cd 0.2 0.002 0.001
Cr 2.7 0.025 0.017
Cu 9.5 0.090 0.061
Hg <0.05 - -
Ni 1.5 0.014 0.009
Pb 0.8 0.008 0.005
Zn 76.5 0.729 0.494
As <1 - -

Kunstmest
Tabel 14 - Typische gehaltes zware metalen in verschillende soorten kunstmesten (Remy en Ruhland, 2006) en
gehaltes in één bepaalde soort (Palmquist en Jönsson, 2003).
Cd Cr Cu Hg Ni Pb Zn As
N - meststof (mg/kg N) 6,0 77,9 26,0 0,1 20,9 54,9 203 9,3
P - meststof (mg/kg P
2
O
5
) 39,5 543 90,5 0,3 88,3 67,0 839 14,5
P - meststof (mg/kg P) 90,5 1245 207 0,7 202 154 1923 33,2
K - meststof (mg/kg K
2
O) 0,1 5,8 4,8 0,0 2,5 0,8 6,2 0,1
K - meststof (mg/kg K) 0,2 10,5 8,7 0,1 4,5 1,5 11,3 0,2
Kalk (mg/kg CaO) 0,5 14,7 14,6 0,1 10,5 9,7 66,9 0,1
Kalk (mg/kg Ca) 0,7 20,6 20,4 0,1 14,7 13,6 93,6 0,1
NPK-S 21-4-7 (mg/kg N) 0,2 37,0 6,9 0,0 22,0 2,0 76,0 -
NPK-S 21-4-7 (mg/kg P) 0,1 12,0 2,3 0,0 7,0 0,7 25,0 -

Vrachten zware metaIen

De bemestingsnormen aangenomen voor deze studie zijn: 205 kg N per ha per jaar en 65 kg P
per ha per jaar. De jaarlijkse vrachten zijn zowel op basis van N als op basis van P berekend.
Alle getallen staan in grammen metaal per hectare per jaar, behalve voor struviet.

Zuiveringsslib GMB-granulaat van slib
Berekend op basis van N P N P
Cd 6,3 4,3 7,8 2,7
Cr 178 123 253 88
Cu 1623 1115 2839 992
Hg 4,6 3,1 5,6 2,0
Ni 124 85 163 57
Pb 559 384 610 213
Zn 4141 2846 5591 1953
As 38 26 45 16












Zware metalen in meststoffen ÷ vergelijking van urine en zwart water met in Nederland toegepaste meststoffen

03/4428
Pagina 67 van 75



Urine Feces
Berekend op basis van N P N P
Cd 0,01 0,04 1,53 1,40
Cr 0,10 0,35 8,44 7,67
Cu 1,40 5,53 166,3 153,6
Hg 0,01 0,07 1,90 1,77
Ni 0,17 0,77 17,05 15,52
Pb 0,13 0,61 3,31 3,06
Zn 3,28 15,27 739,8 2900
Zwart water
Berekend op basis van N P
Cd 0,22 ÷ 0,85 0,44 ÷ 1,86
Cr 2,14 ÷ 7,12 6,50 ÷ 15,5
Cu 23,3 ÷ 143,8 47,3 ÷ 313
Hg 0 ÷ 0,15 0 ÷ 0,30
Ni 3,84 ÷ 6,55 9,75 ÷ 14,2
Pb 3,08 ÷ 10,25 7,39 ÷ 22,3
Zn 154 ÷ 500 500 - 1086

Struviet (vracht in µg / ha.jaar)
Berekend op basis van N P
Cd 0.4 0.1
Cr 5.2 1.1
Cu 18.5 4.0
Hg < dl < dl
Ni 2.8 0.6
Pb 1.6 0.3
Zn 149.4 32.1

N-kunstmest P-kunstmest Kunstmest NPK-S 21-4-7
Berekend op basis van N P N P
Cd 1,23 6 0,05 0,01
Cr 16,0 81 7,59 0,78
Cu 5,33 13 1,41 0,15
Hg 0,014 0,045 0,008 0,001
Ni 4,28 13 4,51 0,46
Pb 11,3 10 0,41 0,05
Zn 41,6 125 15,6 1,63
As 1,91 2,2 - -

N P uit P
2
O
5
P
Runderdrijfmest Varkensmest Runderdrijfmest Varkensmest Runderdrijfmest
Cd 1,14 1,08 2,13 1,24 1,62
Cr 39,9 - 74,4 - 37,2
Cu 501 1048 936 1205 1125
Hg - - - - 0,16
Ni 51,3 - 95,7 - 64,8
Pb 24,2 - 45,2 - 17,8
Zn 903 2690 1687 3094 1546
As - - - - 10,5


Zware metalen in meststoffen ÷ vergelijking van urine en zwart water met in Nederland toegepaste meststoffen

03/4428
Pagina 68 van 75


Gft-compost Champost
Berekend op basis van N P N P
Cd 6,3 10,5 4,6 6,0
Cr 239 398 170 223
Cu 461 768 350 461
Hg 1,9 3,2 0,6 0,7
Ni 111 185 35 47
Pb 892 1489 148 195
Zn 2499 4168 1697 2233
As - - - -

11.3 VergeIijking
Ìn de onderstaande grafiek is een vergelijking gemaakt van de vrachten zware metalen bij een
fosfaatgift van 65 kg P per ha per jaar voor zuiveringsslib, runderdrijfmest, kunstmest, feces en
urine. (NB: de schaal is logaritmisch.)

Duidelijk wordt dat zuiveringsslib relatief de vuilste stroom is en dat bemesting met slib tot de
hoogste vrachten leidt. Het gebruik van zuiveringsslib als meststof wordt door het BOOM in
Nederland niet meer toegepast en het meeste slib wordt momenteel verbrand in speciale
installaties. Opvallend is dat door met runderdrijfmest relatief hoge vrachten van alle metalen
behalve kwik op landbouw-gronden worden gebracht. Ook via kunstmest komen vooral voor
cadmium, chroom, lood en arseen relatief hoge vrachten op landbouwgronden terecht. Een op-
vallende conclusie is dat pure urine een zeer schone meststof is.


11.4 Referenties
CBS, Centraal Bureau voor de Statistiek, Statline, Voorburg/Heerlen 2007-11-30

Delahaye R., Fong P.K.N., van Eerdt M.M., van der Hoek K.W., Olsthoorn C.S.M. (2003)
Emissie van zeven zware metalen naar landbouwgrond. Eindrapport en eindbijlagen. Centraal
Bureau voor de Statistiek, Voorburg/Heerlen.

Dooren van H.J.C., Hanegraaf M.C., Blanken K. (2005) Emissies en compostkwaliteit bij com-
postering van runderdrijfmest, PraktijkRapport Rundvee 68

GMB Slibverwerking (2006) Jaarverslag 2006.

Vrachten zware metaIen bij een gift van 65 kg
P / ha per jaar
0.01 0.10 1.00 10.00 100.00 1000.00 10000.00
Cd
Cr
Cu
Hg
Ni
Pb
Zn
As
Vracht (g/ha.j)
Zuiveringsslib
Runderdrijfmest
Kunstmest (P-bemester)
Feces
Urine
Zware metalen in meststoffen ÷ vergelijking van urine en zwart water met in Nederland toegepaste meststoffen

03/4428
Pagina 69 van 75


Holtze A., Backlund A. (2002) Opsamling, opbevaring og udnyttelse af urin fra Museumsgården
på Møn, Økologisk byfornyelse og spildevandsrensning, Nr. 23. Miljøstyrelsen.

Kool A., van der Putten A.H.J., van der Schans F.C. (2006) Mestverwerking in Wintelre - De
plussen en minnen. Project Duurzame Watersystemen in het Benelux Middengebied.

Kroonen B. de Haan J. (2006) Brochure Een goed stikstofbeheer is geld waard! Maïsteler, haal
meer stikstof uit de bodem! Praktijkonderzoek Plant & Omgeving.

Kujawa K. (2005) Anaerobic treatment of concentrated wastewater in DESAR concepts.
STOWA rapport 2005-14.

Leeuw, E. (2007) Gehaltes zware metalen en arseen in struviet, analyseresultaten.

McBride M.B., Spiers G. (2001) Trace element content of selected fertilizers and dairy manures
as determined by ÌCP-MS, Communications in Soil Science and Plant Analysis, 32:1, 139-156.

Nicholson F.A., Smith S.R., Alloway B.J., Carlton-Smith C., Chambers B.J. (2006) Quantifying
heavy metal inputs to agricultural soils in England and Wales. Water and Environment Journal
20, 87-95.

Palmquist, H. and Jönsson, H. (2003) Urine, faeces, greywater and biodegradable waste as
potential fertilisers", 2nd Ìnternational Symposium on Ecological Sanitation, 7-11 April, Lübeck,
Germany.

Remy C., Ruhland A. (2006) Ecological assessment of alternative sanitation concepts with Life
Cycle Assessment. Technische Universität Berlin, Ìnstitute of Environmental Technology, De-
partment of Water Quality Control. Final report for subtask 5 of the demonstration project ¨Sa-
nitation Concepts for Separate Treatment of Urine, Faeces and Greywater¨ (SCST).

Skjelhaugen O. J. (1999) A Farmer-operated System for Recycling Organic Wastes, J. Agric.
Engng Res. 73: 373-382.

Svensson S.E., Blom A. (2001) A method to evaluate blackwater as a fertilizer in agriculture, in:
On-Site Wastewater Treatment, Proceedings Ninth National Symposium on Ìndividual and
Small Community Sewage Systems, 11-14 March 2001, Fort Worth, Texas, USA. pp. 547-553.

WHO (2006) Guidelines for the safe use of wastwater, excreta and greywater. Volume 4:
Excreta and greywater use in agriculture.



















0
3
/
4
4
2
8
P
a
g
i
n
a

7
0

v
a
n

7
5

1
1
.
5

B
i
j
I
a
g
e

-

A
a
n
v
o
e
r

v
a
n

z
w
a
r
e

m
e
t
a
I
e
n

m
e
t

k
u
n
s
t
m
e
s
t

e
n

c
o
m
p
o
s
t

i
n

h
e
t

j
a
a
r

2
0
0
0




G
e
h
a
l
t
e

(
m
g
/
k
g
)

V
r
a
c
h
t

(
1
0
0
0

k
g
)


C
d

C
u

Z
n

P
b

H
g

C
r

N
i

A
f
z
e
t

m
l
n

k
g

C
d

C
u

Z
n

P
b

H
g

C
r

N
i

S
t
i
k
s
t
o
f
m
e
s
t
s
t
o
f
f
e
n

(
a
l
s

N
)

2
)









2
8
5









k
a
l
k
a
m
m
o
n
s
a
l
p
e
t
e
r


0
,
3
7


1
,
7


6
,
8


2
,
7


0
,
3
7
0


5
,
6


3
9
,
8


2
5
1


0
,
0
9
3


0
,
4
2
7


1
,
7
1


0
,
6
7
8


0
,
0
9
3
0


1
,
4
0


1
0
,
0
0

s
t
i
k
s
t
o
f
m
a
g
n
e
s
i
a


0
,
9
0


3
,
4


1
3
,
6


5
,
9


0
,
0
0
0


7
,
3


7
,
3


1
7


0
,
0
1
6


0
,
0
5
9


0
,
2
3


0
,
1
0
2


0
,
0
0
0
0


0
,
1
3


0
,
1
3

o
v
e
r
i
g
e

s
t
i
k
s
t
o
f
m
e
s
t
s
t
o
f
f
e
n


0
,
9
0


3
,
4


1
3
,
6


5
,
9


0
,
4
1
0


1
5
9
,
9


3
3
1
,
5


1
7


0
,
0
1
5


0
,
0
5
7


0
,
2
3


0
,
0
9
8


0
,
0
0
6
8


2
,
6
6


5
,
5
2


T
o
t
a
a
l

s
t
i
k
s
t
o
f
m
e
s
t
s
t
o
f
f
e
n










0
,
1
2
3


0
,
5
4
2


2
,
1
7


0
,
8
7
8


0
,
0
9
9
8


4
,
1
8


1
5
,
6
4


F
o
s
f
o
r
z
u
u
r
m
e
s
t
s
t
o
f
f
e
n

(
a
l
s

P
2
O
5
)









6
2









s
u
p
e
r
f
o
s
f
a
a
t


6
1
,
3
0


7
5
,
2


1
3
6
3
,
0


4
7
,
0


1
,
4
5
0


5
1
5
,
0


9
5
,
0


1


0
,
0
8
6


0
,
1
0
6


1
,
9
2


0
,
0
6
6


0
,
0
0
2
0


0
,
7
3


0
,
1
3

t
r
i
p
e
l

s
u
p
e
r
f
o
s
f
a
a
t


5
8
,
1
0


6
6
,
0


1
2
1
6
,
0


1
1
,
7


0
,
0
4
7


4
9
0
,
0


9
0
,
0


6


0
,
3
3
5


0
,
3
8
0


7
,
0
1


0
,
0
6
7


0
,
0
0
0
3


2
,
8
2


0
,
5
2

t
h
o
m
a
s
s
l
a
k
k
e
n
m
e
e
l


3
,
2
0


2
1
6
,
0


7
1
0
,
0


2
3
6
,
5


0
,
1
5
3


1
5
2
9
0
,
0


8
8
,
0


0


0
,
0
0
0


0
,
0
0
0


0
,
0
0


0
,
0
0
0


0
,
0
0
0
0


0
,
0
0


0
,
0
0

o
v
e
r
i
g
e

N
P
K
-
,

N
P
-

e
n

P
K
-
m
e
s
t


2
4
,
2
0


5
4
,
0


4
7
1
,
0


4
6
,
5


0
,
4
2
4


2
7
1
,
0


6
4
,
0


4
4


1
,
0
7
4


2
,
3
9
7


2
0
,
9
1


2
,
0
6
4


0
,
0
1
8
8


1
2
,
0
3


2
,
8
4

o
v
e
r
i
g
e

f
o
s
f
o
r
z
u
u
r
m
e
s
t
s
t
o
f
f
e
n


1
5
,
1
0


5
2
,
0


3
1
1
,
0


5
,
5


0
,
0
4
4


2
6
3
,
0


4
8
,
0


1
1


0
,
1
6
1


0
,
5
5
5


3
,
3
2


0
,
0
5
9


0
,
0
0
0
5


2
,
8
1


0
,
5
1


T
o
t
a
a
l

f
o
s
f
o
r
z
u
u
r
m
e
s
t
s
t
o
f
f
e
n










1
,
6
5
7


3
,
4
3
9


3
3
,
1
6


2
,
2
5
7


0
,
0
0
2
5


1
8
,
3
9


4
,
0
1


K
a
l
i
m
e
s
t
s
t
o
f
f
e
n

(
a
l
s

K
2
O
)

3
)









3
2









r
u
w

k
a
l
i
z
o
u
t


0
,
4
5


0
,
3


2
8
,
5


2
0
,
0


0
,
0
0
0


5
,
9


0
,
0


0


0
,
0
0
0


0
,
0
0
0


0
,
0
1


0
,
0
0
8


0
,
0
0
0
0


0
,
0
0


0
,
0
0

k
a
l
i
u
m
c
h
l
o
r
i
d
e

4
0


0
,
4
0


0
,
3


6
0
,
0


1
1
,
0


0
,
0
0
0


3
,
7


7
,
4


2


0
,
0
0
1


0
,
0
0
0


0
,
1
0


0
,
0
1
8


0
,
0
0
0
0


0
,
0
1


0
,
0
1

k
a
l
i
u
m
c
h
l
o
r
i
d
e

6
0


0
,
1
3


0
,
3


8
,
4


1
,
2


0
,
0
0
0


0
,
1


3
,
9


1
8


0
,
0
0
2


0
,
0
0
5


0
,
1
5


0
,
0
2
2


0
,
0
0
0
0


0
,
0
0


0
,
0
7

p
a
t
e
n
t
k
a
l
i


0
,
0
3


0
,
3


0
,
3


1
,
8


0
,
0
0
0


0
,
5


1
,
2


6


0
,
0
0
0


0
,
0
0
2


0
,
0
0


0
,
0
1
1


0
,
0
0
0
0


0
,
0
0


0
,
0
1

o
v
e
r
i
g
e

k
a
l
i
m
e
s
t
s
t
o
f
f
e
n


0
,
1
3


0
,
3


8
,
4


1
,
2


0
,
8
1
0


7
,
4


4
5
,
2


6


0
,
0
0
1


0
,
0
0
2


0
,
0
5


0
,
0
0
7


0
,
0
0
4
5


0
,
0
4


0
,
2
5


T
o
t
a
a
l

k
a
l
i
m
e
s
t
s
t
o
f
f
e
n










0
,
0
0
4


0
,
0
0
9


0
,
3
1


0
,
0
6
5


0
,
0
0
4
5


0
,
0
5


0
,
3
4


K
a
l
k
m
e
s
t
s
t
o
f
f
e
n

(
a
l
s

z
.
b
.
w
.
)

4
)









1
7
1









s
c
h
u
i
m
a
a
r
d
e


1
,
6
5


4
5
,
0


1
7
9
,
0


1
1
,
3


0
,
0
1
5


3
2
,
5


5
,
0


9
2


0
,
1
5
2


4
,
1
4
0


1
6
,
4
7


1
,
0
3
5


0
,
0
0
1
4


2
,
9
9


0
,
4
6

k
o
o
l
z
u
r
e

l
a
n
d
b
o
u
w
k
a
l
k

+

k
a
l
k
m
e
r
g
e
l


0
,
1
9


6
,
8


1
5
,
0


1
,
4


0
,
0
0
5


0
,
8


1
,
7


3
0


0
,
0
0
6


0
,
2
0
5


0
,
4
5


0
,
0
4
1


0
,
0
0
0
2


0
,
0
2


0
,
0
5

k
o
o
l
z
u
r
e

m
a
g
n
e
s
i
a
k
a
l
k


0
,
3
6


4
,
1


5
7
,
3


1
1
,
9


0
,
0
0
5


1
,
0


3
,
2


3
8


0
,
0
1
4


0
,
1
5
8


2
,
2
0


0
,
4
5
6


0
,
0
0
0
2


0
,
0
4


0
,
1
2

m
a
g
n
e
s
i
a
k
a
l
k
m
e
r
g
e
l


0
,
0
4


0
,
0


2
1
,
1


1
0
,
2


0
,
0
1
0


0
,
8


0
,
6


8


0
,
0
0
0


0
,
0
0
0


0
,
1
6


0
,
0
7
8


0
,
0
0
0
1


0
,
0
1


0
,
0
0

n
a
t
t
e

k
a
l
k
s
l
i
b


1
,
3
5


4
4
,
0


1
3
4
,
0


1
8
,
3


0
,
0
0
0


7
,
3


4
8
,
0


1


0
,
0
0
2


0
,
0
5
5


0
,
1
7


0
,
0
2
3


0
,
0
0
0
0


0
,
0
1


0
,
0
6

o
v
e
r
i
g
e

k
a
l
k
m
e
s
t
s
t
o
f
f
e
n


1
,
2
5


1
0
,
0


2
3
7
,
0


3
9
,
0


0
,
0
0
5


3
2
,
5


5
,
0


2


0
,
0
0
2


0
,
0
1
4


0
,
3
4


0
,
0
5
5


0
,
0
0
0
0


0
,
0
5


0
,
0
1


T
o
t
a
a
l

k
a
l
k
m
e
s
t
s
t
o
f
f
e
n










0
,
1
7
5


4
,
5
7


1
9
,
7
8


1
,
6
8
8


0
,
0
0
1
8


3
,
1
1


0
,
7
1


B
r
o
n
:

D
e
l
a
h
a
y
e

e
t

a
l
.



03/4428
Pagina 71 van 75



12 8ynthese
12.1 InIeiding
Bij de ontwikkelingen die momenteel in de waterketen plaats vinden (zie ook de strategienota
¨Anders omgaan met huishoudelijk afvalwater¨ Stowa 2008) wordt nadrukkelijk nagegaan op
welke wijze afvalwater kan worden hergebruikt. Veel aandacht gaat daarbij uit naar energie en
nutriënten/meststfoffen. Urine is een relatief kleine afvalwaterstroom maar bevat wel het
merendeel aan nutriënten. Verschillende onderzoeken en pilotprojecten richten zich nu op de
mogelijkheden om urine separaat in te zamelen en te verwerken. Het is echter eveneens van
belang een beeld te hebben van de potenties die urine zou kunnen hebben als meststof in de
landbouw. Deze verkenning van de provincie Fryslân richt zich daar op.

Vanuit verschillende invalshoeken is door de essayisten naar urine als potentiële meststof voor
de landbouw gekeken. Elk van hen heeft daarbij van uit zijn eigen specifieke invalshoek met
eigen kennis en inzichten de ins en outs belicht. De essay's waren primair bedoeld om aan te
geven wat de relevante thema's zijn waar uiteindelijk bij het beantwoorden van de vraag aan-
dacht aan moet worden besteedt. Ze moesten inzicht geven in wat we al weten en waar de
vragen liggen. Vragen die wellicht op korte termijn moeten worden beantwoord en vragen die
wellicht in de tijd, als uitvloeisel van pilotprojecten, vanzelf beantwoord zullen worden.
De essay's belichten, maar dat was ook onze vraag, nadrukkelijk de waarde die urine kan
hebben in de wereld van de meststoffen, de plek die het kan innemen en de teelten die wellicht
een meer dan gemiddeld belang kunnen hebben bij urine. Toegevoegd is nog een artikel over
de zware metalen in de verschillende meststromen.
De essays belichten daarnaast de consequenties die met het gebruik van urine samenhangen.
Ìngezoomd is op het transport, de maatschappelijke acceptatie en niet geheel onbelangrijk de
kosten/baten voor de huidige afvalwaterbeheerder.

De teneur van essays is positief. Geen van de essayisten schiet de mogelijkheid van urine als
meststof in de landbouw vanuit zijn eigen expertise op grond van argumenten af. Sterker! Alle
essayisten zien nadrukkelijk de kansen, de nieuwe gebruiksmogelijkheden. Dat is natuurlijk
veelbelovend. Het inspireert om na te gaan welke stappen er nu moeten worden gezet. Maar
we weten nog niet alles en de komende tijd zal dan ook besteed moeten worden aan het
beantwoorden van de meest relevante vragen.

Urine (en de stoffen die er in zitten) zijn nu reeds breed toepasbaar in de hedendaagse land-
bouw. Er is ook al de nodige ervaring mee opgedaan. Met name veel stikstof vragende gewas-
sen lijken baat te hebben bij urine als meststof. Maar van belang is wel om met name van uit
de fysiologie van de plant goed na te denken over hoe de meststoffen uit urine het beste ter
beschikking kunnen worden gesteld van de plant ( bijvoorbeeld pure urine, aangezuurde urine,
ingedikt als urivit of struviet), op welke wijze het dan moet worden toegediend (verspreid over
het land of geïnjecteerd met een soort zodenbemester) en tot slot in welke vorm de meststof
zou moeten worden aangeleverd (als geconcentreerde vloeistof of juist in korrelvorm).
De keuzes die daarin gemaakt moeten gaan worden zullen voor een heel belangrijk deel
gewasafhankelijk zijn. Op dit punt is nader onderzoek zeker noodzakelijk.

Bij de beoordeling in welke mate urine in de toekomst belangrijk zou kunnen worden is het van
belang urine te plaatsen in de context van het totale aanbod aan ¨dierlijke meststoffen¨. Urine
zal daarin een eigen plek moeten verwerven. Dat kan vanwege de specifieke kwaliteiten van
urine maar er zal ook een duidelijke concurrentie zijn met kunstmest.

Synthese

03/4428
Pagina 72 van 75


De potentie voor de toekomst is ook afhankelijk van de bijdrage die urine aan de totale mest-
behoefte in Nederland zou kunnen leveren. Ìmmers zolang het een niche-product blijft zal de wil
om te investeren in nieuwe producten en technologieën gering zijn. Ìn het essay van Hein ten
Berge wordt de totale maximale N en P bijdrage van urine aan de mestmarkt becijferd op
respectievelijk 5-9% en 11-16%. Er van uitgaande dat deze hoeveelheid dan niet meer
geïmporteerd hoeft te worden en de netto N en P ballans voor Nederland daarmee wordt ver-
minderd lijkt het effect zowel op de totale meststoffen vracht als op de emissies naar het milieu
zeker significant.

Er zijn ook een aantal belangrijke ontwikkelingen die het gebruik van urine in de landbouw
positief zouden kunnen beïnvloeden.
• Er is een duidelijke trend om steeds meer te streven naar het sluiten van kringlopen.
De opkomst van het begrip Cradle to Cradle (C2C) is daarvan een goed voorbeeld. Afval =
Voedsel wordt met het benutten van een afvalwaterstroom voor de voedselproductie wel
heel letterlijk genomen. Maar de mate waarin de politiek het C2C concept momenteel om-
armt zorgt er voor dat er een beleidsklimaat ontstaat waar benutting van urine zich goed in
kan ontwikkelen.
• Ìn tegenstelling tot nitraat (dat vrij goedkoop) uit een eindeloze bron luchtstikstof kan worden
gewonnen is fosfaat een mineraal waarvan de wereldvoorraden langzaam uitgeput raken.
Algemeen wordt verwacht dat de schaarste aan fosfaat de prijs zal doen stijgen en het
zoeken naar nieuwe fosfaatbronnen zal stimuleren. Terugwinnen van fosfaat (bijvoorbeeld
als struviet) uit urine lijkt daarmee ook vanuit de grondstoffen markt een impuls te kunnen
krijgen. Niet voor niets is inmiddels een groot kunstmestconcern betrokken bij de toepassing
van uit urine gewonnen struviet op sportvelden.
• Ìn de landbouw vinden ontwikkelingen plaats in de richting van precisielandbouw, speciale
meststoffen en nieuwe doseer- en aanvoertechnieken (sleepslangen). Juist vloeibare mest-
stoffen zouden in die ontwikkeling wel eens een toenemende rol kunnen gaan spelen.

Toch ligt de toekomst voor urine in de landbouw niet geheel open. De huidige wet en regel-
geving ten aanzien van afvalwater en meststoffen zijn op dit moment in ieder geval niet
stimulerend en werken vooral, mede door de onduidelijke positie van urine daarin, eerder
belemmerend. Onderzocht zou moeten worden op welke manier zowel de afvalstoffenwet- en
regelgeving als de meststoffenwet- en regelgeving zodanig kunnen worden aangepast dat het
hergebruik van waardevolle mineralen uit afvalstoffen op een goede manier kan worden
gestimuleerd.

Een specifieke toepassing van urine kan wellicht worden gevonden in de toekomstige aqua-
cultures. Dit is een nieuwe bedrijfstak met een brede scope van uiteenlopende producten (van
algen voor biodiesel tot zagers voor de Spaanse markt en zeekraal voor het culi-restaurant. De
technologieën voor aquacultures zijn momenteel sterk in ontwikkeling.
Er is nog geen standaard, ook niet ten aanzien van de aan die cultures toe te voegen voeding-
stoffen. Ìn die zin zou de ontwikkeling van urine als specifieke meststof voor aquacultures goed
kunnen worden meegenomen. De eerste proeven op dit vlak zijn inmiddels uitgevoerd.

Ten opzichte van gangbare meststoffen lijkt urine of producten daarvan ook een aantal voor-
delen te bieden. Zo geeft Liedeke Vergouwen aan dat uit urine gewonnen struviet voor
sommige gewassen mogelijk een betere fosfaatleverancier zou kunnen zijn dan gangbare
(kunst)meststoffen. Urine scoort in het algemeen ook aanzienlijk beter ten aanzien van het
gehalte aan zware metalen. Ten opzichte van andere ¨natuurlijk¨ meststoffen maar ook ten op-
zichte van kunstmest is het gehalte aan zware metalen in urine zeer laag. Gerekend naar
vrachten zware metalen scoort urine aanzienlijk beter dan alle andere meststoffen.

Een apart aandachtsveld vormen de in urine aanwezige medicijnresten en hormonen.
Op verschillende plaatsen is en wordt onderzoek gedaan naar het voorkomen, optredende
concentraties, afbraakprocessen en opname door de plant. De resultaten zijn nog niet een-
duidig. Dit komt onder andere door de grote variabiliteit in de medicijnen en hun eigenschappen
en de grote verschillen in onderzoeksmethoden. De mate waarin medicijnresten en hormonen
een probleem zouden kunnen vormen is mede afhankelijk van de wijze waarop urine in de land-
bouw wordt gebruikt.
Synthese

03/4428
Pagina 73 van 75


Het wordt anders beoordeeld bij de teelt van oesters dan bij de teelt van koolzaad voor diesel-
olie. Daarbij zijn er goede en eenvoudige technieken beschikbaar om medicijnresten en
hormonen eventueel te verwijderen. Ìn Sleen wordt dit momenteel onderzocht. Overigens valt
vanuit het perspectief van het medicijngebruik van landbouwhuisdieren de bijdrage van humane
urine aan de medicijnproblematiek nogal mee. Tijdens het ÌWA congres Advanced Sanitation
(maart 2007) werd een tabel gepresenteerd waaruit blijkt dat bijvoorbeeld van het antibioticum
Tetracycline de dosis in urine van vee circa 400 ÷ 500 mg /l bedraagt terwijl voor menselijke
urine van iemand die dit medicijn gebruikt de dosis circa 0,002 mg/l is.
Hoe met de factor medicijnen en hormonen in de toekomst moet worden omgegaan zal sterk
afhankelijk zijn van de toepassingen die worden gezocht en de eisen die het gewas stelt.

Uit het bovenstaande blijkt dat urine op zich als meststof voldoende marktpotenties heeft maar
de vraag is daarbij natuurlijk relevant hoe die markt daarbij bediend kan worden. Urine wordt
verspreidt door 16 miljoen mensen aangeleverd en zal uiteindelijk via een tussenstation bij de
eindgebruiker aangeleverd moeten worden. De transportsystemen zoals die nu bij de meeste
projecten worden gerealiseerd (afvoerleiding, tank en transport per as) lijken in vergelijking tot
de energie die met productie en transport van kunstmest gemoeid is ook op milieu gebied te
kunnen concurreren. Een eerste vingeroefening daartoe is door Adriaan Mels gedaan. Bij
grootschaliger toepassing zijn er evenwel perspectieven voor efficiëntere transport systemen.
Daarbij wordt gedacht aan bijvoorbeeld concentratietechnieken en geavanceerde persleiding-
systemen. Op dit moment wordt in Zwolle aan de Hogeschool Windesheim onderzoek gedaan
naar het transport van urine door leidingen en voor de wijken ÌJpolder en Bloemendalerpolder
bij Amsterdam is nagegaan hoe een nieuw afvalwater-inzamelsysteem er uit zou kunnen zien.
Dit onderzoek behoeft uitbreiding. Nagegaan zou moeten worden (op grond van de ei-
sen/wensen die door de landbouw worden gesteld) aan welke kwalificaties het transport zou
moeten voldoen (beïnvloeding kwaliteit, concentratie/verdunning, continuïteit, etc). Daarna zou
moeten worden nagegaan met wat voor systemen aan die kwalificaties kan worden voldaan.

Ìn deze fase van de ontwikkeling blijkt het nog moeilijk een goede kosten-baten afweging te
maken. Dat heeft er alles mee te maken dat er nog geen goede kerncijfers beschikbaar zijn.
Teveel elementen in de urineketen verkeren nog in een experimenteel stadium met bijbehoren-
de hogere kosten. Uit de tot nu uitgevoerde studies blijkt wel dat de lokale situatie sterk
bepalend is voor de uiteindelijke kosten-baten afweging. Aan de kostenkant moet vooral
rekening worden gehouden met extra infrastructuur, transport en verwerking; aan de batenkant
staan besparingen op waterverbruik, en zuiveringskosten. Deze zullen in de meeste gevallen
(nog) niet opwegen tegen de kosten. Motivatie om deze hogere kosten wel te accepteren zal
dan ook moeten worden gezocht in de maatschappelijke baten. Duurzaamheid / C2C / minder
grondstoffengebruik/ verminderd energieverbruik/ verminderde uitstoot van CO2 en lachgas
etcetera. Niettemin zijn er ook nu reeds situaties denkbaar waar urine-inzameling ook financieel
uit kan. Twee voorbeelden:
• Ìn het buitengebied kan urinescheiding in combinatie met een ouderwetse septictank, een
goed alternatief vormen voor de huidige ÌBA's of de aansluiting op een persriool. Met het
scheiden van urine en het direct toepassen ervan op het land (als kunstmestvervanger)
wordt een hoger zuiveringsrendement bereikt dan nu met de meeste ÌBA's. De kosten zijn
bovendien aanzienlijk lager terwijl de bedrijfszekerheid hoger wordt.
• Ìn gebieden waar nu reeds sprake is van een overbelaste RWZÌ met geringe uitbreidings-
mogelijkheden kan door het toepassen van urinescheiding bij nieuwbouw of renovatie ver-
plaatsing van de RWZÌ of kostbare uitbreiding nog enige tijd worden uitgesteld. De perspec-
tieven zijn met name groot daar waar geconcentreerde inzameling mogelijk is (scholen,
kantoren etc) .
Het is echter wel van groot belang op korte termijn meer inzicht te krijgen in de financiële kosten
en baten. Zeker als grootschaliger implementatie wordt overwogen zal het te ontwikkelen sys-
teem ook economisch duurzaam moeten zijn.

Minstens zo belangrijk als de financiële kosten en baten bij het beoordelen van de markt-
potenties voor de landbouw zijn de maatschappelijke factoren die bepalen of het toepassen van
urine in de landbouw mogelijk is.


Synthese

03/4428
Pagina 74 van 75


Onderzoek in Meppel heeft al uitgewezen dat de meeste mensen (75%) positief staan tegen het
concept om urine apart in te zamelen. Ook de manier waarop er in de pers met het onderwerp
wordt omgegaan lat zien dat er maatschappelijk veel belangstelling is voor het onderwerp.
Ìn het essay van Adriaan Mels is verder ingezoomd op de vraag hoe publiek en landbouw
reageert op het gebruik van urine als meststof. Uitgangspunt daarbij is dat in alle onderzoeken
gegarandeerd wordt dat er geen enkel gevaar voor de volksgezondheid zal en kan optreden.
Vanuit die optiek ontstaat er een beeld dat hoewel er bij een deel van de ondervraagden een
soort natuurlijke gereserveerdheid bestaat het merendeel van de mensen toch weinig
problemen ziet. (Overigens zou het nog wel eens interessant kunnen zijn over dierlijke mest en
menselijke urine gelijke informatie te verstrekken en dan de vraag te stellen waar men de voor-
keur aan geeft.)

12.2 Tot sIot
Constaterend dat:
• urine als grondstof zeker een marktpotentie heeft als meststof in de landbouw,
• er voor transport en logistiek goede oplossingen (in ontwikkeling) zijn,
• er nu reeds situaties zijn waar urinescheiding kostentechnisch aantrekkelijk is,
• er geen grote maatschappelijke bezwaren lijken te zijn,
is het de vraag welke gebieden in Friesland het meest geschikt zijn om ontwikkelingen op dit
vlak in gang te zetten.
Uiteraard is het daarbij gewenst om gebieden te zoeken waar vraag en aanbod bij elkaar
komen, maar gelet op het feit dat het nog een nieuwe ontwikkeling is zijn de beschikbaarheid
van kennis (en onderzoekscapaciteit) en maatschappelijk draagvlak minstens zo belangrijk.
Vanuit die optiek kunnen twee gebieden worden geselecteerd:
• Ìn de driehoek Harlingen ÷ Leeuwarden ÷ Hallum mag vanuit de ontwikkeling van glastuin-
bouw en aquacultures een vraag naar nieuwe meststoffen worden verwacht. Aanbod aan
urine is aanwezig in de vele nieuwbouwprojecten in Leeuwarden. Veel kennis is beschikbaar
in Leeuwarden (Wetsus en vanHall). Voorwaar een goed vertrekpunt.
• Sneek was in Friesland het eerste sanitatieproject (EET), dat is een goede basis voor een
verdere ontwikkeling. Bij de lokale partijen is dan ook veel maatschappelijk draagvlak aan-
wezig. Het project is begeleid vanuit de Universiteit van Wageningen en Wetsus; de
contacten met de kennisinstituten zijn dan ook stevig. Ook in Sneek vinden de komende
jaren de nodige nieuwbouwprojecten plaats.

Ìn de tweede strategienota van Stowa ¨Anders Omgaan met Huishoudelijk Afvalwater¨ wordt
nadrukkelijk aangegeven dat voor de ontwikkeling van nieuwe sanitatie in Nederland vooral
pilotprojecten nodig zijn om de vele kennis die er, is aan de praktijk te toetsen. Ìn de nota wordt
ook aangegeven dat hergebruik en C2C voor de verdere ontwikkeling van nieuwe sanitatie een
belangrijke drijfveer vormt. Ìn die zin past dit onderzoek naar de marktpotenties van urine goed
binnen de landelijke ontwikkeling en sluit het aan bij de projecten die nu al lopen.

De provincie Fryslân heeft beleidsmatig grote ambities ten aanzien van de transitie van de
waterketen en de ontwikkeling van watertechnologie. Zij hecht aan een duurzame ontwikkeling.
Ook daarin past de gedachte dat afvalwater (urine) als grondstof wordt gebruikt; het geeft een
impuls aan de ontwikkeling van nieuwe afvalwatertechnologieën.

12.3 ConcIusie - aanbeveIing
Urine is in potentie een goede meststof die in verschillende takken van de landbouw kan
worden gebruikt. Primair is het daarbij van belang dat vraag en aanbod op elkaar worden afge-
stemd. Beiden zijn nog niet aanwezig.
Op onderdelen ontbreekt nog kennis. Deze kennis zal de komende periode geleidelijk aan
beschikbaar komen of dient met gerichte onderzoeksvragen te worden beantwoord.
De ontbrekende kennis straat evenwel een verantwoorde implementatie niet in de weg.

Voorgesteld wordt om samen met alle betrokken partijen een grootschalig demonstratieproject
op te zetten dat er toe moet leiden dat over enige jaren op grotere schaal in Fryslân urine
separaat wordt gewonnen, bewerkt en wordt gebruikt in de landbouw.

Synthese

03/4428
Pagina 75 van 75


Aan de ontwikkeling van dit project dienen in iedergeval Wetterskip Fryslân, LTO, Wetsus en
van Hall een belangrijke bijdrage te leveren. Bij de ontwikkeling kan gebruik worden gemaakt
van de kennis die beschikbaar is bij Stowa, WUR/PRÌ en Grontmij.
Het doel van dit demonstratie project zal zijn:
Een impuls geven aan de uitvoering van het provinciaal beleid op gebied van de transitie in de
waterketen, de ontwikkeling van watertechnologie en een verdergaande duurzame ontwikkeling
van het landelijk gebied.
Het versterken van de agrarische sector door het ontwikkelen van duurzame meststoffen die
ook gebruikt kunnen worden in de biologische landbouw en in nieuwe innovatieve landbouw-
methoden (aquacultures).

Ìn het kader van de voorbereiding van dit demonstratieproject is het gewenst op korte termijn:

• Ìnitiatieven te nemen om te komen tot (een) grootschalige inzamellocatie(s). Een goede
kans doet zich voor bij de ontwikkeling van de Kenniscampus van het VanHall instituut.

• Samen met LTO na te gaan bij welke gewassen urine (of urineproducten) toepassing
het meest voor de hand ligt. Hierbij kan een samenwerking worden gezocht met de
proefboerderij inde Kollummerwaard of Nieuw Bosmazathe.

• Na te gaan (op grond van de eisen/wensen die door de landbouw worden gesteld) aan
welke kwalificaties het de meststof zou moeten voldoen (samenstelling, kwaliteit,
concentratie/verdunning, continuïteit, etc). Daarna zou moeten worden nagegaan hoe
aan die kwalificaties kan worden voldaan. Ìn dit project zou een samenwerking tussen
LTO, PRÌ en Grontmij de basis kunnen vormen.

• Ìn ÌPO-verband onderzoeken op welke manier zowel de afvalstoffenwet- en regelgeving
als de meststoffenwet- en regelgeving zodanig kunnen worden aangepast dat het her-
gebruik van waardevolle mineralen uit afvalstoffen op een goede manier kan worden
gestimuleerd. Daarbij kan samenwerking worden gezocht met de Unie van Water-
schappen de Stowa.

Bij het beantwoorden van die vragen zou aansluiting moeten worden gezocht bij lopende
onderzoeks- en pilotprojecten van de Koepelgroep ONSS en zouden nieuwe onderzoeks- en
pilotprojecten in samenwerking met de Koepelgroep/Stowa moeten worden opgesteld.

Om de gewenste ontwikkelingen te coördineren is het gewenst dat de provincie een regierol
vervult en de verschillende betrokken partijen stimuleert om de nodige voorbereidingen te
treffen.



www.grontmij.nl
Grontmij
Zonnedauw 2
9202 PA Drachten
Postbus 91
9200 AB Drachten
T (0512) 33 52 33
F (0512) 51 02 00
noord@grontmij.nl
@ Grontmij , rev.








Verwijdering van medicijnresten en
hormoonverstorende stoffen uit urine
Quick-scan technieken

Definitief





























STOWA-koepelgroep Ontwikkeling Nieuwe Sanitatie Systemen (ONNS)

Grontmij Nederland bv
De Bilt, 17 juni 2005


@ Grontmij , rev.
blad 2 van
Verantwoording

Titel : Verwijdering van medicijnresten en hormoonversto-
rende stoffen uit urine
Projectnummer : 178603
Documentnummer :
Revisie :
Datum : 17 juni 2005

Auteur(s) : dr.ir. J.H. Roorda (Jelle)
e-mail adres : jelle.roorda@grontmij.nl
Gecontroleerd : ir. N.C. Wortel (Nico)
Paraaf gecontroleerd :
Goedgekeurd : ir. P. Roeleveld (Paul)
Paraaf goedgekeurd :



@ Grontmij , rev.
blad 3 van
Inhoudsopgave





1 Inleiding.........................................................................................4
2 Overzicht technieken......................................................................5
2.1 Biologische technieken ...................................................................5
2.2 Oxidatieve technieken ....................................................................6
2.3 Fysisch-chemische technieken ........................................................6
2.4 Membraanfiltratie..........................................................................6
2.5 Adsorptieve technieken ..................................................................7
3 Conclusies en aanbevelingen ..........................................................8
3.1 Conclusies ......................................................................................8
3.2 Aanbevelingen................................................................................8
Literatuur....................................................................................................10



@ Grontmij , rev.
blad 4 van

1 Inleiding

Bij de gescheiden behandeling van urine kunnen de nutriënten Stikstof en
Fosfaat op efficiënte wijze verwijderd of omgezet worden in bruikbare mest-
stoffen. In STOWA (2005) worden een aantal zuiveringsconcepten beschre-
ven die daarvoor in aanmerking komen. Naast de genoemde stoffen bevinden
zich ook andere milieuvreemde stoffen in de urine. Daarbij nemen de genees-
middelen en hormonen een belangrijke rol in.

Na opname of omzetting in het lichaam, worden geneesmiddelen en afbraak-
producten van geneesmiddelen uitgescheiden. Het grootste deel hiervan ver-
laat via de urine het lichaam. Hierover zijn slechts in nauwelijks harde gege-
vens bekend, maar diverse auteurs die zich bezighouden met gescheiden in-
zameling en verwerking van urine geven aan dat in de urine het grootste deel
van de geneesmiddelen te vinden moet zijn. (Larsen et al., 2004; Pronk et al.,
2004). Von Wolffersdorf (2004) heeft wel gemeten in urine en vindt genees-
middelen in concentratieranges van tientallen tot honderden µg per liter urine.
In afvalwater is de range waarin deze gevonden wordt een factor 100 tot 1000
lager (Grontmij, 2005).

STOWA heeft Grontmij opdracht gegeven een quick-scan uit te voeren naar
technieken die de medicijnen, medicijnresten, (natuurlijke en synthetisceh )
hormonen en hormoonverstorende stoffen in het ingezamelde (verdunde)
urine vergaand kunnen reduceren. Daartoe is een globale scan gemaakt van
de beschikbare literatuur. In onderhavige rapportage is hiervan het resultaat
gegeven. Als gesproken wordt over medicijnresten worden daarmee ook de
andere hierboven genoemde stoffen bedoeld. Waar specifiek wordt ingegaan
op de andere stofgroepen wordt dat vermeld.


@ Grontmij , rev.
blad 5 van
2 Overzicht technieken
2.1 Biologische technieken
Biologische afbraak
Over de verwijdering van medicijnresten door biologische afbraak van de
urine is zeer weinig bekend (Larsen et al., 2004). Uit eerste onderzoek blijkt de
halfwaarde tijd van natuurlijke hormonen in een biologische reactor 15 minu-
ten is. Het is onduidelijk wat dit in het (biologisch afbreekbare urine, oa
ureum) betekend. Uit ervaringen met huishoudelijk afvalwater (100 maal
verdunde urine) blijkt dat de helft van de geneesmiddelen ongewijzigd door
een rwzi heen gaan en in het effluent terechtkomen (Ternes, 2005).

Bij de toepassing van technieken voor de behandeling van urine, zoals voor-
gesteld in STOWA (2005), lijkt de verwijdering van de medicijnresten een
goede nageschakelde stap te kunnen zijn. In STOWA (2005) is een overzicht
gegeven van:
- Struviet precipitatie (niet biologisch). Daarbij komt een vaste stof vrij,
die vrij is van medicijnresten. In de vrijkomende waterstroom bevin-
den zich de medicijnresten. Er wordt geen afbraak van medicijnresten
verwacht.
- Biologische N verwijdering. Daarbij wordt ammonium en ni-
traat/nitriet omgezet in stikstofgas wat vervluchtigd. In de overblij-
vende waterstroom bevinden zich de medicijnresten. Deze worden
door de korte verblijftijden in het systeem naar verwachting nauwe-
lijks afgebroken. Wel vindt verwijdering plaats door adsorptie aan het
slib.

Adsorptie aan slib
De retentie van slib in biologische systemen om urine af te breken is vele ma-
len hoger dan in rioolwaterzuiveringsinstallaties (Larsen et al., 2004; STO-
WA, 2005). Medicijnresten die aan het slib geadsorbeerd zijn, worden met het
afgevoerde slib (de hoeveelheid is dus beperkt) verwerkt middels indikking,
(vergisting,) ontwatering en verbranding.

Biologische afbraak in de bodem
Kästner et al. (2004) heeft onderzocht wat de afbraak van nonylphenol en
bisphenol A. Deze hormoonverstorende stoffen (die overigens niet in urine
voorkomen) breken binnen 5-7 dagen tot bijna 90% af tijdens een gesimuleer-
de bodempassage. Voor andere hormoonverstorende stoffen en ook medicij-
nen wordt op grond van vergelijkbare chemische eigenschappen een dergelijke
afbraak verwacht. Uit groot EU-project POSEIDON is gebleken dat ruim
80% van de geneesmiddelen uit rwzi-effluent voor meer dan 90% afbreken en
adsorberen aan de bodem. Desondanks worden een aantal belangrijke ge-
neesmiddelen (carbamazepine en sulfamethoxazole) niet verwijderd en daar-
om teruggevonden in het grondwater (Ternes, 2005).

Overzicht technieken

@ Grontmij , rev.
blad 6 van
2.2 Oxidatieve technieken
Chlorering
Dosering van chloor is onvoldoende effectief om alle medicijnen en hormonen
volledig te oxideren (Ternes, 2005).

Ozonbehandeling
Ozon is selectief voor medicijnresten en wordt in gedoseerde vorm toegepast.
Een verwijdering tot 60% is aangetoond (Pronk et al., 2004), waarbij de ande-
re organische stoffen (ureum) slechts deels werden afgebroken. Als nabehan-
deling van een biologische methode wordt verwacht dat ozonisatie nog effec-
tiever is (Larsen et al., 2004). In effluent wordt een vergaande reductie van een
deel van de stoffen gevonden bij ozonbehandeling (Joss, 2004).

UV-behandeling
Met UV-behandeling is veel ervaring als methode voor desinfectie. Als refe-
rentie voor afvalwaterbehandeling is literatuur beschikbaar, voor urine is nog
geen ervaring opgedaan.

AOP
Onder geavanceerde oxidatie (AOP) wordt verstaan een combinatie zoals
UV/H
2
O
2
, Ozon/UV, Ozon/H
2
O
2
. Het voordeel van deze technologiecombi-
natie is dat bij een juist ontwerp geen schadelijke bijproducten ontstaan. Er is
geen ervaring met AOP voor verwijdering van medicijnresten uit urine. Bij
rwzi’s is een verwijdering van meer dan 90% gemeten voor medicijnen (Ter-
nes, 2005).

2.3 Fysisch-chemische technieken
Strippen
Vluchtige medicijnresten zouden door middel van strippen verwijderd kunnen
worden. Vooralsnog wordt dit niet realistisch geacht voor de behandeling van
urine.

2.4 Membraanfiltratie
Membraanfiltratie is een scheidingsmethode op grond van deeltjesgrootte
(micro- en ultrafiltratie) en op grond van molecuulgewicht (nanofiltratie en
reverse osmosis). Geneesmiddelen zullen door micro- en ultrafiltratie niet
worden tegengehouden. Nanofiltratie en reverse osmosis zijn wel in staat om
een groot gedeelte van de medicijnresten tegen te houden. Bijzondere vormen
van membraanfiltratie zijn bijvoorbeeld electrodialyse, waarbij scheiden
plaats vindt op basis van lading van moleculen.

Nanofiltratie
Pronk et al. (2004, 2004a) beschrijft onderzoek naar de verwijdering van aan
urine gedoseerde ethinylestradiol, propranolol, ibuprofen, diclofenac en car-
bamezapin. Van deze stoffen werd 92%-98% door het membraan tegenge-
houden. Ureum werd volledig door het membraan doorgelaten, ammonium
voor meer dan 50% en fosfaat werd tegengehouden. Hierbij blijven twee
stromen over:
1. Geconcentreerde stroom met fosfaat en medicijnresten. Fosfaat kan ver-
wijderd worden door struviet te vormen, waarbij geneesmiddelen niet in
de struvietmatrix worden opgenomen.
2. Stikstofrijke waterstroom waaruit de stikstof geconcentreerd kan worden
tot meststof.


Overzicht technieken

@ Grontmij , rev.
blad 7 van
Electrodialyse
In dit proces worden geladen componenten uit de urine gebonden aan het
geladen membraan. Daarbij wordt de urine opgeconcentreerd. Het concen-
traat kan biologisch verwerkt worden, in combinatie met struvietvorming
voor P-verwijdering. De medicijnresten zullen in het restproduct overblijven
(Pronk et al., 2004). Het lijkt erop dat de zouten in oplossing blijven (concen-
traat) en de medicijnresten adsorberen aan de electrodialyse membranen.

2.5 Adsorptieve technieken
Actief Kool filtratie
Adsorptie aan actief kool kan door dosering van poederkool of doorstromen
van een korrelkool reactor (Granular Activated Carbon, GAC). Voor medi-
cijnresten kan een vergaande reductie worden behaald (Joss, 2004). Uit rwzi-
effluent tot meer dan 90% (Ternes, 2005). Voor zover bekend, is er met de
behandeling van urine geen ervaring opgedaan.

2.6 Combinatie van technieken
Een combinatie van technieken kan waarschijnlijk zeer effectief zijn. Daarbij
wordt gedacht aan combinaties als AOP en actief kool, of actief kool en na-
nofiltratie (ANF, Roorda et al., 2004).


@ Grontmij , rev.
blad 8 van
3 Conclusies en aanbevelingen
3.1 Conclusies
Vanuit verschillende studies is naar voren gekomen dat medicijnen, medicijn-
resten, hormonen en hormoonverstorende stoffen in RWZI’s afkomstig zijn
van de menselijke urine. Een klein deel wordt ook in de feces gevonden. Ge-
scheiden inzameling en behandeling van urine kan de emissie van deze stoffen
naar het oppervlaktewater vergaand reduceren.

Voor de verwijdering van medicijnen, medicijnresten, hormonen en hor-
moonverstorende stoffen die zich in de urine van mensen bevinden, is een
breed scala aan technieken beschikbaar en in de praktijk toepasbaar. Deze
technieken zijn over het algemeen kostbaar, maar voor de behandeling van
geconcentreerde stromen lijken ze goed toepasbaar. Het kostenaspect speelt
dan een minder belangrijke rol (dan bijvoorbeeld bij de vergaande behande-
ling van communaal afvalwater, wat zeer verdund is ten opzichte van urine).

De technieken voor vergaande reductie van medicijnresten kunnen worden
ingezet in het proces als voorbehandeling van de urine, maar ook als nabe-
handeling van de biologisch behandelde of struviet geprecipiteerde urine. Op
dit moment kan nog geen voorkeur worden uitgesproken en is afhankelijk
van de zuiveringsstappen.

De ervaring met deze technieken is voor de behandeling van urine beperkt.
Op een aantal onderzoeksinstellingen wordt onderzoek verricht op lab-schaal,
voorzover bekend is op praktijkschaal geen voorbeeld bekend. De hier gepre-
senteerde informatie is daarom beperkt en vraagt om meer uitwerking.

De kosten van de beschikbare technieken zijn bekend voor verdunde water-
stromen, voor de behandeling van relatief geconcentreerde urine kan op
grond daarvan een globale inschatting gemaakt worden van de kosten. Dit
voert voor deze quick-scan te ver.

Een combinatie van technieken zou een effectieve optie kunnen zijn.

3.2 Aanbevelingen
Over de verwijdering van medicijnen, medicijnresten, hormonen en hor-
moonverstorende stoffen die zich in de urine bevinden is weinig bruikbare
informatie beschikbaar. De beschikbare informatie is versnipperd aanwezig
en tot op heden niet samengebracht in een goed overzicht. Gezien de moge-
lijkheden om met behandeling van gescheiden ingezamelde urine de reductie
van medicijnen, medicijnresten, hormonen en hormoonverstorende stoffen
afkomstig van huishoudens vergaand te reduceren, wordt aanbevolen om een
goed overzicht van de beschikbare kennis op te stellen. Daarbij zal aansluiting
gezocht moeten worden bij enige grote projecten die in Zwitserland, Zweden
en Duitsland op dit moment worden uitgevoerd.

Conclusies en aanbevelingen

@ Grontmij , rev.
blad 9 van
De concentraties aan medicijnen, medicijnresten, hormonen en hormoonver-
storende stoffen in urine zijn slechts enkele malen bepaald. Om een goede
inschatting te kunnen maken van de mogelijkheden van technieken voor re-
ductie van deze stoffen, dient de gemiddelde samenstelling van urine te wor-
den bepaald.

De kosten van de beschikbare technieken zijn bekend voor verdunde water-
stromen, voor de behandeling van relatief geconcentreerde urine kan op
grond daarvan een globale inschatting gemaakt worden van de kosten. Een
realistische inschatting van de kosten moet gemaakt worden.



@ Grontmij , rev.
blad 10 van
Literatuur

Grontmij (2005). Ketenanalyse humane en veterinaire geneesmiddelen in het
watermilieu - indicatieve kwantitatieve analyse en mogelijkheden voor
reductie van belasting van het watermilieu. Rapport opgesteld voor het
Ministerie van VROM, onder begeleiding van de LBOW-werkgroep
‘(dier)geneesmiddelen en watermilieu’. Auteurs: A. Derksen en J.H.
Roorda. Mei 2005.

Joss, A. (2004). Arzneimittel in Wasser und Abwasser Schlussfolgerungen
von POSEIDON. Kooperationsforum Innovation der
Wasserwirtschaftsinitiative NRW und der WEDECO AG
„Arzneimittelrückstände und endokrin wirksame Stoffe in Trink- und
Abwasser - Herausforderungen, Lösungen und Kosten - “ Dienstag, 30.
März 2004.

Kärstner, M., Müller, J., Kappelmeyer, U., Richnow, H.H. en Kuschk, P.
(2004). Analyse des mikrobiellen Abbaus von organischen
Spurenstoffen in Anlagen zur Abwasserbehandlung – Schicksal
hormonell wirksamer Substanzen in bewachsenen Bodenfiltern.
Proceedings Bremer Colloquium Produktionsintegrierte Wasser-/
Abwassertechnik 2004, ’Pharmazeutische Reststoffe in Abwässern –
Vorkommen – Gefährdungspotenzial – Techniken zur Eliminierung’.
13.-14. September 2004.

Larsen, T.A., Lienert, A.J. en H. Siegrist (2004). How to avoid pharmaceuti-
cals in the aquatic environment. Journal of Biotechnology 113: 295–
304.

Pronk, W., Biebow, M. en Boller, M. (2004). Assessment of processing alter-
natives for source-separated urine. Proceedings World Water Congress
and Exhibition, Marrakech, September 2004.

Pronk, W., Palmquist, H., Biebow, M. en Boller, M. (2004a). The separation
of pharmaceuticals from nutrients in source-separated urine. Envi-
ronmental Science & Technology (submitted September 2004)

Roorda, J.H., Wortel, N.C., Koreman, E. en Dalen, R. van (2004). ANF,
doorbraak in technologie van effluentfiltratie. H2O 37(11), p. 33-35

STOWA (2005). Separate collection and treatment of urine and new poten-
tials for wastewater treatment. Auteur: J. Wilsenach, TUDelft. (con-
cept, druk in voorbereiding)

Ternes, T. (2005). Assessment of technologies for the removal of pharmaceuti-
cals and personal care products (PPCP) in sewage and drinking water
facilities to improve the indirect potable water reuse. Detailed report re-


@ Grontmij , rev.
blad 11 van
lated to the overall project duration: January 1
st
, 2001 to June 30
th
,
2004 of the EU-project POSEIDON. August 2004, version January
18
th
2005. www.eu-poseidon.com (17 juni 2005).

Wolffersdorf, S. von (2004). Untersuchungen zu Sortiertoiletten unter
besonderer Berücksichtigung der Urinverwertung. Diplomarbeit.
Universität Rostock – Agrar- und Umweltwissenschaftlichen
Fakultät – Institut für Umweltingenieurswesen. 1. Juli 2004, Rostock.


Nuttige inzet van urine als meststof voor energiegewassen
Praktijkproef toepassing urine
zorglocatie Anderen

13/99100215/JdW, revisie D1



Praktijkproef toepassing urine
zorglocatie Anderen
Nuttige inzet van urine als meststof voor energiegewassen
Definitief
Opdrachtgevers:
STOWA, Waterschap Hunze en Aas, Provincie Drenthe, Waterbedrijf Gro-
ningen en Waterleidingmaatschappij Drenthe
Grontmij Nederland B.V.
Houten, 28 oktober 2010

13/99100215/JdW, revisie D1
Pagina 3 van 27


¡nhoudsopgave
Samenvatting................................................................................................................................. 5
1 Ìnleiding......................................................................................................................... 7
1.1 Achtergrond van het project.......................................................................................... 7
1.2 Doelstelling integraal project......................................................................................... 7
1.3 Doelstelling en onderzoeksvragen fase 2 (de praktijkproef)......................................... 8
1.4 Begeleidingsgroep ........................................................................................................ 8
1.5 Leeswijzer ..................................................................................................................... 9
2 Onderzoeksopzet praktijkproef ................................................................................... 10
2.1 Ìnleiding....................................................................................................................... 10
2.2 Proeflokatie................................................................................................................. 10
2.3 Scheidingstoiletten en opslag urine............................................................................ 10
2.4 Proefveld..................................................................................................................... 12
2.5 Gewaskeuze ............................................................................................................... 12
2.6 Proefopzet................................................................................................................... 12
2.6.1 Bemesting ................................................................................................................... 12
2.6.2 Gewasopbrengst ......................................................................................................... 13
2.6.3 Onderzoek uitspoeling medicijnen en nutriënten........................................................ 13
2.7 Uitvoering agrarische veldwerkzaamheden................................................................ 14
2.8 Geuronderzoek ........................................................................................................... 14
2.9 Communicatie en verslaglegging................................................................................ 14
3 Resultaten praktijkproef .............................................................................................. 15
3.1 Ìnleiding....................................................................................................................... 15
3.2 Nutriëntengehalte in de urine...................................................................................... 15
3.3 Bemestingsapparatuur: oppompen en aanbrengen urine .......................................... 16
3.4 Gewasgroei en opbrengst........................................................................................... 17
3.4.1 Monitoring gewas........................................................................................................ 17
3.4.2 Gewasopbrengst ......................................................................................................... 17
3.5 Geur ............................................................................................................................ 18
3.5.1 Geurhinder stakeholders............................................................................................. 18
3.5.2 Geuronderzoek (laboratorium).................................................................................... 19
3.6 Geneesmiddelen......................................................................................................... 20
3.6.1 Ìnfiltratieproeven met opvangbakken.......................................................................... 20
3.6.2 Geneesmiddelenconcentraties in de urinetanks......................................................... 20
3.6.3 Verdunningsfactor....................................................................................................... 21
3.7 Overige resultaten....................................................................................................... 22
3.7.1 Aanleg gescheiden sanitatiesysteem ......................................................................... 22
3.7.2 Toiletgedrag en verdunning ........................................................................................ 22
3.7.3 Uitvoering agrarische werkzaamheden en communicatie.......................................... 23
3.7.4 Quick scan literatuur ................................................................................................... 23
4 Samenvatting, conclusies en aanbevelingen.............................................................. 24
4.1 Ìnleiding....................................................................................................................... 24
4.2 Samenvatting en conclusies ....................................................................................... 24
4.3 Aanbevelingen ............................................................................................................ 27

Inhoudsopgave (vervolg)

13/99100215/JdW, revisie D1
Pagina 4 van 27



Bijlage 1: Ìnformatie proefveld
Bijlage 2: Karakteristieken opslagtank urine
Bijlage 3: Ìndeling proefveld en informatie meetopstelling
Bijlage 4: Medicijnen
Bijlage 5: Bemesting
Bijlage 6: Agrarische werkzaamheden
Bijlage 7: Geuronderzoek
Bijlage 8: Gewasontwikkeling
Bijlage 9: Quick scan literatuur


13/99100215/JdW, revisie D1
Pagina 5 van 27

8amenvatting
DoeI praktijkproef
Op de zorglocatie Nijend 18 te Anderen (Drenthe) is in 2009 en 2010 een praktijkproef gehou-
den waarbij op de locatie verzamelde humane urine als meststof is toegepast op een naastge-
legen gecreëerd proefveld. Doel van de proef was om in de praktijk ervaring op te doen met de
toepassing van urine als meststof in de landbouw en om de invloed van urinebemesting op de
ontwikkeling en opbrengst van het gewas te onderzoeken. Een nevendoel van de proef was om
inzicht te krijgen in de uitspoeling van medicijnresten en nutriënten.

OnderzoeksIocatie
Op de onderzoekslocatie bevinden zich een zorgboerderij, een kantoorgebouw en een werk-
plaats. De gebouwen op de locatie van zijn voorzien van scheidingstoiletten en de urine wordt
in twee ondergrondse tanks (inhoud ieder 10 m
3
) opgevangen. Naast de gebouwen bevindt zich
een proefveld dat voorheen in gebruik was als schapenweide. De urine uit de ondergrondse
tanks is als meststof toegepast op het proefveld.

2009
Ìn 2009 was de proef gericht op de praktische aspecten die relevant zijn bij de toepassing van
urine als meststof bij de teelt van een landbouwgewas, namelijk de bemestingsapparatuur,
geur, gewasopbrengst en als nevenaspect ook de uitspoeling van medicijnen en nutriënten.
Hiertoe is het proefveld in twee delen verdeeld waarbij één deel is bemest met urine en één
deel traditioneel is bemest (met varkensdrijfmest). Als gewas is energiemaïs verbouwd. Vooraf
aan de bemesting is een bemestingsplan opgesteld waarbij onder andere de urine uit de putten
is bemonsterd en geanalyseerd en de bemestende waarde daarvan is bepaald. Een loonwerker
uit de omgeving heeft de benodigde veldwerkzaamheden uitgevoerd.
Ìn het proefveld is een meetopstelling aangebracht om het infiltratiewater te kunnen opvangen
en aanvullend te bemonsteren teneinde uitspoeling van geneesmiddelen en nutriënten naar het
grondwater te kunnen nagaan. Vanwege het niet functioneren van deze meetopstelling heeft dit
projectonderdeel niet geleid tot bruikbare meetresultaten.

2010
Vanwege de resultaten van de proef in 2009 is de proefopzet voor 2010 enigszins gewijzigd. De
geurwaarnemingen in 2009 waren aanleiding het onderzoek naar stankoverlast in 2010 te in-
tensiveren. Om meer inzicht te krijgen in de mate van geurhinder is een monster van urine ge-
nomen waarop een geuronderzoek is uitgevoerd in een professioneel geurlaboratorium. Ook is
in 2010 in de proef een mengsel van humane urine en varkensdrijfmest onderzocht omdat dit
qua nutriëntensamenstelling mogelijk voor de landbouwpraktijk een interessante meststof kan
zijn. De geurhinder is eveneens onderzocht aan de hand van een eenvoudige enquête. De ge-
constateerde sterke mate van verdunning van de urine in 2009 heeft tot de beslissing geleid in
2010 het aspect 'bemestende waarde en gewasopbrenst' achterwege te laten.

ResuItaten
Bij de uitvoering van de proef in 2009 en 2010 zijn diverse praktijkervaringen opgedaan. Ge-
concludeerd wordt dat het technisch mogelijk is urine toe te passen, maar daarnaast zijn er ook
enkele praktische knelpunten en aandachtspunten aan het licht gekomen. Op basis van de be-
vindingen uit de tweejarige praktijkproef zijn de volgende zaken geconcludeerd:
• Bemestingsapparatuur. Het is technisch mogelijk met gangbare bemestingsapparatuur urine
op te pompen en op het land aan te wenden. Ìndien urine als meststof in de landbouw wordt
Samenvatting

13/99100215/JdW, revisie D1
Pagina 6 van 27

toegepast is er in de praktijk apparatuur voorhanden, en zijn er dus geen (extra) investerin-
gen in, of ontwikkeling van, machines en apparatuur nodig;
• Verdunning en praktische consequenties. De urine uit de putten van de zorglocatie blijkt cir-
ca 5 tot 8 maal verdund te zijn t.o.v. zuivere urine. Het grotere volume dat moet worden op-
gepompt en aangebracht t.o.v. bemesting met varkensmest om dezelfde bemestende waar-
de te verkrijgen brengt extra machine- en arbeidskosten met zich mee, het leidt tot plasvor-
ming op het perceel en verhoogt waarschijnlijk de ammoniakemissie;
• Verdunning en bemestende waarde. De nutriëntengehalten in de urine zijn vanwege de ho-
ge verdunningsfactor erg laag, namelijk voor wat betreft stikstof acht keer lager dan van de
gebruikte varkensdrijfmest. De urine van deze locatie is vanwege deze beperkte bemesten-
de waarde niet aantrekkelijk voor landbouwkundige toepassing;
• Gewasgroei en gewasopbrengst. Bij toepassing van de verdunde urine op de locatie in de
teelt van energiemaïs zijn visueel geen bijzonderheden aan het gewas geconstateerd.
Met de resultaten van de proef kan, vanwege de korte doorlooptijd van de proef, geen uit-
spraak worden gedaan over de verschillen in de gewasopbrengst van het met urine bemeste
deel en het met varkensmest bemeste deel;
• Geurhinder. De verwachting is niet dat geurhinder praktijktoepassing van urine in de land-
bouw in de weg zal staan. Ìn het eerste jaar (2009) was er sprake van geurhinder tijdens
oppompen en uitrijden van de urine. Dit aspect is in 2010 nader onderzocht. Ìndien de (ver-
dunde) urine van de zorglocatie enkele maanden (4 tot 6) in een put wordt opgeslagen en
nadien wordt opgepompt en aangewend op een landbouwperceel is de geurhinder tijdens
oppompen en aanbrengen minimaal. De geurhinder is bij het aanbrengen van (verdunde)
urine of een mengsel van varkensdrijfmest met urine mogelijk iets groter ten opzichte van
bemesting met varkensdrijfmest. Het verschil is klein;
• Het onderzoek naar verspreiding van geneesmiddelen naar het grondwater is vanwege
praktische onvolkomenheden van de proefopstelling gestaakt.

Door het uitvoeren van de proef zijn naast bovengenoemde aspecten ook andere onverwachte
zaken naar voren gekomen, zoals communicatieproblemen bij de aanleg van het sanitatiesys-
teem en bij de bemesting door de loonwerker, mogelijke oorzaken van de grote mate van ver-
dunning zoals extra vaak doorspoelen vanwege het achterblijven van de 'grote boodschap' in
de toiletten en het niet altijd zittend plassen. Deze praktijkproef heeft daarom geleid tot diverse
nieuwe inzichten waarmee men bij 'nieuwe sanitatie' projecten nadrukkelijk rekening dient te
houden.



13/99100215/JdW, revisie D1
Pagina 7 van 27

1 ¡nleiding
1.1 Achtergrond van het project
De inzameling en behandeling van huishoudelijk afvalwater is de laatste decennia vooral gericht
geweest op de aanleg van grootschalige rioolsystemen en de end-of-pipe-zuivering van het ver-
zamelde afvalwater in rioolwaterzuiveringsinstallaties (RWZÌ's). De laatste jaren wordt steeds
meer gedacht aan andere mogelijkheden zoals inzameling en verwerking van gescheiden deel-
stromen.
De aandacht gaat daarbij onder andere uit naar het apart inzamelen en verwerken van humane
urine. 85% van de stikstof en 45% van het fosfaat die bij de zuiveringen aankomen zijn afkom-
stig van urine. Een mogelijkheid om urine na inzameling te verwerken is de toepassing van de
apart ingezamelde urine als meststof. Een dergelijke toepassing dient dan een dubbel doel, n.l.
onttrekking van stikstof en fosfaat aan de zuivering, zodat de noodzakelijke verwijdering van
deze componenten bij de zuivering gereduceerd wordt en hergebruik van de nuttige componen-
ten stikstof en fosfaat als meststof.

Om meer inzicht te krijgen in de mogelijkheid en wenselijkheid van grootschalige toepassing
van urinescheiding in Nederland is onderzoek nodig, o.a. naar de toepassing als meststof. De
mogelijkheid om dit onderzoek in te vullen deed zich voor in 2006 op de locatie ¨Natuurwerk-
plaats Anderen¨, waar men voornemens was acht wooneenheden voor geestelijk gehandicap-
ten in een zorgboerderij en een kantoorruimte en werkplaats te realiseren. Naast de bebouwing
bevindt zich een perceel waar het telen van gewassen mogelijk is.

De zorgboerderij is ontwikkeld door Vanboeijen, een organisatie die zich inzet om zorg op maat
te bieden aan verstandelijk gehandicapten. Vanboeijen had reeds ervaring opgedaan met de
gescheiden inzameling van urine met drie urinescheidingstoiletten in het Ambachtshuys in Mep-
pel, een dagopvang voor verstandelijk gehandicapten, en was bereid mee te werken aan de
opschaling van de gescheiden inzameling en de praktische toepassing van de urine.

1.2 DoeIsteIIing integraaI project
Ìn december 2006 is het projectplan van het project ¨Nuttige inzet van urine als meststof voor
energiegewassen¨ vastgesteld door de deelnemende partijen (zie paragraaf 1.3). Hoofddoel
van het project is de haalbaarheid van het gebruik van urine als meststof onderzoeken en te
demonstreren. Dit project bestaat uit twee fasen:
1. Onderzoek naar de gevolgen voor het bodemmilieu en de grondwaterkwaliteit bij de toe-
passing van de urine van de locatie Anderen als meststof voor het verbouwen van gewas-
sen (onderzoeksfase);
2. Praktijkervaring opdoen met de toepassing van urine in de teelt van een energiegewas
(praktijkfase)

Ìn de onderzoeksfase (fase 1) zijn de onderzoeksvragen beantwoord door de uitvoering van
een laboratoriumonderzoek waarbij adsorptie- en afbraakparameters zijn vastgesteld voor een
achttal geselecteerde medicijnen.
Op basis van de afbraakparameters zijn in het onderzoek de milieurisico's berekend. De resul-
taten zijn separaat gerapporteerd.





Inleiding

13/99100215/JdW, revisie D1
Pagina 8 van 27

Op hoofdlijnen zijn de conclusies uit het onderzoek als volgt:
• het risico voor contaminatie van het grondwater door één van de geselecteerde geneesmid-
delen door bemesting met urine op de locatie Anderen is laag bij een kortdurende toepas-
sing (enkele jaren);
• op langere termijn kunnen carbamazepine, bezafibraat, clofibrinezuur en ibuprofen een risi-
co vormen. Er dienen aanvullende experimenten uitgevoerd te worden om na te gaan of dit
daadwerkelijk het geval is.

De uitkomsten van dit laboratoriumonderzoek resulteerde in voldoende draagvlak binnen de
begeleidingscommissie om gedurende twee jaar urine op het proefveld aan te brengen en de
praktijkfase aan te vangen.
Onderhavige rapportage betreft de rapportage van de praktijkfase (fase 2).

1.3 DoeIsteIIing en onderzoeksvragen fase 2 (de praktijkproef)
Het belangrijkste doel van de praktijkfase is het opdoen van praktijkervaring met de toepassing
van urine in de teelt van een energiegewas. Nevendoelstelling in deze fase is de uitvoering van
eenvoudige metingen ten aanzien van de verspreiding van geneesmiddelen naar de onder-
grond.

Primaire doelstelling: praktijkproef
De primaire doelstelling van de praktijkproef is het beschouwen van de volgende aspecten:
• Waar loop je in de praktijk tegen aan bij het toepassen van urine in de landbouw t.a.v.:
° De toepasbaarheid van gangbare bemestingsapparatuur (oppompen, doseren en ver-
spreiden);
° Geurhinder;
° Acceptatie van stakeholders en omwonenden.
• Wat is de invloed van bemesting met urine op de ontwikkeling en opbrengst van het gewas
ten opzichte van reguliere bemesting (bij gelijk bemestingsniveau)?

Nevendoelstelling: eenvoudige metingen t.a.v. verspreiding naar ondergrond
De praktijkproef heeft niet als doel om de in het laboratorium opgedane kennis t.a.v. het gedrag
van geneesmiddelen in de praktijk te toetsen (verificatie in het veld van de resultaten onder-
zoeksvraag 1). Desondanks is gedurende het project besloten om tijdens de praktijkproef toch
enkele eenvoudige metingen te verrichten in relatie tot het mogelijke verspreidingsrisico van
geneesmiddelen en ook nutriënten naar de ondergrond.

De onderzoeksvragen ten behoeve van dit nevendoel zijn:
• wat zijn de samenstelling en belasting van het infiltrerende grondwater op een diepte van 40
cm en 60 cm met medicijnen?
• kunnen deze samenstelling en belasting verklaard worden uit de samenstelling van de op-
gebrachte urine, de hoeveelheid neerslagoverschot, de samenstelling van de bodem en de
afbraak- en adsorptieparameters die in het laboratoriumonderzoek zijn afgeleid?
• moeten de conclusies t.a.v de verspreiding van geneesmiddelen naar het diepere grondwa-
ter, die op basis van het laboratoriumonderzoek zijn geformuleerd, bijgesteld worden op ba-
sis van de veldmetingen ?
• wat is de belasting met nutriënten van het infiltrerende water op deze diepten van 40 cm en
60 cm en in hoeverre verschilt deze belasting ten opzichte van reguliere bemesting?

Vanwege het niet functioneren van de meetopstelling heeft dit projectonderdeel niet geleid tot
bruikbare meetresultaten en dit projectonderdeel is in de loop van het project dan ook verwij-
derd.

1.4 BegeIeidingsgroep
De praktijkproef is uitgevoerd in opdracht van STOWA, Waterschap Hunze en Aas, Provincie
Drenthe, Waterbedrijf Groningen en Waterleidingmaatschappij Drenthe. De begeleidingsgroep
bestond uit de volgende personen:
• Bjartur Swart (STOWA);
Inleiding

13/99100215/JdW, revisie D1
Pagina 9 van 27

• Jan Egberts Eleveld/Otto Kluiving (Waterschap Hunze en Aas);
• Rein Bouwer (provincie Drenthe);
• Peter van der Maas (Waterlaboratorium Noord, vertegenwoordiger van Waterbedrijf Gronin-
gen en Waterleidingmaatschappij Drenthe);
• Hans Jansen (Vanboeijen);
• Bert Duker (Woonconcept).

1.5 Leeswijzer
Ìn hoofdstuk 2 wordt de onderzoeksopzet van de proef uiteengezet. Ìn hoofdstuk 3 worden het
verloop en de resultaten van de praktijkproef besproken. Ìn hoofdstuk 4 worden de resultaten
van de praktijkproef samengevat, worden conclusies getrokken en worden aanbevelingen voor
vervolg gedaan.


13/99100215/JdW, revisie D1
Pagina 10 van 27

2 Onderzoeksopzet praktijkproef
2.1 InIeiding
De praktijkproef ¨Nuttige inzet van urine als meststof voor energiegewassen¨ is uitgevoerd ge-
durende twee groeiseizoenen, n.l. in 2009 en 2010. Dit hoofdstuk beschrijft de opzet van de
praktijkproef. Achtereenvolgens zijn de lokatie, de urine opslagtanks, het beschikbare proefveld,
de meetopstelling t.b.v. verspreiding medicijnen en nutriënten naar de ondergrond, de gewas-
keuze, het bemestingsplan, het geuronderzoek en de op het proefveld uitgevoerde werkzaam-
heden beschreven.

2.2 ProefIokatie
De lokatie waar de praktijkproef is uitgevoerd bevindt zich ter plaatse van Nijend 18 te Anderen,
provincie Drenthe (ligging locatie, zie bijlage 1).
Op de locatie bevinden zich de zorgboerderij van Vanboeijen met negen eenheden voor bewo-
ning door verstandelijk gehandicapten (zie figuur 2-1), het kantoor van Landschapsbeheer
Drenthe (zie figuur 2-2) en een werkplaats van Vanboeijen.
Gedurende werkdagen maken circa 44 personen van de laatste twee accommodaties gebruik.
Er bevinden zich 20 urinescheidingstoiletten op de locatie.

Figuur 2-1 Zorgboerderij Vanboeijen te Anderen

2.3 ScheidingstoiIetten en opsIag urine
Op de proeflocatie wordt de urine door de aanwezige scheidingstoiletten gescheiden opgevan-
gen. Een voorbeeld van het toegepaste type scheidingstoilet is te zien in figuur 2-3. Wanneer
zittend geplast wordt komt de urine in het voorste deel van het toilet terecht. Deze urine wordt
via een gescheiden leidingsstelsel apart afgevoerd naar een verzameltank. Het toilet heeft een
spoelknop voor een spoeling van 2 of 4 liter. 10% van het spoelvolume (0,2-0,4 l per spoeling)
verdwijnt door de urineafvoer en komt samen met de urine in de verzameltank terecht.
Het grootste deel van het spoelwater stroomt over naar het achterste deel van het toilet en dit
wordt afgevoerd via het hoofdriool.
Onderzoeksopzet praktijkproef

13/99100215/JdW, revisie D1
Pagina 11 van 27

De urine en een klein deel van het spoelwater wordt verzameld in twee ondergrondse tanks met
beide een inhoud van 10 m
3
. Ìnformatie over de ondergrondse tank is weergegeven in bijlage 2.
Ìn het bestek van de aanleg van de ondergrondse tanks is aangegeven dat de tanks onderling
afsluitbaar moeten zijn. Ìmmers voor toepassing als meststof dient de urine een half jaar opge-
slagen te zijn om pathogenencontaminatie uit te sluiten. De tanks bevinden zich in het gazon en
heg tussen de zorginstelling en het gebouw van Landschapsbeheer (zie figuur 2-2). Berekend is
dat circa 6 m
3
onverdunde urine per jaar geproduceerd wordt op de locatie (voor berekening, zie
bijlage 4).

Figuur 2-2 Locaties van de opslagtanks voor urine op de projectlocatie Nijend 18 te Anderen







Figuur 2-3. Toiletpot voor gescheiden opvang van urine (voorste deel) en feces (achterste deel). Dit type
toiletpot (Nordic van de firma Gustavsberg) heeft een urine-afvoerleiding buiten de pot.




Putdeksels urinetanks
Gebouw Landschapsbeheer Drenthe
Onderzoeksopzet praktijkproef

13/99100215/JdW, revisie D1
Pagina 12 van 27

2.4 ProefveId
Ten behoeve van de uitvoering van de praktijkproef is een grasveld naast de zorglocatie ge-
bruikt. Het perceel heeft een oppervlakte van ongeveer 4.000 m
2
. Het veld werd voorheen met
schapen beweid. Voorafgaande aan het gebruik als proefperceel is het proefveld visueel geïn-
specteerd en bodemkundig onderzocht met behulp van boringen. De aanvullende informatie
over het proefveld op basis van deze inventarisatie is weergegeven in bijlage 1. Ten behoeve
van de praktijkproef is het achterste deel (vanaf de weg en het parkeerterrein) van dit terrein
gebruikt. Dit betreft het meest westelijk gelegen deel van het grasveld. Voor een impressie van
het proefveld voorafgaande aan het gebruik wordt verwezen naar figuur 2-4.
Figuur 2-4 Impressie van het proefveld


2.5 Gewaskeuze
Bij de praktijkproef is gekozen voor de teelt van een energiegewas omdat toepassing van urine
in de teelt van een consumptiegewas mogelijk op psychologische bezwaren zou kunnen stuiten.
Bij toepassing van urine in niet-voedselgewassen (energiegewassen, gewassen voor industriële
verwerking of veevoedergewassen) is dit bezwaar kleiner of afwezig.
Maïs is een vrij eenvoudig te telen gewas en de teelt kan geheel aan een loonwerker worden
uitbesteed. Ook is het een zeer geschikt toetsgewas om de landbouwkundige waarde van
meststoffen te beproeven. Aanvullend informatie over de gewaskeuze is opgenomen in
bijlage 3.

2.6 Proefopzet

2.6.1 Bemesting
Om inzicht te verkrijgen in de verschillen tussen toepassing van urine en gangbare bemesting
(drijfmest) in de maïsteelt is het proefveld in twee gelijke stukken opgedeeld (zie bijlage 3). Ìn
2009 is een bemestingsplan opgesteld om de benodigde bemesting te bepalen en een over-
eenkomstige bemestingssituatie in beide proefvelden te bewerkstelligen. De basis van het be-
mestingsplan wordt gevormd door de oorspronkelijke voedingstoestand van het proefperceel,
de samenstelling van de aan te brengen humane urine van de zorglocatie en de aan te brengen
varkensdrijfmest. Daarnaast dient met het aanbrengen van de mest aan de gebruiksnormen
(wettelijk maximaal toegestane gift) voor stikstof en fosfaat te worden voldaan.

Door BLGG (Bedrijfs Laboratorium voor Grond- en Gewasonderzoek) is een bemonstering uit-
gevoerd om inzicht te krijgen in de voedingstoestand van de bodem. Ìn het laboratorium van
BLGG is het monster geanalyseerd. De resultaten van deze laboratoriumanalyse zijn opgeno-
men in bijlage 5. Naast de analyseresultaten is door BLGG tevens een bemestingsadvies voor
maïs opgesteld en bij het onderzoeksrapport bijgevoegd.

Ìn maart 2009 is een monster van de urine genomen om inzicht te krijgen in de hoeveelheid
nutriënten die aanwezig zijn in de humane urine van de putten op de zorglocatie, t.b.v. het op-
stellen van het bemestingsplan. Dit monster is door BLGG geanalyseerd op de Bemestende
waarde. De onderzoeksresultaten zijn opgenomen in bijlage 5.
Onderzoeksopzet praktijkproef

13/99100215/JdW, revisie D1
Pagina 13 van 27


Op basis van de resultaten van de bemonstering van de bodem van het proefveld en van de
humane urine is in samenwerking met Praktijkonderzoek Plant en Omgeving (dhr. W.C.A. van
Geel, een expert op het gebied van bemesting, bodem en proefopzetten) een bemestingsplan
opgesteld. Ìn bijlage 5 is het opgestelde bemestingsplan weergegeven. Voor het bemestings-
plan is de stikstofwerking van humane urine op 90% gesteld en die van varkensdrijfmest op
75%, uitgaande van bouwlandinjectie, waarbij de mest 10-15 cm diep in de grond wordt ge-
bracht.

Op basis van de resultaten van de proef in 2009 is de proefopzet in 2010 gewijzigd t.o.v. 2009
(zie hoofdstuk 3). Het was vanwege deze wijziging niet noodzakelijk voor de proef van 2010
voorafgaand aan de bemesting een bemestingsplan op te stellen. Ìn 2010 heeft de proef zich
gericht op de mate van geurhinder en is een mengsel van urine met varkensdrijfmest aange-
bracht. Toepassing van urine, dat een veel hogere stikstof/fosfaatverhouding heeft dan var-
kensmest, is in de praktijk namelijk mogelijk interessant om te combineren met varkensmest ter
aanvulling van het stikstoftekort in varkensdrijfmest. Nadere informatie over de opzet van de
bemesting van het proefveld in 2010 is weergegeven in bijlage 5.

Ìn zowel 2009 als 2010 is door de loonwerker naast de urine en varkensdrijfmest tevens een
aanvullende kunstmestgift aangebracht.

2.6.2 Gewasopbrengst
Om de verschillen in gewasopbrengst (het met urine bemeste deel t.o.v. het gangbaar bemeste
deel) te bepalen is in 2009 de maïsopbrengst met behulp van een weegbrug (van de loonwer-
ker) van beide proefvelden bepaald.

2.6.3 Onderzoek uitspoeling medicijnen en nutriënten
Ten behoeve van het onderzoek naar de uitspoeling van medicijnen en nutriënten naar de on-
dergrond is door Grontmij een meetopstelling aangebracht voor het opvangen en bemonsteren
van het infiltratiewater op de twee verschillend bemeste delen van het proefperceel. Een sche-
matische weergave van het ontwerp van de meetopstelling is weergegeven in figuur 2-5. Een
uitgebreide beschrijving van de meetopstelling en de aanleg is weergegeven in bijlage 2. Het
ontwerp bestaat uit vier kunststof opvangbakken (ingegraven op een diepte van 0,4 en 0, 6 m
minus maaiveld) waarvan twee op het met urine bemeste deel en twee op het regulier (met var-
kensmest) bemeste deel. Deze opvangbakken zijn ieder voorzien van een slang die is verbon-
den met de bijbehorende bemonsteringslocatie (vier opvangbuizen van PVC). Ten behoeve van
het onderzoek naar de uitspoeling van medicijnresten en nutriënten is een bemonsteringsplan
opgesteld.

Figuur 2-5 Schematisch zijaanzicht meetopstelling opvang en bemonstering infiltratiewater (per proefper-
ceel). Rechts foto van de aanleg van de meetopstelling.
Onderzoeksopzet praktijkproef

13/99100215/JdW, revisie D1
Pagina 14 van 27

Ìn 2009 en 2010 is voorafgaand aan de bemesting een monster van de urine uit de opslagtanks
genomen om inzicht te krijgen in de aanwezige medicijnen in de opgevangen urine. De medi-
cijnconcentraties zijn in het laboratorium bepaald. Ìn 2009 heeft de analyse plaatsgevonden in
het laboratorium van Omegam in Amsterdam en in 2010 in het laboratorium van Vitens in
Leeuwarden. De analyseresultaten zijn weergegeven in bijlage 4.

2.7 Uitvoering agrarische veIdwerkzaamheden
Ten behoeve van het uitvoeren van de praktijkproef zijn verschillende landbouwkundige werk-
zaamheden uitgevoerd (o.a. het aanbrengen van de bemesting, grondbewerking, inzaaien en
oogsten). Maatschap Hartlief-Lammers (een bedrijf die o.a. loonwerkactiviteiten uitvoert) uit
Donderen heeft de benodigde werkzaamheden in 2009 en 2010 uitgevoerd. Voorafgaand aan
de uitvoering van de verschillende werkzaamheden zijn deze zowel in 2009 als in 2010 met de
loonwerker afgestemd. Ìn bijlage 6 zijn foto's van verschillende werkzaamheden opgenomen.

2.8 Geuronderzoek
Ìn 2009 is geurhinder bij het oppompen van de urine en bij het uitrijden van de urine onderzocht
door het enquêteren van enkele personen. Op basis van de resultaten van 2009 (er was sprake
van geurhinder) heeft in 2010 een uitgebreide enquêtering plaatsgevonden. Ook is in 2010 een
laboratoriumonderzoek door PRA Odournet uitgevoerd.
Ten behoeve van dit geuronderzoek is een monster van de urine uit één van de opslagtanks
genomen (de tank waarin de urine minimaal een half jaar opgeslagen is geweest). Het monster
is aan een panel voorgelegd en beoordeeld op geurdrempel en hedonische waarde. Om de
geur te kunnen vergelijken met de geur van gangbare bemesting is in dit onderzoek ook de
geur van varkensdrijfmest onderzocht. Ook is de geur van een mengsel van urine en varkens-
drijfmest onderzocht. Een uitgebreide beschrijving van de enquêtes en de principes van een
professioneel geuronderzoek zijn weergegeven in bijlage 7.

2.9 Communicatie en versIagIegging
De praktijkproef is in 2009 en 2010 door Grontmij gecoördineerd. Gedurende de proef zijn en-
kele malen de tussenresultaten en knelpunten met de begeleidingsgroep besproken en zijn de
voorgenomen werkzaamheden voor de voortgang van het project aangepast.
Gedurende de praktijkproef in 2009 is door Landschapsbeheer Drenthe een logboek bijgehou-
den. Tevens zijn foto's van de verschillende werkzaamheden gemaakt en zijn op regelmatige
tijden foto's van het proefveld gemaakt.
Ìn 2010 is de proef gevolgd door Grontmij. Daarbij is eveneens de gewasgroei gevolgd en zijn
er foto's van de verschillende door de loonwerker uitgevoerde werkzaamheden gemaakt.



13/99100215/JdW, revisie D1
Pagina 15 van 27

Figuur 3-1 Urine in de opvangput
3 Resultaten praktijkproef
3.1 InIeiding
Ìn dit hoofdstuk worden de resultaten van de praktijkproef in 2009 en 2010 beschreven. Achter-
eenvolgens wordt ingegaan op de bemestende waarde van urine, de ervaringen met de ge-
bruikte bemestingsapparatuur, de gewasgroei en -opbrengst, de geurervaringen en de uitspoe-
ling van medicijnen en nutriënten. Tot slot wordt ingegaan op overige knelpunten die ervaren
zijn bij de uitvoering van de praktijkproef zoals communicatie met derden en het toiletgebruik.

3.2 NutriëntengehaIte in de urine
De concentraties nutriënten in de urine uit de opslagtanks en de aangebrachte varkensdrijfmest
in 2009 en 2010 zijn weergegeven in tabel 3.1. (zie ook bijlage 5).

De urine is in 2009 tweemaal geanalyseerd door BLGG (Bedrijfs Laboratorium voor Grond- en
Gewasonderzoek). Ìn maart 2009 is een monster geanalyseerd t.b.v. het opstellen van het be-
mestingsplan en in juni 2009 is de urine bemonsterd die opgebracht is. Van de varkensmest is
in 2009 alleen een monster geanalyseerd van de daadwerkelijk opgebrachte varkensmest.

Ìn 2010 is een monster van de urine die opgebracht is geanalyseerd door het laboratorium van
Vitens in Leeuwarden. De varkensmest is toen niet geanalyseerd (zie ook bijlage 5).

Tabel 3-1 Nutriënten in de urine en de varkensdrijfmest in 2009 en 2010
Urine (maart/juni 2009) Urine (juni 2010) Varkensdrijfmest (juni 2009)
Stikstof: 0,94/ 1,03 g N/kg 1,3 g N/kg 8,23 g N/kg
Fosfaat 0,11/ 0,14 g P
2
O
5
/kg
(0,05/0,06 g P/kg)
0,06 g P/kg 3,23 g P
2
O
5
/kg
(1,4 g P/kg)
Kali 0,4/ 0,4 g K
2
O/kg 7,8 g K
2
O/kg


Op basis van literatuurgegevens bevat zuivere urine circa
5 à 8 g N/kg en 0,8 à 2 g P/kg
1
De analyses van de urine
op de proeflocatie laten een veel lager nutriëntengehalte
zien. De nutriëntengehalten in de urine zijn erg laag, voor
wat betreft stikstof 8 keer lager dan van de gebruikte var-
kensdrijfmest. Dit betekent dat bij een gelijke bemestende
waarde (stikstof) er achtmaal zoveel verdunde urine op-
gebracht moet worden ten opzichte van in deze proef op-
gebrachte varkensdrijfmest.

Verdunningsfactor
Op basis van de analysegegevens van stikstof blijkt dat de
bemonsterde urine in de tank (opgebrachte urine) een fac-
tor 5 tot 8 keer moet zijn verdund. Dit is meer dan verwacht op basis van het type toilet (ver-
wachting circa 3 tot 4 maal). Ìn paragraaf 3.7.2. wordt nader ingegaan op mogelijke oorzaken
van deze verdunning.



1
Grontmij, 2008. Toepassingsmogelijkheden voorurine in de landbouw in Friesland. Drachten
Resultaten praktijkproef

13/99100215/JdW, revisie D1
Pagina 16 van 27

3.3 Bemestingsapparatuur: oppompen en aanbrengen urine
Proef 2009
Ìn het groeiseizoen van 2009 is de helft van het perceel bemest met varkensmest en de andere
helft met urine uit de opslagtanks.
De urine is met gebruik van een conventionele zodebemester opgepompt en aangebracht. Tij-
dens het pompen en aanbrengen hebben zich geen technische problemen bij de machine voor-
gedaan.

Vanwege de lage stikstofconcentratie in de urine is in 2009 een hoge dosering (groot volume)
aangehouden om te voldoen aan dezelfde bemestende waarde als de bemestende waarde van
de varkensmest op het naburige perceel. De dosering bedroeg circa 110 tot 130 m
3
per hectare.
Gangbare doseringen voor het aanbrengen van dierlijke mest variëren in de praktijk van 20 tot
30 m
3
per hectare. Vanwege deze hoge dosering trad de urine deels uit de sleufjes en er was
her en der sprake van plasvorming.
Bij uittreding uit de sleufjes waarbij plasvorming optrad, zal een relatief hoge ammoniakver-
vluchtiging zijn opgetreden waardoor stikstof voor het gewas verloren is gegaan.

Op basis van deze resultaten is besloten bij de praktijkproef in 2010 niet meer te focussen op
de bemestende waarde van de urine en de gewasopbrengst, maar het onderzoek te concentre-
ren op geuroverlast (zie ook paragraaf 3.5).
Figuur 3-2 Oppompen urine uit de put (links) en aanbrengen van de urine met de zodebemester (rechts).


Proef 2010
Ìn 2010 zijn twee percelen verschillend bemest, n.l. één perceel met verdunde urine uit de op-
slagtank en één perceel met een mengsel van urine uit de opslagtank en varkensmest. Er is
gekozen voor een mengsel van urine met varkensdrijfmest aangezien dit ook in de praktijk een
mogelijke optie zou kunnen zijn. Urine zou namelijk gebruikt kunnen worden om de stikstofge-
bruiksnorm op te vullen bij bemesting met varkensmest (zie bijlage 5). Bovendien zou door het
mengen van de humane urine met varkensdrijfmest de urinestank mogelijk kunnen worden
weggenomen.

Met de zodebemester bleek het mogelijk de urine met de varkensdrijfmest te mengen. Het aan-
brengen van het mengsel leverde geen technische problemen op.
Ìn 2010 werd niet meer gefocust op gelijke bemestende waarde van de op te brengen mest op
beide percelen, maar stond het onderzoek naar de geuroverlast centraal. Op beide percelen
werd eenzelfde hoeveelheid mest(mengsel) aangebracht. Hierbij werd een dosering van circa
30 à 35 m
3
urine (mengsel) per hectare aangehouden. Deze dosering heeft niet tot plasvorming
geleid. De urine bleef vrijwel volledig in de door de zodebemester gemaakte sleuven.


Resultaten praktijkproef

13/99100215/JdW, revisie D1
Pagina 17 van 27

Figuur 3-3 Aanbrengen van de urine op het proefveld in 2010

Als urine zou worden toegelaten als meststof in de landbouw, zullen voor de toedieningswijze
waarschijnlijk dezelfde regels gelden als voor dierlijke mest. Voor de toediening van dierlijke
mest geldt een wettelijke inwerkplicht om de ammoniakemissie uit de mest te minimaliseren.
Vloeibare mest moet daartoe in de grond worden gebracht of intensief met de grond worden
gemengd, zodanig dat het niet meer zichtbaar op het grondoppervlak ligt. Toediening met een
zodebemester, waarbij de mest in sleufjes bovenin de grond wordt aangebracht, mag, mits de
mest niet uit de sleufjes treedt.

Bij toediening met een zodebemester, treedt meer ammoniakvervluchtigingsverlies op dan bij
een bouwlandinjecteur en is de stikstofwerking bij zowel het aanbrengen van de urine als de
varkensdrijfmest lager
5
.

3.4 Gewasgroei en opbrengst

3.4.1 Monitoring gewas
Gedurende de proef is het proefveld regelmatig bezocht door Landschapsbeheer Drenthe (in
2009) en Grontmij in 2010. Tijdens deze bezoeken zijn geen bijzonderheden geconstateerd. Ìn
fig. 3.4 zijn enkele afbeeldingen weergegeven. Meer foto's van de gewasontwikkeling zijn op-
genomen in bijlage 8. Visueel waren er in 2009 geen opvallende verschillen te constateren tus-
sen de gewasgroei op het met urine bemeste perceel en het met varkensmest bemeste perceel.
Ditzelfde was het geval in 2010 voor het met urine bemeste perceel en het met het mengsel
varkensmest/urine bemeste perceel.

Figuur 3-4 Maïs op 9 juni, 7 juli en 21 augustus 2009.

3.4.2 Gewasopbrengst

Proef 2009
Op 29 oktober 2009 is de maïs van het proefveld geoogst. Op basis van opbrengstmetingen
door de loonwerker bedroeg de opbrengst ter plaatse van het met urine bemeste deel in totaal
5.750 kg en het met varkensdrijfmest bemeste deel in totaal 8.350 kg maïs. De oppervlakte van
beide percelen was gelijk.
Op basis van deze opbrengstbepaling kan niet eenduidig worden geconcludeerd dat urine min-
der geschikt is als meststof voor het telen van energiemaïs dan varkensmest. Ìmmers er zijn
nog meer variabelen aanwezig dan alleen het verschil in type bemesting (urine en varkens-
Resultaten praktijkproef

13/99100215/JdW, revisie D1
Pagina 18 van 27

mest). Zo is het perceel verre van homogeen (zie bijlage 1), de bemestingshistorie onbekend en
is door de sterke mate van verdunning van de urine (en mogelijke ammoniakvervluchtiging) niet
optimaal gebruik gemaakt van de bemestende waarde van urine.

Proef 2010
Ìn 2010 is in de proef geen gewasopbrengst bepaald, omdat dit geen doel was van de proef in
2010 (focus op geurhinder), mede omdat de bemestingsgraad van beide percelen ongelijk was.

Figuur 3-5 Oogst proefveld in 2009

De geoogste maïs is door de loonwerker vergist in de op het loonbedrijf aanwezige vergistings-
installatie. Met de oogst van het proefveld s dus biogas geproduceerd.

3.5 Geur

3.5.1 Geurhinder stakeholders
Ìn het navolgende wordt onderscheid gemaakt tussen geurwaarnemingen bij het oppompen van
de urine en bij het aanbrengen van de urine.

Proef 2009
• Oppompen
De loonwerker gaf in 2009 aan dat bij het oppompen van de urine uit de opslagtank sprake was
van stank op het moment dat de oppompslang in de urine werd gestoken (dus niet bij het ope-
nen van de put).

• Aanbrengen
Bij het aanbrengen van de urine in 2009 gaf de loonwerker aan dat er eveneens sprake was
van een verschrikkelijke stank. De stank van de urine was voor de loonwerker niet te harden
(letterlijk: 'de jongens gingen bijna over hun nek'). De geur werd als zeer sterk ervaren, ondanks
het feit dat de loonwerker regelmatig met mest werkt.
De mensen die werkzaam zijn op de locatie bij Stichting Landschapsbeheer Drenthe hadden in
2009 eveneens tijdens het aanbrengen van de urine last van stank. De waargenomen geur, die
tijdens het oppompen loskomt en zich verspreid door het gebouw gedurende het uitrijden, werd
als vreselijk penetrant en weeïg omschreven. De geur van de varkensdrijfmest werd niet zozeer
als storend ervaren.

De geurwaarnemingen in 2009 waren aanleiding het onderzoek naar stankoverlast in 2010 te
intensiveren. Besloten werd niet alleen de geur te laten beoordelen door stakeholders, maar
tevens een professioneel geuronderzoek te laten uitvoeren.

Proef 2010
Ten behoeve van het geuronderzoek is besloten de ene helft van het perceel te bemesten met
alleen urine en enkele dagen later (voor een aparte beoordeling) met een mengsel van urine en
varkensdrijfmest.

Resultaten praktijkproef

13/99100215/JdW, revisie D1
Pagina 19 van 27

• Oppompen
Op het terrein zijn twee opslagtanks aanwezig die onderling afgesloten kunnen worden. Ten
behoeve van de bemestingsproef (mei 2010) werd alleen de urine gebruikt uit de opslagtank
waarin de urine al een half jaar opgeslagen is geweest. Ìn april waren beide tanks vol, ook de
tank waarin de urine tot dat moment was aangevuld. Deze meest verse urine is in april 2010
opgepompt en afgevoerd naar een RWZÌ omdat er anders geen tank meer beschikbaar zou zijn
voor nieuw aan te voeren urine.
Een medewerker van Woonconcept is in april 2010 aanwezig geweest bij het oppompen en af-
voeren om eventuele geurhinder waar te nemen. De medewerker van Woonconcept heeft ge-
constateerd dat er zowel ongeroerd als na intensief roeren van de urine geen geur was waar te
nemen uit de geopende put (met verse urine). Ook een medewerker van Vanboeijen heeft ge-
roken en stelde vast dat er geen onwelriekende geur waar te nemen was.

Tijdens het oppompen van de urine uit de tank waarin de urine een half jaar opgeslagen is ge-
weest ten behoeve van de bemestingsroef met urine was een medewerker van Grontmij aan-
wezig. Zijn bevindingen waren dat er tijdens het oppompen van de urine sprake was van een
lichte geur.

• Aanbrengen
Om de geurervaringen tijdens het aanbrengen van urine en het mengsel van urine en varkens-
mest te onderzoeken zijn de medewerkers van Landschapsbeheer Drenthe geënquêteerd. De
voorgelegde enquêtes zijn opgenomen in bijlage 7.

Ìn 2010 zijn door acht verschillende mensen enquêtes ingevuld op de dag dat de urine is aan-
gebracht. Uit de resultaten valt op te maken dat de reacties uiteenlopen. Zo blijken enkele per-
sonen niets te hebben gemerkt en er zijn personen die de geur als indringend hebben ervaren.
De meerderheid (5 personen) heeft niets gemerkt. Opvallend is dat één persoon spreekt over
een zurige drijfmestgeur.

Er zijn in 2010 vijf enquêtes ingevuld op de dag dat het mengsel van de varkensdrijfmest en
urine is aangebracht. De resultaten van deze enquête zijn eenduidiger. Op de dag van aan-
brengen is door alle geënquêteerden hinder (binnen het gebouw en buiten) ondervonden. De
geur wordt als scherp en penetrant omschreven en de mate van hinder met een waarde van 3
tot 8 (op een schaal van 0 tot 10) gekarakteriseerd. Men heeft enkele uren tot een halve dag
hinder ondervonden.

Tijdens het aanbrengen van zowel de urine als het mengsel van urine en varkensdrijfmest was
een medewerker van Grontmij aanwezig. Zijn bevindingen waren dat er tijdens het aanbrengen
van urine nauwelijks sprake was van stank. De loonwerker constateerde dat er in 2010 wel
sprake was van geur, maar dat de stank in 2009 veel erger was. Ook merkte hij op dat de var-
kensdrijfmest veel meer stonk. Dit werd ook bevestigd door de medewerker van Grontmij.

3.5.2 Geuronderzoek (laboratorium)
Door PRA Odournet bv is geuronderzoek in het laboratorium uitgevoerd ten behoeve van de
vergelijking van de volgende drie mestsoorten:
• (Verdunde) humane urine (uit dezelfde tank die voor de bemesting van de ene helft van het
perceel) is gebruikt;
• Varkensdrijfmest;
• Een mengsel van (verdunde) humane urine en varkensdrijfmest (hetzelfde mengsel als voor
de bemesting van de tweede helft van het perceel is gebruikt);

De principes van een professioneel geuronderzoek zijn weergegeven in bijlage 7.

Geur wordt beoordeeld op geursterkte (geurconcentratie) en op geurervaring (hedonische
waarde).
Uit het geuronderzoek zijn door PRA Odournet de volgende conclusies getrokken:
• De volgende geurconcentraties zijn gemeten:
Resultaten praktijkproef

13/99100215/JdW, revisie D1
Pagina 20 van 27

° Varkensdrijfmest: 1.483.929 ouE/m
3

° Mengsel van varkensdrijfmest en humane urine: 1.160.626 ouE/m
3

° Verdunde humane urine: 214.951 ouE/m
3

• De geurconcentratie van de monsters van varkensdrijfmest is ongeveer een factor 7 hoger
dan de geurconcentratie van de monsters van verdunde humane urine.
• Een mengsel van varkensdrijfmest en humane urine geeft een geurconcentratie die tussen
de waarden van varkensdrijfmest en humane urine in ligt.
• Uit de hedonische metingen komt naar voren dat varkensdrijfmest als minder onaangenaam
wordt beoordeeld dan humane urine of een mengsel van varkensdrijfmest en humane urine.
• Het mengsel van varkensdrijfmest en humane urine resulteert in de laagste hedonische
waarden. Dit mengsel is als het meest onaangenaam beoordeeld door het panel. De ver-
schillen zijn gering.
• De geur van de monsters is in verhouding tot andere geuren als relatief onaangenaam be-
oordeeld.

Het volledige onderzoeksrapport van PRA Odournet is opgenomen in bijlage 7.

3.6 GeneesmiddeIen

3.6.1 Ìnfiltratieproeven met opvangbakken
Er is een proefopstelling aangelegd om de infiltratie van geneesmiddelen naar het watervoe-
rend pakket te kunnen meten (zie bijlage 2).
Vanwege de situatie ter plaatse van het proefveld in de zomer van 2009 is de bemonstering van
het infiltratiewater ten behoeve van het onderzoek naar de uitspoeling van medicijnen en nutri-
enten niet meer zinvol geacht en daarom stopgezet. De resultaten van de geplande bemonste-
ring zouden zeker niet representatief zijn. Enkele oorzaken van de stopzetting waren (zie ook
bijlage 4):
• Ìn de opvangputten is veel meer water gemeten dan mogelijk was op basis van de neerslag-
hoeveelheid. Er kunnen hiervoor verschillende oorzaken zijn. Het uitzoeken van de daadwerke-
lijke oorzaak is als te complex en te duur beoordeeld, mede omdat dit onderdeel een neven-
doel van het proefproject betreft;
• De loonwerker had het proefperceel niet overdwars maar overlangs in tweeën gedeeld en
had bovendien niet bemest ter plaatse van de opvangbakken. Het was hierdoor niet mogelijk
infiltratie van urine met geneesmiddelen te meten en bovendien was het meten van het verschil
in belasting door urine en varkensmest niet mogelijk.

3.6.2 Geneesmiddelenconcentraties in de urinetanks

Volume urine in de tanks en verdunningsfactor
Ìn juni 2009 (circa 1 jaar na opening van de locatie) is de urine uit de opslagtanks bemonsterd
en geanalyseerd. Ten tijde van de monstername bevond zich circa 19 m
3
verdunde urine in de
tanks. Er is berekend dat per jaar op de locatie circa 6 m
3
urine geproduceerd wordt (zie bijlage
4). Op basis van de aangetroffen hoeveelheid van 19 m
3
verdunde urine en de berekende hoe-
veelheid van 6 m
3
zuivere urine wordt een verdunning van circa 3 maal afgeleid.

Geneesmiddelengebruik
Ìn bijlage 4 is het geneesmiddelengebruik in de zorgboerderij in Anderen volgens opgave in de
zomer van 2008 en volgens opgave in januari 2010 weergegeven. Ìn deze bijlage is tevens de
berekening weergegeven van de te verwachten concentratie geneesmiddelen in de urinetanks
in juni 2009 ten tijde van de monstername. Bij deze concentratieberekening is de vracht ge-
neesmiddelen berekend die volgens verwachting in de voorafgaande periode in de tank terecht
is gekomen en is de concentratie berekend uitgaande van een volume van19 m
3
urine in de
tanks ten tijde van de bemonstering.

Analyseresultaten
De urine uit de opslagtank is in 2009 op geneesmiddelen geanalyseerd in het laboratorium van
Omegam in Amsterdam en in 2010 in het laboratorium van Vitens in Leeuwarden (beide jaren
Resultaten praktijkproef

13/99100215/JdW, revisie D1
Pagina 21 van 27

monstername voorafgaande aan toediening op het perceel). De analyseresultaten zijn weerge-
geven in bijlage 4. Van de toegediende geneesmiddelen zijn bij het laboratorium van Omegam
alleen carbamazepine en lithium geanalyseerd en bij het laboratorium van Vitens alleen carba-
mazepine.

Ìn tabel 3-2 zijn de geneesmiddelenconcentraties in 2009 en 2010, alleen van die parameters
die gemeten zijn in gehalten boven de rapportagegrens, weergegeven. Alleen carbamazepine
en lithium komen voor op de aangeleverde lijsten geneesmiddelen die door de cliënten van de
zorgboerderij worden ingenomen. De overige aangetroffen geneesmiddelen zijn reguliere ge-
neesmiddelen die ingenomen kunnen zijn door andere gebruikers van de locatie. Metropolol en
sotalol zijn bijvoorbeeld gangbare bètablokkers en naproxen en diclofenac zijn zeer regulier ge-
bruikte pijnstillers/ontstekingsremmers.

Tabel 3-2. Geneesmiddelenconcentraties van urinemonsters uit opslagtank lokatie Anderen, alleen
van de parameters die aangetroffen zijn in gehalten boven de rapportagegrens
Parameter Gemeten concentratie 2009
(Ôg/l)
Gemeten concentratie 2010
(Ôg/l)
Carbamazepine 140 250
Coffeine 380
Metropolol 11 4,4
Lithium 200
naproxen 48
sotalol 6,1
paracetamol 660
diclofenac 1,5

Ìn tabel 3-3 is voor de bemonstering van 2009, naast de parameters met gehalten boven de
rapportagegrens, weergegeven wat volgens de berekeningen (zie bijlage 4) de concentratie in
de opslagtanks zou moeten zijn. De berekende concentratie is globaal een factor 3 hoger dan
de gemeten concentratie. Dit betekent dat de gemeten concentratie in de opslagtanks circa ne-
gen maal lager is dan berekend is voor zuivere urine.

Het verschil in gemeten en berekende concentratie kan verschillende oorzaken hebben. Enkele
hiervan zijn:
• Er wordt door de bewoners minder van de urinescheidingstoiletten gebruik gemaakt dan
verwacht;
• Het scheidingspercentage van de toiletten is lager dan de 85% waar vanuit is gegaan;
• Er worden door de bewoners minder geneesmiddelen ingenomen dan verwacht;
• De uitscheidingspercentages van de geneesmiddelen door de mens zijn lager dan de per-
centages die in de literatuur vermeld worden;
• (een deel van) de geneesmiddelen breken af tijdens opslag (dit kan niet het geval zijn bij
lithium, een element).

Tabel 3-3. Vergelijking analyseresultaten geneesmiddelen in urine uit de tank (2009) (alleen ge-
neesmiddelen boven detectiegrens zijn weergegeven) en berekende concentraties op basis van
innamegegevens en uitscheidingspercentages (uitscheiding= inname*uitscheidingspercentage).
Parameter Gemeten concentratie
2009
(Ôg/l)
Verwachte concentratie
volgens berekeningen
(Ôg/l)
Factor Bere-
kend/gemeten
Carbamazepine 140 382 2,7
Coffeine 380
Metropolol 11
Lithium 200 629 3,1

3.6.3 Verdunningsfactor
Op basis van een combinatie van zowel de nutriëntengehalten als de geneesmiddelengehalten
lijkt het het meest voor de hand liggend dat er in de tank minder urine terecht komt dan ver-
Resultaten praktijkproef

13/99100215/JdW, revisie D1
Pagina 22 van 27

wacht en lijkt de verdunningsfactor dichter in de buurt van de 8 te liggen dan van de 3,2 die was
afgeleid op basis van de verwachte hoeveelheden urine.

3.7 Overige resuItaten
Naast de resultaten ten aanzien van de onderzoeksvragen zijn er gedurende de proef ook an-
dere bevindingen gedaan. Deze zijn in deze paragraaf beschouwd.

3.7.1 Aanleg gescheiden sanitatiesysteem
Ìn het Programma van Eisen en het bestek ten behoeve van de aanleg van de opslagtanks was
opgenomen dat de verbinding tussen de opslagtanks afgesloten moet kunnen worden. Toch
waren de opslagtanks voor urine in eerste instantie aan de bovenkant met een leiding met el-
kaar verbonden. Dit betekende dat indien de ene tank vol is, de urine naar de andere tank kon
stromen. Consequentie hiervan is dat in beide tanks steeds verse urine terecht kon komen en
een tank niet afzonderlijk kon worden afgesloten. Bij de aanleg is dus afgeweken van het Pro-
gramma van Eisen.
Woonconcept heeft ervoor gezorgd dat de afsluitklep op 20 januari 2010 alsnog is geplaatst.
Door deze klep is het mogelijk de tanks van elkaar af te sluiten en de urine enkele maanden
separaat op te slaan (zie figuur 3-6).

Figuur 3-6 Aangebrachte afsluiter (links) en urinetransportleidingen (rechts)

Ìndien de tanks vol zijn gelopen is er geen automatische overloop naar de riolering. Er was niet
duidelijk afgesproken wie de inhoud (hoeveelheid) in de tanks controleert. Ìnmiddels zijn hier-
over afspraken gemaakt.

Bij een inspectie in december 2009 is geconstateerd dat op de tanks alleen de urinetoevoerlei-
dingen aangesloten zijn en geen andere leidingen. Er werd namelijk, op grond van de grote ma-
te van verdunning van de urine, met de mogelijkheid rekening gehouden, dat er ook andere lei-
dingen op aangesloten konden zijn. Bij deze inspectie is wel gebleken dat de aanwezige leidin-
gen niet allemaal in PE (Polyetheen) waren uitgevoerd, zoals voorgeschreven, maar een deel in
PVC. Het deel in PVC is door aannemer vervangen door PE.

Er is geconstateerd dat in het buitenland wordt gewerkt met plastic tanks terwijl in Anderen be-
tonnen tanks zijn geplaatst. Ìndien deze goed aangelegd zijn hoeft dit geen probleem te zijn.
De aansluiting van de tankdeksels naar de tank zijn opgemetseld. Hierdoor zijn de tanks moge-
lijk niet volledig waterdicht. Gezien de grondwaterstand en de hoogteligging wordt aangenomen
dat dit op deze locatie geen probleem op zal leveren. Met uitzondering van de opgemetselde
rand is het gehele systeem thans technisch in orde.


3.7.2 Toiletgedrag en verdunning
Uit de nutriëntenconcentraties en de geneesmiddelenconcentraties van de urine uit de opslag-
tanks werd een verdunning van 5 tot 8 maal afgeleid. Dit is meer dan verwacht op grond van
het toilettype (3 tot 4 maal). Enkele mogelijkheden van deze relatief sterke verdunning zijn on-
derzocht.
Resultaten praktijkproef

13/99100215/JdW, revisie D1
Pagina 23 van 27


Uit een gesprek van de projectleider van Woonconcept met mensen van Vanboeijen en een
cliënt is gebleken dat er grote hoeveelheden water door de toiletten gaan bij schoonmaakwerk-
zaamheden. Hierbij wordt driftig gebruik gemaakt van alle soorten schoonmaakmiddelen, o.a.
bleekmiddelen.
Ìn de toiletten vindt urinescheiding wanneer zittend geplast wordt, ook door mannelijke gebrui-
kers. Vanboeijen heeft aangegeven dat diverse bewoners nog steeds staand plassen evenals
de mannelijke werknemers bij Landschapsbeheer Drenthe. Daarnaast werd bij Landschapsbe-
heer Drenthe aangegeven dat er regelmatig na een grote boodschap enkele keren nagespoeld
dient te worden om voldoende wegspoeleffect te verkrijgen. Ìedere keer dat er spoelwater ge-
bruikt wordt, komt een deel van het spoelwater (circa 10%) in de urinetanks terecht. Overmatige
spoeling zonder toevoeging van urine naar de tanks leidt tot een grotere verdunning van de uri-
ne in de opslagtanks dan verwacht.

3.7.3 Uitvoering agrarische werkzaamheden en communicatie
Ondanks concrete afspraken met de loonwerker blijkt in de praktijk dat de loonwerker op som-
mige momenten zijn eigen plan trekt, overigens met de beste bedoelingen. Zo is het perceel in
2009 door de loonwerker in de lengterichting in tweeën gedeeld en niet in de breedte zoals
aangegeven was, omdat dit minder draaibewegingen met zich meebrengt en de loonwerker van
mening was dat er twee meer gelijkwaardige percelen zouden ontstaan. De loonwerker heeft
niet beseft dat de opvangbakken voor de infiltratieproeven zich hierdoor niet meer op verschil-
lende percelen bevonden.

3.7.4 Quick scan literatuur
De bevindingen uit de tweejarige praktijkproef zijn middels een quick scan getoetst aan litera-
tuur. De korte weergave van de resultaten hiervan is opgenomen in bijlage 9.


13/99100215/JdW, revisie D1
Pagina 24 van 27

4 8amenvatting. conclusies en aanbevelin-
gen
4.1 InIeiding
Door het uitvoeren van de proef zijn in 2009 en 2010 diverse praktijkervaringen opgedaan
waardoor verschillende knelpunten en aandachtspunten aan het licht zijn gekomen.
Per onderzoeksaspect worden in dit hoofdstuk kort de resultaten samengevat. Daarnaast wor-
den per aspect de conclusies weergegeven. Tot slot worden aanbevelingen gedaan.

4.2 Samenvatting en concIusies

Bemestende waarde
• De urine in de opslagtanks was 5 à 8 maal verdund t.o.v. zuivere urine;
• De nutriëntengehalten in de urine zijn erg laag, voor wat betreft stikstof 8 keer lager dan van
de gebruikte varkensdrijfmest;
• De concentratie stikstof van de gebruikte verdunde urine was ca 5 - 8 x lager dan van zuive-
re urine;
• Om voldoende stikstof aan te brengen om energiemaïs op het proefveld te telen is een zeer
grote dosering nodig.

Conclusie bemestende waarde:
Als gevolg van verdunning is de bemestende waarde van de urine op de zorglocatie erg laag.
Dit maakt de (verdunde) urine van deze locatie niet aantrekkelijk voor landbouwkundige toe-
passing. Er moet namelijk een grotere hoeveelheid worden opgepompt en aangebracht wat ex-
tra machine- en arbeidskosten met zich mee brengt.

Bemestingsapparatuur: oppompen en aanbrengen urine
• Het is mogelijk de verdunde urine uit opslagtanks op te pompen en op het proefveld aan te
brengen met de zodebemester die in deze proef gebruikt is;
• Het is technisch mogelijk urine en varkensdrijfmest in de tank te mengen en op het proefveld
aan te brengen met de zodebemester die in deze proef gebruikt is;
• Bij het aanbrengen van 5 tot 8 maal verdunde urine met een zodebemester in een hoeveel-
heid die dezelfde bemestende waarde (wat betreft stikstof) heeft als varkensmest trad de
verdunde urine uit de sleufjes en trad plasvorming op. Vermoedelijk heeft dit tot een hoge
ammoniakemissie geleid;
• Bij het aanbrengen van verdunde urine in eenzelfde hoeveelheid als gebruikelijk is voor var-
kensmest (ca 30 m
3
/ha) trad geen plasvorming op.

Conclusie bemestingsapparatuur
De zodebemester, die in deze proef is gebruikt, is gangbare bemestingsapparatuur in de prak-
tijk. Op basis hiervan kan worden geconcludeerd dat in de praktijk apparatuur voorhanden is,
indien urine als meststof in de landbouw wordt toegepast. Er zijn dus geen (extra) investeringen
in, of ontwikkeling van, machines en apparatuur nodig.

Gewasgroei en opbrengst
• Visueel zijn er geen bijzonderheden of opvallende verschillen in gewasgroei waargenomen
tussen het perceel dat met urine is bemest en het perceel dat met varkensmest is bemest;
Samenvatting, conclusies en aanbevelingen

13/99100215/JdW, revisie D1
Pagina 25 van 27

• De gewasopbrengst van het met varkensmest bemeste deel was een factor 1,5 keer hoger
ten opzichte van de gewasopbrengst van het met urine bemeste deel (in 2009);
• De oorzaak van dit verschil in opbrengst is niet eenduidig aan het verschil in mestsoort toe
te schrijven, vanwege de invloed van verschillende factoren als de vlakteligigng van het
proefveld, de inhomogeniteit van de bodem, de hydrologische situatie en mogelijke ammo-
niakemissie.

Conclusie gewasgroei en opbrengst
Bij toepassing van de verdunde urine op de locatie in de teelt van energiemaïs zijn visueel geen
bijzonderheden aan het gewas geconstateerd. Met de resultaten van de proef kan geen uit-
spraak worden gedaan over de verschillen in de opbrengst van energiemaïs bij toepassing van
urine op de zorglocatie vergeleken met gangbare bemesting (bij de teelt van energiemaïs in de
praktijk).

Geur
• Bij het oppompen en aanbrengen van de urine in 2009 is geurhinder ondervonden door de
loonwerker en de medewerkers van Landschapsbeheer;
• Ìn 2010 werd door de loonwerker en door medewerkers van Vanboeijen en Landschapsbe-
heer nauwelijks hinder ondervonden tijdens het oppompen en tijdens en na het aanbrengen
van de urine.
• Op basis van het geuronderzoek in het laboratorium is de geur van de urine minder aange-
naam beoordeeld ten opzichte van de geur van varkensdrijfmest. De geur van een mengsel
van urine en varkensdrijfmest is het minst aangenaam. De verschillen tussen de resultaten
van het urinemonsters, het monster varkensdrijfmest en het monster van het mengsel van
urine met varkensdrijfmest waren echter klein.

Conclusie geur
Er is een verschil in geurwaarneming tussen de bewerkingen met urine in 2009 en 2010. Ìn de
urine die in 2009 werd gebruikt bevond zich ook verse urine. De urine die in 2010 werd gebruikt
is minimaal 5 maanden opgeslagen geweest. Mogelijk is deze opslagtijd de reden voor een
beperktere geurhinder. Dit komt overeen met de bevindingen van M. Johansson. Deze heeft
geconstateerd dat de geur van opgeslagen urine minder wordt in de loop van de tijd
2
;
De geurhinder kan bij het aanbrengen van (verdunde) urine of een mengsel van varkensdrijf-
mest met urine mogelijk iets groter zijn ten opzichte van bemesting met varkensdrijfmest. Het
verschil zal naar verwachting klein zijn. De verwachting is niet dat geurhinder praktijktoepassing
van urine in de landbouw in de weg zal staan.

UitspoeIing van medicijnen
• Het meten van infiltratie van medicijnen naar de ondergrond is mislukt vanwege het niet
functioneren van de meetopstelling;
• Van de geneesmiddelen die door de bewoners van de zorgboerderij worden ingenomen
komen alleen lithium en carbamazepine voor in de analysepakketten van de laboratoria;
• Lithium en carbamazepine zijn aangetroffen in de urine in de opslagtanks, echter wel in con-
centraties lager dan verwacht op basis van de innamegegevens. Dit kan duiden op een la-
gere toevoer van urine door de bewoners naar de urineopslagtanks (veel buiten of staand
geplast).

Conclusie uitspoeling van medicijnen
Carbamazepine en lithium, beide geneesmiddelen die in de zorginstelling worden ingenomen,
zijn teruggevonden in de urine-opslagtanks, ook na een half jaar opslag van de urine. Carba-
mazepine is één van de geneesmiddelen waarvan in het onderzoek door de WUR
3
is gebleken
dat die op lange termijn een risico kunnen vormen voor contaminatie van grondwater.



2
Persoonlijke mededeling, 2009. Mats Johansson, VERNA Ecology, Stockholm.
3
Kujawa-Roeleveld et al. 2009.
Samenvatting, conclusies en aanbevelingen

13/99100215/JdW, revisie D1
Pagina 26 van 27

Gescheiden aanIeg sanitatiesysteem
• De tanks waren niet conform bestek aangelegd. De tanks waren niet afzonderlijk afsluitbaar
en niet alle leidingen waren van PE.

Conclusie aanleg gescheiden sanitatiesysteem
De aanleg van een dergelijk nieuw systeem kan niet alleen op basis van een bestek uitgevoerd
worden, maar moet zorgvuldig begeleid worden omdat er zich keuzes voordoen voor de aan-
nemer die vooraf niet voorzien kunnen worden. Het is geen standaardwerk en de communicatie
is een belangrijk onderdeel in deze.

ToiIetgedrag
• Veel mannelijke bewoners van de zorginstelling en van de overige gebouwen blijken staand
te plassen;
• Bij het schoonmaken van de toiletten wordt regelmatig veel water gebruikt en worden veel
chemische schoonmaakmiddelen gebruikt;
• Bij het doorspoelen van de 'grote boodschap' wordt voor een effectieve doorspoeling vaak
doorgespoeld.

Conclusie toiletgedrag
De woongroep is een lastige populatie om zittend plassen aan te leren. Eenmaal staand plas-
sen aangeleerd verander je niet zomaar.
Een goede voorlichting over het toiletgebruik en het doel van de gescheiden urineopvang is
noodzakelijk en moet steeds worden geactualiseerd.

Uitvoering agrarische werkzaamheden
• De loonwerker heeft zich niet altijd aan de voorschriften voor de werkzaamheden gehouden
(vaak met de beste bedoelingen);

Conclusie uitvoering agrarische werkzaamheden
Bemesting met urine en uitvoering van praktijkproeven is voor loonwerkers geen standaardwerk
en vereist een voortdurende heldere communicatie en strakke begeleiding van de uit te voeren
werkzaamheden

UrinehoeveeIheden
• Ìn april 2010 is 10 m
3
urine van de locatie afgevoerd omdat beide tanks vol waren en slechts
één tank gebruikt kon worden voor bemesting

Conclusies t.a.v. management van urinehoeveelheden:
• Vanwege de randvoorwaarde dat de urine minimaal een half jaar separaat moet worden op-
geslagen, kan de inhoud van één tank in het voorjaar worden gebruikt en de inhoud van de
andere tank in het najaar. Aangezien er in het najaar nog een gewas aanwezig is of er is
inmiddels geoogst, kan de urine in het najaar niet meer worden gebruikt voor de maïsteelt.
Dit betekent dat er op de locatie jaarlijks ca. 10 m
3
urine moet worden opgepompt en afge-
voerd;
• De toepassing van de urine in de landbouw vraagt een bepaald management. De urine moet
namelijk op het juiste tijdstip beschikbaar komen (veelal in het voorjaar voor de inzaai van
een gewas). Ìndien een tank bijvoorbeeld in mei vol is en wordt afgesloten (zodat er geen
verse urine meer bij kan) kan de urine pas in september/oktober worden toegepast. Ìn deze
periode is er mogelijk minder behoefte aan stikstofmeststoffen of mag het mogelijk als ge-
volg van wetgeving niet mogen worden uitgereden.
Samenvatting, conclusies en aanbevelingen

13/99100215/JdW, revisie D1
Pagina 27 van 27

4.3 AanbeveIingen
Op grond van de bevindingen in deze praktijkproef worden de volgende aanbevelingen gedaan:
• Uit deze praktijkproef is gebleken dat het technisch (wat betreft gebruik apparatuur) mogelijk
is urine toe te passen in de landbouw. Vanwege het oncontroleerbare toiletgedrag van de
bewoners en het hogere gebruik van geneesmiddelen door de cliënten van de zorgboerderij,
met name carbamazepine, wordt aanbevolen de toepassing op de zorgboerderij niet langer
voort te zetten;
• Bij praktijktoepassing van urine in het algemeen zal een hogere concentratie nutriënten aan-
wezig moeten zijn dan bij deze praktijkproef het geval is geweest. Dit betekent dat verdun-
ning tot een minimum dient te worden beperkt. Hierbij kan gedacht worden aan het aanpas-
sen van het toiletsysteem (o.a. bij voorkeur waterloze urinoirs door mannelijke gebruikers
en/of minder spoelwater) en een goede voorlichting aan de gebruikers;
• Om ammoniakemissie te voorkomen dient na het aanbrengen van de urine, de urine zo snel
mogelijk in de grond te worden gewerkt;
• Voorkom een te hoge (volume)dosering;
• Beperk geurhinder en ammoniakemissie door toepassing een bouwlandinjecteur of machi-
nes die vloeibare mest kunnen injecteren, zoals bijvoorbeeld de spaakwielbemester
4
(zie fig.
4.1);
• Houdt bij de aanleg van de aantallen en de volumes van urineopslagtanks rekening met een
flexibel bemestingsregiem;
• Zorg voor een goede communicatie en een goede begeleiding bij de aanleg van systemen
en de uitvoering van de bemesting wanneer dit voor de eerste keer gedaan wordt.


Figuur 4-1 Sportveldvariant: spaakwielbemester (links) bron: loonbedrijftamminga.nl, Landbouwvariant
spaakwielbemester (rechts) bron: www.agerland.nl/

• Onderzoek de bemestende waarde van zuivere urine en de effecten op de opbrengst (en
eventuele neveneffecten) op proefvelden die geschikt zijn voor (semi)wetenschappelijke
doeleinden;
• Onderzoek de effecten van het aanbrengen van een mengsel van zuivere urine en varkens-
drijfmest op proefvelden die geschikt zijn voor (semi)wetenschappelijke doeleinden;
• Onderzoek de meest kansrijke agrarische toepassingen (bv. biologische landbouw, algen-
kweek);
• Onderzoek de beperkingen tengevolge van de mestwetgeving en de noodzakelijke aanpas-
singen hiervan;
• Onderzoek het gedrag en effecten van medicijnen voor het aquatisch milieu en bodem op
lange termijn.




4
De spaakwielbemester is ontwikkeld voor de toediening van vloeibare kunstmest (betreft veel lagere hoeveelheden
vloeistof per hectare).

29.4.2010
1
Folie 1 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Are pharmaceutical residues a problem for
urine reuse in agriculture?
Dr.-Ing. Martina Winker, M.Sc.
Sustainable Sanitation – ecosan program
German Technical Cooperation (GTZ) GmbH
Folie 2 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
29.4.2010
2
Folie 3 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
What is a fertilizer?
 Fertilizers are substances which are determined to
be applied directly or indirectly towards agricultural
crops to support their growth, to enhance their
yields or to improve their quality;
 Excluded are substances which are determined to
protect plants from pests and diseases without
supporting plant nutrition, determining plant
nutrition, influencing life cycles in plants as well as
soil conditioners, culture media, plant additives,
carbon dioxide, peat and water.
(Düngemittelgesetz, 1977; BGBl. I S. 2134)
Folie 4 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Classification of Fertilizers
• Liquid ↔ Solid
• Mineral ↔ Organic
mineral organic
Nutrient concentration high low
> 8% < 1-5%
Nutrient availability high partially available
(Timing & Efficiency) N - hardly available
P - medium term like MF
K like MF
Soil structure - Improvement
CEC - Improvement
Hygiene - Treatment required
Price high Treatment required
Fertilizer type
(Clemens, 2005)
29.4.2010
3
Folie 5 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
29.4.2010
Change of perspective
Matching of capabilities of existing fertiliser application
technologies:
 10 - 50 m
3
ha
-1
– liquid fertilisers
 ≤ 40 t DM ha
-1
– solid fertilisers
 100 - 600 kg ha
-1
– granulates
Folie 6 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
29.4.2010
Properties of products
29.4.2010
4
Folie 7 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
 High concentrations of N and P as
well as other nutrients
 Low ammonia emission
 Comparable to liquid manure after
field application
 Multi-component fertiliser
29.4.2010
Urine
Muskolus, 2006
Winker, 2007
Vinnerås
Folie 8 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
29.4.2010
Nutrient compositions and crop requirements
N
29.4.2010
5
Folie 9 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
 Mostly derived in high-tech solutions
 Achieved through a combination of
various treatment steps
 Limiting factor in production: energy
costs
 Different plant availability of different
MAP products according to specific
crop (Simons, 2008)
29.4.2010
Urine’s fertiliser products
Tettenborn, 2007
Tettenborn, 2007
Tettenborn, 2007
S
t
e
r
c
o
r
i
t
P
o
t
a
s
s
i
u
m

A
m
m
o
n
i
u
m

P
h
o
s
p
h
a
t
e
Folie 10 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
History – E. Wolff
(Emil Wolff, 1868)
29.4.2010
6
Folie 11 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Barley
Control c
Urine pH 4 u
Urine pH 4/Slurry us
Mineral fertilizer (CAN) m
0
2
4
6
8
10
c u u/s m
y
i
e
l
d

[
t
/
h
a
]
a c c b
Fertilizing Effect
of Urine
(Clemens, 2005)
Folie 12 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Comparison with Manure
N
u
t
r
i
e
n
t

e
q
u
i
v
a
l
e
n
t
s
(Hammer & Clemens, 2007)
29.4.2010
7
Folie 13 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Fertiliser demands worldwide
= Fertilizer prices
(FAZ.NET, 2008)
= Fertilizer usage
= $/t
= Mio. t
Folie 14 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Fertiliser demands worldwide
(FAZ.NET, 2008)
= Fertilizer usage = Fertilizer usage
= Mio. t
= Mio. t
29.4.2010
8
Folie 15 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Urine as fertiliser
 Consume of pharmaceuticals is common
in everyday life.
 Urine is a component in new sanitation
systems.
 Urine has a good potential as liquid
fertilizer.
 But: Urine might contain pharmaceutical
substances…
Folie 16 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Pharmaceuticals
(Winker et al., 2008)
29.4.2010
9
Folie 17 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Schematic Approach
Screening
PHASE I
Feedback
Analysis
First Results Verified Results
PHASE II
Pflanzen-
versuche
Folie 18 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Article
Sub-
stance
Place
Media
Water, Wastewater, Soil, Plants
Degradation
e.g. Sorption, Biodegradation
T
r
a
n
s
f
o
r
m
a
t
i
o
n

p
r
o
d
u
c
t
s
Database
29.4.2010
10
Folie 19 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Database
Article
Sub-
stance
Place
Media
Water, Wastewater, Soil, Plants
Degradation
e.g. Sorption, Biodegradation
T
r
a
n
s
f
o
r
m
a
t
i
o
n

p
r
o
d
u
c
t
s
380 of 760 330 310
2050 1700 420 350
490 330
1670
Folie 20 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Evaluation of Database
 Two aspects investigated regarding plants:
Uptake and Phytotoxicity
Uptake Phytotoxcity
Datasets 162 348
Substances 14 30
Plant species 25 30
Plant families 16 11
29.4.2010
11
Folie 21 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Evaluation of Database - Substances
Uptake Phytotoxicity
Mainly antibiotics investigated!
Folie 22 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Evaluation of Database – Plant types
Uptake Phytotoxicity
Mainly cereals and umbellifers reg. uptake.
Mainly cereals and legumes reg. phytotoxicity.
29.4.2010
12
Folie 23 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Evaluation of Database
Comparison of collected data with urine
Tests with liquid medium
- Urine-water mix assumed
- 112 DS - 12 pharmaceuticals
- Only two articles comparable reporting on uptake by
very old bioassays.
Tests with solid medium
- Application of urine: 25 m
3
ha
-1
- Infiltration of 0.5 m assumed
- 45 DS - 9 pharmaceuticals
Hammer & Clemens. 2007. A tool to evaluate the
fertilizer value and the environmental impact of
substrates from wastewater treatment. Water Science &
Technology 56 (5), pp 201 – 209
Folie 24 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Evaluation of Database
Substance Plant species Reported impacts
Factor
(DB/U)
Chloroquine soybean Phytotoxic: neg. on w, h, r, s, l 182
Chlorotetracycline spring wheat Phytotoxic: pos. on h, r 82
Chlorotetracycline pinto bean Phytotoxic: neg. on w, h, r, s, l 82
Chlorotetracycline green onion
Bioaccumulation:
0.013 ng kg
-1
FW in stalk & leaves
51
Chlorotetracycline cabbage
Bioaccumulation:
0.01 ng kg
-1
FW in stalk & leaves
51
Metronidazole soybean Phytotoxic: neg. on w, h, r, s, l 67
Oxytetracycline spring wheat Phytotoxic: pos. on h, r 2
Oxytetracycline pinto bean Phytotoxic: neg. on w, h, r, s, l 2
29.4.2010
13
Folie 25 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Evaluation of Database
 Pharmaceuticals found in guttation drops.
(Stokes, 1954; Brian et al., 1951;)
 Uptake via peel observed for carrots and potatoes.
(Dolliver et al., 2007; Boxall et al., 2006)
 Different behavior regarding pharmaceutical
substances by different plants.
(Batchelder, 1982)
 Uptake of oxytetracycline detected in barley grain.
(Jacobsen et al., 2004)
Applied amount are much higher then in
case of fertilization with urine.
?
Folie 26 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Design of Pot Experiments with Rye Grass
Winker et al. 2008. Fertilisation of rye grass using urine spiked
with carbamazepine, ibuprofen, and 17α-ethinylestradiol – a
greenhouse experiment. Handed in.
29.4.2010
14
Folie 27 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Results of Pot Experiments
 Only Carbamazepine (CZ) found in soil.
 No effect on biomass production visible.
 Aside of well-known fertilizing effect of urine.
 No differences observed during course of the
vegetation period.
 Analytics: (Reich & Engel – Zentrallabor TUHH)
 EE2 not measurable (matrix effects)
 IBU only in roots (LOQ: 20 µg kg
-1
TM)
 CZ – LOQ in roots: 30 µg kg
-1
TM
– LOQ in aerial plant parts: 75 µg kg
-1
TM
Folie 28 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Plant Tests with Rye Grass
(Winker et al., 2008)
29.4.2010
15
Folie 29 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Results of Pot Experiments
CZ fraction:
0.2% of total
amount
CZ fraction:
30% of total
amount
Folie 30 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Kanton Solothurn, 2007
Results of Pot Experiments
Dairy Cow
(Weight: 600 kg / Milk production: 50 kg d
-1
)
Dry matter: approx. 19 kg d
-1
(DLG, 2005)
CZ uptake: 1.4 mg d
-1
Human being: 0.8 - 2 g d
-1
(Mutschler et al., 2001)
?
29.4.2010
16
Folie 31 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Results of Pot Experiments
?
Folie 32 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Pot experiments
 Biodegradation seems to be an important factor.
 Biomass production was not influenced in the
pharmaceutical concentrations applied via urine.
 CZ was found in roots and aerial plant parts of rye
grass.
 Assumption: Pharmaceutical substances persistent in
soil can be taken up by plants in higher
concentrations.
Only first results!!!
29.4.2010
17
Folie 33 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Germination Tests
 5 pharmaceuticals used
 At different concentration levels to identify
phytotoxicologic effects.
 Duration of test: 10 days
 Applied in a water-urine-mix
 Evaluated: successful germination and dry weight
Winker et al. 2008. Comparison of
analytical and theoretical
pharmaceutical concentrations in
human urine in Germany. Water
Research 42 (14), pp. 3633 -3640.
Folie 34 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Roots of winter barley in contact with ibuprofen.
Results and discussion
29.4.2010
18
Folie 35 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Germination Tests
 The different types of cereals as well as cress react
differently.
 Application of urine had a much larger effect on
germination.
 It seemed that certain pharmaceutical substances
might even have a positive effect.
An effect on germination due to “naturally”
expected pharmaceutical concentrations in
urine is not expected.
?
Folie 36 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Conclusion I
 An evaluation of potential toxic effects for human beings
is not possible at the moment.
 If urine is reused in agriculture, some of the
pharmaceutical residues will enter the human food chain.
 Moreover, research carried out so far shows that the
expected concentrations of pharmaceutical residues in
average urine do not reach concentration levels which
affect plant growth and development.
 Load of hormones and antibiotics in human urine are
much lower than in animal manure which is already used
in agriculture.
29.4.2010
19
Folie 37 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Conclusion II
Statement of Jörn Germer (cited in von Münch and Winker (2009))
“Drug residues in sustainable sanitation products
used to supply plant nutrients can hardly be a
serious issue in regions where malnutrition,
groundwater and surface water pollution due to
inappropriate sanitation and irrigation with
untreated wastewater is a reality”.
Folie 38 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
29.4.2010
20
Folie 39 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
0
5
10
15
20
25
0 20 40 60 80 100
hours after application [h]
c
u
m
m
u
l
a
t
e
d

N
H
3

v
o
l
a
t
i
l
i
z
a
t
i
o
n
[
k
g

N

h
a
-
1
]
slurry
urine/slurry
urine
NH
3
-Emissions
(Clemens, 2005)
Folie 40 19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
Micro nutrients vs. Heavy Metals
(Hammer & Clemens, 2007)
Three years of operation of the urine-diversion system
in GTZ headquarters in Germany; user opinions and
maintenance challenges

S. Blume* and M. Winker*

*German Development Cooperation (GTZ) GmbH, Sustainable sanitation - ecosan program,
Postfach 5180, 65726 Eschborn, Germany.
(Email: steffen.blume@gtz.de; martina.winker@gtz.de)

ABSTRACT In the main office building of GTZ in Eschborn, Germany a resource-oriented
sanitation system containing urine-diversion toilets and waterless urinals is in operation since
2006. After 2.5 years of operating the system, a first overall evaluation of the system and its
acceptance amongst users and cleaning staff was conducted. The overall result is that most of
the users appreciate the resource oriented sanitation concept (recycling of nutrients and water
savings) but have problems with the technical design. Also, it is difficult to convince the
cleaning staff of the necessity of special cleaning routines. Hence, before such systems can be
widely spread, clear cleaning routines and maintenance documentations are required as well as
certain technical modification to ease optimise the separation in the toilet bowl as well as the
change of spare parts of the toilet.
Keywords acceptance, resource oriented sanitation system, source control, UD flush toilet,
urine diversion, waterless urinal
INTRODUCTION
The main building (“Building 1”) of the GTZ headquarters which consists of four
buildings and is located near Frankfurt, Germany, was renovated from 2004 to 2006
after being in use for 30 years. As part of this renovation, principles of
environmentally friendly construction for the water and energy management of the
building were included. This contained a urine separation system with 50 waterless
urinals, 25 source separating or urine-diversion (UD) flush toilets, and a urine storage
tank of 10 m³ to allow the separate collection of urine.

The background of this ecosan initiative is described in SuSanA (2009) and the
objectives were to demonstrate the implementation of such a resource-oriented
sanitation system, to reduce the amount of water used in the GTZ building, and to
research important aspects for Germany such as social acceptance and reuse of urine
in agriculture. This third objective started now within SANIRESCH, an
accompanying research project funded by the German ministry (since mid 2009) and
was initiated by the former head of GTZ’s ecosan program, Christine Werner.

Operation of the system started in 2006 and the experiences gained since then with
user behaviour, user acceptance, and with the technical components are described in
this paper.
MATERIALS AND METHODS
Implemented technologies in Building 1 of GTZ headquaters
The urine separation system consists of:
- 50 water flushed urine-diversion toilets for the waterless collection of urine
(“NoMix Toilet” of Roediger Vacuum). The toilets have two compartments for
urine and feaces respectively. The urine is collected undiluted by means of a
valve located under the toilet seat, triggered when the u
consumes about 1-2 l for the urine flush and 4
v. Münch et al. (2009) describes
- 25 waterless urinals equipped with a patented
system of the Centaurus
further details on the mechanism see v. Münch and Dahm (2009).
- 4 x 2.5 m
3
PE urine storage tanks located in the underground car park of
Building 1.

Figure 1: Left: UD flush toilet and its

The toilets and urinals are located in the core of the building
to the canteen and the large meeting rooms
(aside the top floor) are bathroom equipped with conventional toilets
available. Hence, persons working in the building on a daily base have the choic
between the two different options
only located in the core section
mainly frequented from Monday to Friday from 9
120 l of urine is collected per day.

Figure 2: Schematic design of the
storey building which is double
User surveys with questionnaires
Two user surveys were undertaken
was carried out in September 2008 to evaluate the
the users. The second survey
focus on toilet hygiene issues
valve located under the toilet seat, triggered when the user sits down. This toilet
l for the urine flush and 4-6 l for the solids flush (
(2009) describes this toilet type in more detail.
25 waterless urinals equipped with a patented “flat rubber tube”
Centaurus model of the German company Keramag
further details on the mechanism see v. Münch and Dahm (2009).
PE urine storage tanks located in the underground car park of
toilet and its schematic side view; right: waterless urinal.
are located in the core of the building in the restrooms closest
to the canteen and the large meeting rooms (Figure 2). In the wings in each floor
(aside the top floor) are bathroom equipped with conventional toilets
available. Hence, persons working in the building on a daily base have the choic
between the two different options aside those in the top floor where bathrooms are
only located in the core section. The usage is that of typical office building which is
mainly frequented from Monday to Friday from 9 am to 5 pm. On average around
of urine is collected per day.
Schematic design of the restroom locations at an average floor
storey building which is double-Y shaped.
uestionnaires
undertaken since the operation started in 2006
in September 2008 to evaluate the general acceptance of the toilets by
survey was performed in May 2009 and had a more specific
issues as a result of the earlier questionnaire.
ser sits down. This toilet
l for the solids flush (Figure 1).
“flat rubber tube” smell stop
Keramag (Figure 1), for

PE urine storage tanks located in the underground car park of

: waterless urinal.
in the restrooms closest
In the wings in each floor
(aside the top floor) are bathroom equipped with conventional toilets and urinals
available. Hence, persons working in the building on a daily base have the choice
aside those in the top floor where bathrooms are
The usage is that of typical office building which is
pm. On average around

locations at an average floor of the 10-
in 2006. The first one
acceptance of the toilets by
a more specific
Both surveys were conducted electronically (using the websites Surveygizmo and
Surveymonkay). In the first one, about 900 GTZ employees working in the
headquarters were contacted independently of their office location within the four
GTZ buildings at this site. All contacted employees were employed within the
Department of Planning and Development, which is GTZ’s department for the
worldwide technical support of its programs. The questionnaire took approx. 5 min to
complete. Apart from statistical parameters about the employees and the general
perception of reuse oriented sustainable sanitation systems, it covered topics of toilet
design, hygiene, odour, ease of use and reuse.

The second questionnaire (in May 2009) was focussed on hygienic aspects and an
improvement of the hygienic situation. This questionnaire was sent to only 50 GTZ
employees, whose offices are located close to the respective restrooms in the core of
Building 1 (Figure 2). This selection was done to focus on employees who use the UD
flush toilets and waterless urinals daily. It was designed so that it could be answered
within 3 min. Apart from statistical information such as distance to the toilets,
regularity of usage, age and gender, the questions tried to determine what measures
could encourage users to sit down on toilets in an office building.
Attitudes of cleaning and maintenance staff
The cleaning staff (employed by an external service provider) and GTZ facility
management staff were contacted regularly in connection with user feedback and
technical problems. As the waterless urinals and UD flush toilets were new, the
personnel had to find out how to maintain the system. In fact, it took some time to
discover the crucial aspects and to rectify technical problems.
RESULTS AND DISCUSSION
Survey 1: Employees’ views
In the first survey 24% of the contacted employees responded (218 of 900 people).
53% of the people were within the age of 30-50 years, 30% were younger, and 20%
were older than 50 years. When comparing the UD flush toilet and the conventional
toilets regarding optical appearance, cleanliness, odour, and ease of use, results
showed that the majority of the participants felt that the cleanliness of the UD flush
toilets and odour of the urinals were worse (Table 1). The conventional toilets were
rated better in almost all parameters (Table 1). 52% or respondents mentioned that the
UD flush toilets have problems with flushing, and 48% stated that it needs two or
even more flushes after each use (12% of respondents).

Table 1: Parameters used for measuring of the users’ acceptance by comparing the
source separating with a conventional system. Numbers show percentages (%) of total
answers (218) for toilets and (88) answers of the male urinal users.
Perception
compared to
conv. system

UD flush toilets

Waterless urinals

Both

Optical
appearance
Clean-
liness
Odour
Optical
appearance
Clean-
liness
Odour
Ease of
use
Better

12 5 7

17 14 8

5
Same

76 45 61

77 52 32

57
Worse

12 51 32

6 34 60

39


When asked for their private decisions, a
would move to a flat with
not. 17% would even pay a higher price
and 43% not). Asked about
offices install waterless urinals,
measures.

Although the technical functionality and hence
not good, a remarkable 90%
urine and faeces separately
71% would even buy crops which have been fertili
to WHO guidelines (WHO, 2006).
products which have been fertili
if urine should be allowed
might agree while 12% do not support this concept
the participants would use and
balcony plants.

Figure 3: User opinions regarding
according to Survey 1 (total of 218 participants).

The reactions for acceptance of food fertilised with urine
investigations. Muskolus
with an agricultural background
food produced with urine as fert
groups (also partially users of
idea and 86% would even
al., 2006; Larsen and Lienert, 2006). This is a much higher percentage th
Survey 1 undertaken at GTZ and
problems (see below).
When asked for their private decisions, almost 50% or respondents stated that they
would move to a flat with UD flush toilets whilst 27% are not sure and 25% would
would even pay a higher price for buying such an apartment
Asked about the waterless urinals, 37% would support that other GTZ
fices install waterless urinals, 41% had no opinion and 22% would not support
functionality and hence acceptance of the UD flush toilets
remarkable 90% of the participants are positive towards the
ly from each other and to use them as fertiliser in agriculture.
71% would even buy crops which have been fertilised with human excreta
(WHO, 2006). Even more people (82%) would buy none
products which have been fertilised with human excreta. When asked for their opinion
d be allowed as fertiliser for organic agriculture, 45% agree
do not support this concept. On a personal level, o
would use and further 39% said they might use urine for their own
User opinions regarding the resource oriented sanitation in GTZ Building
Survey 1 (total of 218 participants).
The reactions for acceptance of food fertilised with urine is in line with
investigations. Muskolus (2008) interviewed inhabitants in Berlin as well as people
background, and 62% of both groups stated that they would buy
food produced with urine as fertiliser. Also in Switzerland, 72% of different user
users of UD flush toilets) consider these techniques as a good
even move into a flat equipped with such a concept (Lienert et
al., 2006; Larsen and Lienert, 2006). This is a much higher percentage th
GTZ and is most likely due to technical and maintenance
stated that they
27% are not sure and 25% would
for buying such an apartment (40% maybe
37% would support that other GTZ
opinion and 22% would not support such
of the UD flush toilets is
are positive towards the idea to collect
er in agriculture.
ed with human excreta according
more people (82%) would buy none-edible
When asked for their opinion
45% agreed and 42%
On a personal level, one third of
e for their own

in GTZ Building 1
is in line with other similar
(2008) interviewed inhabitants in Berlin as well as people
% of both groups stated that they would buy
% of different user
toilets) consider these techniques as a good
move into a flat equipped with such a concept (Lienert et
al., 2006; Larsen and Lienert, 2006). This is a much higher percentage than found in
and maintenance
Survey 2: User views regarding sitting on toilets
This survey investigated the
encourage them to sit on the toilet.
Survey 1, and 40% of the
responded (out of 50 approached) the survey results are not necessarily representative
but provide a general idea.
on a regular basis.

They employees were asked which
to sit on the toilet. Sitting is
urine flows to the faeces section and mixes with the brownwater).
respondents would prefer disinfection spray
the toilet seat, 8% would favo
stated that they would apply these hygienic devices
only if the toilets were not clean (21%)

The participants were also
mentioned hygiene devices
question was a restatement of the earlier ones to receive more precise information of
users’ attitudes towards sitting on a public toilet
users would prefer a disinfection spray (52
users find it sufficient to use
52% of respondents if they had a disinfection spr
of respondents if no hygiene device was available.

Figure 4: Survey 2 results: Employees’
certain hygienic devices were provided (at the moment, none of these are provided).
Total number of respondents w
These results on attitudes regarding sitting on public toilets
be researched further since they relate to users’ (partly irrational) fears of “catching a
disease” when sitting on a public toile
contrast to earlier findings in Switzerland where 72
Survey 2: User views regarding sitting on toilets
the enhancement of the hygienic perception by the users
encourage them to sit on the toilet. Age distribution of the participants was similar to
40% of the respondents were female and 60% male. As only 25 people
responded (out of 50 approached) the survey results are not necessarily representative
but provide a general idea. 52% of respondents said that they used the UD flush toilets
were asked which hygienic devices they would prefer to
. Sitting is necessary in order to activate the urine valve (otherwise
urine flows to the faeces section and mixes with the brownwater). Almost
would prefer disinfection spray which is applied with toilet paper
favour paper covers and 35% other devices. The respondents
apply these hygienic devices either on a regular basis
were not clean (21%) or not at all (17%).
also asked if they would sit down on the toilet
devices were available (results summarised in
question was a restatement of the earlier ones to receive more precise information of
towards sitting on a public toilet. The results confirmed that most
disinfection spray (52%) or a paper cover (48%)
users find it sufficient to use toilet paper used as cover (35%). The willingness to sit
of respondents if they had a disinfection spray available compared to only 17%
of respondents if no hygiene device was available.
2 results: Employees’ willingness to sit on the UD flush toilet if
certain hygienic devices were provided (at the moment, none of these are provided).
Total number of respondents was 25.
These results on attitudes regarding sitting on public toilets are interesting
be researched further since they relate to users’ (partly irrational) fears of “catching a
disease” when sitting on a public toilet The findings from the small Survey
indings in Switzerland where 72% of the respondents stated
hygienic perception by the users to
Age distribution of the participants was similar to
As only 25 people
responded (out of 50 approached) the survey results are not necessarily representative
UD flush toilets
devices they would prefer to entice them
necessary in order to activate the urine valve (otherwise
Almost 50% of
which is applied with toilet paper to clean
The respondents
on a regular basis (26%),
down on the toilet if the above
results summarised in Figure 4). The
question was a restatement of the earlier ones to receive more precise information of
confirmed that most
%), and 35% of
. The willingness to sit is
ay available compared to only 17%

on the UD flush toilet if
certain hygienic devices were provided (at the moment, none of these are provided).
interesting and should
be researched further since they relate to users’ (partly irrational) fears of “catching a
findings from the small Survey 2 are in
% of the respondents stated that
they are willing to sit when it is required (Larsen and Lienert, 2007) – although there
is naturally a major difference between toilets at home and toilets outside of the home
environment. The monitoring of the system installed in the Eawag building (Zurich,
Switzerland) has not shown discrepancies to this statement so far (Goosse et al.,
2009). On the contrary, it seems that female users in that building tend to flush the
toilet while sitting which causes dilution of the urine with flush water.
Technical problems and solutions
Experiences with waterless urinals
In the beginning of the operation in mid 2006 it was found that urine accumulated on
the ground underneath the urinals. Further checks showed that the urinals had sunk
slightly down (only a few millimeters). As the discharge pipes were fixed in the wall,
this resulted in pressure on the joint where the urine pipe is connected with the urinal.
Due to this pressure a gap developed between the inlet and the urinal, and urine
leaked to the inner part of the urinal and down the outlet pipe. Bad odor occurred as a
result of this small vertical movement of the urinal (this might be a reason for the
worse perception of waterless urinals (stated by 60% of respondents, Table 1)
compared to conventional ones conducted in Survey 1). Hence, the screws need to be
checked regularly to prevent vertical movement of the urinal (it has not occurred
again since that initial event).

To avoid odor problems with the waterless urinals different cleaning agents were
tested. Best results were achieved with the “MB Aktivreiniger” of Urimat. This is an
environmentally friendly cleaning agent with microbiologically active ingredients.
Furthermore, a permanent deodorant air diffuser was installed in the toilet room in the
first floor.

There is quite a high turn-over of cleaning staff employed by an external company
who is responsible for the cleaning in the GTZ buildings in Eschborn. As a result, the
urinal sieves and smell stops in some of the restrooms were not cleaned for many
weeks or even months. This led to the accumulation of urine precipitates, well as
pubic hair and slime deposits which then caused odour problems. Thorough cleaning
staff instruction and supervision is crucial but difficult due to high staff turn-over.
Even for the (in Germany) quite widely spread waterless urinals, awareness raising
and training is still required for the cleaning staff when they are not familiar with such
urinals. Additionally, Keramag introduced an improved design for the smell stop in
2007 which has less dirt accumulation and is easier to clean.
Experience with the urine-diversion (UD) flush toilets
The installed type of UD flush toilet has two main weaknesses:
1. Design of the bowl: Toilet paper thrown into the front part of the bowl (urinal
section) is not flushed away with the small urine flush and hence more than one flush
becomes necessary – negating the possible water saving effect. And even for the
faeces sometimes 2-3 flushes are required. Similar findings were reported for the
installations at Eawag: in 17% of all cases a second flush was necessary (Goosse et
al., 2009).
2. Urine valve: The valve on the urine pipe can get blocked over time (Figure 5). In
this case, urine is no longer collected separately but flows to the faeces section of the
toilet. Or it can result in the fact that the valve does not close anymore, causing odour
problems in the restroom and dilution of the urine. Therefore, the cleaning staff needs
to carry out preventative maintenance which can be done by adding citric acid to the
valve once per month that remains there for 24 hours. Our experience showed that if
this maintenance is neglected, these valves stop working after approx. 2 years of use.


Figure 5: Left: Soft urine precipitations inside a urine valve. Right: the same valve
after cleaning soaking in citric acid for several days (source: L. Ulrich, 2009).
Low nitrogen content of the collected urine
Low nitrogen concentrations were observed in the urine collection tanks at GTZ: With
2,800 mg l
-1
the measured nitrogen concentration for the stored urine is two thirds less
than typical literature values for pure urine of 8,000 mg l
-1
(Meinzinger and
Oldenburg, 2009). The main reason for this is probably that nitrogen loss occurs in the
form of ammonia gas being emitted through the tank’s ventilation system, which has
also been reported at the Eawag building (Goosse et al., 2009). Urine tanks should not
be ventilated, only pressure equalized (v. Münch et al., 2009) but in this case, a
10 mm vent pipe from the urine tanks goes all the way to the top of Building 1,
causing more ventilation than desired. It is also possible that the urine is diluted with
flush water if users flush while being seated or if the urine valve is broken.
Recommendations for maintenance
Based on the three years of experience, now the following maintenance routines
(supervision that they are really being adhered to is crucial and not always easy) are
recommended:
• Every evening the waterless urinals have to be cleaned (wiped down manually).
• On highly frequented toilets (on ground floors close to canteens and meeting
rooms) additional cleaning on an hourly base is recommended using a wet cloth
and subsequently spraying the detergent containing fragrant substances as well.
• The smell stops (flat rubber tubes) have to be taken out daily and cleaned with
detergent and rinsed with water.
• As the rubber of the smell stops fatigues and then sticks together, the smell stops
have to be replaced about once per year.
• The daily cleaning routine for UD flush toilets is in principle the same as for
conventional ones although it is more time consuming to clean away faeces stains
due to the more complicated bowl design.
• For precipitation prevention the urine valve needs to be soaked once per month
with citric acid for a period of 24 hours. This is done by filling 200 ml of the citric
acid into the open valve (seat pressed down to open the valve).
• Annually, the functionality of the urine valves should be controlled and once per
year clogged valves should be cleaned or replaced.
CONCLUSIONS
The overall result from the user surveys is that the users appreciate the resource
oriented sanitation concept (recycling of nutrients and water savings) but are unhappy
with the inconveniences caused by the technical design of the UD flush toilets.
Furthermore, it was shown that a crucial point for users is perceived or actual toilet
hygiene: People’s willingness to sit down on the toilet could be raised significantly if
disinfection devices were available.
For a wider acceptance, further technical development of the UD flush toilets would
be necessary. A high turn-over in cleaning staff and communication difficulties makes
it difficult to communicate the necessary cleaning routines which take a little bit more
extra time and are new for the cleaning staff. Hence, before such urine-diversion flush
toilets can be widely spread, clear cleaning and maintenance routines are required.
On a positive note, this demonstration and research project has attracted wide
attention for the ecosan approach within GTZ (implementing development
cooperation projects worldwide) and outside of GTZ. Each year, many international
delegations and student groups take part in guided tours of the installations, which
raises their awareness about resource oriented sanitation systems.
ACKNOLWLEDGEMENTS
The authors wish to thank Christine Werner (AGIRE programme, GTZ, Morocco) for initiating the
project in her position as team leader of the GTZ Ecosan team, Lukas Ulrich (former GTZ intern; now:
ETH Zurich, Switzerland) for devising and conducting the second survey and Dr. Elisabeth von Münch
for critical review of this paper.
REFERENCES
Goosse P., Steiner M., Udert K. & Neuenschwander W. 2009. NoMix Toilettensysteme. Erste Monitoring
Ergebnisse im Forum Chrisbach. GWA 7, 567-574.
Larsen T. and Lienert J. 2007. Novaquatis final report. NoMix - A New Approach to Urban Water Management.
Eawag, Dübendorf, Switzerland. URL: http://www2.gtz.de/Dokumente/oe44/ecosan/de-Nomix-Toilettensystem-
erste-Monitoringergebnisse.pdf.
Lienert J. & Larsen T.. 2006. Considering user attitude in early development of environmentally friendly
technology: A case study of NoMix toilets. Environ. Sci.Technol. 40(16), 4838-4844.
Lienert J., Thiemann K., Kaufmann-Hayoz R. & Larsen T. 2006. Young users accept NoMix toilets - a
questionnaire survey on urine source separating toilets in a college in Switzerland. Wat. Sci. Technol. 54(11-12),
403-412.
Meinzinger F. & Oldenburg M. 2009. Characteristics of source-separated household wastewater flows - a
statistical assessment. Water Sci. Technol. 59(9), 1785-1791
SuSanA (2009). Case study of sustainable sanitation projects. Urine and brownwater separation at Eschborn,
Germany. Sustainable Sanitation Alliance. URL: http://www.susana.org/images/documents/06-case-studies/en-
susana-cs-germany-eschborn-house-1-2009.pdf.
v. Münch E.& Dahm P. 2009. Waterless Urinals. A Proposal to Save Water and Recover Urine Nutrients in Africa.
In: 34th WEDC International Conference, Addis Ababa, Ethiopia. URL: http://www2.gtz.de/Dokumente/
oe44/ecosan/en-waterless-urinals-a-proposal-to-save-water-and-recover-urine-nutrients-in-africa-2009.pdf.
v. Münch E., Olt, C. and Winker M. 2009. Technology review | Urine diversion components. GTZ, Eschborn,
Germany. URL: http://www.gtz.de/en/dokumente/gtz2009-en-technology-review-urine-diversion.pdf.
WHO. 2006. WHO Guidelines for the Safe Use of Wastewater, Excreta and Greywater. Vol. IV, Excreta and
Greywater use in Agriculture, WHO/UNEP/FAO. URL: http://www.who.int/water_sanitation_health/
wastewater/gsuww/en/index.html.

Sign up to vote on this title
UsefulNot useful