;=@3/2D/<132

1:=<7<5/2D713

/1673D7<5A1/:3
7<G=C@>71BC@3A
www.amateurphotographer.co.uk

<WY]\
2!a
<]ZWUVb\SSRSR
<]eg]cQO\
aV]]bW\bVSRO`Y 

4C::
:/0
B3AB

6=EB=¬

EVObg]c
\SSRb]Y\]e
OP]cbdWRS]
W\2A:@a
£2.40

AV]]bO[OhW\U^WQbc`Sa
W\OT`]abgZO\RaQO^S

713
3F>3@B/2D

Saturday 2 January 2010

www.storemags.com & www.fantamag.com

4`][bVS3RWb]`

1]\bS\ba

/[ObSc`>V]b]U`O^VS` 4]`SdS`g]\SeV]Z]dSa^V]b]U`O^Vg

BVSdWRS]`SdWdOZ 

#

EVS\7eOaO
bSS\OUS`V][S
dWRS]eOaO
2O[WS\
V]PPgOZ[]ab
]\OaQOZSeWbV
2S[]ZRS`
abWZZ^V]b]U`O^Vg
3RWb]`
7\bVSZWP`O`g
^V]b]U`O^VgeOaaO\ReWQVSRPSbeSS\
dWRS]U`O^VgO\RSbQVW\UO\ReVS\7`O\
]cb]T^V]b]U`O^VgP]]Ya7¸Rb]^c^[g
aSfSRcQObW]\W\bVSV][S[]dWSaSQbW]\
=bVS`bVO\bVSTOQbbVObdWRS]QO[S`Oa
aSS[SRb][OYSUW`ZabOYSbVSW`QZ]bVSa]TT
7Q]cZR\¸baSSbVSObb`OQbW]\]TbVS[]dW\U
W[OUSOaO\O`bT]`[;gP`]bVS`aO\R7
caSRb]gOe\ObbVSac\aSba[g^O`S\ba
aV]b]\Ac^S`&O\ReSeS`SUZORSOQV
`SSZQ]cZR]\ZgZOabbV`SS[W\cbSa³Oa
bVS^WQbc`SaeS`S·[]dW\U¸eSSf^SQbSR
a][SbVW\Ub]PSVO^^S\W\U
/ZbV]cUVdWSeSR]\bVSeOZZ7XcabR]\¸b
W\bS`OQbeWbVdWRS]W\bVSaO[SeOg7R]
eWbVabWZZa³g]cQO\¸bXcabaV]]bOPSOcbWTcZ
aQS\SW\bVSaO[SeOgQO\g]c-2]g]c
eOZYO`]c\ReWbVOdWRS]QO[S`OW\g]c`
^]QYSbXcabW\QOaSa][SbVW\UVO^^S\a-
Ac`SZgdWRS]aO`ST]`a^SQWOZ]QQOaW]\a
acQVOaQV`WabS\W\UaeSRRW\UaV]ZWROga
O\RPW`bVROga/\RbVS\g]c\SdS`USb
`]c\Rb]SRWbW\UbVS`SacZba
EWbVbVS`WaS]TdWRS]W\a]QWOZO\R
\SeaeSPaWbSabVS\SfbUS\S`ObW]\a
O`SW\a^W`W\UOV][S[]dWS`SdWdOZ
O\ReWbVdWRS]W\2A:@aeS\]eVOdS
[]`SQ`SObWdSQ]\b`]ZbVO\SdS`PST]`S
7e]\RS`WTeSaV]cZRPSbOYW\U^O`b

<SeadWSeaO\R`SdWSea 
<Sea 

>OUS"#

0IMGEVYRWSYXSJ1WYTTPMIW7MKQEVIPIEWIW 
QQJPIRW>IRMXYWIVMR'LVMWXQEW
PMKLXWÁEWGS4LSXSKVETL]WTIIHHEXMRKPEYRGLIH 

@SdWSe

8LIPEXIWXFSSOWI\LMFMXMSRWERH[IFWMXIW 

 :SbbS`a

%4VIEHIVWWTIEOSYXSRXLI[IIO¸WMWWYIW 

! 0OQYQVOb

7XIZI1EVWLEPPEWOW[LIXLIVGEQIVEWSJXLIWX
GIRXYV]KMZITLSXSKVETLIVW[LEXXLI]VIEPP][ERX
*MRHSYXLS[XLI
2MOSR(7JEVIH
MRSYV%4XIWX

' BVS¿\OZT`O[S

6SKIV,MGOWTSRHIVWXLI[SVXLSJQEOMRKER]
2I[=IEV¸WVIWSPYXMSRW 

BSQV\W_cS 
" >V]b]W\aWUVb  

"# <WY]\2!A 

'PMZI2MGLSPWI\TPEMRW[L]WSQIXMQIWIZIRXLI
FIWXGSQTSWMXMSRWEVIPIXHS[RF]RSXLEZMRKE
WIRWISJWGEPI 

1=D3@AB=@G
(IWTMXIMXWLMKLQE\MQYQWIRWMXMZMX]EJTW
WLSSXMRKVEXIERH,(ZMHISGETXYVI[MPPXLI
2MOSR(7¸WQMPPMSRTM\IPWFIIRSYKLJSV
TVSJIWWMSREPPIZIPTLSXSKVETLIVW#6MGLEVH
7MFPI]TYXWMXXSXLIXIWX 

& BVSZOab`Sa]`b 

-RTEVXX[SSJLMWJIEXYVI6MGLEVH7MFPI]PSSOW
EXLS[XSYWIEHZERGIHGPSRMRKQIXLSHWXS
VIQSZIYR[ERXIHSFNIGXWMRERMQEKI

=\bSabO\RbSQV\WQOZ 

!' BSabPS\QV 

#  ?/

#% /`bWQcZObSR:12aQ`SS\a
1=D3@AB=@G;MXLXMPXEFPI0MZI:MI[IREFPIH
WGVIIRWEKVIEX[E]XSMRNIGXMRXIVIWXMRXSER
MQEKI%RKIPE2MGLSPWSRTYXWJSYVEVXMGYPEXIH
WGVIIRWXSXLIXIWX 

8LI0EWXSPMXI8MPXLIEHÂEWLFVEGOIXERH
,EQE0)(1EGVS0MKLX

" 2A:@dWRS]bSQV\]Z]Ug
1 =D3@AB=@G%VI]SYFEJÂIHF]XLIVIGIRXZMHIS
XIGLRSPSK]MRXVSHYGIHXS(706WERHL]FVMH
GEQIVEW#*IEVRSXEW:MRGIRX3PMZIVI\TPEMRWEPP

>OUS  

3YVI\TIVXWERW[IV]SYVUYIWXMSR 

G]c`^WQbc`Sa
% 5OZZS`g 

%RSXLIVWIPIGXMSRSJWYTIVFVIEHIVMQEKIW

!$ /^^`OWaOZ 

(EQMIR(IQSPHIVI\EQMRIW]SYVMQEKIW
SJJIVMRK[SVHWSJ[MWHSQERHGSRWXVYGXMZIEHZMGI

'SPMR:EVRHIPP
I\TPEMRWLS[XS
QEOIXLIQSWXSJ
JVSWX]QSVRMRKW 

(MWGSZIVXLILMHHIRFIEYX]SJ]SYVKEVHIRMR
[MRXIVWE]W'SPMR:EVRHIPPEWLII\TPEMRWLS[XS
XEOIFSPHGSQTIPPMRKMQEKIWSRJVSWX]QSVRMRKW

7\/> 2SQS[PS`eSOaYSR¬
EVObWabVSVWUVSab7A=
2
aSbbW\Ug]c`SUcZO`ZgcaS- 

G]cO\aeS`SR¬

!  7Q]\a]T^V]b]U`O^Vg 

IRV]'EVXMIV&VIWWSRMWSRISJXLIKVIEXIWXERH
,
QSWXMRÂYIRXMEPTLSXSKVETLIVWMRXLILMWXSV]SJ
XLIQIHMYQ(EZMH'PEVOPSSOWEXLMWPMJIERH[SVO

AS\Rcag]c`^WQbc`Sa
B]VOdSg]c`^WQbc`Sa^cPZWaVSRW\5OZZS`gaS\RW\OaSZSQbW]\
]Tc^b]bS\W[OUSaBVSgQO\PSSWbVS`OaSZSQbW]\]TRWTTS`S\b
W[OUSa]`OZZVOdSbVSaO[SbVS[S2WUWbOZ¿ZSaaS\b]\12
aV]cZRPSaOdSRW\O>V]b]aV]^Q][^ObWPZST]`[ObacQVOa
8>35]`B744eWbVOQ]\bOQbaVSSbO\RacP[WaaW]\T]`[DWaWb
eeeO[ObSc`^V]b]U`O^VS`Q]cYO^UOZZS`gT]`RSbOWZaES
QO\\]b^cPZWaVW[OUSaeWbV]cbbVS\SQSaaO`gbSQV\WQOZRSbOWZa
3OQV@50W[OUSaV]cZRPSO[W\W[c[]T "&^WfSZaOZ]\UWba
Z]\USabZS\UbVB`O\a^O`S\QWSaO\R^`W\baO`SOZa]OQQS^bSRES
`SQ][[S\RbVObb`O\a^O`S\QWSaO`SaS\beWbV]cbUZOaa[]c\ba
O\R^]abSRdWOA^SQWOZ2SZWdS`g4]`b`O\a^O`S\QWSa^`W\ba]`RWaQa
b]PS`Sbc`\SRg]c[cabW\QZcRSO\A/3eWbVacT¿QWS\b^]abOUS
acPaQ`WPS&"#$%$%%%&

=c`_cSabW]\
TbVSeSSY

4SObc`Sa 
4 
W`abQZOaaT`]ab 1=D3@AB=@G

=c`ORR`SaaO\R
]bVS`Q]\bOQbRSbOWZa
/[ObSc`>V]b]U`O^VS`
7>1;SRWO0ZcS4W\0cWZRW\U 
A]cbVeO`YAb`SSb:]\R]\A3AC

/>3RWb]`WOZBSZS^V]\S( !"&"!&
4Of !"&&!
3[OWZO[ObSc`^V]b]U`O^VS`.W^Q[SRWOQ][
/>/RdS`bWaW\UBSZS^V]\S( !"& #%
3[OWZZSSM[]``Wa.W^Q[SRWOQ][
/>AcPaQ`W^bW]\aBSZS^V]\S(&"#$%$%%%&
3[OWZW^QacPa._aacYQ][
/>bSab`S^]`baBSZS^V]\S(%% %!%%!
eeebSab`S^]`baQ]cY^V]b]U`O^VgO^

COVER PICTURE © COLIN VARNDELL, RICHARD SIBLEY AND CLIVE NICHOLS

© COLIN VARNDELL 

/ !#
0"&"&
1$! #
2$"O\ROP]dS 

1 
#

0

/
!#

0
"&

BVWaeSSYeSOaY¬
6]eR]g]cTSSZOP]cbdWRS]W\2A:@a/7caSWb07e]cZRZWYSb]caSWb17`SOZZg
R]\¸beO\bWb27R]\¸bQO`SSWbVS`eOg

D]bS]\ZW\S
eeeO[ObSc`^V]b]U`O^VS`Q]cY 
8O\cO`g 7eeeO[ObSc`^V]b]U`O^VS`Q]cY7!

www.storemags.com & www.fantamag.com

when you buy online with code

AP210
See us at SWPP London Show
Novotel Hammersmith Jan 15-17

www.
ww
w.st
w.
stor
st
orem
or
emag
em
ags.
ag
s.co
s.
com
co
m & ww
www.
w.fa
w.
fant
fa
ntam
nt
amag
am
ag.c
ag
.com
.c
om

See the step-by-step video demo
www.pprof.com/vdemo

:ObSab
\Sea
SdS`gROg

2]g]cVOdSOab]`g1]\bOQb1V`Wa1VSSa[O\
BSZS^V]\S !"&" '
4Of !"&&!
3[OWZO[ObSc`^V]b]U`O^VS`.W^Q[SRWOQ][

O[ObSc`^V]b]U`O^VS`Q]cY

<Sea7/\OZgaWa71][[S\b7>V]b]2WO`g 

>V]b]U`O^VS`aV]^SbVS
`Sa^]\aS]T^]ZWQSZSORS`a
eWZZPS`STZSQbSRPgOQVO\USW\
ObbWbcRS]TbVSP]PPg]\
bVSPSOb
>V]b]`WUVbaa^O`Ya[SRWOT`S\hg^OUS%

;>QOZZaT]`PSbbS`^]ZWQSb`OW\W\UZ>]ZWQS^ZSRUS[cab`SOQV·P]PPg]\PSOb¸

>V]b]`WUVbaQO[^OWU\(bVS\SfbQVO^bS`
@756BA
E/B16
1][[WbbSRb]RSTS\RW\U
g]c`^V]b]U`O^VWQ`WUVba

4

)%67XLEX&VMXEMR
[MPPFIGSQIEWXEXI
XLEXYWIW''8:QSVI
XLERER]SXLIVREXMSR]IX
[LSWIERXMXIVVSVPE[WWXST
TLSXSKVETLIVWYWMRKXLIMV
S[RGEQIVEWLEWWTEVOIHE
JVIWLTIXMXMSRMR4EVPMEQIRX
%YWXMR1MXGLIPPEOIIR
TLSXSKVETLIV[LSGLEMVW
XLI4EVPMEQIRXEV]%PP4EVX]
4LSXSKVETL]+VSYTLEWXEFPIH
ERI[)EVP](E]1SXMSR )(1 
MRXLI,SYWISJ'SQQSRW
%R)(1MWEJSVQEPQSXMSR
XLEXEPPS[W14WXSI\TVIWW
ERHTYFPMGMWIXLIMVSTMRMSRW
SRKMZIRQEXXIVWERH
EJJSVHWJIPPS[TSPMXMGMERWXLI
STTSVXYRMX]XSWYTTSVXMXF]
EHHMRKXLIMVWMKREXYVIW-R
XLITIXMXMSR%YWXMR TMGXYVIH 
YVKIWTSPMGIGLMIJWXS·IHYGEXI¸
TSPMGISJÁGIVWSRXLIFIEX
8LI)(1WXEXIW·8LMW
LSYWIZMI[W[MXLGSRGIVR
XLIRYQFIVSJMRGMHIRXWSJ
TLSXSKVETLIVWFSXLEQEXIYV
ERHTVSJIWWMSREPFIMRK
WXSTTIHF]SZIVSJÁGMSYW

:SWQOC9
`c\a]cb]T
;'ac^^ZWSa
0)-'%9/LEWI\LEYWXIH
WYTTPMIWSJMXW1HMKMXEP
VERKIÁRHIVGEQIVEFYX
MRWMWXWMXMWHSMRKEPPMXGER
XSQIIXTLSXSKVETLIVW¸
SVHIVWEWWSSREWTSWWMFPI
acPaQ`WPS&"#$%$%%%&

TSPMGIGSRWXEFPIWERH
4'73W?4SPMGI'SQQYRMX]
7YTTSVX3JÁGIVWAJVSQ
XEOMRKTLSXSKVETLWSJ7X
4EYP¸W'EXLIHVEPÁWLERH
GLMTWLSTWMR'LEXLEQXLI
,SYWISJ'SQQSRWXLI
1MPPIRRMYQ&VMHKI'LVMWXQEW
PMKLXWMR&YVKIWW,MPPWXVEXIKMG
FYMPHMRKWMR,YPPERHSXLIV
TYFPMGTPEGIWEPPYRHIVXLI
TVSZMWMSRWMRXLIERXMXIVVSVMWQ
PIKMWPEXMSREKEMRWXIPMGMXMRK
MRJSVQEXMSRPMOIP]XSFIYWIJYP
XSETIVWSRGSQQMXXMRKSV
TVITEVMRKEREGXSJXIVVSVMWQ¸
-RXLIQSXMSR%YWXMR
I\TVIWWIWLMWJIEVWXLEX&VMXEMR
[MPPFIGSQIEWXEXIXLEXXVEMRW
QSVIGEQIVEWSRMXWTISTPI
XS·LEVEWW¸MXWGMXM^IRW[LMPI
XLI]YWIXLIMVS[RGEQIVEW
8LI0EFSYV14JSV+VIEX
+VMQWF]·GSQQIRHWXLIZMI[
SJ?ERXMXIVVSV[EXGLHSKA0SVH
'EVPMPIXLEXXLITSPMGIWLSYPH
WLS[GSQQSRWIRWI¸ERH
YVKIWXLI,SQI7IGVIXEV]
ERHXLI%WWSGMEXMSRSJ'LMIJ
4SPMGI3JÁGIVW?%'43AXS
MRJSVQTSPMGIERH4'73W
XLEX·TLSXSKVETL]MWEVMKLXEW
[IPPEWERIRNS]EFPITEWXMQI
JSVFSXLXSYVMWXWERHEPEVKI
WIGXMSRSJSYVTISTPI¸
,IWXVIWWIWERIIHXS

·IHYGEXIGSRWXEFPIWERH
4'73WEFSYXXLIVMKLXW
SJTLSXSKVETLIVWMRXLIMV
XVEMRMRKWSXLI]GERVIGSKRMWI
XLEXXLINS]TLSXSKVETL]
ERHLETT]WRETTMRKFVMRK
XSGMXM^IRWERHXSYVMWXWEPMOI
WLSYPHRSXFIMRLMFMXIH¸
%TVIZMSYWTIXMXMSRPSHKIH
F]XLI14PEWX]IEVPEVKIP]
FEWIHSRXLII\TIVMIRGIWSJ
%4VIEHIVWPIHXSGVSWWTEVX]
WYTTSVXJSVTLSXSKVETLIVW¸
VMKLXWJVSQLYRHVIHWSJ14W
8LIRI[WGSQIWNYWX
HE]WEJXIVTSPMGITPIHKIHXS
GLERKIXLI[E]XLI]XVIEX
TLSXSKVETLIVW[LSXEOI
TMGXYVIWMRTYFPMGJSPPS[MRKE
PIRKXL]GEQTEMKR
4LSXSKVETLIVWGEYXMSYWP]
[IPGSQIHQSZIWF]TSPMGI
PIEHIVWXSGVEGOHS[RSR
YR[EVVERXIHYWISJERXM
XIVVSVPE[W
%'43LEWMRWXVYGXIHTSPMGI
JSVGIWMR)RKPERHERH;EPIW
RSXXSYWIERXMXIVVSVMWQ
PIKMWPEXMSRXSWXSTTISTPIXEOMRK
TLSXSKVETLWJSPPS[MRK[MHIV
GSZIVEKIMRRI[WTETIVWERH
SR&&'8:ERHVEHMS
.SLR8VEG]GLMIJI\IGYXMZI
SJXLI&YVIEYSJ*VIIPERGI
4LSXSKVETLIVW &*4 XSPH
%4·;LMPIXLI[EVRMRKJVSQ

%WTSOIW[SQERJSV0IMGE
'EQIVEXSPH%4·;IEVI
GYVVIRXP]SYXSJWXSGO¬;I
LEHERMRMXMEPHIPMZIV]EX
PEYRGLERHXLIR[I¸ZIFIIR
VIGIMZMRKHIPMZIVMIWEXVIKYPEV
MRXIVZEPWIEGLQSRXLXSJYPÁP
EWQER]SVHIVWEWTSWWMFPI¸
7LIEHHIH·1SWXHIEPIVW
LEZIE[EMXMRKPMWXJSVXLI1
[SVPH[MHIEW[IPPEWMRXLI
9/ERHXLI[EMXMRKPMWXWGER
ZEV]MRPIRKXL¸
8LIWTSOIW[SQERWEMHWLI
[EWRSXEFPIXSXIPPYWLS[

QER]GEQIVEW[IVITEVXSJ
XLIMRMXMEPFEXGLFYXEHHIH
·;I¸VIHSMRKEPP[IGERXSJYPÁP
SVHIVWEWUYMGOP]EW
[IGERERHSYVHIEPIVWERH
IRHGYWXSQIVWEVIE[EVI
SJXLIWMXYEXMSR¸
8LIRI[WGEQIEJXIV
0IMGEERRSYRGIHE LMOI
MRTVMGIWSREPPTVSHYGXW³
ETEVXJVSQXLI1³JVSQ 
.ERYEV]FPEQMRK
EHZIVWII\GLERKIVEXIWERH
XLIYTGSQMRK:%8VMWI
7LSVXP]EJXIVMX[IRXSRWEPI

%'43MW[IPGSQIWMQMPEV
QIWWEKIWLEZIFIIRMWWYIH
MRXLITEWXXSPMXXPIIJJIGX¸
,S[IZIVMXMWLSTIHXLEX
XLIGSRWXERXVITIXMXMSR[MPP
FIKMRXSKIXXLVSYKLXSXLI
SJÁGIVSRXLIWXVIIX
·8LMWPEXIWX[EVRMRKMWUYMXI
WXVSRKERHVITIEXW[LEXXLI
&*4LEWFIIRWE]MRKEPPEPSRK
XLEXµ3JÁGIVWERHGSQQYRMX]
WYTTSVXSJÁGIVW¬WLSYPHRSX
FIWXSTTMRKERHWIEVGLMRK
TISTPIJSVXEOMRKTLSXSW
9RRIGIWWEVMP]VIWXVMGXMRK
TLSXSKVETL][LIXLIVJVSQXLI
GEWYEPXSYVMWXSVTVSJIWWMSREP
MWYREGGITXEFPI¶%PP[IRIIH
RS[MWJSVXLIFSFF]SRXLI
FIEXXSXEOIRSXI¸
L*SVQSVITPYWGSQQIRX
WIITEKI

%4VITSVXIHLS[HIQERHJSV
XLI1GEQIVESYXWXVMTTIH
WYTTP]EWGYWXSQIVWMRGPYHMRK
TVSJIWWMSREPWXVEHMRKMRXLIMV
(706WWRETTIHYTXLI
JYPPJVEQIGEQIVE[MXLMR
QMRYXIWSJMXWYRZIMPMRKSR 
7ITXIQFIV

A</>
A6=B
/>:SWQOeW\\S`
BVSeW\\S`]TOPSa^]YS
· #bV/[ObSc`>V]b]U`O^VS`¸
S\U`OdSR:SWQO;'QO[S`O
VOaPSS\\O[SR/ZO\9\WUVb
T`][6WbQVW\6S`bT]`RaVW`S
eOaabc\\SReVS\VSVSO`R
\Sea]TVWaeW\W\O^V]\S
QOZZT`][/>3RWb]`2O[WS\
2S[]ZRS`BVS:SWQO!#[[
T /[ObSc`>V]b]U`O^VS` 
#bVO\\WdS`aO`gQO[S`O
Q][SaeWbVOAc[[WQ`]\;
/a^VZS\aW\O^OQYOUS
e]`bV$%$#7beOa[ORS
b]QSZSP`ObS/>¸a #bV
O\\WdS`aO`gO\RTSObc`SaO
a^SQWOZ·/[ObSc`>V]b]U`O^VS` 
#bV/\\WdS`aO`g&&" '¸
S\U`OdW\U]\bVSb]^^ZObS
BS``]`ae]]^
/\bWbS``]`Wa[^]ZWQS
ae]]^SR]\O^V]b]U`O^VS`
W\bVS1Wbg]T:]\R]\OTbS`VS
`STcaSRb]UWdSVWa^S`a]\OZ
RSbOWZab]OaSQc`WbgUcO`R
>`]TSaaW]\OZ^V]b]U`O^VS`
5`O\bA[WbVVORVWaPOU
aSO`QVSRPg]T¿QS`aeV]
O``WdSRW\bV`SS^]ZWQSQO`a
O\ROdO\=\QSaObWa¿SROab]
VWaWRS\bWbgbVS^V]b]U`O^VS`
eOaOZZ]eSR]\VWaeOgASS
\SfbeSSYT]`[]`S
<SeHSWaaZS\aSa
1O`ZHSWaaVOa[ORSWba
;OY`]>ZO\O`B#[[
T O\R[[T ZS\aSa
OdOWZOPZSW\1O\]\34;]c\b
HSWaaaOgaWbVOa]^bW[WaSR
P]bVZS\aSaT]`O\OZ]UcSO\R
TcZZT`O[SRWUWbOZA:@QO[S`Oa
BVS#[[]^bWQRcS]cbW\
2SQS[PS`Q]aba
'$### 
SfQZD/BeVWZSbVS[[
Q]aba 
!&#%SfQZD/BO\R
WaRcSb]O``WdSW\SO`Zg 
C9^`WQSaeS`S\]bOdOWZOPZSOb
bVSbW[S]Te`WbW\U 

8O\cO`g 7eeeO[ObSc`^V]b]U`O^VS`Q]cY7#

www.storemags.com & www.fantamag.com

>V]b]2WO`g

<Sea

/eSSY]T^V]b]U`O^VWQ]^^]`bc\Wbg
E32<3A2/G

AWU[O`SZSOaSa%%[[
T &"21;OQ`]=A6A; 

!2313;03@

2=<¸B;7AA1V`Wab[Oa?cSabaO`]c\R1]`TS1OabZSO[!^[
BVSA_cO`S1]`TS1OabZS2]`aSb06 #3HBSZ(' '"& '"DWaWb
eee\ObW]\OZb`cab]`UcY3F6707B7=<AQWS\QSW\4]Qca³aQWS\bWaba
^V]b]U`O^VSRPg/\b]\1]`PW\O\R8]V\=¸5`ORgc\bWZ%8O\cO`g
ObbVS<ObW]\OZ>]`b`OWb5OZZS`g:]\R]\E1 6=63BSZ( %!$##
DWaWbeee\^U]`UcY

© ANNA LINDERSTAM 2008

B6C@A2/G
!2313;03@

3F6707B7=<PgdO`W]ca
^V]b]U`O^VS`ac\bWZ#
4SP`cO`gObbVS`SQS\bZg
]^S\SR6]bAV]S
5OZZS`g:]\R]\31<
&AEBSZ( %" 
$'DWaWbeee
V]baV]SUOZZS`gQ][
2=<¸B;7AA<SeGSO`¸a
3dSSdS\baW\QZcRSO
TW`Se]`YRWa^ZOgObbVS
:]\R]\3gSabO`bW\U
Ob[WR\WUVb

© MILES ALDRIDGE

4@72/G 

8/<C/@G

3F6707B7=<A][SbVW\UT]`3dS`g]\SW\QZcRSae]`YPg6SZ[cb<Seb]\
@WQVO`R/dSR]\O\R2]\;Q1cZZW\c\bWZ$8O\cO`gOb6O[WZb]\a5OZZS`g
:]\R]\E9 3CBSZ( %
"'''"'!DWaWbeee
VO[WZb]\aUOZZS`gQ][
2=<¸B;7AA<SeGSO`¸a
2OgEOZYO[^[Ob
Ab]c`VSOREWZbaVW`S0/ 
$?2BSZ(%"%&"# DWaWb
eee\ObW]\OZb`cab]`UcY

A/BC@2/G 

8/<C/@G

3F6707B7=<Pg0WZZ@]eZW\a]\O\R@WQVO`R<WQV]Za]\c\bWZ %8O\cO`g
Ob>V]b]TcaW]\:]\R]\AE'&:/BSZ( %%!&#%%"DWaWbeee
^V]b]TcaW]\]`U3F6707B7=<0SW\U0Z]\RWS(2SPPWS6O``gPg0`WO\/`Wa
c\bWZ8O\cO`g Ob>`]cR1O[RS\:]\R]\<E&/6BSZ( %"& 
!&$%DWaWbeee^`]cRQ]cY

AC<2/G 

!8/<C/@G

;=<2/G 

"8/<C/@G

BC3A2/G 

#8/<C/@G

2=<¸B;7AA1]PeSP0Z]eS`aT]`bVS<SeGSO`!O["^[Ob
0]RWO[1OabZS3OabAcaaSfB<! #C/BSZ(#&&!'$DWaWbeee
\ObW]\OZb`cab]`UcY3F6707B7=<=^S\ASSPg8W[5]ZRPS`Uc\bWZ 
%8O\cO`gObBVS>V]b]U`O^VS`a¸5OZZS`g:]\R]\E1 6%60BSZ(&"#
$ $&DWaWbeee^V]b]\Sb]`UcY

3F6707B7=< &Ab]`WSaPgU`ORcObSa]TbVS;/W\>V]b]X]c`\OZWa[O\R
2]Qc[S\bO`g>V]b]U`O^Vgc\bWZ#8O\cO`gObbVS:]\R]\1]ZZSUS]T
1][[c\WQObW]\5OZZS`gA^OQSa:]\R]\A3$A0DWaWbeee &ab]`WSa
Q]cY3F6707B7=<9SS^bVSE]`ZREWZRPg@]US`6]]^S`c\bWZ 
8O\cO`gOb6]]^S`a5OZZS`g:]\R]\31@=//BSZ( %"'!'%
DWaWbeeeV]]^S`aUOZZS`gQ]cY

3F6707B7=<AZSS^ZSaaPgQ]\bS[^]`O`g^V]b]U`O^VS`DS`SR:OVOd
c\bWZ !8O\cO`gObE]ZdS`VO[^b]\/`b5OZZS`gESab;WRZO\RaED2C
BSZ(' ## ##DWaWbeeedS`SRZOVOdQ][3F6707B7=<>]W\ba]T
DWSe(1O^bc`W\UbVS'bV1S\bc`gW\>V]b]U`O^Vac\bWZ%;O`QVObBVS
0`WbWaV:WP`O`g:]\R]\<E 20BSZ( %" %!! DWaWbeeePZcY

A

-+1%LEWERRSYRGIH
ERI[PEVKIETIVXYVI 
QQQEGVSPIRW
EMQIHEXHMKMXEP706YWIVW
8LIQQJ('
1EGVS37,71MRGPYHIWER
3TXMGEP7XEFMPMWIVGPEMQIH
XSIREFPITLSXSKVETLIVW
XSYWIWLYXXIVWTIIHWJSYV
WXSTWWPS[IVXLER[SYPH
SXLIV[MWIFITSWWMFPI
*IEXYVIWMRGPYHIE
QMRMQYQJSGYWMRKHMWXERGI
SJGQERHEQE\MQYQ
QEKRMÁGEXMSRVEXMSSJ 
QEOMRKMXMHIEPJSV
GPSWIYTTLSXSKVETL]
EGGSVHMRKXS7MKQE
%PWSSRFSEVHXLI 
KRI[GSQIVEVIXLVII
EWTLIVMGEPPIRWIWERHSRI
)\XVESVHMREV]0S[(MWTIVWMSR
)0( KPEWWIPIQIRX
-X[MPPFIEZEMPEFPIMR7MKQE
'ERSR2MOSR ( 4IRXE\

ERH7SR] ( QSYRXW
TVMGIH†
7MKQETSMRXWSYXXLEX
ZMKRIXXMRK[MPPSGGYVMJXLI
PIRWMWYWIH[MXLQQ
ÁPQFEWIH706WSVHMKMXEP
GEQIVEW[MXLMQEKIWIRWSVW
PEVKIVXLER·%47'¸WM^I
*SVHIXEMPWGEPP7MKQE
-QEKMRK9/SR 

HS\WbcaS`W\1V`Wab[OaZWUVbaTWOaQ]
@756BA
E/B16
1][[WbbSRb]RSTS\RW\U
g]c`^V]b]U`O^VWQ`WUVba

%4,383+6%4,)6YWMRKER
SPHÁPQGEQIVE[EWWXSTTIH
[LMPIXEOMRKTLSXSWSJ
'LVMWXQEWPMKLXWSRE7YWWI\
WXVIIXEQMHXIVVSVMWQJIEVW
4SPMGIWE]XLI
TLSXSKVETLIVEVSYWIH
WYWTMGMSRFIGEYWILI[EW
WIIRXEOMRK·QER]TLSXSW¸MR
EFYW]WLSTTMRKEVIE%RHVI[
;LMXI[EWWXSTTIH
F]X[S4SPMGI'SQQYRMX]
7YTTSVX3JÁGIVW 4'73W 
MR&YVKIWW,MPP,ILEHFIIR
YWMRKE>IRMX706
%RHVI[[LSPMZIWMR
&VMKLXSRXSPH8LI%VKYW
RI[WTETIVXLEXXLI4'73W
JSPPS[IHLMQEWLI[EPOIH
XS[SVO
7YWWI\4SPMGIGSRÁVQIHXS
%4XLEXSJÁGIVWVIGSVHIHLMW
HIXEMPWSRETSPMGI·WXSTERH
EGGSYRX¸JSVQ·-LEHRSXLMRK
XSLMHIWS-NYWXTVSZMHIHXLI
HIXEMPW2S[-¸QGSRGIVRIH
EFSYX[LIVIXLSWIHIXEMPWEVI
KSMRKXSIRHYT¸%RHVI[XSPH
XLIRI[WTETIV
,IEHHIH·-SRP]XSSOSRI

SVX[STLSXSWFYXIZIRMJ
-LEHXEOIRQSVI[LSEVI
XLI]XSWE][LEXMWXSSQER]#
-HSR¸XXLMROXEOMRKXSSQER]
TLSXSWMRXLIWXVIIX[EVVERXW
FIMRKGSRWMHIVIHWSQIOMRH
SJXIVVSVMWXXLVIEX[LMGLMW
[LEXXLI][IVIWYKKIWXMRK¸
%WTSOIWQERJSV7YWWI\
4SPMGIXSPH%4XLEXSJÁGIVW
WYWTIGXIH%RHVI[QE]LEZI
FIIRSREVIGSRREMWWERGI
QMWWMSRJSVEXIVVSVMWXEXXEGO
-REWXEXIQIRX7YWWI\
4SPMGIWEMH·%QER[EW
WTSOIRXSF]X[S4'73W¬
8LI][IVIGSRGIVRIHXLEX
LIETTIEVIHXSFIXEOMRKXSS
QER]TLSXSKVETLWMREFYW]
WLSTTMRKEVIEERHXLIVIJSVI
WTSOIXSLMQ
·,IW[MJXP]WEXMWÁIHXLIQLI
[EWEGXMRK[MXLSYXER]WMRMWXIV
MRXIRXERHLI[IRXSRLMW[E]
[MXLMRQMRYXIW
·;LIREWOIHLS[QER]
TLSXSWMW·XSSQER]¸E
TSPMGIWTSOIWQERVIJYWIH
XS·KIRIVEPMWI¸XIPPMRKYWXLEX
XLISJÁGIVWVIEGXIHXSXLI
·GMVGYQWXERGIW¸EXXLIXMQI
3JÁGIVWLEZIRSXFIIR
KMZIRMRWXVYGXMSRWSRLS[
QER]TLSXSWQE]FIXEOIR
FIJSVITSPMGIWYWTMGMSR
WLSYPHFIEVSYWIH

$7eeeO[ObSc`^V]b]U`O^VS`Q]cY7 8O\cO`g 

www.storemags.com & www.fantamag.com

A</>
A6=B
=Zg[^ca
2A:@VW`S
/2A:@QO[S`OS_cW^[S\bVW`S
aS`dWQSVOaPSS\ZOc\QVSRPg
bVS=Zg[^caC93AgabS[CaS`
5`]c^9WbT]`VW`SW\QZcRSa
=Zg[^caQO[S`OP]RWSaZS\aSa
O\R^`]a^SQÀOaV=Zg[^caC9
VOa^ZSRUSRb]`STc\R^O`b]`
bVSTcZZQ]ab]TVW`SWTbVS
Qcab][S`bVS\RSQWRSab]Pcg
bVSYWbT`][\SeOQQ]`RW\Ub]
=Zg[^ca3AgabS[CaS`5`]c^
T]c\RS`7O\0c`ZSgBVS`SPObS
aQVS[S`c\ac\bWZbVSS\R]T;Og 
O\RWa]\Q]\RWbW]\bVOb
WbS[aO`SVW`SRT]`O[OfW[c[
]TaSdS\ROgaDWaWbeeeS
U`]c^cY\SbVW`ST]`RSbOWZa
8Saa]^a
8Saa]^aWa]TTS`W\UQcab][S`a
W\bS`SabT`SSQ`SRWbWTbVSg
a^S\R[]`SbVO\ #]\ZW\S
AWf[]\bVa¸W\bS`SabT`SSQ`SRWb
WaOdOWZOPZSb]Qcab][S`a
a^S\RW\U #%'']` 
[]\bVa¸W\bS`SabT`SSWTbVSg
a^S\R[]`SbVO\&4]`
RSbOWZaQOZZ&&!!!]`
dWaWbeeeXSaa]^aQ][
<SeOZbS`SR
W[OUSaZOe/\SeZOebVObe]cZR`S_cW`SOZZ
RWUWbOZZgOZbS`SR^]`b`OWbacaSRW\
ORdS`bWaW\Ub]PSZOPSZZSROa
·`Sb]cQVSR¸VOaPSS\^`]^]aSR
PgO4`S\QV^]ZWbWQWO\DOZ{`WS
0]gS`QZOW[abVObQ][^cbS`
a]TbeO`SOZbS`abVSW[OUS·a]eS
S\bS`OabO\RO`RWaSRO\R
P`OW\eOaVSRe]`ZR¸OQQ]`RW\U
b]O`S^]`bW\BVS<SeG]`Y
BW[Sa6S`RSPObSWagSbb]PS
d]bSR]\PgbVS4`S\QV
U]dS`\[S\bbVSO`bWQZSORRa
AVOYW\¸
^V]b]QZOW[
AW\US`AVOYW\¸AbSdS\aVOa
RS\WSRbVObVSOaaOcZbSRO
T`SSZO\QS^V]b]U`O^VS`
AbSdS\aeV]aS`SOZ\O[SWa
;WQVOSZ0O``SbbeOaOQQcaSR]T
P`SOYW\UOQO[S`OcaSRPg6cU]
;Q<SWQSObOV]bSZW\<]`bVS`\
7`SZO\RW\2SQS[PS` &
AbSdS\a¸VWba]\UaVOdSW\QZcRSR
;S``g1V`Wab[Oa3dS`g]\S

acPaQ`WPS&"#$%$%%%&

2]g]cVOdSOab]`g1]\bOQb1V`Wa1VSSa[O\
BSZS^V]\S !"&" '
4Of !"&&!
3[OWZO[ObSc`^V]b]U`O^VS`.W^Q[SRWOQ][

>]ZWQSQVWSTa^`][WaS
^V]b]`WUVba]dS`VOcZ
>]ZWQSVOdS^`][WaSRb]Q`OQYR]e\]\O\bWbS``]`ab]^a
]T^V]b]U`O^VS`aOTbS`c\^`SQSRS\bSR[SRWOQ]dS`OUS

@756BA
E/B16
1][[WbbSRb]RSTS\RW\U
g]c`^V]b]U`O^VWQ`WUVba

>

© MO BAIG

30-')LEZITPIHKIH
XSGLERKIXLI[E]XLI]
XVIEXTLSXSKVETLIVW
[LSXEOITMGXYVIWMRTYFPMG
JSPPS[MRKEPIRKXL]GEQTEMKR
WTEVOIHF]XLII\TIVMIRGIWSJ
%4VIEHIVW
8LI%WWSGMEXMSRSJ'LMIJ
4SPMGI3JÁGIVW %'43 LEW
MRWXVYGXIHTSPMGIJSVGIWMR
)RKPERHERH;EPIWRSXXSYWI
ERXMXIVVSVMWQPIKMWPEXMSRXS
WXSTTLSXSKVETLIVWJSPPS[MRK
GSZIVEKISJTLSXSKVETLIVW¸
VMKLXWMRREXMSREPRI[WTETIVW
SR8:ERHSRVEHMS
%4LEWSFXEMRIHEJYPP
GST]SJEPIXXIVWIRXXS
TSPMGIGLMIJWHIXEMPMRK
SJÁGIVW¸TS[IVWXSWXST
TLSXSKVETLIVWYRHIV
ERXMXIVVSVMWQPIKMWPEXMSR
8LIPIXXIV³[VMXXIREWE
·1IQS¸HEXIH(IGIQFIV
³[EWWIRXF]%'43
XSGLMIJGSRWXEFPIWERH
GSQQMWWMSRIVWSJTSPMGI
JSVGIWMR)RKPERHERH;EPIW
8LIMWWYI[EWXLVYWX
MRXSXLIPMQIPMKLXFIJSVI
'LVMWXQEWPEVKIP]EWEVIWYPX

SJX[SLMKLTVSÁPIMRGMHIRXW
8LI-RHITIRHIRX
RI[WTETIVNSYVREPMWX.IVSQI
8E]PSVVITSVXIHLS[LI[EW
UYM^^IH[LMPIXEOMRKTLSXSW
SJXLI,SYWIWSJ4EVPMEQIRX
,MWFVYWL[MXLXLIPE[
GEQIEW&&'TLSXSKVETLIV
.IJJ3ZIVWGSQTPEMRIHXS
XLI1IX4SPMGIEJXIVFIMRK
WXSTTIH[LMPIXEOMRKTMGXYVIW
SJ7X4EYP¸W'EXLIHVEP WII
2I[W%4(IGIQFIV 

>WQa]T^]ZWQS

%'43¸WPIXXIVEPWSEHHVIWWIWE
PE[MRXVSHYGIHIEVPMIVXLMW]IEV
XLEXTSXIRXMEPP]GVMQMREPMWIW
TLSXSKVETL]SJTSPMGISJÁGIVW
%'43¸WMRWXVYGXMSRWXS
TSPMGIJSVGIWEVIEWJSPPS[W
·7IGXMSR%'SYRXIV
8IVVSVMWQ%GXTVSZMHIW
TS[IVWXSGSZIVMRWXERGIW
[LIVITLSXSKVETLWEVI
FIMRKXEOIRSJTSPMGISJÁGIVW
[LSEVISV[LSLEZIFIIR
IQTPS]IHEXXLIJVSRXPMRISJ
GSYRXIVXIVVSVMWQSTIVEXMSRW
·8LIWIWGIREVMSW[MPPFI
I\GITXMSREPP]VEVIIZIRXWERH
HSRSXGSZIVMRWXERGIWSJ
TLSXSKVETL]F]VEMPIRXLYWMEWXW
XSYVMWXWSVXLIQIHME¸
8LI[EVRMRKPIXXIVEPWS
SYXPMRIWXLI·7XSTERH
%GGSYRX¸TVSGIHYVI[LIVI

4LSXSKVETLIVWHIWGIRHSR0SRHSR¸W7SYXL
&EROXSTVSXIWXEJXIVE&&'TLSXSKVETLIV[EW
WXSTTIHEXXLIWEQIWTSXEJI[HE]WIEVPMIV

acPaQ`WPS&"#$%$%%%&

ETSPMGISJÁGIVMWPIKEPP]
VIUYMVIHXSTVSHYGIE·7XST
ERH%GGSYRX¸JSVQEWWSSR
EWXLISJÁGIVHIQERHW
WSQISRI¸WTIVWSREPHIXEMPW
3RXLMWXLI%'43PIXXIV
WXEXIW·)RGSYRXIVWFIX[IIR
TSPMGISJÁGIVWERH4'73W
?4SPMGI'SQQYRMX]7YTTSVX
3JÁGIVWAERHXLITYFPMGVERKI
JVSQKIRIVEPGSRZIVWEXMSR
XLVSYKLXSEVVIWX3JÁGIVW
RIIHXSFIEFWSPYXIP]
GPIEVXLEXRSVIGSVHRIIHW
XSFIWYFQMXXIHXSGSZIV
ER]EGXMZMX]XLEXQIVIP]
GSRWXMXYXIWEGSRZIVWEXMSR¸
-XEHHW·3RP]EXXLITSMRX
[LIVIEQIQFIVSJXLI
TYFPMGMWEWOIHXSEGGSYRX
JSVXLIMVEGXMSRWFILEZMSYV
TVIWIRGIMREREVIESV
TSWWIWWMSRSJERMXIQHS
XLITVSZMWMSRWSJXLI4%')
?4SPMGIERH'VMQMREP)ZMHIRGI
%GXAETTP]ERHEVIGSVHJSV
XLEXµWXSTERHEGGSYRX¶RIIH
XSFIWYFQMXXIH
·)ZIREXXLEXTSMRXE
HMWGYWWMSRHSIWRSXGSRWXMXYXI
XLIYWISJER]TSPMGITS[IV
ERHWLSYPHRSXFIVIGSVHIH
YRHIVXLIEYWTMGIWSJXLI
8IVVSVMWQ%GXJSVI\EQTPI¸
,S[IZIVXLIPIXXIVJEMPW
XSWTIPPSYXXLEXXLITIVWSR
FIMRKWXSTTIHMWRSXF]

PE[VIUYMVIHXSWYTTP]XLMW
MRJSVQEXMSR JSVQSVISRXLMW
WIIRI\X[IIO¸W2I[W 
8LIPIXXIVMWWMKRIHF]
%RHVI[8VSXXIV3&)LIEH
SJ%'43¸W1IHME%HZMWSV]
+VSYTERH'VEMK1EGOI][LS
VITVIWIRXW%'43SR7XST
ERH7IEVGLTSPMG]

Ab]^O\RaSO`QV

6IKEVHMRK7IGXMSR7XST
ERH7IEVGLXLIPIXXIVEHHW
·7IGXMSRKMZIWSJÁGIVWRS
WTIGMÁGTS[IVWMRVIPEXMSR
XSTLSXSKVETL]ERHXLIVI
MWRSTVSZMWMSRMRPE[JSVXLI
GSRÁWGEXMSRSJIUYMTQIRXSV
XLIHIWXVYGXMSRSJMQEKIW
IMXLIVHMKMXEPSVSRÁPQ
·3RXLIVEVISGGEWMSR
[LIVIERSJÁGIVWYWTIGXW
XLEXERMRHMZMHYEPMWXEOMRK
TLSXSKVETLWEWTEVXSJXEVKIX
VIGSRREMWWERGIJSVXIVVSVMWX
TYVTSWIWXLI]WLSYPHFI
XVIEXIHEWEXIVVSVMWXWYWTIGX
ERHHIEPX[MXLYRHIV7IGXMSR 
SJXLMW?8IVVSVMWQA%GX
8LMW[SYPHIRWYVIXLEXXLI
PIKEPTS[IVI\MWXWXSWIM^I
IUYMTQIRXERHVIGSZIV
MQEKIWXEOIR¸
%JXIVMXWGSZIVEKISJXLI
GSRXVSZIVW]8LI-RHITIRHIRX
RI[WTETIV TMGXYVIH XSPH
%4·-JMX[EWR¸XJSVWTIGMEPMWX
QIHMEWYGLEW%QEXIYV
4LSXSKVETLIV³EPIVXMRK
IRXLYWMEWXWERHTVSJIWWMSREPW
XSXLIQMWYWISJXLIERXM
XIVVSVMWQPE[WF]TSPMGI³XLI
QEMRWXVIEQQIHMEQMKLXRSX
LEZITMGOIHYTSRXLMWWXSV]¸
8SVIEHXLIPIXXIVZMWMX[[[
EQEXIYVTLSXSKVETLIVGSYO

1][[S\b
1V`Wa1VSSa[O\
<SeaSRWb]`
@OWaW\UbVS^`]TWZS]TbVWa
WaacSW\bVS^cPZWQSgS
bV`]cUVQ]dS`OUSW\\ObW]\OZ
\Sea^O^S`aWaO[OaaWdSP]]ab
b]bVSQO[^OWU\6]eSdS`
^V]b]U`O^VS`aeWZZV]^SbVObbVS
`Sa^]\aS]T^]ZWQSZSORS`aeWZZPS
`STZSQbSRPgOQVO\USW\bVSObbWbcRS
]TbVSP]PPg]\bVSPSObO\RWa\]b
[S`SZgO\ObbS[^bb]_cSZZO
^]bS\bWOZ^cPZWQPOQYZOaVbVOb[Og
VOdS`SacZbSRT`][bVWaWaacSeW\\W\U
eWRSa^`SOR[SRWOQ]dS`OUS
/>VOaR]Qc[S\bSRQ]c\bZSaa
`S^]`ba]T^V]b]U`O^VS`aTOZZW\U
dWQbW[b]O\bWbS``]`ZOea]dS`bVS
^OabTSegSO`aO\R]c`[SaaOUSb]
`SORS`aWa^ZSOaSQ]\bW\cSb]OZS`b
ca]TO\gTc`bVS`W\QWRS\baEVWZS
bVS/1>=·;S[]¸WaeSZQ][S/>
VOa`SQSWdSRaW[WZO`Oaac`O\QSa
T`][/1>=bVS6][S=TTWQS
O\R^]ZWQS]`UO\WaObW]\aPST]`S
/QbW]\aPg^]ZWQS]\bVSU`]c\R
]dS``SQS\b[]\bVaW\RWQObSbVOb
bVS[SaaOUSb]Qc`P`Sab`WQbW]\a
]\^V]b]U`O^VS`aWaabWZZ\]b
USbbW\UbV`]cUV
BVS6][S=TTWQS¸a^cPZWQ
`SZObW]\abSO[³O\RbVS
Q]c\bS`bS``]`Wa[[W\WabS`VW[aSZT
³VOdSb]ZR/>bVObWbVOa\SdS`
PSS\bVSW\bS\bW]\b]ab]^
ZSUWbW[ObS^V]b]U`O^VgES
QO\]\ZgV]^SbVOb^]ZWQSOQbW]\a
a^SOYOaZ]cROabVSe]`RabVOb
O^^SO`W\/1>=¸aaeWTbZg
R`OTbSRZSbbS` 

8O\cO`g 7eeeO[ObSc`^V]b]U`O^VS`Q]cY7%

www.storemags.com & www.fantamag.com

<Sea

C9^V]b]U`O^VS`eW\aZSUOZTWUVb

/

9/TLSXSKVETLIV
LEW[SREWM\]IEV
PIKEPFEXXPIEKEMRWX
XLI7[MWWKSZIVRQIRXEJXIV
LIWYIHSZIVMRNYVMIWMRÂMGXIH
F]E·TSPMGIWXYRKVIREHI¸
HYVMRKETSPMXMGEPTVSXIWX
SYXWMHIE+7YQQMX
*VIIPERGITLSXSKVETLIV
+Y]7QEPPQERJVSQWSYXL
0SRHSRWYJJIVIHEWIVMSYWPIK
MRNYV]JVSQERI\TPSWMSR[LMPI
GSZIVMRKEHIQSRWXVEXMSR
SYXWMHIXLI+7YQQMXMR
+IRIZEMR
;IYRHIVWXERHXLEX
XLIGSYVXLEHXSHIGMHI
[LIXLIVXLITLSXSKVETLIV¸W
MRNYV]LEHFIIRGEYWIH
F]ETSPMGIKVIREHISVE
ÁVI[SVOXLVS[RF]SRISJ
XLITVSXIWXIVW
8LITLSXSKVETLIVWEMH
LI[EWJSVGIHSJJ[SVOJSV

@756BA
E/B16
1][[WbbSRb]RSTS\RW\U
g]c`^V]b]U`O^VWQ`WUVba

WM\QSRXLWEWEVIWYPXSJ
XLIMRNYV][LMGLWXMPPVIWXVMGXW
LMWQSFMPMX]
7TIEOMRKI\GPYWMZIP]XS%4
7QEPPQERWEMHXLIGSYVX¸W
HIGMWMSRSR2SZIQFIV 
TEZIWXLI[E]JSVLMW
GPEMQJSVGSQTIRWEXMSR
7QEPPQER¸WPE[]IVLEWRS[
ÁPIHEGPEMQJSVGSQTIRWEXMSR
XSXEPPMRKEVSYRH†
,EHXLI0SRHSRFEWIH
TLSXSKVETLIVPSWXXLIGEWI
LIJEGIHE†PIKEPFMPP
7QEPPQERWEMHXLEXXLI
GSYVX¸WHIGMWMSRGEQIEW
ELYKIVIPMIJ·-XXSSOE
[LMPIJSVMXXSWMROMR¸LI

/>¸aeSSYZg`]c\Rc^]TQZcP\SeaT`][OZZ]dS`0`WbOW\

XSPH%48LITLSXSKVETLIV
WEMHXLIHIGMWMSRWXVMOIWER
MQTSVXERXFPS[JSVNSYVREPMWXW
GSZIVMRKTVSXIWXWEFVSEH
EPXLSYKLLIJIIPWWYGL
MRGMHIRXWEVIZMI[IHEWER
·SGGYTEXMSREPLE^EVH¸
,IWEMHLILEHFIIR
VYRRMRKYTEÂMKLXSJWXEMVW
XSKIXE[E]JVSQXLIGVS[H
[LIRLI[EWLMXF]ER
I\TPSWMSRJVSQEKVIREHI
XLVS[RJVSQEFSZI
7QEPPQER¸WPIKEP
ZMGXSV][EWGSRÁVQIH
F]XLI2EXMSREP9RMSR
SJ.SYVREPMWXW[LMGLLEH
FEGOIHXLITLSXSKVETLIV¸W
ÁKLXJSVNYWXMGI
%RSVMKMREPNYHKIQIRX
LEHJSYRHMR7QEPPQER¸W
JEZSYVFYXXLI7XEXISJ
+IRIZE[EWWYGGIWWJYP
[MXLEWYFWIUYIRXETTIEP

0OaW\Uab]YS
1O[S`O1ZcP

BVSQZcP¸aO\\cOZ^V]b]SfVWPWbW]\]^S\a
]\4SP`cO`gTSObc`W\UbVSPSabW[OUSa
S\bS`SRW\b]WbaUZ]POZQ][^SbWbW]\eVWQV
QZ]aSa]\"8O\cO`g4]`RSbOWZadWaWbeee
^V]b]SfVWPQ]cYPQQ

";]ab2WUWbOZ

BVSU`]c^VOaO\\]c\QSRbVOb]\S]TWba
[S[PS`ae]\¿`ab^ZOQSW\bVSAS\W]`
QObSU]`g]TbVS/\R`Se>SSb;S[]`WOZ
>V]b]U`O^VWQ1][^SbWbW]\ ';S[PS`a
aOgbVSgUSbb]USbVS`T]`·Q`WbW_cS
RWaQcaaW]\O\R^ZO\\W\U¸4]`RSbOWZa
dWaWbeee"[]abRWUWbOZQ]QQ

<]`bV1VSaVW`S /2WUWbOZE]`YaV]^Wa^ZO\\SRb]bOYS^ZOQS
>V]b]U`O^VWQ ObbVS6OhSZ5`]dS0]eZW\UBS\\Wa1ZcP
Ob&^[]\#8O\cO`geVS\[S[PS`aQO\
A]QWSbg
acP[WbW[OUSaT]`bVSa]QWSbg¸aO\\cOZ
SfVWPWbW]\DWaWbeee\Q^a]`UcY

AS\RQZcP\Seab](O^SdS\ba.W^Q[SRWOQ][

A</>
A6=B

>S\bOf9f
c^RObS
>S\bOfVOac^RObSRbVS
¿`[eO`ST]`Wba9f2A:@
4W`[eO`SdS`aW]\ORRa
·bV`SSSTTSQbaV]]bW\U
Tc\QbW]\a¸7bOZa]ORRaOQ`]aa
^`]QSaaW\UTc\QbW]\ac^^]`b
b]bVSQO[S`O¸aU`SS\Pcbb]\
O\RW[^`]dSROQQc`OQg]TbVS
PObbS`gZSdSZW\RWQOb]`eWbV
·W[^`]dSRabOPWZWbgT]`US\S`OZ
^S`T]`[O\QS¸4]`RSbOWZa
dWaWbeee^S\bOfX^S\UZWaV
ac^^]`bRWUWbOZYfMaVb[Z

SHOOTBANK.NET

>V]b]aV]^
T]`W>V]\S
7[OUW\Ua]TbeO`SUWO\b
/R]PSVOaZOc\QVSRWba
W>V]\SQ][^ObWPZSdS`aW]\
]T>V]b]aV]^W\bVSC9BVS
/R]PS>V]b]aV]^Q][;]PWZS
O^^ZWQObW]\eVWQVWaT`SSb]
R]e\Z]OROZZ]eacaS`ab]
Q`]^`]bObSO\RQVO\USbVS
Q]Z]c`]TO\W[OUS=\Sb]cQV
STTSQbaW\QZcRSEO`[DW\bOUS
O\RDWU\SbbSBVS`SWaOZa]O
0ZOQYO\REVWbSO\R1]]Z0ZcS
BW\b]^bW]\4]`RSbOWZadWaWb
Vbb^([]PWZS^V]b]aV]^
Q][W^V]\S

>V]b]U`O^Vga^SSRRObW\UZOc\QVSR
=392+TLSXSKVETLIVW
LSTMRKXS·ÁRHPSZIXLVSYKL
XLIPIRW¸[IVIKMZIRXLI
GLERGIXSXEOITEVXMRE
TLSXSKVETL]WTIIHHEXMRK
IZIRXLIPHMREGSRZIVXIH
·8YVOMWLFEXLLSYWI¸MRXLI
'MX]SJ0SRHSR
3VKERMWIVWWE]XLI·7LSSX
(EXMRK¸I\TIVMIRGISR
(IGIQFIV[EWEZEVMEXMSR
SJWTIIHHEXMRK[LIVIXLI
·TS[IVSJGVIEXMZMX]¸GERQEXGL
TISTPI·[MXLSYXXLITVIWWYVI
SJQEOMRKTSPMXIGSRZIVWEXMSR¸
·(EXIVW[MPPFIQEXGLIH
YTMRHMJJIVIRXXIEQW X[S
FS]WERHX[SKMVPW KMZIR
GPYIWLIIXWERHWIRXSYX
SRXSXLIWXVIIXWXEWOIH
[MXLGSRWXVYGXMRKTLSXSWEW
ERW[IVWXSXLIGPYIW¸WEMH
SVKERMWIVW7LSSX)\TIVMIRGI

ELIEHSJXLIIZIRX
·;MXLIEGLGPYIGSQIWE
RI[XIEQKMZMRKHEXIVWE
GLERGIXSQIIXYTXSIMKLX
TSXIRXMEPTEVXRIVWXLVSYKLSYX
XLIGSYVWISJXLIEJXIVRSSR¸
3RGITEVXMGMTERXW
GSQTPIXIHXLIGPYIWXLI]
[EXGLIHEWPMHIWLS[SJXLI
HE]¸WMQEKIW4VM^IW[IRXXS
XLI·QSWXGVIEXMZITLSXSW¸
3VKERMWIVWEHHIH·%X
XLIIRHSJXLIIZIRMRK
TEVXMGMTERXW[LSXMGOIH
IEGLSXLIV¸WFS\IWSRSYV
7LSSX(EXMRKGEVH[IVI
TYXMRXSYGL[MXLIEGLSXLIV
ZMEIQEMPPIEZMRKMRHMZMHYEPW
XSGSQTPIXIXLIMVS[R
VSQERXMGEHZIRXYVIW¸
:MWMX[[[WLSSXI\TIVMIRGI
GSQSVGEPP
JSVQSVIHIXEMPW

BVWaeSSYW\¬ 

&'"

/>O^^ZOcRSRbVS`WaSW\caS]T^V]b]U`O^VgOabVSPOaWaT]`bVS
·1V`Wab[OaQO`RS^WRS[WQ¸]dS`bVS&'!&'"TSabWdSaSOa]\
OZPSWbO`bW¿QWOZZgQ]Z]c`SRdS`aW]\a·BVSaSO`SQVO`[W\U
RSaWU\aW\Q]Z]c`WbWab`cSeVWQVQO\\]bPSW[^`]dSRc^]\¸
0cbORRSR/>(·BVSaSO`S`O`SO\Ra][SeVObb]]Sf^S\aWdS
T]`bVSQ`]eReV]VOdSbVcaPSS\aVcbc^b]bVSbOeR`gO\R
W\Q]\U`c]caObbS[^baOb^SbbW\SaaeVWQVb]][O\g]TbVS
QO`RaSfVWPWbBVS`SWaO¿\S]^^]`bc\WbgbVca]^S\SRc^b]
^V]b]U`O^Vg¸/>¸a#8O\cO`g&'"WaacSQ]\QZcRSRbVObQO`Ra
POaSR]\ZO\RaQO^S^V]b]aO`S·TO`[]`S^`STS`OPZSb]bVS
US\S`OZ`c\]T[WRac[[S``]aSaO\Ra^`W\UÀ]eS`aeVWQV
aSS[b]T]`[bVSQVWSTab]QYW\b`ORS]TbVS]`RW\O`gQ]Z]c`SR
QO`RRSaWU\S`a¸

&7eeeO[ObSc`^V]b]U`O^VS`Q]cY7 8O\cO`g 

www.storemags.com & www.fantamag.com

acPaQ`WPS&"#$%$%%%&

www.storemags.com & www.fantamag.com

@SdWSe

G]c`UcWRSb]bVSZObSab^V]b]U`O^VgP]]YaSfVWPWbW]\aO\ReSPaWbSa

1]\\SQbSRE]`ZRa
YRXMPIEVP].ERYEV]

<]YWO<&$
&;>3f^Z]`S

STIRWMRIEVP].ERYEV]
ERHVYRWJSVJSYVQSRXLW 

(MKMXEPMQEKMRKQE]FIERMRXIKVEP
TEVXSJTLSXSKVETL]FYXXLEXHSIWR¸X
QIERÁPQTVSGIWWIWEVIJSVKSXXIR
³RSXMJTLSXSKVETLIVERH-PJSVH
QEWXIVTVMRXIV%RHVI[7ERHIVWSR
LEWER]XLMRKXSHS[MXLMX%RHVI[LEW
TYFPMWLIHWIZIVEPFSSOWSRXVEHMXMSREP
HEVOVSSQTVSGIWWIWERHWLEVIWLMW
ZMI[WSREVERKISJTLSXSKVETLMG
MWWYIW3RIRXIVMRKXLILSQITEKI
ZMI[IVWGERWGVSPPHS[RERYQFIVSJ
TSWXWSRXSTMGWMRGPYHMRKKPEWWPERXIVR
WPMHIWERHPMXLTVMRXMRK-RJSVQEXMZI]IX
IRXIVXEMRMRKXLIFPSKWEVIPMKLXLIEVXIH
MRXSRIERHTVSZMHIEYWIJYPMRWMKLXMRXS

EVERKISJXIGLRMGEPTVSGIWWIW%WMW
SJXIRXLIGEWI[MXLSRPMRIFPSKW[LIVI
XLIXI\XÂS[WGSRXMRYSYWP]HS[RXLI
TEKIMXGERFIHMJÁGYPXXSJSPPS[XLI
WITEVEXIWXVERHWFYXJSVYTJVSRX
TIVWSREPGSQQIRXEV]%RHVI[¸W
FPSKQEOIWMRXIVIWXMRKVIEHMRK
,IEPWSVYRWTLSXSKVETL]ERH
HEVOVSSQXIGLRMUYI[SVOWLSTW
MRGPYHMRKLERHGSPSYVMRKG]ERSX]TI
ERHTMRLSPITLSXSKVETL]
8SWIIQSVISJLMW
MQEKIWZMWMX[[[
ERHVI[WERHIVWSRGSQ
+IQQE4EHPI]

;OabS`W\U
2WUWbOZ>O\]`O[WQ
>V]b]U`O^Vg

0SRKKSRIEVIXLIHE]W[LIRQSFMPI
TLSRIW[IVIYWIHWSPIP]JSVQEOMRK
XIPITLSRIGEPPW2S[RIEVP]EPPQSFMPI
TLSRILERHWIXWLEZIERMRFYMPX
GEQIVEERHEWXLIRYQFIVSJTM\IPW
MRGVIEWIWWSXSSHSIWXLIMQEKI
QEOMRKTSXIRXMEPEWTLSXSKVETLIV
,IRV]6IMGLLSPHHMWGSZIVIH*SV
XLITEWXÁZI]IEVW,IRV]LEWFIIR
[SVOMRK[MXL2SOMESREWIVMIWSJ
TVSNIGXWXSGVIEXIKMERXTERSVEQMG
MQEKIW,MWPEXIWXTVSNIGXWTSRWSVIH
F]&%%ERHHIWMKRGSQTER]7O]PMRI
;LMXIWTEGIMWHMZMHIHMRXSX[S
I\LMFMXMSRW'SRRIGXIH;SVPHWERH
2SOME214)\TPSVI
-R'SRRIGXIH;SVPHWXLIVIEVI 
MQEKIWQQPSRKERHQ
LMKL8LIMQEKIWXEOIRYWMRKE
2SOME214GEQIVEEVIQEHI
JVSQQYPXMTPIQSFMPITLSRIMQEKIW
WXMXGLIHXSKIXLIV,IRV]XVEZIPPIH
XSRMRIGMXMIWMRÁZIGSRXMRIRXWXS
GSQTPIXIXLMWTVSNIGX8LIRYQFIVSJ
MRHMZMHYEPMQEKIWJSVIEGLTERSVEQE
ZEVMIWJVSQJSVXLIMQEKISJ,SRK

/SRK WIIFIPS[ ERHRIEVP]JSV
,IRV]¸WMQEKISJ:IRMGI WIIFSXXSQ 
8LI2SOME214)\TPSVI
I\LMFMXMSRSTIRWMQQIHMEXIP]
EJXIV'SRRIGXIH;SVPHWGPSWIWMR
.ERYEV]ERHJIEXYVIWQSVIXLER
TERSVEQMGMQEKIWXEOIRMR(YFEM
ERH1YQFEM[MXLE2SOME214
GEQIVE8SGVIEXILMWMQEKIW,IRV]
XEOIWEWIVMIWSJSZIVPETTMRKTMGXYVIW
QSZMRKLMWGEQIVELSVM^SRXEPP]EPSRK
IEGLZMI[,I¸PPXEOIXLVIIWITEVEXI

·VS[W¸SJMQEKIWWXEVXMRK[MXLXLI
WO]PMRIFIJSVIQSZMRKLMWGEQIVE
TLSRIHS[RXSWLSSXXLIQMHHPIERH
FSXXSQVS[SJIEGLWGIRI,IYWIWE
TVSKVEQQIGEPPIH%YXSHIWO7XMXGLIV
XSWXMXGLXLIMQEKIWXSKIXLIVERHXLIR
QERYEPP][SVOWSRXLIMQEKIWYWMRK
XLI(MWXSVXERH;EVT
XSSPWMR4LSXSWLST8S
WII,IRV]¸WMQEKIWZMWMX
[[[HMKMXEPTERSVEQE
GSYO+IQQE4EHPI]

&],EVEPH;SIWXI
6SGO]2SSOTETIVFEGO 
TEKIW†
-7&2
8LMWYREWWYQMRKFSSOMWTIVLETWXLI
FIWXKYMHI[I¸ZIWIIRSRTERSVEQMG
TLSXSKVETL]8LVSYKL[SRHIVJYP
MPPYWXVEXMSRWERHIUYEPP]MQTVIWWMZI
MQEKIW;SIWXIHMWGYWWIWXLIÁRIV
TSMRXWSJGSQTSWMRKEHNYWXMRKERH
GSVVIGXMRKTERSVEQEW,IWTIRHWNYWX 
TEKIWWYQQEVMWMRKXLIFEWMGWEW
XLMWMWEKYMHIJSVXLIQSVIEHZERGIH
TERSVEQEWLSSXIV6IRHIVMRKERH
FPIRHMRKTVSNIGXMSRX]TIWTMRGYWLMSR
ERHFEVVIPHMWXSVXMSRGLVSQEXMG
EFIVVEXMSRSJJXLITIKSVQEHIXS
QIEWYVI;SIWXIERW[IVWEPP]SYV
UYIWXMSRWERHERXMGMTEXIW
EPPXLISFWXEGPIW8LMW
MWSRIXSOIITSR]SYV
WLIPJJSVEPSRKXMQI
.IJJ1I]IV

© HENRY REICHHOLD

&],IRV]6IMGLLSPH
,IEXLVS[8IVQMREP
HITEVXYVIWPIZIPEHQMWWMSRJVII

ESPaWbS 0]]Y`SdWSe

© HENRY REICHHOLD

3fVWPWbW]\

eeebVSeSPRO`Y`]][Q][ 

7eeeO[ObSc`^V]b]U`O^VS`Q]cY7 8O\cO`g 

www.storemags.com & www.fantamag.com

acPaQ`WPS&"#$%$%%%&

@SdWSe

© LILLIAN BASSMAN

0]]Y`SdWSe
© LILLIAN BASSMAN

:WZZWO\0Oaa[O\(E][S\
&](IFSVEL7SPSQSR
%FVEQWLEVHFEGOTEKIW†-7&2

7b¸aOZWbbZSW`]\WQbVOb:WZZWO\0Oaa[O\O
ZSUS\RW\bVSTOaVW]\^V]b]U`O^Vge]`ZR
]TbVS'"aO\R¸#ab]ROgabO\RaW\bVS
aVOR]ea]T]bVS`^V]b]U`O^VS`aeV]aS
e]`YO\RabgZSO`S[]`S`SQS\b7beOa
OTbS`OZZVS`aWU\Obc`SVWUVQ]\b`Oab]T
PZOQYaVOR]eaO\RP`WUVbeVWbSabVOb
[ORSVS`TO[]caG]c[WUVbOZa]PS
ac`^`WaSRb]Y\]ebVOb0Oaa[O\OUSR
'WaabWZZbOYW\U^WQbc`SaO\RSdS\\]e
^caVW\UbVSS\dSZ]^SeWbVOPab`OQb
W\bS`SabaW\T]`[
E][S\`S^`]RcQSa ]T0Oaa[O\¸a
PSabW[OUSaT`][VS`ROgaOb6O`^S`¸a
0OhOO`W\bVS'#aOaeSZZOa[O\g
acPaQ`WPS&"#$%$%%%&

bVObVOdS\SdS`PST]`SPSS\^cPZWaVSR
7b¸aOabc\\W\UOQVWSdS[S\bbVOb]\S
QO\Z]]YObbVSaS^WQbc`SaO\RVOdS
\]WRSOeVS\bVSgeS`SbOYS\OabVS
[OX]`^WbTOZZ]TTOaVW]\^V]b]U`O^Vg
WabVObQZ]bVW\UO\RVOW`abgZSaRObSa]
_cWQYZg7\OeOgbVWaWaOZa]OQ`SRWbb]
bVSO`bWabaO\R^cPZWaVS`a]TbVS'#a
B]ROgeSa[cUZg`SUO`RbVObS`OOaO
aW[^ZS`[]`S`S^`SaaSRbW[SPcba][S
$gSO`aZObS`0Oaa[O\¸ae]`YabO\Ra
]cbOa[]`SRO`W\UO\RW\dS\bWdSbVO\
[]ab]TeVObeSaSSW\
b]ROg¸a[OUOhW\Sa
8STT;SgS` 
8O\cO`g 7eeeO[ObSc`^V]b]U`O^VS`Q]cY7

www.storemags.com & www.fantamag.com

AVO`Sg]c`dWSeaO\R]^W\W]\aeWbVTSZZ]e/>`SORS`aSdS`geSSY
4]`PWRRS\^V]b]a

;MXLRS[FILMRHYWMXQYWXWSSRFIXMQIXSXLMRO
EFSYXXLI%QEXIYV4LSXSKVETLIVSJXLI=IEV
GSQTIXMXMSR8SOIITMXXSTMGEPERHVIÂIGXXLIGYVVIRXMWWYIW
JEGMRKTLSXSKVETLIVW-[SYPHPMOIXSWYKKIWXXLIJSPPS[MRK
XLIQIWJSVXLIXIRVSYRHW 
8LI;VSRK%VQSJXLI0E['ETXYVITSPMGISJÁGIVWHSMRKXLMRKWXLI]
WLSYPHR¸X)\XVETSMRXWMJXLISJÁGIVWMRZSPZIHLEZILMHHIRXLIMV-(RYQFIVW 
*SVFMHHIR0SRHSR4LSXSKVETLW8LMRKW]SYEVIR¸XQIERXXSXEOI
TMGXYVIWSJ8LIWGSTIMWLYKIFIGEYWIMXGSZIVWTVIXX]QYGLIZIV]XLMRK
XLIWIHE]W 
4LSXSWLSTTMRK=SYVFIWXTMGXYVISJETVMZEXIWLSTTMRKQEPP 
'LMPHVIREX4PE]+IXMREQSRKXLIOMHWEXXLIPSGEPTPE]KVSYRH 
7IGYVMX]%PIVX&IWXI]IGSRXEGXTSVXVEMXSJEWIGYVMX]KYEVH 
;EXGLMRK=SY;EXGLMRK1I''8:QEOIWEKVIEXWYFNIGXMXWIPJERH
XLIVI¸WFSYRHXSFISRIRIEV]SY 
&YMPHMRKW3YXSJ&SYRHW%MVTSVXWVEMP[E]WXEXMSRWHSGO]EVHWTS[IV
WXEXMSRWSMPVIÁRIVMIW³]SYREQIMX]SYTVSFEFP]WLSYPHR¸XFIWLSSXMRKMX 
4';SVPH&IWXTLSXSKVETLMGI\EQTPISJTSPMXMGEPGSVVIGXRIWWKSRIQEH 
7XVIIX0MJI'ERHMHTMGXYVIWSJTISTPI[LIXLIVXLI]PMOIMXSVRSX 
&ILMRH'PSWIH(SSVW&IWXMRXIVMSVWLSXSJETSPMGIWXEXMSRGIPP
8LI[MRRIVMWXLITLSXSKVETLIV[MXLXLIQSWXTSMRXWSZIVXLIXIRVSYRHW
ERH[LSLEWR¸XFIIRGSRZMGXIH8LMW]IEVGSYPHFIERMRXIVIWXMRKSRI
.SLR4IVVMQIRX)WWI\
-¸PPWIIMJ-GERFSSOXLIGERXIIREX4IRXSRZMPPIJSVXLII\LMFMXMSR³
(EQMIR(IQSPHIV)HMXSV

BVSQW`QZS]TZWTS

© JIM FINDLAY

%WEVIEHIVSJ%4JSVEPQSWX]IEVW
-[EWEWXSRMWLIHERHHMWQE]IHF]
XLITYFPMGEXMSRSJXLIFMKSXIHVERXF]
%PI\&MVGL 0IXXIVW%4(IGIQFIV 
GEWXMKEXMRK·/MPPIVGEXW¸1E]FI%PI\
HSIWRSXVIEPMWIXLEXMXMWXLIREXYVISJ
XLIFIEWX MRGPYHMRKLYQERW XSXEOI
MXWTPEGIMRXLIJSSHGLEMR
;LMPI-EKVII[MXL%PI\¸WSTMRMSR
EFSYXXLIJEOIV]SJXLIMQEKIXLMW
[EWRSXXLIHSMRKSJXLIMRRSGIRX

JIPMRITMGXYVIH%WEWYTTSVXIVSJ
WYWXEMREFMPMX]MRREXYVI ERHEVIGIRX
[MRRIVSJEFMSHMZIVWMX]TLSXS
GSQTIXMXMSR -VIGSKRMWIXLEXXLIVI
MWETPEGIJSVEPPERMQEPWSRXLMW
)EVXLERHXLEXREXYVEPWIPIGXMSR[MPP
TVIZEMP-RXIVJIVIRGIF]LYQERMX]
MRXLMWTVSGIWWEVXMÁGMEPP]EPXIVWXLI
FEPERGISJXLIIGSW]WXIQ-WYKKIWX
XLEX%PI\¸WS[REVKYQIRXFEGOÁVIW
SRLMQMXMWLYQEREGXMZMX]XLEXMW
HIGMQEXMRKXLIEZMERPMJIMRXLMWGSYRXV]
ERHKPSFEPP] F]HIWXVS]MRKMXWLEFMXEX
0IJXXSXLIMVS[RHIZMGIWERMQEPW[MPP
ÁRHEREXYVEPWYWXEMREFPIFEPERGISJ
TVI]ERHTVIHEXSV
%YWXVEPME¸WTVSFPIQWEVIXLIMHIEP
I\EQTPISJXLMW(MVIGXMRXIVJIVIRGI
F]QER XLIMRXVSHYGXMSRSJVEFFMXW
GEQIPWWLIITW]TLMPMWERHTVMWSRIVW 
GVIEXIHXLIMWWYIWXLI]JEGIRS[XLI
HIWXVYGXMSRSJMRHMKIRSYWWTIGMIW

8LI]EVIWMQTP]VIEGXMRKXSXLI
GSRWIUYIRGIWSJXLIMVS[RLYQER
JSPP]8LIWLSSXMRKSJXLIERMQEPW
MHIRXMÁIHMWI\XVIQI[LIRWMQTPI
GSRXVEGITXMSR[SYPHFIWYJÁGMIRX
XSGSRXVSPXLITSTYPEXMSR[MXLMR
XLIIGSW]WXIQ
-EWWYQIJVSQ%PI\¸WEXXMXYHIXLEX
LI[SYPHFIUYMXILETT]XSWIIXLI
KIRSGMHISJXLIKVI]WUYMVVIPJS\FEX
QMROFEHKIVSXXIVERHWSSRERHXLI
VIGIRXP]VIMRXVSHYGIHEPMIRWIEIEKPI
ERHVIHOMXITVIZMSYWP]LYRXIHXS
I\XMRGXMSRF]QER
-EQRSXGSRGIVRIHXLEX%PI\HSIW
RSXGEVIJSVGEXWXLEX¸WLMWFIPMIJFYX
Q]LYQERMXEVMERFIPMIJGEVIWJSVEPP
PMJIIZIR%PI\¸W4IVLETWSRIHE]
%PI\QE]EVVMZIEXXLIVIEPMWEXMSR
XLEXEPPPMJIMWTVIGMSYWERHÁRMXI1]
MQEKITYFPMWLIHFIPS[MWWPMKLXP]
QSVIFIRMKR
.MQ*MRHPE]+PEWKS[

>g`O[WRaQVS[S

6IKEVHMRKXLITLSXSSJEKPEWWVSSJ
F]'EPPYQ7XVMRKIVMR%TTVEMWEP%4 
(IGIQFIV-¸QWYVTVMWIHXLEX%4
)HMXSV(EQMIR(IQSPHIVHMHR¸X
VIGSKRMWIXLI0SYZVI4]VEQMHMR
4EVMWWIIRJVSQXLIMRWMHI-X¸WZIV]
HMWXMRGXMZIERHEZIV]GSQQSR
TLSXSKVETLMGWYFNIGXEPXLSYKL
TMGXYVIWEVIQSVIGSQQSRP]XEOIR
JVSQXLISYXWMHI-EKVII[MXL(EQMIR
XLEXMX¸WERI\GIPPIRXTLSXSKVETL
IWTIGMEPP]GSRWMHIVMRKXLI]SYXL
SJXLITLSXSKVETLIV
.IVIQ](SYFPI;IWX=SVOWLMVI
8LEROWJSVXLEX.IVIQ]³(EQMIR
(IQSPHIV)HMXSV

/ZZabgZS\]acPabO\QS

-GER¸XLIPTFYXFIEQYWIHF]XLI
QEVOIXL]TIXLEXMWWYVVSYRHMRKXLI
MRXVSHYGXMSRSJ1MGVS*SYV8LMVHW
GEQIVEW[LIVIF]LEZMRKMRZIRXIH
XLITVSHYGXXLIQERYJEGXYVIVW¸
QEVOIXMRKHITEVXQIRXEVIRS[
XV]MRKXSGVIEXIERIIHJSVMX;I¸VI
WYTTSWIHXSFIPMIZIXLEXXLIVIEVIE

eW\aO `]ZZ^OQY]T
!$Sf^]ac`S4cXW¿Z[
Ac^S`WO7A= !#[[¿Z[
]`O4cXW¿Z["50[SRWOQO`R 
W\OQV]WQS]T1][^OQb4ZOaV
A2]`;S[]`gAbWQY

E`WbSb]:SbbS`a/[ObSc`>V]b]U`O^VS`7>1;SRWO0ZcS4W\0cWZRW\UA]cbVeO`YAb`SSb:]\R]\A3AC
TOfb] !"&&!]`S[OWZb]O[ObSc`^V]b]U`O^VS`.W^Q[SRWOQ][ 
>ZSOaSW\RWQObSeVSbVS`g]ce]cZRZWYSb]`SQSWdS4cXW¿Z[¿Z[]`O[S[]`gQO`R^ZSOaSabObSbg^S^`STS``SRO\RW\QZcRSg]c`TcZZ^]abOZORR`Saa 
7eeeO[ObSc`^V]b]U`O^VS`Q]cY7 8O\cO`g 

www.storemags.com & www.fantamag.com

acPaQ`WPS&"#$%$%%%&

© MICHA EL ROSE

AVORSa]TU`Sg

7SVV]1V6SWIFYX]SYVTLSXSKVETLSJE
·VIH¸WUYMVVIPMR%4(IGIQFIVMWEGXYEPP]
EKVI]WUYMVVIP+VI]WUYMVVIPWEVISJXIR
FVS[RFYXRIZIVXLIMRXIRWIVIHFVS[R
SJXLI&VMXMWLVIHWUYMVVIP TIVZIVWIP]SR
XLIGSRXMRIRXVIHWUYMVVIPWGERFIKVI]
EPXLSYKLXLMWJSVQHSIWR¸XSGGYVMR&VMXEMR 
8LIX[SGERIEWMP]FIHMWXMRKYMWLIHF]
XLIWQEPPIVWM^IERHHIPMGEXIETTIEVERGI
SJXLIVIHMXWTVSTSVXMSREXIP]PEVKIVERH
QYGLFYWLMIVXEMPERHXLIXYJXWSJLEMVXLEX
WTVSYXJVSQXLIXMTWSJMXWIEVW[LMGLEVI
GPIEVP]QMWWMRKJVSQXLMWMRHMZMHYEP2MGI
WLSXXLSYKL
.SREXLER7[EPI7LIXPERH

2

%QE^MRK%4LEWVIEHIVI\TIVXWMRIZIV]ÁIPH8LERO]SY
1V7[EPI³(EQMIR(IQSPHIV)HMXSV

RYQFIVSJGSQTEGXGEQIVEYWIVW
SYXXLIVI[LS[ERXXSMQTVSZIXLI
UYEPMX]SJXLIMVTLSXSKVETLWFYXEVI
VIPYGXERXXSXEOIXLIPIETMRXS(706
TLSXSKVETL]8LIWIWEQITISTPI
LS[IZIV[MPPFITIVJIGXP][MPPMRKXS
WLIPPSYXGSRWMHIVEFP]QSVIQSRI]
XLERXLI][SYPHLEZIXSJSVEZIV]
GETEFPI(706ERHPIRWIWMRSVHIVXS
FY]WSQIXLMRKXLEXYPXMQEXIP]MRGPYHIW
ERHHIPMZIVWPIWW
%PVIEH]3P]QTYWWIIQWXS
LEZIVIEPMWIHXLEXEGEQIVEXLEX
HSIWR¸XMRGPYHIERSTXMGEPZMI[ÁRHIV
GERRSXFIXEOIRXSSWIVMSYWP]WS[I
RS[ÁRHXLEXXLIRI[4IR)4[MPP
FIWSPHERHQEVOIXIHEWEOMXXLEX
MRGPYHIWERIPIGXVSRMGZMI[ÁRHIV
EXXLIPIWWXLERFEVKEMRTVMGISJ
EVSYRH†,EZI]SYWIIRLS[
QYGL'ERSR2MOSRSV7SR](706
OMX]SYGERFY]JSVXLEX#7YVIP]XLIVI
EVIR¸XXLEXQER]WMPP]TISTPISYX
XLIVI¬EVIXLIVI#
-XWXVMOIWQIXLEXXLI1MGVS*SYV
8LMVHWGSRGITXVITVIWIRXWEGPEWWMG
I\EQTPISJXV]MRKXSQEOIWX]PI
XVMYQTLSZIVWYFWXERGI8LIQSXSVMRK
IUYMZEPIRXSJFY]MRKEGSYTIVEXLIV
XLEREWEPSSRMX¸WRMGIXSPSSOEXFYX
]SY¸PPYPXMQEXIP]FITE]MRKEPSXQSVI
JSVEPSXPIWW
7XIZI4EGMXXM&YGOMRKLEQWLMVI
;LMPITVMGMRKQMKLXFI
YRGSQJSVXEFP]LMKL-XLSYKLX
XLI1MGVS*SYV8LMVHWW]WXIQ
LEHKSRIHS[RVEXLIV[IPP
;LEXHSSXLIVVIEHIVWXLMRO#³
(EQMIR(IQSPHIV)HMXSV

3OQVb]bVSW`]e\

-JIEVXLEX.SLR4IVMEQLEWQMWWIH
XLITSMRXEFSYXQERYJEGXYVIVW
PEYRGLMRKRI[GEQIVEW 0IXXIVW%4
(IGIQFIV %WWSQISRI[LSIEVRWE

/>`SORS`AbSdS;O`aVOZZ
Q]\aWRS`abVS abQS\bc`g
QO[S`O2]SaWb`SOZZg]TTS`
eVOb^V]b]U`O^VS`aeO\b-

PMZMRKJVSQTLSXSKVETL][LSWILSYWI
ERHJEQMP]HITIRHSRQ]FIMRKEFPI
XSHIPMZIVTMGXYVIWSRXMQIIZIV]XMQI
-VIP]LIEZMP]SRQ]IUYMTQIRXFYX
RSXNYWXMRXIVQWSJVIPMEFMPMX]
8LI2MOSR(JSVMRWXERGIEPPS[W
QIXSWLSSXMR0SRHSR¸W%PFIVX,EPP
EX-73[MXLSYXYWMRKÂEWL
FIGEYWISJEHZERGIWMRWIRWSVHIWMKR-
HSR¸XRIIHXLIVIWSPYXMSRSJXLI
(<WS-[SR¸XFY]SRI&YXXLI
ZMHISGETEFMPMXMIWSJXLI(7[MPP
EPPS[QIXSPIEZIXLIGEQGSVHIV
EXLSQI[LIRXLIGPMIRX[ERXWE
QSZMIGPMT-QMKLXFY]SRIFIGEYWI
MX[MPPIEVRQIQSRI]
;LMPI[IEPPQMKLXQMWWXLI
VSQERGISJYWMRKÁPQXLIVIEPMX]MW
XLEXXLITLSXSKVETLMG[SVOÂS[LEW
GLERKIHWSQYGLXLEXJSVER]XLMRK
SXLIVXLERÁRIEVXTLSXSKVETL]
MX¸WHIEH8LIPMQMXEXMSRWSJHMKMXEP
EVIQERMJIWXFYXMRXIVQWSJ
KIXXMRKMQEKIWXLIGPMIRX[ERXWMX¸W
YRFIEXEFPI1V4IVMEQMWYRHSYFXIHP]
EWOMPPIHTLSXSKVETLIVFYXMJXLI620-
I\IVGMWILITEVXMGMTEXIHMR[EWPEMHSR
I\GPYWMZIP]JSVLMQXSKIXMQEKIWSJ
XLEXLIPMGSTXIVERHPMJIFSEXMREGXMSR-
[SRHIVMJLI[SYPHLEZITMGOIHYTLMW
2MOSR*SZIVE(#8LEX¸WXLIOMRH
SJWXVIWW-[EWLETT]XSPIEZIFILMRH
QIEPPXLSWI]IEVWEKS[LIR-FSYKLX
Q]ÁVWX(<
-¸ZIEPWSRSXMGIHXLEXQSVIERH
QSVISJQ]TVSJIWWMSREPÁPQQEOMRK
JVMIRHWEVIHMXGLMRKXLIMVI\TIRWMZI
(MKMFIXEWERH<('%1VMKWMRJEZSYV
SJ(706W YWYEPP]E'ERSR)37(
1EVO-- [LMGLSJJIVXLIQXLIGVIEXMZI
ÂI\MFMPMX]TVIZMSYWP]SRP]EZEMPEFPI
XSFMKFYHKIXÁPQGEQIVEQIR7S
[LMPIERI[JIEXYVIQMKLXWIIQ
MRGSRWIUYIRXMEPXSWSQIMXGER
FIEPMJIWEZIVXSSXLIVW
4EYP,EVQIV0SRHSR

3A>7B3O\S\bW`S`Sd]ZcbW]\W\bVSa^OQS]TXcabbS\gSO`aWb
aSS[abVSQO[S`Oa]\]TTS`abWZZQO\¸bUWdS^V]b]U`O^VS`a
eVObbVSgeO\b·8cabeVObR]^V]b]U`O^VS`aeO\b-¸g]c
[OgOaY7T]\Zg7Y\Se0cb`SORW\UO`]c\RWbaSS[aeSO`SObO
\SePSUW\\W\U;O\cTOQbc`SaO`S\]ebVW\YW\U]cbaWRSbVSP]f
ZWPS`ObW\UbVS[aSZdSaT`][bVSg]YS]TA:@RSaWU\O\RW\dS\bW\U
a][SbVW\UbVObW``WbObW\UZgeSQO\¸b_cWbS^cb]c`TW\US`]\Pcb
eVWQVbWSa^V]b]U`O^VgW\b]bVS abQS\bc`gb]bVSSfbS\bbVObWb
eWZZVSZ^caacRRS\Zg`SOZWaSeVObbVS abQS\bc`gOQbcOZZgWa
1O[S`OaO`SSWbVS`b]]VSOdg`S_cW`W\UPcZYgRcabPW\aWhSR
ZS\aSa]`VOdS^c\gaS\a]`abVObO`Sb]]a[OZZeSSRgO\ReSOY
\]\SfWabS\bdWSeTW\RS`aO\R]bVS`RSTSQba7bOZZaS`dSab][OaY
bVSTOQbbVObXcabOP]cbSdS`gQO[S`OQ`SObSRb]ROgWaO[W`OQZS]T
bSQV\]Z]UgbVObQO\SOaWZg^`]dWRSb]^_cOZWbg^`W\bab]OaWhSbVOb
'']TcaO`S[]`SbVO\VO^^geWbV'']TbVSbW[S
4`O\YZgdWRS]acQYaO\RWTSZSQb`]\WQdWSeTW\RS`aO`SbVSTcbc`S
Oa=Zg[^caRSQ`SSabVS\ZWTSZ]]YaU`W[W\RSSR;g]e\^S`a]\OZ
TOd]c`WbSe]cZRPSOQO[S`OW\b]eVWQV7Q]cZRaZ]bSWbVS`OTWZ[
POQY]`ORWUWbOZ]\SOZZ]eW\U[Sb]caSbVSaO[SZS\aSa]\bVS
aO[S!#[[aWhSRaS\a]`
]`TWZ[<Sfbc^e]cZRPS
d]WQS`SQ]U\WbW]\·1O[S`O(
TVg^S`T]QOZRWabO\QS
P`OQYSbTWdS^Zca]`[W\ca
3D^ZSOaS¸7¸RaOgb][g
b`W^]R[]c\bSR
Q][^O\W]\eVWZSaWbbW\U]\
O`]QYSObW\UOaO\ReWQV
EVS\\Se^`]RcQbaO`S
O\\]c\QSRWbaSS[abVS
Sf^S`baQO\¸bSdS\OU`SS]\
XcabeVS`SW\`SZObW]\b]bVSP]fbVSbVW\YW\UWa7aOgVOba]TTb]
@WQ]VT]`Q][W\Uc^eWbVOagabS[eVS`Sg]c¸`S\]bbWSRb]bVS
aS\a]`7[OUW\SPSW\UT]`QSRb]caS4cXWQV`][SDSZdWOWTeVObg]c
`SOZZgeO\bSReOa9]ROY3YbOQV`][S5FBVW\Y]TbVSTc\g]c
Q]cZRVOdSaWTbW\UbV`]cUVOeV]ZS`OTb]TbVW`R^O`bg·ZS\a]`a¸eWbV
bVSW`Q]Z]c`^OZSbbSa:S\aSa[O``WSRb]^S`TSQbZgbOWZ]`SRaS\a]`a
T`SST`][[O\gQc``S\bbSQV\]Z]UWQOZQ]\ab`OW\ba:S\aSag]cQO\
QVO\USObO\gbW[SY\]eW\UbVObbV]aSRcZZV]c`a]T`Sb]cQVW\UO`S
PO\WaVSRb]bVS^Oab;g\SeTOd]c`WbSe]cZRPSObV`SSc\Wb^`W[S
ZS\aYWb &#&#eWbVOag\QV`]\WaSR]^bWQOZdWSeTW\RS`bVOb
P`W\Uac^`O\USTW\RS`abgZSbVSQ]``SQbT`O[SZW\SaeWbVSOQVZS\a
=TQ]c`aSbVS@WQ]V[WUVb\]b[OYSWbPcbac`SZgbVS\Se
WRSOWabVS`S(a[OZZQ]\TWUc`OPZSVWUV_cOZWbg[W``]`ZSaa
aS\a]`]^bW[WaSRO\RaZWQY;]ab`SdWSeS`aaSS[ae]`\b]
UWdW\UWbOQVO\QSPcba][S
UWdSbVSW[^`SaaW]\bVOb
bVSg¸`SZW\W\UWbc^ZWYSORcQY
W\OaV]]bW\UUOZZS`g
BVS[OW\^`]PZS[
bV]cUVWaeVObO`SeS
U]W\Ub]QOZZbVWa\Sebg^S
]T abQS\bc`gQO[S`O
eVWQV]\SROg[WUVb
Q][SeWbVd]WQS`SQ]U\WbW]\
OaabO\RO`R- 

:]]YW\bVSeW\R]e
]TO\gQVO`WbgaV]^O\R
g]cQO\cacOZZgTW\RO
RSQS\b!#[[Q][^OQb
]\aOZST]`ZSaabVO\bVS
^`WQS]TO`]ZZ]TTWZ[

G]c`bV]cUVba]`dWSeaOP]cb#e]`RaaV]cZRPSaS\bb]·0OQYQVOb¸ObbVScacOZ
/>ORR`SaaaSS^OUS!/TSS]T#eWZZPS^OWR]\^cPZWQObW]\
acPaQ`WPS&"#$%$%%%& 

8O\cO`g 7eeeO[ObSc`^V]b]U`O^VS`Q]cY7!

www.storemags.com & www.fantamag.com

www.
ww
w.st
w.
stor
st
orem
or
emags.com & www.fantamag.com
em
om

1ZWdS<WQV]Za>V]b]7\aWUVb

BVS/>Sf^S`ba

DWaWbW\U
6O`Q]c`b
/`P]`Sbc[

3OQVeSSY]\S]T]c`bSO[]T
Sf^S`ba]TAbSdS0Z]][2OdWR
1ZO^^B][;OQYWSO\R1ZWdS<WQV]Za
eWZZ`SdSOZbVSaSQ`SbaPSVW\R]\S
]TbVSW`U`SObW[OUSaBVWaeSSY
Wb¸a1ZWdS<WQV]Za
1:7D3<716=:A5O`RS\a
/abVSC9¸ab]^UO`RS\
^V]b]U`O^VS`1ZWdS¸a
Y\]eZSRUSO\R^WQbc`Sa
O`SW\Q]\abO\bRS[O\R6Wa
Sf^S`bWaSeWZZPSW\dOZcOPZS

7

© JEFF MEYER

2EZMPPEKIRIEV3\JSVHGEPPIH
2YRILEQ'SYVXIRE]MWEKEVHIR
GEPPIH,EVGSYVX%VFSVIXYQ
[LMGLLEWE[SRHIVJYPZEVMIX]ERH
EVVERKIQIRXSJXVIIWERHWLVYFW8LI
EVFSVIXYQMWTEVXSJXLI9RMZIVWMX]SJ
3\JSVH&SXERMGEP+EVHIRWERHMXMWE
WXYRRMRKTPEGIXSZMWMXEPP]IEVVSYRH
TEVXMGYPEVP]MRXLIEYXYQR[LIRMXMW
STIRXSIZIV]SRIXSZMWMX
8LIFIRIÁXWSJZMWMXMRKER]
EVFSVIXYQMRXLIEYXYQRKS[MXLSYX
WE]MRKFYXEJXIVXLIGSPSYVWLEZI
TIEOIHERHXLIPIEZIWLEZIHVSTTIH
MXQE]WIIQTSMRXPIWWXSTLSXSKVETL
XVIIW)ZMHIRXP]QER]TISTPIJIIP
XLMW[E]EW-EP[E]WRSXMGIJEVJI[IV
ZMWMXSVW[ERHIVMRKEVSYRHXLIKVSYRHW

CLIVE NICHOLS EXPLAINS WHY SOMETIMES
EVEN THE BEST COMPOSITIONS ARE LET
DOWN BY NOT HAVING A SENSE OF SCALE
SRGIXLIVIHQETPIWLEZITIEOIH
,S[IZIVPEXIEYXYQRERHIEVP][MRXIV
GERFIKVIEXXMQIWXSPSSOJSVTMGXYVIW
XLEXIQTLEWMWIPMKLXMRKERHWXVYGXYVI
-XSSOXLMWTMGXYVISJEPMQIERH
ELSVWIGLIWXRYXXVIIIEVP]SRI
EYXYQRIZIRMRKNYWXFIJSVIWYRWIX
7XEVMRKWXVEMKLXMRXSXLIWYR-PMOIH
XLIQ]WXIVMSYWREXYVISJXLIPMKLXERH
LS[MXMPPYQMREXIHXLIIHKIWSJXLI
XVIIXVYROWERHXLIFEVIFVERGLIW
-[EWPSSOMRKJSVERIQTLEWMWSR
WXVYGXYVIERHXLIWXVSRKHMVIGXMSREP
PMKLXTVSZMHIHF]XLIWIXXMRKWYR[EW
KMZMRKQIEJEWGMREXMRKGSQTSWMXMSR
LMKLPMKLXMRKWLETIERHJSVQ
,S[IZIVEWETTIEPMRKEWXLMW
WGIRI[EWXLIWIXVIIWEPSRI

[SYPHLEZIFIIRER3/TMGXYVIFYX
RSXEKVIEXTMGXYVI*SVQI[LEX
XVERWJSVQWXLMWJVSQEREZIVEKIWLSX
XSSRISJQ]JEZSYVMXIWMRQ]EVGLMZI
MWXLIWIRWISJWGEPI
8LIVI[IVITPIRX]SJFEVIXVIIWMR
XLIEVFSVIXYQERHTIVLETWWSQI
LEHQSVIMRXIVIWXMRKWLETIWFYX-
WXSTTIHERHWIXYTQ]XVMTSHEVSYRH
XLMWWGIRIFIGEYWIXLIFIRGLMRXLI
PS[IVVMKLXLERHGSVRIVSJQ]JVEQI
[EWTIVJIGXP]TPEGIH&]JVEQMRKMX
EPSRKXLIFSXXSQXLMVHEW-¸ZIHSRI
MXHVE[WXLIZMI[IV¸WEXXIRXMSRXSXLI
QEKRMÁGIRXLIMKLXERHKVERHIYV
SJXLIXVIIWRI\XXSMX8LMWFIRGLMW
XLIOI]XSXLIWYGGIWWSJXLI[LSPI
GSQTSWMXMSRERH[MXLSYXMXQ]TMGXYVI

BOZYW\UbSQV\W_cS
/a1ZWdS[S\bW]\aa][SbW[SabVSSTTSQb]TORRW\UOaS\aS]TaQOZSQO\
[OYSOZZbVSRWTTS`S\QSb]g]c`W[OUS6]e[O\gbW[SaVOdSg]cPSS\
abO\RW\UW\OeWRS¿SZR]`PST]`SObOZZVWZZ]`W[^]aW\UPcWZRW\UO\RbOYS\
O^WQbc`S]\Zgb]Z]]YObWbZObS`O\R¿\RbVObWbR]Sa\¸baSS[OaPWUOag]c
`S[S[PS`SRWb-;O\gbW[Sag]c¸ZZ¿\Rg]cQO\USbSdS`gbVW\UQ]``SQb³
bVS^S`TSQbSf^]ac`Sabc\\W\UZWUVb^W\aVO`^T]Qca³PcbbVSW[^OQbg]c
TSZbObbVSbW[S]TbOYW\UbVS^WQbc`SWaOPWbZ]ab=TbS\g]cQO\`S[SRgbVWa
aW[^ZgPgORRW\UOaS\aS]TaQOZS
/ZbV]cUVWb¸acacOZZgT`]e\SRc^]\W\\Obc`S^V]b]U`O^Vg^S]^ZSO`S
bVS^S`TSQbT]WZb]OaQOZSZSaaQ][^]aWbW]\/aeSQO\W[[SRWObSZg^`]QSaa
O\RQ][^`SVS\RbVSaWhS]TOVc[O\PSW\UeSQO\`SZObSWbb]bVS]bVS`
SZS[S\baW\bVST`O[SO\R[OYSbVS\SQSaaO`g^O`OZZSZa/a[OZZVc[O\
¿Uc`S[OYSaO\ORXOQS\b[O^ZSb`SSOZZbVS[]`Sab`WYW\U:WYSeWaS
aV]`bS`acPXSQbaaSS[ReO`TSRPgVc[O\VSWUVb7\bVS^WQbc`S]\bVSZSTb
g]cQO\aSSV]ebVSW\QZcaW]\]TbVSe][S\aWbbW\UObbVS^WQ\WQbOPZSW\
bVSZ]eS``WUVb]TbVST`O[SSfOUUS`ObSabVSVSWUVbO\RU`O\RSc`]TbVS
b]eS`aO\R`]e]Tb`SSaPSVW\RbVS[A]bVS\SfbbW[Sg]c¿\Rg]c`aSZT
eOWbW\UT]`a][S]\Sb][]dS]cb]Tg]c`T`O[Sb`gbOYW\UbVSaV]b
O\geOg(WbQ]cZRPSXcabeVObg]c`^WQbc`S\SSRa

© CLIVE NICHOLS 

>S]^ZSO`SbVS^S`TSQbT]WZ
b]OaQOZSZSaaQ][^]aWbW]\ 
acPaQ`WPS&"#$%$%%%&

6O`Q]c`b/`P]`Sbc[<c\SVO[
1]c`bS\Og=fT]`RaVW`S=F""'>F
BSZ(&$#!"!#
=^S\W\UbW[Sa(/^`WZ<]dS[PS` 
O[#^[SdS`gROg2SQS[PS`;O`QV 
O["!^[;]\ROg4`WROg1Z]aSR
2SQS[PS` 8O\cO`g!
>`WQSa(ASOa]\bWQYSbdOZWRT]`]\SgSO`
T`][RObS]T^c`QVOaS1]\QSaaW]\O`g
aSOa]\bWQYSb&#2OgbWQYSb!
1]\QSaaW]\O`gROgbWQYSb #
[SYPHFIEPQSWXYWIPIWW.YWXXV]
TYXXMRK]SYVLERHSZIVXLIFIRGLSR
XLITEKILIVIERHPSSOMRKEXMXEKEMR
-XPSWIWEWMKRMÁGERXEQSYRXSJMXW
MQTEGXHIWTMXIXLIWXVSRKPMKLX
GSQMRKXLVSYKLXLIXVIIXVYROW
9WMRKQ]2MOSR*<[MXLE 
QQ^SSQ-WIXYTQ]XVMTSH
ERHJVEQIHXLMWWGIRINYWXFILMRH
XLIX[SXVIIXVYROW*MRHMRKXLIVMKLX
JSGEPPIRKXLJSVEWGIRIPMOIXLMWGER
FIXVMGO]-ORI[-[ERXIHXLIFIRGLMR
XLIFSXXSQGSVRIVEPSRKXLIXLMVHERH
-[ERXIHXSKMZIEPSXSJVSSQEFSZI
MXMRXLIJVEQI,S[IZIV-HMHR¸X[ERX
MXXSFIWSWQEPPXLEXMXKIXWPSWX8LI
TSMRXSJXLITMGXYVI[EWXSIQTLEWMWI
EWIRWISJWGEPIWS-[EWGEVIJYPRSX
XSHMPYXIXLEXIJJIGX
8LIXVYXLMW-HSR¸XEGXYEPP]PSSOEX
XLIJSGEPPIRKXL-¸QNYWXRSXGSRWGMSYW
SJMX-ORS[[LEXPIRW-LEZISJ
GSYVWIFYXQ]WXERHEVHQIXLSHMWXS
WXEVXSYXF]JVEQMRKEWGIRI[MHIERH
XLIRKVEHYEPP]GVSTMRGEQIVE[LIR
PSSOMRKEXMXXLVSYKLXLIZMI[ÁRHIV
-¸PPTVSFEFP]XEOIEJI[WLSXWEXIEGL
QSZIMR[EVHWFIGEYWIWSQIXMQIWE
KSSHTMGXYVIHSIWR¸XVIZIEPMXWIPJYRXMP
PEXIVFYXKIRIVEPP]EW-GVSTXLVSYKL
XLIZMI[ÁRHIV-¸PPKIXXSETSMRX[LIVI
-VIGSKRMWIXLEXEPPXLIIPIQIRXWEVI
MRTPEGI*SVQIXSTVIWWXLIWLYXXIV
FYXXSRMX¸WVIEPP]NYWXEGEWISJ[LIXLIV
[LEX-¸QWIIMRKXLVSYKLQ]ZMI[ÁRHIV
MWTPIEWMRKXSXLII]I
-EPWSQEOIELEFMXSJFVEGOIXMRK
IZIV]XLMRK-XV]XSKMZIQ]WIPJIRSYKL
XS[SVO[MXLWS-SRP]LEZIXSHSXLI
PIEWXEQSYRXSJTSWXTVSGIWWMRK
TSWWMFPI*SVXLMWTMGXYVI-[ERXIHXS
QEOIXLIQSWXSJXLIWMPLSYIXXIWS
-IRHIHYTWLSSXMRKMXEFSYXWXST
YRHIVI\TSWIH/>

B]aSS[]`S^WQbc`SaPg1ZWdS<WQV]Za
dWaWbeeeQZWdS\WQV]ZaQ]cY 
8O\cO`g 7eeeO[ObSc`^V]b]U`O^VS`Q]cY7#

www.storemags.com & www.fantamag.com

www.st
storemag
ags.com & www.fa
fant
ntamag
ag.com

www.st
storemag
ags.com & www.fa
fant
ntamag
ag.com

BSQV\W_cS@S[]dW\UC\eO\bSR=PXSQba

7\bVSaSQ]\R
]T]c`be]^O`b
O`bWQZS]\QZ]\W\U
@WQVO`RAWPZSg^cba
a][SORdO\QSR
bSQV\W_cSaW\b]^`OQbWQS

A]TbeO`S
/R]PS>V]b]aV]^>V]b]aV]^
3ZS[S\ba]`aW[WZO`a]TbeO`S
AgabS[`S_cW`S[S\ba
EW\R]ea>1]`;OQ
AYWZZ`S_cW`SR
BW[Sb]Q][^ZSbS [W\cbSa

0ST]`S

/TbS`

BSQV\W_cSSf^ZOW\SR
/RdO\QSR`Sb]cQVW\UbSQV\W_cSa³^O`b

/

7QYGLEW[IXV]XS
GVIEXITIVJIGXQEWXIVTMIGIW
MRGEQIVEXLIVI[MPP
EP[E]WFISGGEWMSRW[LIRER
YR[ERXIHSFNIGXETTIEVWMRETMGXYVI
*SVXYREXIP]MQEKIIHMXMRKWSJX[EVI
KMZIWYWXLIEFMPMX]XSVIQSZIXLIWI
IPIQIRXWERHXLIVIMWRSWLEQI
MRHSMRKWS
7OMPPIHTLSXSKVETLMGTVMRXIVWSJXIR
IHMXMQEKIWMRXLIHEVOVSSQERH
XLIVIMWQER]EWXSV]SJEPXIVIHERH
HSGXSVIHMQEKIWGSQMRKSYXSJXLI

SPH7SZMIX9RMSR8LIHMJJIVIRGI
RS[MWXLEXXLIWISRGIQ]XLMGEP
WOMPPWGERFIEGLMIZIHMRNYWXEJI[
QMRYXIWSREGSQTYXIVVEXLIV
XLEREJI[LSYVWMRXLIHEVOVSSQ
-RXLITVIZMSYW0EWXVIWSVXMR
%4(IGIQFIV-VIQSZIH
XLIÂEKTSPIJVSQXLIXSTSJXLMWJSVX
YWMRKEGSQFMREXMSRSJWEQTPI
WIPIGXMSRWQEWOMRKERHGPSRMRK
8SGSQTPIXIXLIMQEKI-EQ
RS[KSMRKXSVIQSZIXLI[MVIW
XLEXWXVIXGLEGVSWWXLIMQEKISRXLI 

&7eeeO[ObSc`^V]b]U`O^VS`Q]cY7 8O\cO`g 

www.storemags.com & www.fantamag.com

PIJX8LMWMWSRISJXLIQSWXGSQQSR
GPSRMRKXEWOWETLSXSKVETLIV[MPP
GSQIEGVSWWFYXMXGERFIXVMGO]
MJXLI[MVIWEVIMRJVSRXSJEGPSYH]WO]
*MREPP]-[MPPHIQSRWXVEXILS[XS
YWIEPMXXPIEVXMWXMGPMGIRGIXSVIQSZI
XLIHMWXVEGXMRKGEVSRXLIPIJXLERH
WMHISJXLIMQEKIVITPEGMRKMXMRWXIEH
[MXLEVSGO]QSYRH
,STIJYPP]XLIWIWXVEMKLXJSV[EVH
XIGLRMUYIW[MPPLIPT]SYGPSRISYX
YR[ERXIHEVIEW[MXLSYXGVIEXMRK
VITIXMXMZIGPSRMRKTEXXIVRW
acPaQ`WPS&"#$%$%%%&

@S[]dW\UC\eO\bSR=PXSQbaBSQV\W_cS

1Z]\W\U]cbeW`SaO\RZO`US]PXSQba
6]eb]SZW[W\ObSRWab`OQbW\USZS[S\baeWbV]cbQ`SObW\UQZ]\W\U^ObbS`\a

BVSbSQV\W_cSb]`WRbVSW[OUS]TbVS]dS`VSORQOPZSa
WaaW[WZO`b]bVS]\S7caSRb]`S[]dSbVSÀOU^]ZSW\bVS 

^`SdW]ca:Oab@Sa]`b7VOdScaSRbVS;O`_cSSb]]ZeWbVO

aZWUVbZgTSObVS`SRSRUSb]aSZSQbO\O`SOXcabOP]dSbVSeW`S

CaSbVWaaSZSQbW]\b]^ObQV]dS`bVS]dS`VSORQOPZS
7VOdS`S^SObSRabS^a]\SO\R 

B]R]bVWaaSZSQb:OgS`,<Se,:OgS`DWO1]^geVWQV
!
be]O\c[PS`]TbW[SaQ`SObW\U
eWZZQ]^gbVSaSZSQbW]\b]O\SeZOgS`EWbVbVS\SeZOgS`
aSdS`OZaSZSQbW]\ac\bWZ[]ab]TbVS
aSZSQbSRcaSbVS;]dSb]]ZT]c\RW\bVSB]]Za^OZSbbSO\R
[]dSbVSZOgS`a]bVS^ObQVWa^ZOQSR]dS`bVSQOPZS

QOPZSVOaPSS\`S[]dSRBVSW[OUS\]eVOa!!ZOgS`a
B]ÀObbS\bVS[aSZSQb:OgS`,4ZObbS\7[OUS

BVSO`SOaeVS`SbVSQOPZS[SSbaOQZ]cR\SSRb]PS
B]Q][^ZSbSbVSW[OUS7eO\bb]`S[]dSbVSQO`O\R
BVSWRSOWab]caSbVS1Z]\Sb]]Zb]Q]^gbVWaO`SO]dS`
"
#
$
QZ]\SRb]PZS\RbVS[B]R]bVWaQVO\USbVS=^OQWbg
ab`cQbc`S]\bVSZSTbOaeSZZOabVS]PXSQbOP]dSWb7
bVSQO`7TR]\SQO`STcZZgWbaV]cZR`S^ZOQSbVSQO`eWbV
]TbVSQZ]\W\UP`caVb]&O\RU`ORcOZZgPcWZRc^bVSSTTSQb eWZZcaSa][SO`bWabWQZWQS\QSb]R]a]7VOdSaSbO\SeQZ]\S O`SOZWabWQ`]QYac`TOQS
9SS^]\SVO\R]\bVS/ZbYSgO\R^`SaabVWaSdS`gTSeQZWQYa
b]aSZSQbO\SeQZ]\SaO[^ZSBVWaVSZ^a^`SdS\b^ObbS`\W\U

^]W\bObbVSP]bb][SRUS]TbVS`]QY

7VOdScaSRbVS;O`_cSSb]]Zb]aSZSQbbVS`]QYg
%
O`SOO\RbVS\W\dS`bSRbVSaSZSQbW]\PgQZWQYW\U
ASZSQb,7\dS`b

CaW\UOZO`US1Z]\SP`caVaSbb]O`]c\R%=^OQWbg
&
QZ]\SbVSQZ]cRaW\bVSPOQYU`]c\R]dS`bVS]PXSQb
/UOW\aSbbW\UbVS=^OQWbgZ]eS`bVO\OZZ]eabVSSTTSQb

acPaQ`WPS&"#$%$%%%&

7\bVS¿\OZW[OUSbVSÀOU^]ZSQOPZSaO\RQO`VOdSOZZPSS\
`S[]dSR[OYW\UbVSW[OUSOZ]b\SObS`O\RbWRWS`

b]PSU`ORcOZZgPcWZbc^eVWZSbVSaSZSQbW]\^`SdS\babVS
`]QYaPSW\UOTTSQbSR^`]RcQW\UOQZSO`SRUS 

8O\cO`g 7eeeO[ObSc`^V]b]U`O^VS`Q]cY7'

www.storemags.com & www.fantamag.com

www.
ww
w.st
w.
stor
st
orem
or
emag
em
ags.
ag
s.co
s.
com
co
m & ww
www.
w.fa
w.
fant
fa
ntam
nt
amag
am
ag.c
ag
.com
.c
om

4`]abg:O\RaQO^Sa

4W`abQZOaaT`]ab
2WaQ]dS`bVSVWRRS\PSOcbg]Tg]c`
UO`RS\W\eW\bS`aOga1]ZW\DO`\RSZZOa
VSSf^ZOW\aV]eb]bOYSP]ZRQ][^SZZW\U
W[OUSa]\T`]abg[]`\W\Ua

8LIWIFIIGLXVIIWPMRMRKXLIVSEHMR[IWX
(SVWIXLEHFIIRXVERWJSVQIHMRXSER
IXLIVIEPWGIRIF]XLIJSKERHLSEVJVSWX
2MOSR*)QQWIGEXJ
/SHEGLVSQIXVMTSH
acPaQ`WPS&"#$%$%%%& 

8O\cO`g 7eeeO[ObSc`^V]b]U`O^VS`Q]cY7 

www.
ww
w.st
w.
stor
st
orem
or
emag
em
ags.
ag
s.co
s.
com
co
m & ww
www.
w.fa
w.
fant
fa
ntam
nt
amag
am
ag.c
ag
.com
.c
om

:O\RaQO^Sa4`]abg

E

-28)6XVERWJSVQWSYVKEVHIRW
ERHLIHKIVS[WMRXSQ]VMEH
TSXIRXMEPGPSWIYTMQEKIW
'VYRGL][LMXIGV]WXEPWSJMGIHIGSVEXI
IZIV]XLMRKXSTVIWIRXEXERXEPMWMRKWGIRI
XSXLITLSXSKVETLIV&EVIX[MKWPIEJPMXXIV
WIIHLIEHWERHKVEWWIWXLEX]SY[SYPHR¸X
PSSOEXX[MGIMRRSVQEPGSRHMXMSRWKPMWXIR
[MXLJEWGMREXMRKMRXVMGEXIHIXEMPWSJMGI
TEXXIVRW-XGERFII\GMXMRKXS[EOIYTXSÁRH
IZIV]XLMRKIQFVSMHIVIH[MXLEXLMGOGSEXMRK
SJ[LMXIJVSWXFYXXSQEOIMXEWYGGIWWJYP
TLSXSKVETLMGI\TIVMIRGI]SYLEZIXSFI
TVITEVIH(E]WEVIWLSVXMR[MRXIVERH
JVSWXQE]RSXPEWXPSRKWS]SYLEZIXSFI

VIEH]XLIRMKLXFIJSVIXSQEOIXLIQSWXSJ
JVII^MRKGSRHMXMSRW[LIRXLI]SGGYV
1EOIWYVI]SYLEZIEPP]SYVOMXTEGOIH
XLIRMKLXFIJSVI'LEVKIGEQIVEFEXXIVMIW
ERHWTEVIWERHGLIGOXLEX]SYLEZI
TPIRX]SJGPIEVQIQSV]GEVHW4EGOQEGVS
ERH[MHIERKPIPIRWIWERHER]GPSWIYT
EGGIWWSVMIWPMOIVIÂIGXSVWERHÂEWLKYRW
8STVIZIRXSTXMGWJVSQJSKKMRKYTXV]XS
EZSMHHVEQEXMGGLERKIWSJXIQTIVEXYVI-J
TSWWMFPIWXSVI]SYVKIEVMRXLIFSSXSJ]SYV
GEVXLIRMKLXFIJSVISVQSZIMXSYXHSSVW
FIJSVI]SYKIXVIEH]MRXLIQSVRMRK
,S[IZIVOIITFEXXIVMIWMRXLI[EVQJSVEW
PSRKEWTSWWMFPIXSWEJIKYEVHXLIMVGLEVKI

BVS`WUVbZ]QObW]\

%WEP[E]W[MXLREXYVITLSXSKVETL]XLIGEXGLTLVEWIJSV
WYGGIWWMW·VIGSRREMWWERGITPERRMRKERHTVITEVEXMSR¸1EOI
WYVI]SYORS[[LIVIPS[P]MRKHEQTTPEGIWSGGYVMR]SYV
RIMKLFSYVLSSH7IEVGLJSVEVIEW[MXLTPIRX]SJVSYKLZIKIXEXMSR
PMOIHSGOWJIVRWWIIHLIEHWFVEQFPIERHKSVWIEPPSJ[LMGLEVI
MHIEPWYFNIGXW[LIRGSZIVIHMR[LMXIVMQIJVSWX=SYQE]RIIHXS
KSRSJYVXLIVXLER]SYVS[RKEVHIRSVPSGEPTEVOJSVWYFNIGXW
8LMW[EWERYRYWYEPWMXYEXMSR[LIVIEQMWXLEHKIRXP]
FPS[RXLVSYKLXLMWEVIESJ[SSHPERHMRWYF^IVS
XIQTIVEXYVIW8LIQSMWXYVIJVS^IXSXLIX[MKWERH
GVIEXIHXLMW[SRHIVJYPIJJIGX
2MOSR*QQWIGEXJ*YNMGLVSQI
:IPZMEXVMTSH

1V]]aW\UbVS`WUVbacPXSQba

-EQTEVXMGYPEVP]JSRHSJTLSXSKVETLMRKFVEGOIRMRMG]GSRHMXMSRW
8LIYRHIVWMHIWSJJVSRHWMJXLI]LEZIFIIRI\TSWIHXSXLIJVSWX
TVSHYGII\UYMWMXIP]HIXEMPIHTEXXIVRW0IEJPMXXIVGEREPWSPSSO
MQTVIWWMZI[LIRXLIWTIRXPIEZIWGSRXVEWX[MXLMG]JVMRKIWERH
PIEJZIMRWEVITMGOIHSYXERHEGGIRXYEXIHF]JVSWXGV]WXEPW*VS^IR
GSF[IFWEXHE[RQEOIMRXVMKYMRKMQEKIW[MXLFVMXXPIMGIGV]WXEPW
JYWIHXSXLITEVEP]WIHKSWWEQIV)ZIRMRQMH[MRXIVXLIVIMWWXMPP
TPIRX]SJJSPMEKIEVSYRH[MXLTPERXWWYGLEWLIVF6SFIVXERH
FYXXIVGYTPIEZIWPSSOMRKJVIWLERHZMFVERX[LIRIHKIH[MXLJVSWX
%VGLMXIGXYVEPWIIHLIEHWSJXIEWIPWXLMWXPIWERHYQFMPPMJIVSYWTPERXW
EVITIVJIGXTLSXSKIRMGWXVYGXYVIWJSVJVSWXERHGERQEOIWXVMOMRK
MQEKIW[LIRFEGOPMXEXHE[R
7IEVGLJSVWLETIWMRXLIJVSWXXLEXQEOIREXYVEPGSQTSWMXMSRW
PMOIXLIWIJIVRJVSRHW
2MOSR(QQQEGVSWIGEXJ-73XVMTSH 
7eeeO[ObSc`^V]b]U`O^VS`Q]cY7 8O\cO`g 

www.storemags.com & www.fantamag.com

acPaQ`WPS&"#$%$%%%&

4`]abg:O\RaQO^Sa

1`SObW\UOeW\b`gabWZZZWTS

8LMROEFSYXGVIEXMRK]SYVS[RJVSWX]GPSWI
YTWLSXW'SPPIGXPIEZIWXLEXWXMPPLEZITPIRX]
SJGSPSYVERHWGEXXIVXLIQSR]SYVPE[R
XLIRMKLXFIJSVI-J]SYHSR¸XLEZIEGGIWW
XSEPE[R]SYGSYPHPIEZI]SYVGSPPIGXMSRSJ
PIEZIWSVWIIHLIEHWSREXMRXVE]JSVXLI
TIVJIGXWXMPPPMJIEXÁVWXPMKLX
;LIRXIQTIVEXYVIWHVSTXSEXPIEWX„'
IEVP]MRXLIQSVRMRKMXMWTSWWMFPIXSGVIEXI
EVXMÁGMEPMGMGPIWF]WTVE]MRKPYOI[EVQ[EXIV
JVSQETPERXQMWXWTVE]SRXSWIIHLIEHW
SVX[MKW,S[IZIVXLIXIQTIVEXYVISJXLI
[EXIVMWGVYGMEP³MJMX¸WXSS[EVQMX[MPPRSX
JVII^IUYMGOP]IRSYKLERHMJMX¸WXSSGSPHMX
[MPPJVII^IMRXLIRS^^PI-J]SYGERKIXXLI
XIQTIVEXYVISJXLI[EXIVNYWXVMKLXXLMWMW
XLITIVJIGXQIXLSHJSVGETXYVMRKGVIEXMZI
MGMGPITLSXSKVETLW
8LMWLSK[IIHWIIHLIEH[EWWTVE]IH[MXL
PYOI[EVQ[EXIVMRJVII^MRKGSRHMXMSRW
2MOSR*)QQWIGEXJ
/SHEGLVSQIXVMTSHGEFPIVIPIEWI

E]`YW\UeWbVbVSZWUVb

-XHSIWR¸XLEZIXSFIWYRR]XSKIXKVIEXTLSXSKVETLWSJJVSWX-R
JEGXJSKK]QSVRMRKWTVSHYGIEWSJXHMJJYWIHPMKLXXLEXMWTIVJIGXJSV
GPSWIYTHIXEMPW-JMXMWPMOIP]XSFIWYRR]WIEVGLJSVEXXVEGXMZIJVSWX]
WYFNIGXWFIJSVIXLIWYRVIEGLIWXLIQERHXLIRWLSSXMRWYRPMKLXXS
GETXYVIXLIWTEVOPISJXLIWYR¸WÁVWXVE]W%PXIVREXMZIP]WLSSXJVSWX]
HIXEMPWMRXLIWLEHIERHYWIEWQEPPQMVVSVXSVIÂIGXXLIWYRPMKLX
FEGOSRXSXLIQ-RHYPPGSRHMXMSRWEFYVWXSJÂEWLGEREHHEFMXSJ
WTEVOPIXSERMG]GPSWIYT
-X[EWMQTSVXERXXSGLSSWIEWQEPPETIVXYVILIVIXSIRWYVI
XLEXEPPXLIJSPMEKI[EWMRJSGYW
2MOSR*QQQEGVSWIGEXJ*YNMGLVSQI:IPZMEXVMTSH 

EVS\bS[^S`Obc`SaR`]^b]ObZSOab 
#Ž1WbWa^]aaWPZSb]Q`SObSO`bW¿QWOZWQWQZSa
Pga^`OgW\UZcYSeO`[eObS`T`][O^ZO\b
[Waba^`Og]\b]aSSRVSORa]`beWUa 
T &

T

/^S`bc`S
8LIWQEPPIVETIVXYVISJJ[SVOIHFIXXIVSRXLMWJVSWXIH
ERKIPMGEEWMXLEWVIWYPXIHMREPPSJXLIHIXEMPMRJSGYW
2MOSR(QQQEGVS-73XVMTSH

acPaQ`WPS&"#$%$%%%& 

8O\cO`g 7eeeO[ObSc`^V]b]U`O^VS`Q]cY7 !

www.storemags.com & www.fantamag.com

:O\RaQO^Sa4`]abg

EVWbSPOZO\QS

-XMW[SVXLI\TIVMQIRXMRK[MXL]SYVGEQIVE¸W
[LMXIFEPERGIWIXXMRKWXSIQTLEWMWIXLI
GSSPRIWWSJJVS^IRWYFNIGXW8LITYVTSWI
SJ[LMXIFEPERGIWIXXMRKWMWXSTVIWIVZI
REXYVEPPSSOMRKGSPSYVWMRHMJJIVIRXPMKLXMRK
GSRHMXMSRWWYGLEWWYRR]GPSYH]ÂEWL
SVÂYSVIWGIRX8LIMRGERHIWGIRXWIXXMRK
MWHIWMKRIHXSFEPERGIXLIIJJIGXSJPMKLX
JVSQXVEHMXMSREPPMKLXFYPFWERHXLIVIJSVI
TVSHYGIWEHMWXMRGXFPYILYI8V]YWMRKXLMW
WIXXMRKXSI\EKKIVEXIXLIGSSPGSPSYVWSJ
JVSWXIWTIGMEPP]MRGPSYH]GSRHMXMSRW-HIEPP]
JSVQE\MQYQGSRXVSPWIPIGX]SYVGEQIVE¸W
[LMXIFEPERGIGYWXSQJYRGXMSRERHHMEPMR
EPS[IVZEPYIXLER/7IXXMRKMXXS 
/[MPPTVSHYGIEFPYIGEWXXLEXLEWXLI
EHHIHFIRIÁXSJRSXFIMRKEJJIGXIHF]ÂEWL
EWMRER]SJXLIWXERHEVHTVIWIXWIXXMRKWE
[EVQLYI[MPPFIEYXSQEXMGEPP]WIX[LIR
ÂEWLMWYWIH-J]SYEVIRSXJEQMPMEV[MXL
W[MXGLMRKFIX[IIRHMJJIVIRX[LMXIFEPERGI
WIXXMRKWGLIGO]SYVGEQIVEQERYEPERH
I\TIVMQIRXFIJSVILERH

4ZOaV

<Obc`OZZWUVbeWbVOcb]eVWbSPOZO\QS

8LIÁVWXWLSX[EWXEOIR[MXL
REXYVEPPMKLX[MXLXLI[LMXI
FEPERGIWIXXSEYXS8LIWIGSRH
MQEKI[EWEGSQFMREXMSRSJ
REXYVEPPMKLXERHÁPPMRÂEWL[MXL
XLI[LMXIFEPERGIWIXXSÂEWL
[LMGLTVSHYGIWE[EVQIVIJJIGX
2MOSR(QQQEGVS 
WIGEXJ-73XVMTSH

<ObW]\OZZWUVb¿ZZW\ÀOaVeVWbSPOZO\QSaSbb]ÀOaV 

7Tg]cO`S\]bTO[WZWO`eWbVaeWbQVW\UPSbeSS\RWTTS`S\beVWbS
POZO\QSaSbbW\UaQVSQYg]c`QO[S`O[O\cOZO\RSf^S`W[S\b 

"7eeeO[ObSc`^V]b]U`O^VS`Q]cY7 8O\cO`g 

www.storemags.com & www.fantamag.com

acPaQ`WPS&"#$%$%%%&

4`]abg:O\RaQO^Sa

BVS`WUVbQ]\RWbW]\a

8LMGOJVSWXSGGYVWQSWXSJXIR[LIRXLIEMV
GEVVMIWEPSXSJQSMWXYVIMRGSPHGSRHMXMSRW%
ZIV]GSPHRMKLXJSPPS[MRKE[IXHE]MW[LIR
XLIQSWXTLSXSKIRMGWYFNIGXWEVIPMOIP]XS
SGGYV;EXGLXLI[IEXLIVJSVIGEWXERHPSSO
EXXLIWO]EXWYRWIX-JMXMWGPIEVXLIVIMWE
KSSHGLERGIXLEXXLIXIQTIVEXYVIQE]HVST
PS[IRSYKLJSVXLIQSMWXYVIMRXLIEMVXS
GSRHIRWIERHJVII^I8LIVIEVIWYGLTPEGIW
EWJVSWXTSGOIXW[LMGLEVIPS[P]MRKEVIEW
SJKVSYRH[LIVIJVSWXSJXIRJSVQW[LIRMXMW
XSSQMPHIPWI[LIVI9WYEPP]XLIWIPS[EVIEW
[MPPFIJSYRHRIEVVMZIVWSVWXVIEQW[LMGL
EPWSTVSHYGIXLIQE\MQYQEQSYRXSJEMV
PEHIRQSMWXYVI
%LSEVJVSWXVIUYMVIWEWTIPPSJÁRIFYXZIV]
GSPH[IEXLIV,MKLTVIWWYVI[LMGLKMZIW
WYRR]HE]WMRXLI[MRXIVSJXIRVIWYPXWMR
JSKK]RMKLXWERHMJXLIXIQTIVEXYVIHMTWPS[
IRSYKLXLIQMWX]EMVJVII^IWXSX[MKWERH
FVERGLIWPMOI[EJIVXLMRFPEHIWSJ[LMXIMGI
ETTIEVMRKPMOITYVI[LMXIJIEXLIV]JSPMEKI

8LMW[EWWLSXZIV]
PEXISREKPSSQ]
[MRXIVEJXIVRSSR
2MOSR*QQ 
WIGWEXJ
*YNMGLVSQI:IPZME 
XVMTSH

7\QO\RSaQS\b
,SEVJVSWXWSGGYV[LIR
XLIVIMWEGSQFMREXMSR
SJJSKERHJVII^MRK
XIQTIVEXYVIW8LMW
[SSHPERHWGIRI[EW
WLSXNYWXEWXLIWYR
FVSOIXLVSYKLXLIQMWX
2MOSR( 
QQWIGEX
J-73XVMTSH
acPaQ`WPS&"#$%$%%%&

EVWbSPOZO\QS
&]WIPIGXMRKXLIMRGERHIWGIRX
[LMXIFEPERGIWIXXMRKXLITMGXYVI
MRXLIXSTPIJXLERHGSVRIVLEWE
QYGLGSPHIVJIIPXSMX
2MOSR(QQQEGVS 
WIGEXJ-73XVMTSH

/cb]eVWbSPOZO\QS

\R
1]ZW\DO`\RSZZ]`UO\WaSa^V]b]ROgaO
a
VS`
U`O^
V]b]
`S^
\Obc 
T]`
e]`YaV]^a
SPaWbS
bV`]cUV]cbbVSgSO`1VSQY]cbVWae cY
ZZQ]
\RS
dO`
]ZW\
eQ
T]`[]`SRSbOWZaObee 

8O\cO`g 7eeeO[ObSc`^V]b]U`O^VS`Q]cY7 #

www.storemags.com & www.fantamag.com

AS PART OF OUR PHOTOGRAPHIC SEMINAR SERIES
IN ASSOCIATION WITH AMATEUR PHOTOGRAPHER, WHAT DIGITAL CAMERA AND CANON

BOOK NOW!
LIMITED PLAC
ES
AVAILABLE

LIFESTYLE & PORTRAIT
PHOTOGRAPHY SEMINAR
WITH ANNABEL WILLIAMS WEDNESDAY 17TH FEBRUARY 2010, 6.30PM - 8PM
s part of our photographic seminar
series, we are delighted to welcome
Annabel Williams, who will be hosting
a Lifestyle and Portrait Seminar.
Annabel Williams is frequently acknowledged
as one of the most outstanding social
photographers of this decade. She has been
fundamental in the changing face of lifestyle
photography today.
Her energy for photography is boundless,
both inspiring her clients and enlightening and
enriching all of those who hear her speak.
Annabel is often asked, ‘What makes a great
portrait photographer?’ During this seminar she
will give you an insight into her photographic
approach, which she describes as being ‘90%
psychology and 10% technique’; while Catherine
Connor, her business partner, will explore how to
develop your photographic business stand in an
ever-competitive marketplace.
These exclusive seminars for up to 90 people
are held at the ‘home’ of AP and WDC in the

A

HOW TO BOOK YOUR PLACE
EMAIL us at spiadmin@ipcmedia.com with
the words ‘ANNABEL WILLIAMS SEMINAR’
in the subject line. Please include your
name, address and telephone number.

Blue Fin Building, rising above the impressive
Tate Modern and City of London skyline.
Tickets are sold on a first-come, first-served
basis at £29 per head to include the presentation
from Annabel and Catherine, followed by a Q&A
session. Tea and coffee will be served afterwards,
and you will have the opportunity to ‘touch and
try’ Canon products with the Canon team, and
to meet AP and WDC editorial staff. You will be
able to purchase a signed book from Annabel,
and every delegate will also be given a goody
bag and a hints and tips sheet to take home.

POST a cheque for £29 made out to ‘IPC
Media Ltd’ to Estelle Hicks-Bennett, SPI
Seminar, Room 9-372, Blue Fin Building,
110 Southwark Street, London, SE1 OSU.
Please include your name, address, email
and telephone number.
CALL 020 3148 4326/1 and leave your
name, address and phone number on
our answer phone.
SUPPORTED BY:

www.storemags.com & www.fantamag.com

@SORS`>WQbc`Sa

AS\RcaOaSZSQbW]\]Tg]c`^WQbc`SaO\RaSS
g]c`e]`Y^`W\bSRW\/[ObSc`>V]b]U`O^VS`
DWaWbeeeO[ObSc`^V]b]U`O^VS`Q]cYO^UOZZS`gT]`RSbOWZa

3RWb]`¸a
1V]WQS

8LMWXS[IVMRKTMGXYVI
KMZIWEZIV]GPIEVWIRWI
SJNYWXLS[XEPPIPIKERX
ERHQENIWXMGXLIWIXVIIW
EVI%HEQ¸WWMHIPMKLXMRK
IQTLEWMWIWXLI(JSVQW
SJXLIXVYROW[LMPIXLEX
TIVJIGXEVGLMRXLIHMWXERGI
SJJIVWXLISRP][E]SYX
SJXLIGSQTSWMXMSR%
[IPPWTSXXIHWGIRIERHE
[IPPI\IGYXIHMQEKISJMX

/RO[6W`]\a
2Sd]\
LddYaVcYXaZVg^c\

Ag[[Sb`WQOZb`SSaOab`]\UaV]]bW\UO\UZSO\RSfQSZZS\b
Sf^]ac`SQ][PW\Sb]Q`SObSOR`O[ObWQaS\aS]T
RS^bVW\bVWa[gabS`W]caW[OUS
1O\]\3=A"2&##[[ aSQaObT %
7A="^]ZO`WaS`b`W^]R
acPaQ`WPS&"#$%$%%%& 

8O\cO`g 7eeeO[ObSc`^V]b]U`O^VS`Q]cY7 %

www.
ww
w.st
w.
stor
st
orem
or
emag
em
ags.
ag
s.co
s.
com
co
m & ww
www.
w.fa
w.
fant
fa
ntam
nt
amag
am
ag.c
ag
.com
.c
om

@SORS`>WQbc`Sa

/RO[6W`]\a
2Sd]\
%HEQLEWFIIRMRXIVIWXIHMRTLSXSKVETL]JSVQER]]IEVWFYX
WXEVXIHXEOMRKEWIVMSYWMRXIVIWXMR,IVIGIRXP]IRVSPPIHSRER
EVXGSPPIKIGSYVWIERHLSTIWXLMW[MPPEJJSVHLMQXLISTTSVXYRMX]XS
TYVWYIERI[GEVIIVTEXLEWETLSXSKVETLIV·-[ERXIHXSFIQSVI
GVIEXMZIERHJIPXTLSXSKVETL][EWXLITIVJIGXTPEXJSVQJSVXLMW¸LI
WE]W%HEQIRNS]WTLSXSKVETLMRKPERHWGETIWMRXLIWSYXL[IWXSJ
)RKPERHTEVXMGYPEVP](EVXQSSVERHGSEWXEPPERHWGETIWMR4P]QSYXL
ERH'SVR[EPP

&7eeeO[ObSc`^V]b]U`O^VS`Q]cY7 8O\cO`g 

www.storemags.com & www.fantamag.com

5caVW\U
ab`SO[ 

AeW`ZW\UeObS`
Q`SObSRPgbVSZ]\U
Sf^]ac`SO\RPSOcbWTcZ
ZWUVbUWdS/RO[¸aW[OUS
O[OUWQOZ_cOZWbg
1O\]\3=A"2 
&##[[&aSQa
ObT 7A=
^]ZO`WaS`b`W^]R

6WZZaWRS
dWSe2Sd]\ 

/RO[abWbQVSRbe]
T`O[Sab]USbVS`b]
Q`SObSbVWa[OXSabWQ
^O\]`O[WQW[OUS
1O\]\3=A"2 
&##[["aSQ
ObT 7A= 
<2U`OR¿ZbS`
b`W^]R

acPaQ`WPS&"#$%$%%%&

@SORS`>WQbc`Sa

@]aa;QEVW`bS`
2c[T`WSa
6SWWNSMRIH(YQJVMIW'EQIVE'PYFMRXLIPEXIW
ERHWXEVXIHQEOMRKLMWS[RFPEGO 
[LMXITVMRXWEXLSQI
%JXIVERYQFIVSJ]IEVWWTIRXXEOMRKTMGXYVIWSJLMWJEQMP]
6SWWFSYKLXEHMKMXEP706MRERHHIGMHIHXSVINSMR
LMWJSVQIVGEQIVEGPYF·-IRNS]TLSXSKVETLMRKPSGEP
GSEWXEPWGIRIWTEVXMGYPEVP]IEVP]MRXLIQSVRMRKXSGEXGL
XLIPMKLX¸WE]W6SWW·-XIRHXSXEOI[MHIERKPIPERHWGETI
WLSXWFYX-EP[E]WLEZIQ]XIPITLSXSPIRW[MXLQIMRGEWI
WSQIXLMRKGEXGLIWQ]I]I-¸QHVE[RXSEFWXVEGXWGIRIW
ERH-XV]XSOIITQ]GSQTSWMXMSRWWMQTPI¸

acPaQ`WPS&"#$%$%%%&

4S\QS
O\ReObS` 

A]Tb`SÀSQbW]\aO\R
OQc`dW\UTS\QSQ`SObS
POZO\QSO\R[]dS[S\b
W\bVWaW[OUSbOYS\Ob
:]QV9S\2c[T`WSa
O\R5OZZ]eOg
=Zg[^ca3# 
""#[[ #aSQa
ObT$7A=

Ac\`WaS 

2SZWQObSZWUVb
OQQS\bcObSabVS
RO^^ZSRQZ]cRa
bVObO`S\SObZg
^]aWbW]\SR]dS`
6SabO\7aZO\RW\
bVSA]ZeOg4W`bV
1O\]\3=A"#2 
&##[[aSQ
ObT$7A=

BSfbc`SR
¿SZR

!/RO[a^]bbSR
bVSaSRWabW\QbWdS
bSfbc`SaO\RQ]Z]c`a
eVWZSR`WdW\UW\4WTS
a]VSab]^^SRb]
bOYSOaV]b
1O\]\3=A"#2
## #[["aSQ
ObT$"7A= 

8O\cO`g 7eeeO[ObSc`^V]b]U`O^VS`Q]cY7 '

www.storemags.com & www.fantamag.com

@SORS`>WQbc`Sa

:SaZSgEWZZWO[a]\
5ZOaU]e
0IWPI]LEWHEFFPIHMRERYQFIVSJGVIEXMZIEVXWFYXWIXXPIHSRTLSXSKVETL]
MR7LIMWWIPJXEYKLXERHWXEVXIHXS·KIXXSKVMTW¸[MXLTLSXSKVETL]
[LMPIWLI[EWXVEZIPPMRK[MXLLIVÁERGqI8LIMVHIWXMREXMSRWMRGPYHIH
,SRK/SRK8SRKEERH2I[>IEPERH0IWPI]IRNS]WXVEZIPQEGVS
PERHWGETIERHYVFERTLSXSKVETL]·-ÁRHTISTPIERHXLITPEGIWXLI]
MRLEFMXJEWGMREXMRK¸WLIWE]W·-PSZIPERHWGETITLSXSKVETL][LIRXLI
PMKLXHIGMHIWXSTPE]EPSRK¸8SWIIQSVISJ0IWPI]¸WMQEKIWZMWMX[[[
PIWPI][MPPMEQWSRGSQ

Ab`SSbOb\WUVb

Bc\\SZ 

BVWaW[OUSQ]\aWaba]TbV`SSaV]ba³
bVSabObW]\^S]^ZS¸aTSSbO\RbVS;]]\
³eVWQV:SaZSgQ][PW\SRW\>V]b]aV]^
1O\]\3=A!2&##[["aSQaObT#$
7A=b`W^]R 

0g^]aWbW]\W\UVS`acPXSQbaZWUVbZg
]TTQS\b`S:SaZSg^cZZabVSdWSeS`W\b]
bVSaQS\SO\RQ`SObSaOaS\aS]TRS^bV
1O\]\3=A!2&##[[#aSQObT
7A=b`W^]R

6O\]WDWSb\O[

1ObVSR`OZ

!:SaZSgacQQSaaTcZZgQO^bc`SabVWa
e][O\W\T]QcaeVWZSbVS[]dW\U
b`OT¿QO`]c\RVS`WaPZc``SR
1O\]\3=A!2&##[[#aSQ
ObT7A=

!7eeeO[ObSc`^V]b]U`O^VS`Q]cY7 8O\cO`g 

www.storemags.com & www.fantamag.com

"BVS`SO`Sbe]aV]baVS`S(bVS
QObVSR`OZeWbVab`SOYgQO`VSORZWUVba
O\RO^OaaW\Ub`O[bVObORRa[]dS[S\b
1O\]\3=A!2&##[[ aSQaObT 
7A=b`W^]R

acPaQ`WPS&"#$%$%%%&

@SORS`>WQbc`Sa

BVS3RWb]`¸a
1V]WQSeW\a
O<ObW]\OZ
5S]U`O^VWQ
3O`bV3f^Z]`S`
aV]cZRS`POU

E]`bV
[]`S
bVO\
#
P]US\W[OUW\UQ]cY
AS\Rcag]c`^WQbc`SaO\Rg]c
Q]cZReW\O\3O`bV3f^Z]`S`
aV]cZRS`POUT`][<ObW]\OZ
5S]U`O^VWQBVSPOUeVWQVWa
[ORST`][VS[^VOaOeWRS
aV]cZRS`ab`O^WaRSaWU\SRb]
V]ZRO\R^`]bSQbOa[OZZ2A:@
]`Q][^OQbQO[S`OO\RWa
eObS``SaWabO\b

> 
:CA

3OQVTSObc`SR
`SORS``SQSWdSa

#

6]eb]acP[Wb
W[OUSab]5OZZS`g

>ZSOaSaSSbVS·AS\Rca
g]c`^WQbc`Sa¸aSQbW]\]\
^OUS!T]`RSbOWZa]`
dWaWbeeeO[ObSc`
^V]b]U`O^VS`Q]cY
O^UOZZS`g

acPaQ`WPS&"#$%$%%%& 

8O\cO`g 7eeeO[ObSc`^V]b]U`O^VS`Q]cY7!

www.storemags.com & www.fantamag.com

:IRMGI-XEP]
,IRVM'EVXMIV&VIWWSR
EXXLI'EWMRS:IRMIV
JSVLMWI\LMFMXMSRSJ
HVE[MRKW

www.
ww
w.st
w.
stor
st
oremags.co
or
com
m & ww
www.
w.fa
fant
fa
ntam
nt
amag
ag.c
ag
.com
.c
om

71=<71>6=B=5@/>63@

6S\`W1O`bWS`0`Saa]\
6S\`W1O`bWS`0`Saa]\Wa]\S]TbVSU`SObSabO\R[]ab
W\ÀcS\bWOZ^V]b]U`O^VS`aW\bVSVWab]`g]TbVS[SRWc[
2OdWR1ZO`YZ]]YaObVWaZ]\UO\RSdS\bTcZZWTS

© HENRI CARTIER-BRESSON/MAGNUM PHOTOS 

'& "

= 4  > 6 =B= 5 @ / > 6 G

8LI:EVHITEVXQIRX
,]rVIW*VERGI

E
© MARTINE FRANCK/MAGNUM PHOTOS

,)2,IRVM'EVXMIV
&VIWWSRTYFPMWLIH
LMWFSSO8LI(IGMWMZI
1SQIRXMRLIGSRWSPMHEXIH
ERMRXIVREXMSREPVITYXEXMSRJSVLMW
[SVOERHTSTYPEVMWIHLMWHMWXMRGXMZI
ETTVSEGLXSTLSXSKVETL]8LIFSSO
MRXVSHYGIHLMWMHIESJTLSXSKVETLW
GETXYVMRKEWMRKPIWMKRMÁGERXERH
·HIGMWMZI¸QSQIRX[LMGLLIHIWGVMFIH
EW·XLIWMQYPXERISYWVIGSKRMXMSR
MREJVEGXMSRSJEWIGSRHSJXLI
WMKRMÁGERGISJERIZIRXEW[IPPEWXLI
TVIGMWISVKERMWEXMSRSJJSVQW[LMGL
KMZIWXLEXIZIRXMXWTVSTIVI\TVIWWMSR¸
(YVMRKLMWPSRKERHTVSPMÁGGEVIIV

acPaQ`WPS&"#$%$%%%&

'EVXMIV&VIWWSRYWIHXLMWETTVSEGLXS
VIGSVHERHMRXIVTVIXXLI[SVPHEVSYRH
LMQMRWSGMEPHSGYQIRXEV]TSVXVEMX
ERHPERHWGETI[SVO,IXVEZIPPIH
[MHIP]SJXIRVIGSVHMRKGSYRXVMIWEX
WMKRMÁGERXQSQIRXWMRXLIMVLMWXSV]
ERHLMW[SVOYPXMQEXIP]GLVSRMGPIWXLI 
XLGIRXYV]QSVIXLSVSYKLP]XLER
ER]SXLIVTLSXSKVETLIV
,MWI\XVESVHMREV]PMJILEHEJSVXYREXI
FIKMRRMRK'EVXMIV&VIWWSR[EW
FSVRMRXSSRISJ*VERGI¸W[IEPXLMIWX
JEQMPMIW[LMGLLEHQEHIMXWJSVXYRI
MRXLIGSXXSRMRHYWXV]ERHIQTPS]IH
LYRHVIHWSJ[SVOIVWMRMXWJEGXSVMIW
%JXIVGSQTPIXMRKLMWIHYGEXMSRMX

[SYPHLEZIFIIRIEW]JSVLMQXS
NSMRXLIJEQMP]FYWMRIWWFYX'EVXMIV
&VIWWSRLEHSXLIVMHIEW,ILEH
HIZIPSTIHEPSZISJEVXJVSQERIEVP]
EKIERH[LIRLI[EWLIWXYHMIH
[MXLXLI'YFMWXTEMRXIV%RHVq0LSXI
'EVXMIV&VIWWSRPEXIVGEQI
YRHIVXLIMRÂYIRGISJXLI7YVVIEPMWX
QSZIQIRXXLEXW[ITXXLVSYKLXLIEVX
[SVPHMRXLIQMHWFYXWXVYKKPIH
XSVIEPMWILMWEQFMXMSRWEWETEMRXIV
ERHPEXIVHIWXVS]IHQSWXSJLMWIEVP]
GERZEWIW%JXIVREXMSREPWIVZMGIMR
XLI*VIRGLEVQ]MRLIWE[E
TLSXSKVETLF]1EVXMR1YROEGWMXLEX
WLS[IHXLVII%JVMGERFS]WVYRRMRK

MRXSXLI[EZIWEX0EOI8ERKER]MOE
-XLEHETVSJSYRHMRÂYIRGISR
LMQ·-WYHHIRP]YRHIVWXSSHXLEX
TLSXSKVETL]GERÁ\IXIVRMX]MRE
QSQIRX¸LIPEXIVWEMH·8LIVIMW
WYGLMRXIRWMX]MRXLMWMQEKIWYGL
WTSRXERIMX]WYGLNSMIHIZMZVIWYGL
QMVEGYPSYWRIWWXLEXIZIRXSHE]MX
WXMPPFS[PWQISZIV¸
,IFSYKLXE0IMGEERHTEMRXIH
EPPXLIQIXEPPMGTEVXWFPEGOXSQEOI
MXPIWWRSXMGIEFPI;MXLXLMWUYMIXERH
YRSFXVYWMZIGEQIVELI
IQFEVOIHSRERI[PMJI
EWETLSXSKVETLIV·-X
FIGEQIXLII\XIRWMSR 

8O\cO`g 7eeeO[ObSc`^V]b]U`O^VS`Q]cY7!!

www.storemags.com & www.fantamag.com

7Q]\a]T>V]b]U`O^Vg6S\`W1O`bWS`0`Saa]\

© HENRI CARTIER-BRESSON/MAGNUM PHOTOS

= 4  > 6 =B= 5 @ / > 6 G

2SQWaWdS[][S\ba 
'& 0]`\Ob1VO\bSZ]c^

ASW\SSb;O`\S4`O\QS 

' ! 0SUW\aVWaZWTSZ]\UZ]dS
]T^OW\bW\U6SZObS`
abcRWSac\RS`1cPWab
O`bWab/\R`S:V]bS 

' & ' /bbS\RabVSC\WdS`aWbg

%]SYRK&IPKMER[SQER
ERH+IWXETSMRJSVQIVMW
MHIRXMÁIHEWWLIXVMIWXS
LMHIMREGVS[HEXEXVERWMX
GEQTJSVVIJYKIIWERH
43;WPMFIVEXIHF]XLI
7SZMIXEVQ]

]T1O[P`WRUSeVS`S
VSabcRWSa3\UZWaVO`b
O\RZWbS`Obc`S 

'! 2]Sa[O\ROb]`g
\ObW]\OZaS`dWQSW\
bVS4`S\QVO`[g 

'! 7\a^W`SRPgO
SJQ]I]IERH-LEZI
RIZIVFIIRWITEVEXIH
JVSQMX¸LIPEXIV[VSXI
-RXLI]IEVWXLEXJSPPS[IH
LIXVEZIPPIHI\XIRWMZIP]ERHUYMGOP]
FYMPXERMQTVIWWMZIFSH]SJ[SVO
,IEPWS[SVOIHMRÁPQQEOMRK
EWWMWXMRKXLI*VIRGLHMVIGXSV.IER
6IRSMVSRX[SSJLMWÁPQW
'EVXMIV&VIWWSRNSMRIHXLI*VIRGL
EVQ]EXXLISYXFVIEOSJXLI7IGSRH
;SVPH;EVERH[EWGETXYVIHF]
+IVQERXVSSTWMR.YRI,I[EW
OITXMRTVMWSRIVSJ[EVGEQTW[LIVI
LI[EWJSVGIHXSHSLEVHPEFSYVFYX
XLVII]IEVWPEXIVLIIWGETIH,I[IRX
SRXSVIGSVHQIQSVEFPIMQEKIWSJ
XLIEJXIVQEXLSJ[EV,S[IZIVLILEH
FIIRQMWWMRKJSVWSPSRKXLEXLI[EW
[MHIP]TVIWYQIHXSFIHIEHERHXLI
1YWIYQSJ1SHIVR%VXMR2I[=SVO
LEHFIIRTVITEVMRKETSWXLYQSYW
WLS[SJLMW[SVO-RWXIEHMXFIGEQI
EVIXVSWTIGXMZII\LMFMXMSRGIPIFVEXMRK
LMW[SVO[LMGLSTIRIHMR
-RXLIWEQI]IEVXSKIXLIV[MXL
JIPPS[TLSXSKVETLIVW6SFIVX'ETE
(EZMH·'LMQ¸7I]QSYV+ISVKI6SHKIV
ERH;MPPMEQ:ERHMZIVX'EVXMIV
&VIWWSRJSYRHIHXLI1EKRYQ4LSXSW
EKIRG]EGSSTIVEXMZIS[RIHF]MXW
QIQFIVW-RXLI]IEVWXLEXJSPPS[IH
LIKEMRIHMRXIVREXMSREPVIGSKRMXMSR
JSVLMWTLSXSKVETLWSJXLIJYRIVEPSJ
+ERHLM 'EVXMIV&VIWWSRLEHQIX
LMQPIWWXLERERLSYVFIJSVILI[EW
EWWEWWMREXIH ERHXLIGMZMP[EVMR'LMRE
-RXLIFSSO8LI(IGMWMZI
1SQIRX[EWTYFPMWLIH MXW*VIRGL
XMXPI[EW-QEKIWkPE7EYZIXXIPMXIVEPP]
XVERWPEXIHEW·-QEKIWSRXLI6YR¸ -X
[EWEVIXVSWTIGXMZISJLMW[SVOXSHEXI

ERHHIQSRWXVEXIH'EVXMIV&VIWWSR¸W
XEPIRXJSVGVIEXMRKMRWMKLXJYPMQEKIW
XLEXJYWIHEVE^SVWLEVTWIRWISJ
XMQMRK[MXLEREXYVEPERHWIIQMRKP]
IJJSVXPIWWEFMPMX]JSVGSQTSWMXMSR
-RXLIFSSO¸WMRXVSHYGXMSRLIZMZMHP]
HIWGVMFIHXLIGSQTYPWMSRXLEXHVSZI
LMW[SVO·-TVS[PIHXLIWXVIIXWEPPHE]
JIIPMRKZIV]WXVYRKYTERHVIEH]XS
TSYRGIHIXIVQMRIHXSµXVET¶PMJI³XS
TVIWIVZIPMJIMRXLIEGXSJPMZMRK¸LI
[VSXI·%FSZIEPP-GVEZIHXSWIM^IXLI
[LSPIIWWIRGIMRXLIGSRÁRIWSJSRI
WMRKPITLSXSKVETLSJWSQIWMXYEXMSR
XLEX[EWMRXLITVSGIWWSJYRVSPPMRK
MXWIPJFIJSVIQ]I]IW¸
'EVXMIV&VIWWSRGSRXMRYIHXS
XVEZIP[MHIP]MRXLIWERH¸W
TLSXSKVETLMRKMR'LMRE1I\MGS'YFE
.ETER-RHMEERH6YWWME,S[IZIVMR 
LIIRHIHLMWTLSXSNSYVREPMWXMG
[SVO[MXL1EKRYQTVIJIVVMRKXS
GSRGIRXVEXISRPERHWGETIWERH
TSVXVEMXW,ITLSXSKVETLIHPIWW
ERHPIWWJVIUYIRXP]ERHEPXLSYKL
LIRIZIVKEZIYTXLIGEQIVEIRXMVIP]
LIVIXYVRIHQSVIXSHVE[MRKERH
TEMRXMRKMRLMWPEXIV]IEVW
-RMREWWSGMEXMSR[MXLLMW
[MJIERHHEYKLXIVLIFIKERQEOMRK
TPERWJSVXLI,IRVM'EVXMIV&VIWWSR
*SYRHEXMSR-XSTIRIHMR4EVMW
MRERHRS[LSYWIWLMW
EVGLMZI'EVXMIV&VIWWSRWXEXIH
XLEXMXWLSYPHFI·RIMXLIVQYWIYQ
RSVQEYWSPIYQ¸ERHWLSYPHEPWS
TVSZMHII\LMFMXMSRWTEGIJSVSXLIV
TLSXSKVETLIVW¸[SVO8LIJSPPS[MRK
]IEVLIHMIHEXXLIEKISJ
'EVXMIV&VIWWSR¸WPIKEG]LS[IZIV
PMZIWSR,MWI\XIRWMZIFSH]SJ
[SVOLEWMRÂYIRGIHKIRIVEXMSRWSJ

TLSXSKVETLIVWERHLIPTIHIWXEFPMWL
QSHIVRTLSXSNSYVREPMWQRSXNYWX
EWEQIERWSJHSGYQIRXMRKIZIRXW
FYXEPWSEWEVIGSKRMWEFPIEVXJSVQMR
MXWIPJ·8EOMRKTLSXSKVETLW¸LI[VSXI
·MWEQIERWSJYRHIVWXERHMRK[LMGL
GERRSXFIWITEVEXIHJVSQSXLIV
QIERWSJZMWYEPI\TVIWWMSR-XMWE
[E]SJWLSYXMRKSJJVIIMRKSRIWIPJ
RSXSJTVSZMRKSVEWWIVXMRKSRI¸W
S[RSVMKMREPMX]-XMWE[E]SJPMJI¸/>

@SQ][[S\RSR

0]]Ya 

BVS`SO`S^`]POPZg[]`SP]]YaOP]cb6S\`W

1O`bWS`0`Saa]\bVO\O\g]bVS`^V]b]U`O^VS`
/[]\UbVSPSabWa6S\`W1O`bWS`0`Saa]\(BVS
;O\BVS7[OUSO\RBVSE]`ZRPg>SbS`5OZOaaW
O\R>VWZW^^S/`POWhO`BVS`SQS\bZg^cPZWaVSR
6S\`W1O`bWS`0`Saa]\Pg1Z{[S\b1V{`]cf
^cPZWaVSRPgBVO[Sa6cRa]\^`]dWRSaO
^]QYSbaWhSRW\b`]RcQbW]\b]bVS^V]b]U`O^VS`
O\RVWae]`Y

ESPaWbSa
BVSeSPaWbST]`bVS1O`bWS`0`Saa]\

4]c\RObW]\eeeVS\`WQO`bWS`P`Saa]\
]`UQ]\bOW\aW\bS`SabW\UPW]U`O^VWQOZ
W\T]`[ObW]\W\QZcRW\UORSbOWZSRPWPZW]U`O^Vg
O\R¿Z[]U`O^Vg<c[S`]caW[OUSa^Zca
PW]U`O^VWQOZ[ObS`WOZQO\OZa]PST]c\R
]\eee[OU\c[^V]b]aQ][;]`ScaSTcZ
W\T]`[ObW]\^ZcaZW\Yab][O\g[]`SeSPaWbSa
QO\PST]c\R]\eeeeWYW^SRWO]`U

!"7eeeO[ObSc`^V]b]U`O^VS`Q]cY7 8O\cO`g 

www.storemags.com & www.fantamag.com

^V]b]U`O^VPg;O`bW\
;c\YOQaWVSbOYSac^
^V]b]U`O^Vg 

'!! 4W`ab^V]b]U`O^VWQ

SfVWPWbW]\ObbVS
8cZWO\:Sdg5OZZS`g
W\<SeG]`Y 

'" 1O^bc`SRPgbVS

5S`[O\O`[gO\R
PSQ][SaO^`Wa]\S`]T
eO`6SSaQO^SaObbVS
bVW`RObbS[^bbV`SS
gSO`aZObS` 

'"% @Sb`]a^SQbWdS

SfVWPWbW]\ObbVS
;caSc[]T;]RS`\/`b
1]T]c\RabVS;OU\c[
>V]b]aOUS\Qg 

'# >cPZWaVSaVWaP]]Y

BVS2SQWaWdS;][S\b 

'$$ BS`[W\ObSaVWaOQbWdS
`]ZSeWbV;OU\c[
^V]b]a 

'% ;O``WSaTSZZ]e

^V]b]U`O^VS`;O`bW\S
4`O\QYBVSW`ROcUVbS`
;{ZO\WSWaP]`\W\'% 

! B]USbVS`eWbVVWaeWTS
O\RROcUVbS`Q`SObSa
bVS6S\`W1O`bWS`
0`Saa]\4]c\RObW]\
W\>O`Wa 

" 2WSaW\;]\bXcabW\
>`]dS\QS4`O\QS
OUSR'#

acPaQ`WPS&"#$%$%%%&

«clikpic»
Websites for photographers

Now you can have a professionally
designed website for just £35 p.a.
Clikpic is an easy-to-use service for photographers who want
a website without the cost and hassle of setting one up.

With minimal technical expertise required, you can use our
online admin system and a wide choice of template
designs to create and edit your own web site quickly,
easily and very cost-effectively.
or change your site whenever you want and as often
• Update
as you like.
• Have as many pages as you like, in a variety of formats.
of style features and options to customise your site
• Dozens
and give it your own feel and look.

up to PayPal or Google Checkout to sell your prints online • Link
you can even have a shopping basket facility within your web site.
to have your own domain name for an extra £6 p.a. (or if you
• Opt
already have one, link it to your Clikpic site at no extra cost).

Many more features
We are continually adding features to the system, usually at no
extra cost. Here are some of the additional things you can do
with your website, all within the £35 price band. Many more
features are available and there are many more to come!

» Add a slideshow on your homepage.
» Add a guest book.
» Receive enquiries through the contact form.
» Create a calendar, blog or an events diary.
» Add your own logo.
» Change design styles whenever you want.
» Use the free stats service provided.
» Image watermarking facility.
» Create links pages.
Price list: £35 pa allows up to 100 images; £50 pa up to 200; £80 pa up to 500;
£180 pa up to 2,000. Discounts available for longer-term subscriptions.
Please see the Prices section on www.clikpic.com for full details.

Visit www.clikpic.com for a FREE 7 day trial
www.storemags.com & www.fantamag.com

3f^S`bORdWQSVSZ^O\RbW^aT`][/>3RWb]`2O[WS\2S[]ZRS`
BVST]`Y
GO`W0S\]
<WY]\2!![[ 
aSQObT! 7A= #

=EVMSVMKMREPP]WIRXMRXLMWTMGXYVIJSV
XLI6IÂIGXMSRWVSYRHSJ%43=
8LI[E]LILEWYWIHLMWQQ
JPIRWLEWLEHUYMXIERMQTEGX
SRLS[XLITMGXYVIPSSOWGVIEXMRKE
ZIV]WLEPPS[HITXLSJÁIPH,ILEW
UYMXIWIRWMFP]RSXYWIHMXEFWSPYXIP]
[MHISTIREXJFIGEYWIPIRWIW
SJXIRHSR¸XTIVJSVQIWTIGMEPP][IPPEX
XLIMV[MHIWXETIVXYVI'PSWMRKMXHS[R
WPMKLXP]XSJMWIRSYKLJSV=EVMXS
EZSMHXLI[SVWXJVMRKMRKERHZMKRIXXMRK
[LMGLEVIGSQQSRTVSFPIQW[LIR
WLSSXMRKEXXLI[MHIWXWIXXMRKW
-RXEOMRKGSRXVSPSJXLIETIVXYVI
=EVMLEWEPWSFIIREFPIXSGSRXVSP
XLIHITXLSJÁIPHERHLILEWKSX
XLIJSVOERHMXWVIÂIGXMSREFWSPYXIP]
WLEVT[LMPIXLIVIWXSJXLIMQEKI
MWRMGIERHWSJX-X¸WEKVIEXMHIE
EPXLSYKLMXQEOIWQI[SRHIV[L]
LIXSSOMX7YVIP]=EVMHMHR¸XKSXSXLI
FIEGL[MXLEJSVOERHXLIMRXIRXMSRSJ
GETXYVMRKXLMWWLSXWSMXQYWXNYWXLEZI
LETTIRIH[LIRLI[EWXLIVI-X¸WXLI
WSVXSJXLMRKXLEXGER[SVOZIV][IPP
,S[IZIVXLI[LMXIHSYXEVIE
FILMRHXLIJSVO[LIVIXLIWYR
MWVIÂIGXMRKSRXLI[IXWERHMW
XSSFVMKLXERHHMWXVEGXMRK%RH
YRJSVXYREXIP]MXMWXLIÁVWXTPEGI[I
PSSO%PXLSYKLXLIFVMKLXRIWWHSIW

6]dS`Àg
:S\6OgeO`R
<WY]\1]]Z^WfA' 
!"#aSQObT#%7A=$"

6]eb]
acP[Wb
g]c`
^WQbc`Sa
AS\Rc^b]aWf^`W\baaZWRSa]`
W[OUSa]\12^ZSOaSW\QZcRSbVS
]`WUW\OZ¿ZSaT`][bVSQO[S`O
OZ]\UeWbVg]c`acP[WbbSR
dS`aW]\a]\g]c`12BSZZcaOZWbbZS
OP]cbbVS^WQbc`SaO\RWTg]cQO\
W\QZcRSRSbOWZa]TS_cW^[S\bcaSR
O\RSf^]ac`SaSbbW\Ua
AS\Rg]c`^V]b]U`O^Vab]
·/^^`OWaOZ¸Ob]c`cacOZORR`Saa 
aSS^OUS!>ZSOaSS\QZ]aS
O\A/3WTg]ce]cZRZWYSbVS[
`Sbc`\SR

0IRMWEQEREJXIVQ]S[RLIEVXLI
PSZIWTLSXSKVETLMRKMRWIGXWERHLI
VMKLXP]TSMRXWSYXXLEXMX¸WEFMXSJE
[EMXMRKKEQI)ZIV]XMQILIKIXWGPSWI
XSXLIQLIWE]WXLI]Â]SJJMRWXIEH
]SYLEZIXSWXE][LIVI]SYEVIERH
[EMXJSVXLIQXSVIXYVR
8LMWMWERI\GIPPIRXXMTJSVQEGVS
TLSXSKVETL]WIX]SYVWIPJYT[LIVI
]SYXLMROXLIMRWIGXWEVIKSMRKXSFI
ERH[EMXJSVXLIQ-XGERFIJVYWXVEXMRK
EWXLI]WIIQXSETTIEVIZIV][LIVI
ETEVXJVSQ[LIVI]SYEVI,S[IZIV
MJ]SYTMGOYT]SYVGEQIVEERHQSZI
]SYGERKYEVERXIIXLI]¸PPHMWETTIEV
JVSQXLIVIXSSERH]SY¸PPIRHYT
GLEWMRKXLIQEVSYRHXLIKEVHIR
7TMHIVWEPXLSYKLRSXMRWIGXWEVIXLI
I\GITXMSREWXLI]XIRHXSMKRSVIYW
3JXLIQER]MQEKIW0IRLEWWIRX
MR-¸ZIGLSWIRXLMWWLSXSJELSZIVÂ]
TIVGLIHSREÁRKIVFIGEYWIXLI
MRGPYWMSRSJXLIÁRKIVKMZIWXLIMQEKI
EKVIEXWIRWISJWGEPI3JXIR[IWII
MQEKIWSJMRWIGXWSRÂS[IVWERH

IQTLEWMWIXLIJSVO¸WWMPLSYIXXI[LMGL
MWXLIWYFNIGXMXKMZIWXLIMQTVIWWMSR
XLEXXLITMGXYVILEWRSXFIIRGVEJXIH
EWGEVIJYPP]EWMXQMKLXLEZIFIIR
FIGEYWI]SY[SYPHR¸XRSVQEPP]TPER
XSLEZIWYGLEPEVKIEVIESJXLIWGIRI
GSQTPIXIP][LMXIHSYX8LIWSPYXMSR
XSXLMWTVSFPIQMWXSYWIEVIÂIGXSV
[LMGL[MPPPMJXXLII\TSWYVISRXLIJSVO
ERHEPPS[=EVMXSYWIEWLSVXIVWLYXXIV

WTIIHXSGETXYVIEPMXXPIQSVIXSREP
HIXEMPMRXLIFEGOKVSYRH;IWLSYPHR¸X
XV]XSMRGVIEWIXLIEQSYRXSJTL]WMGEP
HIXEMPMRXLISFNIGXEW=EVMLEWGLSWIR
LMWHITXLSJÁIPHGEVIJYPP]FYXQSVI
XSREPMRJSVQEXMSR[SYPHVIEPP]QEOIE
HMJJIVIRGI'LIGOXLILMWXSKVEQERH
SZIVI\TSWYVI[EVRMRKW³XLIWI[MPP
LIPT]SYQEREKIXLIFVMKLXRIWWSJ
XLIWGIRI[LMPI]SYEVIWLSSXMRKMX

PIEZIWFYX]SY¸VIRIZIVVIEPP]WYVI
LS[FMKXLSWIÂS[IVWERHPIEZIWEVI
%W[IEPPORS[LS[FMKEÁRKIVMW[I
GERYRHIVWXERHXLIWM^ISJXLIMRWIGX
8LMWMWEVIEPP]WLEVT[IPPXEOIR
WLSXEPXLSYKLXLILSZIVÂ]MWTIVLETW
EFMXWQEPPMRXLIJVEQI;LEX¸W
EQE^MRKXLSYKLMWXLEX0IRXSSO
XLMWYWMRKEHMKMXEPGSQTEGXGEQIVE
[LMGLVIEPP]WLS[WLS[KVIEXHMKMXEP
GSQTEGXWEVIJSVQEGVSTLSXSKVETL]
8LMWMWFIGEYWIXLI]EVIEFPIXSJSGYW
WSGPSWIXSXLIWYFNIGX
8LMWMWEKVIEXWLSXXEOIRMRJYPP
WYRPMKLXERHRMGIP]PMXFYX[LMPIXLI
MRWIGXMWTIVJIGXP]I\TSWIHERHXLI
FEGOKVSYRHLEWIRSYKLHIXEMPERH
GSPSYVXSGVIEXIMRXIVIWX[MXLSYXFIMRK
HMWXVEGXMRKTEVXWSJXLIÁRKIVLEZI
FYVRXSYX8LIVIMWTVSFEFP]RSXQYGL
0IRGSYPHLEZIHSRIEXXLIXMQI
EPXLSYKLEKSSHXMT[SYPHFIXSYWI
EHMJJYWIVPMOIXLISRI[IKEZIE[E]
MR%47ITXIQFIVFIX[IIR
XLIWYRERHXLIMRWIGX8LMWQEOIWXLI
PMKLXWSJXIVERHVIHYGIWXLIGSRXVEWX
ERHMX[SYPHLEZIXEOIRXLIIHKI
SJJXLILMKLPMKLXWSRXLIÁRKIV8LMW
WLSYPHR¸XXEOIE[E]JVSQXLIJEGXXLEX
XLIMRWIGXPSSOWJERXEWXMGXLSYKLERH
XLEXMX¸WE[IPPXEOIRTMGXYVI

!$7eeeO[ObSc`^V]b]U`O^VS`Q]cY7 8O\cO`g 

www.storemags.com & www.fantamag.com

acPaQ`WPS&"#$%$%%%&

ASSg]c` 2O[WS\¸a^WQbc`S]TbVSeSSYeW\aO#8Saa]^a
ab]`Sd]cQVS`BVSbe]`c\\S`ac^SOQVeW\
#d]cQVS`b]a^S\R]\^V]b]P]]YaT`][
^WQbc`Sa O8Saa]^a¸]\ZW\SaS`dWQSObeeeXSaa]^aQ][
W\^`W\b C9`SaWRS\ba]\Zg

:]\Sb`SS
2OeWR@]YWbO
1O\]\3=A"2 [[ 
#aSQObT#$7A="

%QE^MRKP](E[MHWE]WLISRP]WXEVXIH
XEOMRKTMGXYVIWMR.ERYEV]PEWX]IEV-
XLMROXLEXQSWXFIKMRRIVWMJ[IGER
GEPP(E[MHXLEX[SYPHRSXFSXLIVXSKS
SYXSREQMWX]HE]FIGEYWIMX[SYPHR¸X
PSSOPMOIXLIWSVXSJ[IEXLIVXLEXMW
GSRHYGMZIXSEKSSHTMGXYVI(E[MH
HMHXLSYKLERHLI¸WFIIREFPIXS
GETXYVIEVIEPP]RMGIWGIRI
;LEX-PMOIEFSYXXLMWWLSXMWMXW
GSQTSWMXMSR[LMGLLEWFIIRZIV]
GEVIJYPP]TYXXSKIXLIV³EPPLIPTIHF]
XLIQMWX[LMGLWIVZIWXSWITEVEXIXLI
JSVIKVSYRHJVSQXLIFEGOKVSYRH8LMW
MWETMGXYVIXLEXVIEPP]GSRJSVQWXSXLI
6YPISJ8LMVHWERHMXHSIWMX[IPP
;LMPIXLIXVIIMWE[E]XSXLIPIJX
LERHWMHISJXLIMQEKI(E[MHLEW
KMZIRMXIRSYKLWTEGIIZIRJYVXLIVXS
XLIPIJXJSVMXXSWMXGSQJSVXEFP][MXLMR
XLIJVEQIERHXLEX¸WZIV]MQTSVXERX
%PWSXLILSVM^SRGYVZIWEVSYRHMR
XLIJVEQIERHWTPMXWMXMRXSEXLMVHSR
XLILSVM^SRXEPERHMWEKEMRRMGIERH
GSQJSVXEFPI%PXLSYKLXLIPEVKITEXGL
SJWO]GSYPHLEZIXYVRIH[LMXIMXLEW
RSXERHMXLIPTWXSIQTLEWMWIXLI
acPaQ`WPS&"#$%$%%%&

WIRWISJQMWXMRXLITMGXYVI
-XMWEP[E]WXIQTXMRKXSXYVRYTXLI
GSRXVEWXSJXLIWITMGXYVIWEFMXXSS
QYGLMRTSWXTVSGIWWMRKFYXMX[EW
XLIREXYVEPP]PS[GSRXVEWXSJXLMWQMWX]
WGIRIXLEXLIPTIHEXXVEGX(E[MHXS
MX8LEXMWSJXIRJSVKSXXIRSRGIXLI
TMGXYVIVIEGLIWXLIGSQTYXIV,EZMRK
WEMHXLEXXLSYKL(E[MHLEWEGXYEPP]
PIJXLMWGSRXVEWXEPMXXPIXSSÂEXWS-
LEZIQEHIEX[IEOXSXLIQMHXSRIW
MR4LSXSWLSTYWMRK'YVZIWERH0IZIPW
[LIVI-SRP]QSZIHXLIFPEGOERH
QMHHPIWPMHIVWWPMKLXP] XSFYMPHMREPMXXPI
FMXSJWITEVEXMSRFYX[MXLSYXPIXXMRK
XLSWIZIV]PMKLXKVI]WXYVR[LMXI
8LIVIIHWMRXLIJSVIKVSYRHEVIE
PSZIP]XSYGLGVIEXMRKPE]IVWXLEXPIEH
YWVMKLXYTXSXLIWXSRI[EPP%W]SY
PSSOEPSRKXLI[EPP]SYGERNYWXWII
EÁKYVI[EPOMRKXLIVIMX¸WXLIWSVX
SJHIXEMP]SYQMKLXRSXRSXMGIEXÁVWX
KPERGIFYXMXWLS[WXLEXXLIQSVI
]SYPSSOEXWSQIXLMRKXLIQSVI
]SYKIXSYXSJMX
8LMWMWXLIOMRHSJTMGXYVIXLEX[SYPH
PSSOZIV]RMGIFPS[RYTERHLERKMRK
SRXLI[EPP)ZIRXLSYKL-¸ZIQEHI
WSQIWPMKLXGSRXVEWXEHNYWXQIRXWEPP
GVIHMXWLSYPHKSXS(E[MH,IWTSXXIH
XLIWGIRIGSQTSWIHMXERHI\TSWIH
MX,IHMHZIV][IPPERHXLEX¸W[L]XLMW
MWQ]TMGXYVISJXLI[IIO 

8O\cO`g 7eeeO[ObSc`^V]b]U`O^VS`Q]cY7!%

www.storemags.com & www.fantamag.com

www.storemags.com & www.fantamag.com

BSabPS\QV

2SRWQObSRb]bV]`]cUV^`]RcQbbSabW\U

4]`bVQ][W\UbSaba

7\bVS\SfbTSe[]\bVa/>V]^Sab]`c\bVS
T]ZZ]eW\US_cW^[S\bbV`]cUVbVS[]ab
`WU]`]cabSabW\U^`]QSRc`SaW\bVSW\Rcab`g¬
A]\g
1O\]\
@WQ]V
1O\]\
>S\bOf

/Z^VO&#
>]eS`AV]bA'
5F@
3=A%2da
9%

acPaQ`WPS&"#$%$%%%&

8O\
8O\
8O\

ESZQ][Sb]]c`bSab`SdWSeaO\RORdWQSaSQbW]\
=dS`bVS\SfbTSe^OUSaeSeWZZ^`SaS\bbVWaeSSY¸a
S_cW^[S\bbSaba`SORS`_cSabW]\aO\RbSQV\W_cS^]W\bS`a

=c`
UcO`O\bSS
b]g]c
/ZZ]c`bSabaO`SQ]\RcQbSRPg^S]^ZSeV]
c\RS`abO\RbVS^`]RcQbO`SOOaeSZZOa
^V]b]U`O^VgESOW[b]RWaQ]dS`O\g
aV]`bQ][W\UaOaeSZZOa¿\RW\UbV]aS
Oa^SQbabVObRSaS`dS^`OWaS/ZZ]c`
bSabaO`SbV]`]cUVV]\Sab
O\RW\RS^S\RS\b

:Oab]ZWbSBWZbVSOR
ÀOaVP`OQYSb
 ''

%WMXMWQEHISJQIXEPXLI0EWXSPMXI8MPXLIEHÂEWLFVEGOIXLEWJEVQSVI
WXVIRKXLXLERGLIETIVTPEWXMGFVEGOIXW*IEXYVMRKEREHNYWXEFPIPSGOMRK
WLSIQSYRXXLIFVEGOIXLSPHWEÂEWLKYRWIGYVIP]
8LIFVEGOIXLEWEWTMKSXEXXLIFSXXSQ[LMGLIREFPIWMXXSFI
QSYRXIHSREPMKLXMRKWXERH3RGIEXXEGLIHXLIXMPXMRKEGXMSREPPS[W
XLIÂEWLXSFIERKPIHYTXSFSYRGIÂEWLSJJEGIMPMRKSVHS[RXSHMVIGX
PMKLXSRXSEWYFNIGX[LMGLMWLIPTJYP[MXLRSRXMPXMRKÂEWLKYRW
%REHHMXMSREPFSRYWMWXLIPSGOEFPILSPIXLEXEPPS[WEHMJJYWMSR
YQFVIPPEXSFIEXXEGLIHXSXLIFVEGOIXQEOMRKMXYWIJYP[LIRXEOMRK
TSVXVEMXMQEKIW*SVER]TLSXSKVETLIV[MWLMRKXSWIXYTEWQEPPLSQI
WXYHMSXLI0EWXSPMXI8MPXLIEHÂEWLFVEGOIX[MPPFIE[IPGSQIEHHMXMSR
6MGLEVH7MFPI]
฀*SVQSVIMRJSVQEXMSRZMWMX[[[NSLRWSRWTLSXSTMEGSYO

/ZbV]cUV\]bQVSO^WbWa
TO`PSbbS`bVO\aW[WZO`
^ZOabWQdS`aW]\a

6O[O:32;OQ`]:WUVb
'$&'
8LIVIEVIERYQFIVSJHMJJIVIRXGMVGYPEVPMKLXWXLEXEVIHIWMKRIHXS
VIHYGIWLEHS[W[LIRXEOMRKQEGVSTLSXSKVETLW8LI,EQE0)(
1EGVS0MKLXMWHMJJIVIRXJVSQSXLIVTVSHYGXWFIGEYWIMXYWIWER
I\XIRHEFPIEVQXSTSWMXMSRXLIPMKLXWMRJVSRXSJXLIGEQIVEPIRW
8LISXLIVIRHSJXLIEVQMWEXXEGLIHXSXLIPMKLX¸WTS[IVWYTTP]
[LMGLGERFIGSRRIGXIHXSXLIGEQIVEZMEELSXWLSIQSYRX
8LVII%%%FEXXIVMIWTS[IVXLI0)(W[LMGLEVIWIXMRE
GMVGPIERHEVIHIWMKRIHXSFITPEGIHEVSYRHEGEQIVEPIRW
8LIVIEVIPS[ERHLMKLTS[IVWIXXMRKWXLEXTVSZMHIEGSRXMRYSYW
WSYVGISJPMKLXXLEXMWMHIEPJSVXEOMRKGPSWIYTQEGVSMQEKIW
8LIEVXMGYPEXIHEVQEPWSEPPS[WXLIPMKLXYRMXXSFI
TSWMXMSRIHXSXLIWMHISJXLIWYFNIGX
8LIGSPSYVXIQTIVEXYVISJXLI0)(WMWR¸XUYMXI
RIYXVEP,S[IZIV-JSYRHMX[EWIEW]XSEGLMIZIE
RMGIRIYXVEP[LMXIFEPERGIF]WIXXMRKEGEQIVE
XSMXWÂEWLWIXXMRK
8LISRP]HS[RWMHIXSXLIPMKLXMWXLEXXLI
0)(WLEZIRSHMJJYWMSR[LMGLGERVIWYPXMR
WLEHS[WETTIEVMRKEVSYRHXLISFNIGX]SYEVI
TLSXSKVETLMRK8LMWGERFIIEWMP]VIWSPZIHF]
YWMRKXVEGMRKTETIVXSQEOIEHMJJYWIVXSTPEGI
SZIVXLI0)(PMKLXW6MGLEVH7MFPI]

/dS`g\SObRSaWU\
PcbWbWa_cWbS
Sf^S\aWdS

฀*SVQSVIMRJSVQEXMSRZMWMX
[[[LEQEGSYO

8O\ 
8O\cO`g 7eeeO[ObSc`^V]b]U`O^VS`Q]cY7!'

www.storemags.com & www.fantamag.com

/>3f^ZOW\a¬2A:@DWRS]BSQV\]Z]Ug

3f^ZOW\a¬

/ZbV]cUVdWRS]bSQV\]Z]UgWaPSQ][W\U
W\Q`SOaW\UZgQ][[]\W\RWUWbOZA:@O\RVgP`WR
QO[S`OabVS¿ZST]`[ObaO\RW[OUSaaWhSa
O`SOPWb]TO[gabS`gb][O\gS\bVcaWOababWZZ
^V]b]U`O^VS`a>`]TSaaW]\OZ^V]b]U`O^VS`O\R
dWRS]^`]RcQS`DW\QS\b=ZWdS`Sf^ZOW\aOZZ

A]c\R

1ER]ZMHISIREFPIHGEQIVEWLEZIEWQEPP
QSRSQMGVSTLSRIEPXLSYKLXLMWGERTMGO
YTLERHPMRKRSMWIW7SQIEPWSLEZIE
WSGOIXJSVERI\XIVREPQMGVSTLSRI[LMGL
TVSHYGIWFIXXIVWSYRHUYEPMX]

2A:@dWRS]
bSQV\]Z]Ug
B

,)PEXIWXHIZIPSTQIRXMR
(706ERHL]FVMHGEQIVEWLEW
FIIRXLIMRXVSHYGXMSRSJ,MKL
(IÁRMXMSR ,( ZMHIS'SQTEGXHMKMXEP
GEQIVEWLEZIFIIREFPIXSGETXYVI
WLSVXZMHISGPMTWJSVWSQIXMQIEPFIMX
YWMRKEPS[IVVIWSPYXMSRSJ\
SV\TM\IPW8LIWIWM^IWEVI
QSVIXLERWYJÁGMIRXJSVTYFPMWLMRKSR
=SY8YFIFYXXLIUYEPMX]MWKIRIVEPP]
RSXWYJÁGMIRXJSVQYGLIPWI
-R2MOSRMRXVSHYGIHXLI
(XLI[SVPH¸WÁVWX(:706 (MKMXEP
:MHIS706 GEQIVEGETEFPISJ
GETXYVMRK,(ZMHIS&IJSVIXLMW
MX[EWR¸XTSWWMFPIXSGETXYVIZMHIS
YWMRKE(706GEQIVEHYIXSXLI
QMVVSV[LMGLRIIHWXSÂMTYTMRSVHIV
XSQEOIXLII\TSWYVI2S[QENSV
QERYJEGXYVIVWWYGLEW'ERSR2MOSR

3P]QTYW4EREWSRMG4IRXE\ERHWS
SREPPSJJIVERMRXIVGLERKIEFPIPIRW
GEQIVEGETEFPISJWLSSXMRK,(ZMHIS
7S[L]EHHZMHISXSEWXMPPWGEQIVE#
(:706GEQIVEW[IVIMRMXMEPP]
GSRGIMZIH[MXLXLIKVS[MRKRYQFIV
SJRI[WMXIQWSRXLIMRXIVRIXMR
QMRH³ETVIWWTLSXSKVETLIVGSYPH
FISRPSGEXMSRGETXYVMRKWXMPPWSRI
QSQIRXERHXLIRUYMGOP]W[MXGLMRK
SZIVXSGETXYVMRKZMHISJSVYWISRXLI
MRXIVRIX8LIWSGMEPTLSXSKVETLIVGER
FIGETXYVMRKWXMPPWSJE[IHHMRKERH
W[MXGLSZIVXSGETXYVIEWLSVXGPMTSJ
XLIFVMHIERHKVSSQ[EPOMRKHS[R
XLIEMWPI*VSQXLIGSRWYQIVW¸TSMRX
SJZMI[XLIKVIEXXLMRKEFSYX(:706
GEQIVEWMWXLIMVWTSRXERIMX]³MXMW
VETMHP]FIGSQMRKEGSRZIRMIRXSRI
GEQIVEHSIWMXEPPWSPYXMSR

@SQ]`RW\U
dWRS]

(:706ERHL]FVMHGEQIVEWRIIH
LMKLWTIIHQIQSV]GEVHWXSOIIT
YT[MXLXLIJEWXERHGSRXMRYSYWHEXE
XVERWJIVSJFIX[IIRERH1FW
QIKEFMXWTIVWIGSRH ,MKLIVVEXIW
[MPPTVSHYGIGPIERIVPSSOMRKZMHIS
ERH[MPPEPWSQEOIMXIEWMIVXSIHMXERH
GSPSYVGSVVIGX8LITSTYPEVGLSMGIW
EVI7(,' 7IGYVI(MKMXEP,MKL
'ETEGMX] ERH'SQTEGX*PEWL
QIQSV]GEVHW

1cS:WdSDWSe
7QSSXLEGXMSRZMHISRIIHWXSFI
GETXYVIHEXLMKLIVJVEQIVEXIWSJ 
SVJVEQIWTIVWIGSRH
,S[IZIV(706GEQIVEWGER¸XQSZI
XLIQMVVSVYTERHHS[REXXLIWIVEXIW
8SKIXEVSYRHXLITVSFPIQ(:706
GEQIVEWYWI0MZI:MI[;LIR0MZI
:MI[MWEGXMZEXIHXLIQMVVSVPSGOWYT
ERHEGSRXMRYSYWWMKREPMWJIHXSXLI
WIRWSVERH0'(WGVIIR8LIWGIRI
GERRS[FIGSRXMRYSYWP]QSRMXSVIH
ERHZMHISVIGSVHIHEXXLIWEQIXMQI
1SWX(:706GEQIVEWLEZIPMQMXIH
EYXSJSGYW[LIRMR0MZI:MI[QSHI
%RSYXSJJSGYW,(WIUYIRGIMW
VIEPP]RSX[SVXLPSSOMRKEXIWTIGMEPP]
[LIRZMI[IHSREPEVKIWGVIIR8LI
FIWX[E]SJIRWYVMRKWLEVTZMHISMW
XSTVIWIXXLIJSGYWFIJSVIW[MXGLMRK
MRXS0MZI:MI[-R0MZI:MI[]SYGER
LEPJHITVIWWXLIWLYXXIVFYXXSRXS
WIXXLIJSGYWTSMRXFYXXLMWMWRSXXLI

FIWX[E]IWTIGMEPP]MJ]SYRIIHXSXEP
EGGYVEG]3RGIVIGSVHMRKWXEVXWXLI
EYXSJSGYWXYVRWSJJ
8LIGYVVIRXXVIRHMWXSWLSSX
ZMHISYWMRKEWLEPPS[HITXLSJÁIPH
[LMGLTPEGIWXLIJSGYWSREWIPIGXMZI
TSMRX3RISJXLIQEMREHZERXEKIW
SJYWMRKE(:706GEQIVEMWMXW
EFMPMX]XSYWIEPMQMXIHHITXLSJÁIPH
IWTIGMEPP][LIRYWMRKJYPPJVEQI
(:706GEQIVEWPMOIXLI'ERSR)37 
(1EVO--SV2MOSR(7%PEVKIV
WIRWSVWM^ITVSHYGIWEWLEPPS[IV
HITXLSJÁIPHWSJSGYWLEWXSFI
EGGYVEXI8LIWQEPPIVWIRWSVWM^IW
YWIHF]GSQTEGXGEQIVEWERH
GEQGSVHIVWEVIQSVIJSVKMZMRKHYI
XSXLIMVI\XIRHIHHITXLSJÁIPH[LMGL
GERFIJVSQXLIJVSRXPIRWIPIQIRXXS
MRÁRMX]8LMWGERFIEREHZERXEKIMR
UYMGOKVEFWMXYEXMSRWFYXPIEZIWZIV]
PMXXPIWGSTIJSVGVIEXMZITVSHYGXMSRW

"7eeeO[ObSc`^V]b]U`O^VS`Q]cY7 8O\cO`g 

www.storemags.com & www.fantamag.com

3RGITVSTIVP]WIXYT
XLI7XIEHMGEQ1IVPMR
HEQTIRWER]WLEOIERH
LIPTWQEOILERHLIPH
JSSXEKIWQSSXL-XMW
IWTIGMEPP]YWIJYP[LIR
TERRMRKSVQSZMRKEPSRK
[MXLXLIWYFNIGX

acPaQ`WPS&"#$%$%%%&

2A:@DWRS]BSQV\]Z]Ug/>3f^ZOW\a¬

2A:@daQ][^OQbQO[S`Oa

7IZIVEPGSQTEGXGEQIVEWEPWSSJJIV,(ZMHISGETXYVIERHGSWXPIWWXLERE(706GEQIVEWS[LEXEVI
XLIQEMRHMJJIVIRGIW#%(706MWQSVIZIVWEXMPIEWMXSJJIVWE[MHIVERKISJMRXIVGLERKIEFPIPIRWIW[LMGL
MRXYVR[MPPKMZI]SYQSVIGVIEXMZIGSRXVSP[MXL]SYVZMHIS,S[IZIVXLIVIEVIERYQFIVSJLMKLUYEPMX]
L]FVMHGEQIVEWXLEXEPWSLEZIMRXIVGLERKIEFPIPIRWIWFYXXLIWIEVII\TIRWMZIERHEXTVIWIRXSRP]SJJIV
EPMQMXIHVERKISJPIRWIW
9RPMOIXLI2MOSR(4EREWSRMG¸W0YQM\
(1'+,MWEL]FVMHGEQIVEVEXLIVXLER
E(706FYXFSXLGERVIGSVH,(ZMHIS

AS\a]`aWhSa

'SRWYQIVGEQGSVHIVWERHGSQTEGXGEQIVEW[MXL
WQEPPWIRWSVWTVSHYGIGPMTW[MXLEKSSHHITXLSJ
ÁIPH8LMW[MPPLIPTOIITIZIV]XLMRKMRJSGYW

%QSRKSXLIVXLMRKWWIRWSVWM^ILEWER
MQTEGXYTSRMQEKIUYEPMX]ERHHITXL
SJÁIPHGSRXVSP%PXLSYKLÁPIJSVQEXW
GSQTVIWWMSRERHPIRWGLSMGIGSQIMRXS
TPE]FIXXIVUYEPMX]JSSXEKIMWKIRIVEPP]
TVSHYGIHF]GEQIVEW[MXLPEVKIVWIRWSVW
'EQIVEW[MXLWQEPPIVWIRWSVWTVSHYGI
QSVII\XIRWMZIHITXLSJÁIPHWSMXMW
LEVHIVXSWITEVEXIXLIWYFNIGXJVSQMXW
WYVVSYRHMRKW%WWLS[RSRXLIPIJXXLI
PEVKIVWIRWSVSJE(706SVL]FVMHGEQIVE
IREFPIWWLEPPS[HITXLSJÁIPH

*YPPJVEQI(706 
MRGSRWYQIVGEQGSVHIV

%47' 

MRTVSGEQGSVHIV

4WZSaWhSa

*YPPJVEQI(:706GEQIVEWGERTVSHYGIGPMTW[MXL
EWLEPPS[HITXLSJÁIPH[LMGLMWMHIEPJSVMWSPEXMRK
WYFNIGXWJVSQXLIFEGOKVSYRH,S[IZIVJSGYW
LEWXSFIEGGYVEXIEWSRP]EWQEPPTSVXMSRSJXLI
MQEKI[MPPFIWLEVT
acPaQ`WPS&"#$%$%%%&

,(QSZMIWGERSGGYT]QER]KMKEF]XIWJSVEWLSVXWIUYIRGIWSMRSVHIVXSÁXMXEPP
SREQIQSV]GEVHXLIQSZMILEWXSYWIGSQTVIWWMSRERH14)+MWETSTYPEV
GLSMGI%JSYVQMRYXIWIUYIRGIGETXYVIHMR*YPP,( \ YWMRK14)+
GSQTVIWWMSRSGGYTMIWQIKEF]XIWSJWXSVEKIWTEGI SRIKMKEF]XI 8LIWEQI
JSYVQMRYXIWIUYIRGI[MXLSYXGSQTVIWWMSRSGGYTMIWKMKEF]XIWSJWXSVEKI
7SQIGEQIVEWSJJIV%:-SV13:GETXYVI[LMGLEVIEPWSGSQTVIWWIHÁPIJSVQEXW
FYXYWIPIWWGSQTVIWWMSR8LI'ERSR)37(1EVO--VIGSVHWXS'SQTEGX*PEWL
GEVHWYWMRK5YMGO8MQI13:ÁPIW[MXLXLI,GSHIGERHYWMRKXLMWWIXXMRKXLI
WM^ISJEJSYVQMRYXIÁPIMWETTVS\MQEXIP]+&8LI4EREWSRMG0YQM\(1'+,
YWIW7(,'GEVHWERH1FW%:',(JSVQEX[LMGLMWERIJÁGMIRXGSHIGERHMR
QER]GEWIWGERSYXTIVJSVQ1FW,(:VIGSVHMRKW2MOSRYWIW%:- QSXMSR
.4)+ XSVIGSVHZMHISERHEPXLSYKLXLIGETXYVIMWWQEPPIV \ EJSYV
QMRYXIWIUYIRGISGGYTMIW1&
3RGIXLIZMHISLEWFIIRIHMXIH]SYGERWEZIXLIÁPIYWMRKHMJJIVIRXGSHIGW
8LIWIVERKIJVSQ5YMGO8MQI,14)+YRGSQTVIWWIH%:-*PEWL*MPIW;1*
(:(ERHWSSR%PPSGEXMRKXLIVMKLXEQSYRXSJGSQTVIWWMSRJSVEKMZIRHIWXMREXMSR
GERFIEHEYRXMRKXEWOFYXEWEKIRIVEPVYPIPIWWGSQTVIWWMSRIUYEPWFIXXIVUYEPMX] 
8O\cO`g 7eeeO[ObSc`^V]b]U`O^VS`Q]cY7"

www.storemags.com & www.fantamag.com

/>3f^ZOW\a¬2A:@DWRS]BSQV\]Z]Ug

@Sa]ZcbW]\O\RT]`[Oba
9RPMOIWXMPPTLSXSKVETL][LIVI[ILEZIX[SSVXLVIIÁPIX]TIW[MXL[LMGLXS
GETXYVIMQEKIW .4)+8MJJSVVE[ ZMHISGETXYVIGSQIWMRWIZIVEPJSVQEXW

4cZZ62*YPP,MKL(IÁRMXMSR
8LMWMWXLIPEVKIWXWM^IXLEXQSWX
(:706GEQIVEWSJJIV8LIJVEQI
WM^IMW\TM\IPWERH
TVSHYGIWWXYRRMRKUYEPMX][LIR
ZMI[IHSRPEVKIWGVIIRW

627XMPP,MKL(IÁRMXMSRFYXEXXLI
4ERRMRKXSSJEWX[MXLE(:706GERVIWYPXMRYTVMKLXWOI[WERHFPYVV]
JSSXEKI%WPS[TERYWMRKEXVMTSH[MPPTVSHYGIFIXXIVVIWYPXW

AV]]bW\UbSQV\W_cSa
4ERRMRKXSSJEWXEGVSWWEWXEXMGWGIRI
GERFPYVXLIMQEKISVWOI[YTVMKLXW
%WPS[TERYWMRKEWXYVH]XVMTSH
TVSHYGIWXLIFIWXVIWYPXW+IRIVEPP]
XV]XSOIITER]TERHYVEXMSRXSEFSYX
WIZIRWIGSRHWEWXLMWKMZIWXLIZMI[IV
XMQIXSXEOIMRXLIWGIRIERHWLSYPH
IPMQMREXIER]FPYV
%YXSI\TSWYVIGSRXMRYIWXSSTIVEXI
[LMPIVIGSVHMRK8LMWQE]FIWIIR
EWEKSSHXLMRKFYXER]GLERKIWMR
I\TSWYVIHYVMRKEGPMTGERFIZIV]
RSXMGIEFPI-X¸WFIXXIVXSPSGOXLI
I\TSWYVIFIJSVIWXEVXMRKXSVIGSVH
ZMHIS-XMWEPWSIEWMIVXSGSVVIGXER]
I\TSWYVIIVVSVSRERIRXMVIGPMTXLER
XV]MRKXSGSVVIGXWQEPPWIKQIRXW
;LIRWLSSXMRKEXSVJTW
XLIWLYXXIVWTIIHQEXGLIWXLIJVEQI
VEXIXLEXMWWIGWIGSV 
WIG*SVJEWXQSXMSRXLMWGERGEYWI
WPMKLXFPYVVMRKSJXLIMQEKI+IRIVEPP]
]SYWLSYPHWIPIGXEWLYXXIVWTIIHXLEX
MWX[MGIXLIJVEQIVEXI8LMWMRIJJIGX
QIERW]SYEVIYWMRKXLIGEQIVEMR
WLYXXIVTVMSVMX]QSHI,S[IZIVSRE

FVMKLXWYRR]HE]WIGSVWIG
MWRSXXLIMHIEPGLSMGIIWTIGMEPP]MJ]SY
[ERXXSYWIE[MHIETIVXYVI7IPIGXMRK
ELMKLIVWLYXXIVWTIIHMWRSXXLIFIWX
STXMSRIMXLIV*SVI\EQTPIWLSSXMRKE
WIUYIRGISJJTWQIERWXLEXIEGL
JVEQIMWI\TSWIHJSVWIG-J]SY
WIXXLIWLYXXIVWTIIHXSWE]WIG
XLIRIEGLJVEQIMWI\TSWIHJSVE
JVEGXMSRSJXLIJVEQIHYVEXMSR
[LMGLGERVIWYPXMREWXVSFMRKIJJIGXJSV
QSZMRKWYFNIGXW8LIFIWXSTXMSRMWXS
OIITXLIWLYXXIVWTIIHEWGPSWIXSXLI
JVEQIVEXIEWTSWWMFPIYWIEPS[IV-73
SVYWIRIYXVEPHIRWMX]ÁPXIVW
3RIHMWEHZERXEKISJYWMRKE(:706
GEQIVEMWXLIWLSVXVIGSVHMRKXMQIW
JSV,(ZMHIS8LIWIGERVERKIJVSQ
ÁZIQMRYXIW 2MOSR XSQMRYXIW
4EREWSRMGERH'ERSR %PXLSYKL
XLMWQE]WIIQPMQMXMRK[EXGLER]
HSGYQIRXEV]ERH]SY¸PPWIIXLEXQSWX
WLSXWEVISRP]LIPHJSVEJI[WIGSRHW
-J]SYHSRIIHPSRKIVXSVIGSVHER
IZIRXGETXYVIWIZIVEPGSRWIGYXMZI
WIUYIRGIWSJÁZISVQMRYXIW

3RWbW\U¿ZSa

-J]SY[ERXXSZMI[]SYVGPMTWWXVEMKLXE[E]]SYGSYPHWMQTP]PMROYTXLIGEQIVE
XSEHSQIWXMG8:WIXZMEXLI,(1-SYXTYX,S[IZIVMJ]SY[ERXXSIHMX]SYV
QSZMIGPMTWXLIVIEVIWIZIVEPIEW]XSYWIWXEVXYTETTPMGEXMSRWWYGLEWM1SZMI
1EG %HSFI4VIQMIVI)PIQIRXWERH'SVIP:MHIS7XYHMS<-J]SY¸VIJIIPMRK
EQFMXMSYWXEOIEPSSOEX*MREP'YX4VS 1EG %HSFI4VIQMIVI4VS'7%ZMH
7SR]:IKEW%HSFI%JXIV)JJIGXW'7ERHWSSRFYXFIE[EVIXLEXXLIWIMRZSPZI
EWXIITPIEVRMRKGYVZI

1]\QZcaW]\

-J]SYVIEPP][ERXXSTVSHYGIXLI
LMKLIWXTSWWMFPIUYEPMX]QSZMIWXLIRE
GEQGSVHIVMWGYVVIRXP]EFIXXIVSTXMSR
XLERE(:706GEQIVE,MKLUYEPMX]
GEQGSVHIVWSJJIVELMKLHIKVIISJ
MQEKIGSRXVSPMRGPYHMRKQYPXMTPI
TVSÁPIWXSQEXGLWLSSXMRKGSRHMXMSRW
EHZERGIH[LMXIFEPERGIGSRXVSPW
GSRXMRYSYWEYXSJSGYW MJ[ERXIH 
QSXSVMWIH^SSQMRKXMQIGSHI
MRZMI[ÁRHIVTVSJIWWMSREPUYEPMX]
QYPXMTPIGLERRIPEYHMSVIGSVHMRK
EFMPMX]XSW]RGLVSRMWIQYPXMTPIGEQIVEW

MRGEQIVEIJJIGXWIEWMIVLERHPMRK
IWTIGMEPP][MXLWLSYPHIVQSYRXIH
GEQGSVHIVWERHWSSR8LISRP]GEZIEX
MWXLIGSWXFIGEYWI[LIRGSQTEVIH
[MXLETVSJIWWMSREPGEQGSVHIVXLI
(:706[MRWLERHWHS[R
(:706GEQIVEWLEZIQEHIELYKI
MQTEGXFSXLJSVXLIWXMPPWTLSXSKVETLIV
ERHMRXLIQSZMIMRHYWXV];IEVIRS[
WIIMRKGVIEXMZIWLSVXQSZMIWQEHI
[MXL(:706GEQIVEWERHQER]
TVSHYGXMSRGSQTERMIWEVIYWMRKXLIWI
GEQIVEWJSVPSGEXMSR[SVO8LIVIMWRS
HSYFXXLEXXIGLRSPSK][MPPQSZISR³
[EXGLXLMWWTEGI

WQEPPIVWM^ISJ\%PXLSYKL
WQEPPIVXLER*YPP,(MXSJJIVW
SYXWXERHMRKTMGXYVIUYEPMX]

62D,MKL(IÁRMXMSR:MHISMW

YWIHSRXETIFEWIHGEQGSVHIVW
8LIJSVQEXMW\ERH
VIGSVHWEX1FW;LIRZMI[IH
XLIJVEQII\TERHWXS*YPP,( 
\ FYXFIGEYWIXLI
MQEKIMWWUYII^IHMXGERPSWI
HIÁRMXMSR

A27XERHEVH(IÁRMXMSR8LMW

JSVQEXGSRJSVQWXSXLI\
4%0 SV\ 287' JSVQEXW
1SWXQSZMI(:(WEVITVSHYGIHMR
7(8LIMQEKIJSVQEXGERFIIMXLIV 
SVXLIPEXXIVFIMRKXLI
QSWXGSQQSR

D5/:MHIS+VETLMGW

%VVE]+IRIVEPP]XLMWMWE\
ZMHISJSVQEX:+%MWKSSHJSV
IQEMPMRKZMHIS4S[IV4SMRX
TVIWIRXEXMSRW[IFZMHISERHWSSR
FYXJSVLMKLUYEPMX]ZMHIS]SYWLSYPH
FIYWMRK,(:+%EPPS[WPSRKIV
WLSSXMRKXMQIWFYXEXEVIHYGIH
UYEPMX]1SWXHMKMXEPGEQIVEWSJJIV
:+%STXMSRW

/D162%HZERGIH:MHIS

'SHIG,MKL(IÁRMXMSR8LMWMWE
W]WXIQXLEXWYTTSVXWXETIPIWW
VIGSVHMRKQIHMEERHLEWQER]
STXMSRWMRGPYHMRKMT
ERHT%:',([EWSVMKMREPP]
GSRGIMZIHJSVXLITVSHYGXMSRSJ
&PYVE]HMWGW
'YVVIRXP]EPP(:706WGETXYVI
ZMHISYWMRK4VSKVIWWMZIQSHI
8LMWQIERWXLEXIZIV]JVEQIMW
EGSQTPIXITMGXYVIERHEWWYGL
JVEQIKVEFWGERFIIEWMP]TYPPIH
JVSQEWIUYIRGIERHTVMRXIH*YPP
,(EX\WLSYPHTVSHYGI
EKSSHUYEPMX]\MRTVMRX

4]`[ObaO\RcaSa
;>35

8LMWWXERHWJSV1SZMRK
4MGXYVIW)\TIVX+VSYTERHXLIÁVWX
ZIVWMSRSJXLMWJSVQEX 14)+ [EW
GVIEXIHMREWEREYHMSERH
ZMHISGSQTVIWWMSRWXERHEVHYWIHJSV
ZMHIS'(W-R14)+GEQI
EPSRKXSHIÁRIWXERHEVHWJSVEYHMS
ZMHISERHXLIXVERWTSVXSJFVSEHGEWX
XIPIZMWMSRRIX[SVOW-X[EWEPWSYWIH
JSVXLIÁVWX(:(WERHMWWYMXEFPIJSV
YWI[MXL,(JSSXEKI%HIWMVIXS
TVSXIGXQSZMIWJVSQYREYXLSVMWIH
GST]MRKPIHXSXLIHIZIPSTQIRX
SJXLI14)+WXERHEVHMR
14)+14)+ERH, WII
FIPS[ EVIXLITVIJIVVIHJSVQEXWJSV
=SY8YFIYTPSEHW

6 $" 

8LMWTSTYPEV
GSQTVIWWMSRWXERHEVH[EWGVIEXIH
MRERHYWIW14)+4EVX 
-XETTPMIWPSWWPIWWGSQTVIWWMSR
XSQEMRXEMRLMKLMQEKIUYEPMX]ERH
MWEPWSORS[REW%HZERGIH:MHIS
'SHMRK %:' 8LMWJSVQEXMWGETEFPI
SJLERHPMRKXLI,(GSRXIRXJSYRH
SR&PYVE]HMWGWERHMWXLIJSVQEX
YWIHJSVZMHISWHS[RPSEHIH
JVSQM8YRIW%:',(MWPMOI%:'
FYX[EWHIZIPSTIHNSMRXP]F]7SR]
ERH4EREWSRMGWTIGMÁGEPP]JSV
WEZMRK,(ZMHISSRXETIPIWW
GSRWYQIVGEQGSVHIVW

" 7eeeO[ObSc`^V]b]U`O^VS`Q]cY7 8O\cO`g 

www.storemags.com & www.fantamag.com

2WdF8LI(MZ<JSVQEX

HIZIPSTIHF](MZ<-RGMWFEWIH
EVSYRH14)+4EVXFYXMXYWIW
PSWW]GSQTVIWWMSRXSQEOIXLI
ÁPIWM^IWQYGLWQEPPIV[LMPIWXMPP
VIXEMRMRKEJEMVP]LMKLPIZIPSJUYEPMX]
(MZ<QSZMIWXEOIYTEVSYRHSRI
XIRXLSJXLIWTEGISJ(:(QSZMIW
[LMGLQEOIWXLIQMHIEPP]WYMXIHJSV
QSZMIHS[RPSEHW%JYPP(MZ<QSZMI
GERYWYEPP]FIWXSVIHSREWMRKPI'(

E;D;MRHS[W1IHME:MHIS

[EWHIZIPSTIHF]1MGVSWSJXERH
MWEGSQTVIWWIHJSVQEXPEVKIP]JSV
WXVIEQMRKZMHISSZIVXLIMRXIVRIX
-XMWXLIHIJEYPXJSVQEXJSV;MRHS[W
1IHME4PE]IV

/D7 

%YHMS:MHIS-RXIVPIEZIMW
ERSPHIVPIWWGSQQSR1MGVSWSJX
HIZIPSTIHJSVQEX

?cWQYBW[S
>ZOgS`5YMGO8MQI4PE]IV

MWJVIIXSHS[RPSEHJVSQ[[[
ETTPIGSQUYMGOXMQITPE]IVERHMX
[SVOWSR;MRHS[WEW[IPPEW1EG
GSQTYXIVW%PXLSYKL5YMGO8MQILEW
MXWS[R13:JSVQEXMXMWGSQTEXMFPI
[MXL14)+14)+14)+
,;1:ERH%:-ÁPIWEW[IPP
EWQER]SXLIVW

acPaQ`WPS&"#$%$%%%&

IMPROVE YOUR PHOTOSHOP
& ELEMENTS SKILLS
Learn how to use your image-editing software – enrol today!

TO ENROL OR FOR
MORE INFORMATION
SEND THIS COUPON TO
The School of Photographic
Imaging Administrator
Blue Fin Building, 9th Floor,
110 Southwark Street, London SE1 0SU
or call 0203 148 4326
N Yes, I’d like to enrol on the Foundation

in Digital Imaging Techniques
N Please send me more details

about the courses

Now
only £195

Home Study
Course

d time only
* For a limite

The Foundation in Digital Imaging Techniques is an entry-level course for first-time users of Adobe
Photoshop, Photoshop Elements and other image-editing software programs. This is a home study
course so you are free to work at your own pace and in your spare time, and there are no classes
to attend or tests to sit. Enrol today, receive your student pack and start learning new skills!

Mr/Mrs/Ms . . . . . . . Forename . . . . . . . . . . . . .
Surname . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Address . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
......................................
......................................
......................................
......................................
Postcode . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Daytime tel number . . . . . . . . . . . . . . . . . . . .
Email . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
If you would like to receive the SPI student
E-newsletter please tick here N
HOW TO PAY: (UK RATES).
Overseas fees available on request
BY CHEQUE OR POSTAL ORDER:
Made payable to IPC Media for: N £195

Your course includes

LEARN HOW TO:
LSize

LFull colour, illustrated
LPersonal tutor

LAdjust

LWritten

and crop a digital image
tones, correct colours and convert your images to monochrome
LUse the selection tools to adjust certain areas of your images
LRemove dust and scratches from precious photos
LBanish red-eye forever
LSharpen your images
LCreate an archive to safeguard
valuable pictures

manual

feedback on the
coursework you submit
LFree kit: universal card reader,
lens brush, inkjet paper
LOffer on Photoshop CS4 Extended
L50% off an annual subscription
to Amateur Photographer or
What Digital Camera magazine
L20% off digital print
orders with PhotoBox
L20% off digital prints with Arrowfile
L10% off Jessops branded products
LOfficial course certificate on
graduating

BY CREDIT CARD:
Mastercard N Visa N
Card number . . . . . . . . . . . . . . . . . . . . . . . . . .
......................................
Issue number . . . . . . . . . . . . . . . . . . . . . . . . . .
Start date . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Expiry date . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Three-digit security number . . . . . . . . . . . . .
Signature (I am over 18)
.....................................
BY DIRECT DEBIT:
Please note, if you are paying by
Direct Debit the full cost of the
course will be £210
N Yes, please send me a bank instruction

form to deduct three monthly debits of
£70 from my account
Signature (I am over 18)
In association with
www.nikon.co.uk

Offer on
Photoshoped
CSr ex4clEusxivtee denaldwith

Ou
ents
ws our stud
Adobe allo hase CS4
to purc
*
30
£2
r
Extended fo

*This price is a special rate for those who do not qualify
as a ‘full time’ student in order to obtain a discounted
version of CS4 extended direct from Adobe.

For detailed course contents visit www.amateurphotographer.co.uk/spi and
download an information pack, or call Charlene Baker on 0203 148 4326.
www.st
stor
oremag
or
ags.
ag
s.co
s.
com
co
m & www.fant
ntam
nt
amag
am
ag.com

.....................................
If you would like to receive emails from the SPI containing
news, special offers and product and service information
and take part in research, please tick here N
Amateur Photographer, published by IPC Media (IPC),
will collect your personal information to process your
entry. IPC would like to contact you by post or telephone
to promote and ask your opinion on our products and
services. Tick here if you prefer not to hear from IPC N
IPC will occasionally pass your details to carefully selected
organisations so they can contact you by telephone or post
with regards to promoting and researching their products
and services.
Tick here if you prefer
not to be contacted N

AP SP 2 JANUARY 2010

44

| www.amateurphotographer.co.uk | 2 January 2010

www.storemags.com & www.fantamag.com

subscribe 0845 676 7778

<WY]\2!A1O[S`OBSab

<WY]\2!A

<WY]\2!A
>`]TSaaW]\OZ2A:@

EWbVO\Sfb`O]`RW\O`WZgVWUV[OfW[c[aS\aWbWdWbgO'T^aaV]]bW\U`ObS
O\R62dWRS]QO^bc`SbVS<WY]\2!AeWZZPSZ]]YSRObZcabTcZZgPg[O\g
O\O[ObSc`^V]b]U`O^VS`0cbO`SWba [WZZW]\^WfSZaabWZZS\]cUV-
@WQVO`RAWPZSg
BSQV\WQOZE`WbS`

7

23GXSFIVPEWX]IEV2MOSR
ERRSYRGIHXLIXLMVHGEQIVEMRMXW
TVSJIWWMSREP(VERKIXLI(7
%PXLSYKLMXWFSH]MWPEVKIP]YRGLERKIH
JVSQXLISVMKMREPQMPPMSRTM\IP(
ERHXLIQMPPMSRTM\IP(<MXLEW
ERI[QMPPMSRTM\IPWIRWSV8LI
QEMRFIRIÁXSJXLMWRI[WIRWSVSZIV
XLISVMKMREPSRISJXLI(MWXLEXMXGER
GETXYVIMQEKIWEXERI\XVESVHMREV]
WIRWMXMZMX]SJ-73

%PXLSYKLMXQE]WSYRHPMOIER
MRXIVKEPEGXMGWTSVXMRKIZIRXXLI
·TM\IPVEGI¸MWWSQIXLMRKXLEXMWSJXIR
XEPOIHEFSYXF]TLSXSKVETLIVW1ER]
[ERXGEQIVEWXLEXTVSHYGIWQSSXL
TMGXYVIW[MXLPMXXPIMQEKIRSMWIVEXLIV
XLERLMKLIVVIWSPYXMSRWFYXRSMWMIV
MQEKIW8LIVILEZIFIIRWMKRWSJ
QERYJEGXYVIVWEGORS[PIHKMRKXLMW
VIGIRXP]QSWXRSXEFP][MXLXLIPEYRGL
SJXLI'ERSR4S[IV7LSX+[LMGL
LEWQSVIXLERJSYVQMPPMSRJI[IV
TLSXSWMXIWXLERMXWTVIHIGIWWSVXLI
4S[IV7LSX+
7S[LMPIXLIQMPPMSRTM\IP
WIRWSVSJXLI2MOSR(7QMKLXWIIQ

EPMXXPIWTEVWI[LIRGSQTEVIHXSXLI
PMOIWSJXLIQMPPMSRTM\IP2MOSR
(<ERH7SR]%PTLEERH
SVIZIRXLIQMPPMSRTM\IP'ERSR
)37(1EVO--XLI(7MWMRJEGX
EMQIHEXEZIV]HMJJIVIRXX]TISJ
TLSXSKVETLIV
%WE[IEXLIVTVSSJLMKL
TIVJSVQERGIGEQIVE[MXLELMKL
-73WIRWMXMZMX]XLI(7MWXEVKIXIH
EXTVSJIWWMSREPTLSXSKVETLIVW[LS
VIP]SRWTIIHERHXLIEFMPMX]XS
WLSSXMRPS[PMKLX,S[IZIV
†MWEPSXXSTE]JSV
EGEQIVE[MXLNYWX
QMPPMSRTM\IPWERH-¸Q

/bOUZO\QS
L ZZW]\^WfSZ1;=AaS\a]`
L;OfW[c[aS\aWbWdWbg]T
7A= "
L6WUVRS¿\WbW]\dWRS]QO^bc`S
L'T^aaV]]bW\U`ObS
L<Se·?cWSb¸[]RS
LAb`SSb^`WQSO`]c\R" 
P]Rg]\Zg

:OPbSab

acPaQ`WPS&"#$%$%%%& 

8O\cO`g 7eeeO[ObSc`^V]b]U`O^VS`Q]cY7"#

& ww
www.
w.fa
w.
fant
fa
ntam
nt
amag
am
ag.c
.com
.c
om

1O[S`OBSab<WY]\2!A

@Sa]ZcbW]\\]WaSO\RaS\aWbWdWbg       

<]WaSOaO]T^WfSZa

=c``Sa]ZcbW]\bSabT]c\RbVObbVS<WY]\
2!A^`]RcQSRaW[WZO``SacZbab][]ab]bVS`
QO[S`OaeWbVO ZZW]\^WfSZaS\a]`
BVSQ][^`SaaW]\O\RRSTOcZb\]WaS
`SRcQbW]\VOdSOaZWUVbSTTSQb]\bVS
`Sa]ZcbW]\]T8>35W[OUSa;]`SRSbOWZ
O\RaVO`^\SaaQO\PSUOW\SRPgQO`STcZZg
ORXcabW\UbVS`Oe¿ZSaeVS`SbVS`Sa]ZcbW]\
`SOQVSaOaVWUVOa $]\]c`QVO`b
EVS\WbQ][Sab]\]WaSO\RaS\aWbWdWbg
bVS2!A`SOZZgQ][SaW\b]Wba]e\<WY]\¸a
^]ZWQg]TW[^`]dW\U]\SfWabW\UbSQV\]Z]Ug
VOaQZSO`Zg^OWR]TTO\RbVSO[]c\b]T\]WaS
Wa[W\W[OZSdS\eVS\aV]]bW\UOb7A= 
&7\QZ]aSc^W[OUSa7b]]Y]TORSS`
U`OhW\UOZZbVSVOW`a]\bVSRSS`¸aTOQSO`S
dWaWPZSO\R\]WaSWadW`bcOZZgW\dWaWPZSGSb     

,

"]\O<WY]\2!3dS\eVS\Q][^O`SR
b]bVS2!<WY]\QZOW[aO`]c\RO ab]^
W[^`]dS[S\bW\bVSO[]c\b]T\]WaSdWaWPZS
ObO\gUWdS\7A=aS\aWbWdWbg4`][eVOb7

2g\O[WQ`O\US
EWbVORg\O[WQ`O\US]T#3DbVS<WY]\
2!AWa]\O^O`eWbV[]ab]bVS`2A:@
QO[S`OaObbVSb]^S\R]TbVS[O`YSbEWbV
bVSaS\a]`^`]RcQW\UdS`gZWbbZS\]WaSOb
bVS[]abQ][[]\ZgcaSR7A=a^SSRabVS`S
Wa^ZS\bg]TÀSfWPWZWbgeVS\WbQ][Sab]
ORXcabW\UbVSP`WUVb\SaaO\RQ]\b`Oab]TO\
W[OUSeWbV]cbW\b`]RcQW\U\]WaS
/QbWdS2:WUVbW\UWaOdOWZOPZSW\bVS
2!Ab]VSZ^[OYSaVOR]eO`SOaP`WUVbS`
OZbV]cUVWbR]Sa\¸bW\Q`SOaSbVSRg\O[WQ
`O\USO\RWa`SOZZg]\ZgOQ]\b`OabQc`dS
3dS\eVS\bVSaS\aWbWdWbgWaaSbb]7A=$
O\RbVS/QbWdS2:WUVbW\UaSbb]Wba3fb`O
6WUVaSbbW\U]\ZgOVW\b]TZc[W\O\QS\]WaS
WaW\b`]RcQSR
EVS\caSRObWbaVWUVSab7A=aSbbW\Ua
bVS2!AacTTS`aO`]c\RO3DRSQ`SOaSW\
Rg\O[WQ`O\USBVWaWaUS\S`OZZgQOcaSRPg
bVS\]WaSW\bVSW[OUSabO`bW\Ub]OTTSQbbVS
VWUVZWUVbO\RaVOR]eO`SOa 

&
MRXIVIWXIHXSWII[LIXLIV
2MOSR¸WHIGMWMSRXSOIIT
XLITM\IPGSYRXEXXLMW
QSHIWXPIZIP[MPP[SVO
MRXLIGEQIVE¸WJEZSYV

4SObc`Sa

8STVSZIXLEXXLI(7MWQSVIXLER
EQIVIYTKVEHISJXLISVMKMREP(
XLIRI[GEQIVEGSQIW[MXLWSQI
WYFWXERXMEPMQTVSZIQIRXWERHRI[
JIEXYVIW8LIÁVWXSJXLIWIMWEJYPP
JVEQIQMPPMSRTM\IP'137MQEKI
WIRWSV8LI(7MWSRP]XLIJSYVXL2MOSR
(706XSJIEXYVIEJYPPJVEQIMQEKMRK
WIRWSVERHEPXLSYKLMXLEWVSYKLP]
XLIWEQIRYQFIVSJTLSXSWMXIWEWXLI
WIRWSVSJXLISVMKMREP(XLIWIRWSV
LEWFIIRGSQTPIXIP]VIHIWMKRIH
%GGSVHMRKXSEVITVIWIRXEXMZISJ2MOSR
9/MQTVSZIQIRXWLEZIFIIRQEHI

,

7A=

฀:c[W\O\QS฀฀
฀@SRQVO\\SZ
฀5`SS\QVO\\SZ
฀0ZcSQVO\\SZ

bVSW[OUSaeS`SbOYS\Ob7A=! 
CaW\UOTcZZT`O[SaS\a]`[OYSaO
U`SObRSOZ]TRWTTS`S\QS(W[OUSabOYS\
Ob7A=! Z]]YZWYSbV]aSbOYS\Ob7A=

,

VOdSaSS\eVWZSbSabW\UbVSQO[S`ObVWaWa
QS`bOW\ZgbVSQOaS 

&!

5O[cb
0`WUVb\Saa  

/R]PS''&
a@50
<WY]\2!a   

3D   

<WY]\2!A

C\RS`abO\RW\UbVSU`O^V

BVWaU`O^VaV]eabVSP`WUVb\SaadOZcSa`SQ]`RSRPgbVSbSabQO[S`OeVS\WbWacaSRb]
^V]b]U`O^VOabS^^SRU`ORcObW]\eSRUSBVSeSRUSVOab`O\a[WaaW]\dOZcSaW\» 3DabS^a
`O\UW\UT`][b] 3DBVSQO[S`O¸aSf^]ac`SWaaSba]bVS 3DaSQbW]\W\bVSeSRUSVOa
OP`WUVb\SaadOZcS]T ##A]TbeO`SO\OZgaWa]TbVSW[OUSbVS\RSbS`[W\SabVS`SQ]`RSR
P`WUVb\SaadOZcSa]TOZZbVS]bVS`abS^aO\RQOZQcZObSabVSQO[S`O¸aRg\O[WQ`O\US

XSXLIQMGVSPIRWIWSZIVIEGLTLSXSWMXI
-XMWXLIWIPIRWIWXLEXLIPTXSHMVIGX
PMKLXMRXSXLITLSXSWMXI[LMGLMRXYVR
LEWERIJJIGXSRXLIEQSYRXSJMQEKI
RSMWIKIRIVEXIH
8LIMQTVSZIQIRXWQEHIF]
2MOSRLEZIIREFPIHXLIGSQTER]
XSMRGVIEWIXLIQE\MQYQHIJEYPX
-73WIRWMXMZMX]WIXXMRKSJXLI(7
XSERMQTVIWWMZI-73
,S[IZIVQSVIMQTVIWWMZIWXMPPMW
XLIGEQIVE¸WI\XIRHIH-73VERKI
[LMGLEXMXWQE\MQYQ,MWIXXMRK
MWXLIIUYMZEPIRXSJEWXEKKIVMRK-73 
8LIWII\XVIQIWIRWMXMZMX]
WIXXMRKWEPPS[TLSXSNSYVREPMWXWXS
KIXXLITMGXYVIWXLEXTE]XLIMVFMPPW
VIKEVHPIWWSJXLIPMKLXMRKGSRHMXMSRW
8LIVIMWERIZIVMRGVIEWMRKHIQERH
JSVTLSXSNSYVREPMWXWXSWLSSXZMHIS
EPSRKWMHIXLIMVWXMPPWJSSXEKI7S

[MXLXLMWMRQMRHXLI(7MWXLIÁVWX
JYPPJVEQI2MOSR(706GETEFPISJ
VIGSVHMRKLMKLHIÁRMXMSRQSZMIW
JSSXEKI0MOIXLI%47'JSVQEX
2MOSR(7XLI(7GERVIGSVH 
\TM\IPZMHISWEXEJVEQI
VEXISJJTWEPSRK[MXLWXIVISWSYRH
ZMEERI\XIVREPQMGVSTLSRIMRTYX
-XMWXLIGSRZIVKIRGISJZMHIS
ERHXLI(7¸W-73WIRWMXMZMX]XLEXMW
TEVXMGYPEVP]MQTVIWWMZI³XLEXMWXLI
EFMPMX]XSWLSSXZMHISJSSXEKIEXER]
-73WIRWMXMZMX]YTXSERHMRGPYHMRK-73 
-ÁVWXWE[EHIQSRWXVEXMSR
SJXLMWJIEXYVIEXXLIGEQIVE¸WPEYRGL
8LIJSSXEKIWLSXF]:MRGIRX1YRMIV
[EWXEOIREXHE[RERH[EWSJX[S
FVS[RFIEVWVSEQMRKF]XLIFEROW
SJEVMZIV;LIR-TSMRXIHSYXXLEX
XLIVI[EWWXMPPZMWMFPIMQEKIRSMWISR
XLIÁPQJSSXEKI.IVIQ]+MPFIVXSJ

"$7eeeO[ObSc`^V]b]U`O^VS`Q]cY7 8O\cO`g 

www.storemags.com & www.fantamag.com

BVSQ]Z]c`UO[cb]TbVS<WY]\2!AaV]ea
WbWa^O`bWQcZO`ZgU]]ROb`S^`]RcQW\UPZcSa
O\R`SRaEVWZSbVSQO[S`OWaQO^OPZS]T
QO^bc`W\U\SO`ZgOZZbVSQ]Z]c`aeWbVW\
bVSa@50Q]Z]c`UO[cbWbWa\¸b_cWbSOPZS
b]S\Q][^OaaOZZ]TbVSU`SS\aOdOWZOPZS
BVObaOWR7RWR\¸bVOdSO\g^`]PZS[aeWbV
^O`bWQcZO`Q]Z]c`aaV]eW\UPO\RW\U

2MOSR9/WEMHXLEXEPXLSYKLXLIVI[EW
WPMKLXMQEKIRSMWIEZMHISSJXLMWX]TI
[SYPHTVIZMSYWP]LEZILEHXSLEZI
FIIRWLSXMRMRJVEVIH[LMGL[SYPH
LEZIVIWYPXIHMRXLIZMHISFIMRKMR
IMXLIVQSRSGLVSQISV[MXLEWXVSRK
KVIIRGEWX5YMXILS[XVYIXLMWMWSJ
TVSJIWWMSREPZMHISGEQIVEW-HSR¸X
ORS[FYXXLIVIWYPXW[IVIGIVXEMRP]
MQTVIWWMZI=SYGERWIIXLIZMHISF]
ZMWMXMRKLXXTXMR]GGG:K
8LILMKLPIZIPSJTIVJSVQERGI
HIQERHIHF]TVSJIWWMSREP
TLSXSKVETLIVWMWEPWSQEMRXEMRIH[MXL
XLIRMRIJVEQIWTIVWIGSRHWLSSXMRK
VEXI[LMGLMWXLIWEQIEWXLEXJSYRH
SRXLISVMKMREP(;LIRXLI(7MW
W[MXGLIHXSXLIWQEPPIV(<JSVQEX
JVEQIXLIWLSSXMRKVEXIMWMRGVIEWIH
XSJVEQIWTIVWIGSRH
%WEJYPPJVEQI QQIUYMZEPIRX 
acPaQ`WPS&"#$%$%%%&

(706GEQIVEXLI2MOSR(7MWFIWX
YWIH[MXLWXERHEVH2MOSR*QSYRX
PIRWIW-XMWGSQTEXMFPI[MXL2MOSR¸W
(<JSVQEXPIRWIWFYXXLIMQEKIEVIE
[MPPFIGVSTTIHXSXLIWEQIWM^IEW
XLEXSJE(<WIRWSVVIWYPXMRKMRMQEKIW
SJQMPPMSRTM\IPWMRVIWSPYXMSR
8LIEYXSQEXMGGVSTTMRKGERFI
XYVRIHSJJVIWYPXMRKMRJYPPVIWSPYXMSR 
QMPPMSRTM\IPMQEKIWEPXLSYKL
XLI]WYJJIVJVSQWIZIVIZMKRIXXMRK
8LI(<JSVQEXMWR¸XXLISRP]GVST
EZEMPEFPISRXLI(7%\GVSTMW
TSWWMFPIXLEXVIWYPXWMRQMPPMSR
TM\IPMQEKIW% XIRQMPPMSRTM\IP 
GVSTMWEPWSEZEMPEFPIERHXLMWJSVQEX
WLSYPHTVSZII\XVIQIP]YWIJYPJSV
TSVXVEMXTLSXSKVETLIVW
8LSWI[LSFSYKLXXLISVMKMREP(
[IVIMQTVIWWIH[MXLXLIMQEKIUYEPMX]
FYXSJXIRJSYRHXLIQWIPZIWLEZMRKXS
acPaQ`WPS&"#$%$%%%&

GPIERXLIMQEKIWIRWSV3RISJXLI
PIWWKPEQSVSYWFYXQYGLRIIHIHERH
VIUYIWXIHJIEXYVIWSJXLI(7MWMXW
MRGEQIVEWIRWSVGPIERMRK8LMWWLSYPH
RS[LIPTXSOIITWIRWSVWJVIIJVSQ
HYWX8LIGPIERMRKTVSGIWWGERFIWIX
XSSTIVEXIIZIV]XMQIXLIGEQIVEMW
XYVRIHSRSVSJJ 

'

0cWZRO\RVO\RZW\U

%WERI[IVZIVWMSRSJXLI(VEXLIV
XLERERIRXMVIP]RI[QSHIPXLIVI
MWZIV]PMXXPIHMJJIVIRGIFIX[IIRXLI
FSHMIWSJXLI((<ERH(78LI
(7JIEXYVIWX[SZIV]WPMKLXGLERKIW
8LIÁVWXSJXLIWIMWXLIEHHMXMSRSJE
HIHMGEXIHFYXXSRXSW[MXGLSR0MZI
:MI[QSHI:MHISGETXYVIMWEPWS
WXEVXIHZMEXLI0MZI:MI[QSHI 

WSMXMWMQTSVXERXXLEXXLIJIEXYVIMW
UYMGOP]ERHIEWMP]EGGIWWMFPI
8LIWIGSRHGLERKIMWIZIR
WYFXPIV8SLIPTTLSXSKVETLIVWMRGSPH
[IEXLIVXLIGYXE[E]SRXLIFEXXIV]
HSSVPEXGLLEWFIIRQEHI[MHIVXS
QEOIMXIEWMIVXSGLERKIXLIFEXXIV]
[LMPI[IEVMRKKPSZIW8LMWRI[GSZIV
LEWXLIWEQITVSHYGXGSHIEWXLI
SPHSRI &0 ERHMWGSQTEXMFPI[MXL
FSXLXLI(ERH(<
&IWMHIWXLIWIGLERKIWXLI
QEKRIWMYQEPPS]FSH]SJXLI(7MW
EPQSWXI\EGXP]XLIWEQIEWXLIIEVPMIV
X[SQSHIPW-XLEWXLIWEQIRYQFIV
SJ·3¸VMRKWERHWIEPWXSTVSXIGXXLI
GEQIVEEKEMRWXQSMWXYVIERHHYWX
VIKEVHPIWWSJXLIGSRHMXMSRW(YVMRK
XLMWXIWX-EPSRK[MXLXLI(7[EW
GEYKLXMRELIEZ]HS[RTSYVSJVEMR
ERHHIWTMXIXLIVIEVSJXLIGEQIVE   

@/E7A=$

8>357A=$ 

@/E7A= " 

8>357A=& 

8>357A= "<@=< 

@/E7A=" 

8>357A= &<@=< 

@/E7A=  

@/E7A=$" 

8>357A=! <@=< 

8>357A= 

<WY]\2!A1O[S`OBSab 

BVSaSW[OUSaaV]e% ^^W 
]\OQ][^cbS`
aQ`SS\aSQbW]\a]T
W[OUSa]TO`Sa]ZcbW]\
QVO`babWZZZWTSaQS\SO\R
OU`SgQO`RESaV]e
bVSaSQbW]\]TbVS
`Sa]ZcbW]\QVO`beVS`S
bVSQO[S`OabO`bab]TOWZ
b]`S^`]RcQSbVSZW\Sa
aS^O`ObSZgBVSVWUVS`
bVS\c[PS`dWaWPZSW\
bVSaSW[OUSabVS
PSbbS`bVSQO[S`O¸a
RSbOWZ`Sa]ZcbW]\Wa
ObbVSa^SQW¿SR
aS\aWbWdWbgaSbbW\U
BVSaSQbW]\]T
bVSabWZZZWTSW[OUS
Q]\bOW\abVSS[PZS[
]\OabO\RO`RaWhSR
[ObQVP]fBVSTcZZaQS\S
QO\PSdWSeSRObVbb^(
bW\gc`ZQ][$%aX'$

KIXXMRKWTPEWLIH[MXL[EXIVMXHMHR¸X
WYJJIVER]EHZIVWIIJJIGXW
8LIFYXXSRPE]SYXSJXLI(7
WLSYPHFIJEQMPMEVXSER]SRI[LSLEW
YWIHEVIGIRXTVSJIWWMSREPPIZIP2MOSR
(706TPYWXLIGEQIVEMWEPWSWMQMPEV
MRYWIXSXLILMKLIRHIRXLYWMEWXPIZIP
(7%QSRKXLIOI]HMJJIVIRGIW
FIX[IIRXLIFSH]SJXLI(7ERH
XLSWIQSHIPWJYVXLIVHS[R2MOSR¸W
VERKIMWXLIEHHMXMSREPWQEPP0'(EX
XLIFSXXSQSJXLIVIEVSJXLIGEQIVE
8LMWWQEPPWGVIIRHMWTPE]WXLI-73
WIRWMXMZMX]XLIMQEKIUYEPMX]ERH[LMXI
FEPERGIWIXXMRKW
%WXLI(7YWIWEPEVKI)2)0E
PMXLMYQMSRVIGLEVKIEFPIFEXXIV]
XLIFSXXSQSJXLIGEQIVE
MWPEVKIVXLERXLEXSJER
IRXLYWMEWX(706³EVSYRH
XLIWEQIWM^IEWE( 

8O\cO`g 7eeeO[ObSc`^V]b]U`O^VS`Q]cY7"%

www.storemags.com & www.fantamag.com

1O[S`OBSab<WY]\2!A

2ObO¿ZS
4]QOZ
^]W\ba
2cOZ1][^OQb4ZOaV
a]QYSba

BOYS\Ob7A=$"bVWa\WUVbaV]b]TAb>OcZ¸a1ObVSR`OZaV]eadW`bcOZZg\]aWU\]TQV`][O
\]WaSO\RdS`gZWbbZSZc[W\O\QS5WdS\bVSaS\aWbWdWbgO\RbVSZ]eZSdSZ]TZWUVbbVSO[]c\b
]TRSbOWZbVObbVS<WY]\2!AVOaPSS\OPZSb]`Sa]ZdSWadS`gW[^`SaaWdS
[MXLXLIEHHMXMSRSJEFEXXIV]
KVMT-RJEGXXLIFSXXSQSJ
XLIGEQIVEMWFYMPXPMOIE
FEXXIV]KVMTERHMRGPYHIWE
WLYXXIVVIPIEWIFYXXSRHIWMKRIHJSV
WLSSXMRKMRTSVXVEMXSVMIRXEXMSR%R
·%*3R¸FYXXSRMWEPWSWIXMRXSXLIVIEV
SJXLIGEQIVEJSVZIVXMGEPWLSSXMRK
EPXLSYKLMRTVEGXMGIMXSJXIRTVSZIHE
LMRHVERGI;LIRYWMRKXLIGEQIVEMR
SRILERHXLIÂIWL]TEVXSJQ]TEPQ
FIPS[XLIXLYQFTVIWWIHEKEMRWXXLMW
FYXXSR;LIRVIZMI[MRKMQEKIWMR
TPE]FEGOQSHIXLMWSJXIRGEYWIHXLI
EYXSJSGYWXSFIEGXMZEXIHVIXYVRMRK
XLIGEQIVEXSMXWWLSSXMRKQSHI
VIEH]XSXEOIXLIRI\XMQEKI;LIR
XLIFYXXSRMWEGGMHIRXEPP]TVIWWIH
HYVMRKZMHISGETXYVIMXMWIZIRQSVI
MRGSRZIRMIRXEWMXGEYWIWXLIJSGYW
XSWIEVGLFEGOERHJSVXL8LMW[EW
EPWSERMWWYI[MXLXLISVMKMREP(ERH
EPXLSYKLXLIVSPISJXLIFYXXSRGER
FIGLERKIHMRXLIGYWXSQQIRYMX
WIIQWSHHXLEX2MOSRLEWR¸XXEOIRXLI
STTSVXYRMX]XSWIXXLIFYXXSRWPMKLXP]
HIITIVMRXSXLIFSH]WSXLEXMXGERRSX
FIEGGMHIRXEPP]TVIWWIH
%PPXLMRKWGSRWMHIVIHXLIFYMPHERH
LERHPMRKSJXLI(7EVII\GIPPIRX
EW]SY[SYPHI\TIGXJVSQEGEQIVE
GSWXMRKSZIV†;MXLELYKI
RYQFIVSJMRGEQIVEGYWXSQMWEXMSR
STXMSRWMRGPYHMRKER*RFYXXSR1]
1IRYERH%*ÁRIXYRIXLIZEVMSYW
JYRGXMSRWSJXLIGEQIVEGERFI
X[IEOIHXSÁXXLII\EGXWLSSXMRK
RIIHWSJMRHMZMHYEPTLSXSKVETLIVW 

'

EVWbSPOZO\QSO\RQ]Z]c`

&]YWMRKXLI2MOSR)\TIIHTVSGIWWSV
ERHEPPS[MRKVE[ÁPIWXSFIGETXYVIH
MRFMXGSPSYVHITXLXLI(7
VIRHIVWGSPSYVI\GIPPIRXP]8LIVIEVI
ERYQFIVSJTVIWIX4MGXYVI'SRXVSP
WIXXMRKWXLEXEPPS[]SYXSEPXIVXLI
FVMKLXRIWWGSRXVEWXWLEVTRIWW
WEXYVEXMSRERHLYISJ.4)+MQEKIW
8LIWITEVEQIXIVWGERFIEPXIVIHERH 

BVSPcWZRO\R
VO\RZW\U]TbVS2!A
O`SSfQSZZS\bOag]c
e]cZRSf^SQbT`][
OQO[S`OQ]abW\U
" 
WEZIHWS]SYGERLEZI]SYVS[RFERO
SJGYWXSQ4MGXYVI'SRXVSPWIXXMRKW
8LIWIWIXXMRKWGEREPWSFIPSEHIHXS
ERHJVSQSXLIVGSQTEXMFPIGEQIVEW
9WMRKXLI4MGXYVI'SRXVSP9XMPMX]SR
'ETXYVI2<WSJX[EVI]SYGEREHNYWX
EPPXLIEFSZIWIXXMRKWEW[IPPEWGVIEXI
EGYWXSQMQEKIGYVZI8LIWIGERXLIR
FIPSEHIHSRXSXLI(78LIGYWXSQ
4MGXYVI'SRXVSPJEGMPMX]MWYWIJYPWLSYPH
]SY[MWLXSVITPMGEXIXLITEVXMGYPEV
PSSOSJEÁPQSVMJ]SYEPVIEH]LEZIE
WIXSJ4MGXYVI'SRXVSPWJVSQERSXLIV
GSQTEXMFPI2MOSRGEQIVE8LIWX]PIW
GERIZIRFIETTPMIHXSZMHISJSSXEKI
ERHZMI[IHPMZI[LMPIXLIJSSXEKIMW
FIMRKWLSX%TM\IP6+&WIRWSV
MWYWIHXSNYHKIXLI[LMXIFEPERGI
'SPSYVWEVI[IPPVIRHIVIHERHXLI
[LMXIFEPERGIMWGSVVIGX[LIRMQEKIW
EVIWLSXYWMRK%;&ERHTVIWIX[LMXI
FEPERGIWIXXMRKW,S[IZIVTMGXYVIW
XEOIRMRSZIVGEWXGSRHMXMSRWPSSO
WPMKLXP]FIXXIV[MXLXLIGEQIVEWIXXS
XLIWXERHEVHHE]PMKLXWIXXMRKVEXLIV
XLERXLIGPSYH]WIXXMRK 

&

;SbS`W\U

8LI2MOSR(7YWIWXLIWEQI 
TM\IP6+&WIRWSVXSNYHKI
FSXLXLIGSVVIGXI\TSWYVIERHXLI
GSVVIGX[LMXIFEPERGI8LIEHZERXEKI
SJYWMRKXLIWEQIWIRWSV
JSVRYQIVSYWJYRGXMSRW
MWXLEXXLI]GEREPPXLIR
GSQQYRMGEXIERHWLEVI

The D3S has dual
memory card sockets
for storing images and
video footage. The
second card can be
allocated to provide
extra memory, a backup
of the first card, to
store JPEG files (when
shooting raw and JPEG
simultaneously) or to
save video footage.

4ZOaV
Like other professionallevel cameras, the
Nikon D3S doesn’t have
an in-camera flash.
However, the camera is
compatible with Nikon’s
Speedlight flashguns,
and compatible wireless
flashguns can be
controlled using either
the Speedlight SB-900
or the SU-800 Wireless
Commander unit.

?cWSb[]RS
Recently seen on the
D300S, the Quiet mode
raises the shutter
more slowly than
usual. After exposing
the sensor the shutter
is closed with the
mirror returning more
slowly to its original
position and only when
the photographer has
released the shutter
button. Noise is still
audible, but the loud
‘slap’ that usually
occurs is avoided.

A]TbeO`S
As with all Nikon DSLR
cameras, the D3S
comes with View NX
software. This offers
basic editing features
for raw and JPEG files.
Nikon’s Capture NX
2 software has more
editing options for raw
files. It is available
separately for £158.99.
For more details see
www.nikon.co.uk.

Nikon UK, 380 Richmond Road, Kingston,
Surrey KT2 5PR. Tel: 0871 200 964.
Website: www.nikon.co.uk
£4,199.99
FX-format (full frame) CMOS device with
12.1 million effective pixels
4526x2832 pixels
Output size
Focal length mag 1x (1.5x in DX-format crop mode)
Nikon F
Lens mount
Approx 15MB NEF, 6MB JPEG (high quality,
Max file size
large)
NEF (raw), JPEG, raw+JPEG simultaneously
File format
Three-stage JPEG, three-stage NEF
Compression
Adobe RGB, sRGB
Colour space
Electronically controlled focal-plane
Shutter type
30-1/8000sec in 1⁄3 steps plus B
Shutter speeds
1/250
Max flash sync
ISO 100-12,800 in 1/3EV steps and Hi1, 2, 3
ISO
(ISO 102,400)
Exposure modes PASM
Metering system 1,005-pixel 3D Matrix metering,
centreweighted (adjustable), spot (1.5%)
±5EV in 1⁄3, 1/2 or 1EV steps
Exposure comp
±9EV across 2-9 exposures in increments
Exposure
of 1, 1⁄3 or 2⁄3EV steps
bracketing
Auto, 6 presets (with fine-tuning), plus 3
White balance
custom and Kelvin adjustment settings
2-9 exposures in increments of 1, 2 or 3
WB bracket
Single, continuous (Hi/Lo selectable, up to 9fps
Drive mode
in FX mode, 11fps in DX mode), self-timer
3in TFT with 920,000 dots
LCD
Type B BriteView clear matte VI screen
Viewfinder type
Approx 100%
Field of view
Dioptre adjustment -3 to +1 dioptre
Focusing modes Manual, single shot AF, continuous AF with AF
fine-tuning
51 points, selectable manually or automatically
AF points
Yes
DoF preview
Yes
PC socket
No
Built-in flash
Optional remote release
Cable release
2x CompactFlash shots, compatible with CF
Memory card
type I/II, Microdrive and UDMA
Rechargeable Li-Ion battery (supplied)
Power
USB 2.0 Hi-Speed/HDMI
Connectivity
1,240g (without battery or card/s)
Weight
159.5x157x87.5mm
Dimensions
List price
Sensor

"&7eeeO[ObSc`^V]b]U`O^VS`Q]cY7 8O\cO`g 

www.storemags.com & www.fantamag.com

acPaQ`WPS&"#$%$%%%&

<WY]\2!A1O[S`OBSab

:12:WdSDWSedWSe¿\RS`O\RdWRS]

62;7a]QYSb

>ZOQSR]\bVSaWRS]TbVS
QO[S`ObVWaOZZ]eaO\
62;7QOPZSb]PS^ZcUUSR
W\a]bVObW[OUSaO\R
dWRS][OgPSdWSeSR]\
OQ][^ObWPZSSfbS`\OZ
RWa^ZOg

ASQ]\RO`g
:12^O\SZ

BVWaa[OZZS`ZW_cWR
Q`gabOZRWa^ZOgaV]ea
bVS7A=aS\aWbWdWbgE0
O\R7[OUS?cOZWbg

1O[S`OaV]e\OQbcOZaWhS
:WdSDWSeeWbVZSdSZ

=\QSOUOW\bVS:12RWa^ZOgO\R
dWSe¿\RS`]TbVS2!AO`SbVSaO[SOabVS
2!O\R2!f7\TOQbbVS!W\' R]b
:12aQ`SS\WabVSaO[SOabVS]\ScaSR
W\bVS2!2'2!AO\R2%7bWa
P`WUVbQZSO`O\R]TVWUVS\]cUV_cOZWbg
b][OYSWb^]aaWPZSb]QVSQYbVObSdS\
¿\SRSbOWZaO`SQ]``SQbZgT]QcaSR
BVSdWSe¿\RS`]TTS`aO¿SZR]T
dWSeeWbVO%f[OU\W¿QObW]\O\RWbWa
P`WUVbO\RZO`USS\]cUVb]OZZ]e[O\cOZ
T]Qca:WYS]bVS`4FaS`WSa<WY]\2A:@a
acPaQ`WPS&"#$%$%%%&

DWRS]QO^bc`SaQ`SS\

bVS2!AVOaOQW`QcZO`SgS^WSQSb]eVWQV
g]cQO\¿bOQQSaa]`WSaW\QZcRW\UbVS
2@#`WUVbO\UZSdWSe¿\RS`O\R
29%;[OU\WTgW\USgS^WSQS
EVS\aV]]bW\UObO\OeYeO`R
O\UZS:WdSDWSeQO\PSOQbWdObSR
dWOORSRWQObSRPcbb]\]\bVS`SO`
EVWZSbVWaWaOQbWdObSROTSe]TbVS
]\aQ`SS\RWa^ZOga^`]dSSfb`S[SZg
caSTcZ=\SWaOZWdSVWab]U`O[eVWQV
aV]eabVSSfOQba^`SOR]Tb]\SaOQ`]aa
bVSW[OUS/\]bVS`WabVSdW`bcOZV]`Wh]\

;S\caQ`SS\

eVWQVWaVWUVZWUVbSRW\U`SS\eVS\
bVSQO[S`OWa^S`TSQbZgZSdSZ>S`VO^a
[]abW[^]`bO\bWabVSOPWZWbgb]h]][
W\]\bVS:WdSDWSeW[OUSb]QVSQYO\R
ORXcabT]Qca
2;]dWSdWRS]QO^bc`SWaOQbWdObSRdWO
bVS:WdSDWSe[]RS/aeWbV:WdSDWSe
]\ZgQ]\b`OabRSbSQbW]\/4Wa^]aaWPZS
eVS\aV]]bW\UO2;]dWS1]\bW\c]ca/4
Wa\]bOdOWZOPZSa]T]Qcab`OQYW\U[cabPS
VO\RZSR[O\cOZZgBVSbSQV\W_cSOZZ]ea
Q]\b`]Z]TT]QcaW\UO\RRS^bV]T¿SZRbVOb

aW[^ZgWa\¸b^]aaWPZSeWbVOQO[Q]`RS`
0SW\UOPZSb]Q`SObSP]YSVPOQYU`]c\R
STTSQba[OYSaSdS\bVSaW[^ZSabdWRS]
T]]bOUSZ]]Y^`]TSaaW]\OZ
1][PW\SReWbVbVS2!A¸aVWUV7A=
aS\aWbWdWbWSabVS2;]dWS[]RSQ][Sa
W\b]Wba]e\BVSOPWZWbgb]aV]]bdWRS]
T]]bOUSOb7A= &]`VWUVS`]^S\a
c^]^^]`bc\WbWSabVObcaSRb]\SSR
Sf^S\aWdSRSRWQObSRS_cW^[S\b 

' 

8O\cO`g 7eeeO[ObSc`^V]b]U`O^VS`Q]cY7"'

www.storemags.com & www.fantamag.com

1O[S`OBSab<WY]\2!A

=c`dS`RWQb

/
CaW\UbVS<WYY]`&"[[D@ZS\a
eWbV]cbOac^^]`be]cZR\]`[OZZg^`]dSO
QVOZZS\US6]eSdS`OaW[OUS\]WaSeOa\]b
OQ]\QS`\7aSbbVS2!Ab]7A=! b]Od]WR
QO[S`OaVOYSO\ReOaOPZSb]QO^bc`SbVS
SgSZOaVSa]TbVWaRSS`W\T]Qca 

BVS[SbS`W\UT]c\R
W\bVS<WY]\2!AWa
OZ[]abQ][^ZSbSZg
ORO^bOPZSRS^S\RW\U
]\g]c`a^SQW¿Q
aV]]bW\UaWbcObW]\ 
MRJSVQEXMSR[MXLIEGLSXLIV
*SVI\EQTPIF]ORS[MRKXLI
PIRWJSGEPPIRKXLERHXLI%*
TSMRXXLIGEQIVEGER[SVO
SYXLS[JEVE[E]EWYFNIGXMWERHEHNYWX
XLIÂEWLI\TSWYVIEGGSVHMRKP]%PWSF]
PMROMRKXLMWWIRWSVXSXLIEYXSJSGYW(
QEXVM\XVEGOMRKGERXEOITPEGIEWXLI
WIRWSVVIGSVHWETEVXMGYPEVGSPSYVERH
WLEHIEVSYRHXLIJVEQIERHVIPEXIW
MXWTSWMXMSRXSXLIEYXSJSGYW[LMGLGER
GSRXMRYIXSXVEGOMX
;LIRMRMXWIZEPYEXMZIQEXVM\
QIXIVMRKQSHIXLI(7XVMIWXS
GEPGYPEXI[LEX]SYEVITLSXSKVETLMRK
ERHEHNYWXWXLII\TSWYVIEGGSVHMRKP]
*SVI\EQTPIMX[MPPMKRSVII\XVIQIP]
FVMKLXLMKLPMKLXWFYXMJXLIXSTLEPJ
SJERMQEKIMWSZIVI\TSWIHMX[MPP
VIEPMWIXLMWMWXLIWO]ERHHEVOIRXLI
I\TSWYVIWPMKLXP]-RVIEPMX]XLSYKL
QSWXHMKMXEPGEQIVEW[SVOSRZIV]
WMQMPEVTVMRGMTPIWXSXLMWERHEWKSSH
EWXLI2MOSR(7¸WQIXIVMRKW]WXIQ
MWMRTVEGXMGIXLITM\IPWIRWSV
HSIWR¸XWIIQXSLEZIEQEWWMZI
EHZERXEKISZIVGEQIVEW[MXLJEV
JI[IVQIXIVMRK^SRIW
-JSYRHXLEXQEXVM\QIXIVMRK[SVOW
ZIV][IPPMRQSWXPERHWGETIWGIRIW
ERHSRP]SGGEWMSREPP]HMH-LEZIXS
QEOIGSVVIGXMSRWYWMRKI\TSWYVI
GSQTIRWEXMSR;LIRTLSXSKVETLMRK
[MPHPMJIXLSYKL-JSYRHXLEXGIRXVI
[IMKLXIHQIXIVMRK[EWEFIXXIVSTXMSR
%RIZIRFIXXIVSTXMSRMWXSYWI(
XVEGOMRKERHPMROXLIQIXIVMRKXSXLI
JSGYWTSMRXMRYWI
7LSYPH]SYRSXPMOIXLIVIWYPXW
XLI)\TSWYVI*MRI8YRIWIXXMRKWGER

FIJSYRHMRXLI'YWXSQQIRY8LMW
EPPS[WXLIMRHMZMHYEPEHNYWXQIRXSJXLI
QIEWYVIQIRXSJIZEPYEXMZIGIRXVI
[IMKLXIHERHWTSXQIXIVMRKF]EW
PMXXPIEW):7SMJ]SYÁRHXLEXWTSX
QIXIVMRKGSRWXERXP]TVSHYGIWMQEKIW
XLEXEVIEXSSHEVOJSV]SYVPMOMRK]SY
GEREPXIVMXXSEP[E]WTVSHYGIFVMKLXIV
VIWYPXWXLERMXWHIJEYPXWIXXMRK[LMPI
WXMPPLEZMRKXLIWXERHEVHGSRXVSPSZIV
I\TSWYVIGSQTIRWEXMSR
-REPPXLIQIXIVMRKJSYRHMRXLI
2MOSR(7MWEPQSWXGSQTPIXIP]
EHETXEFPIHITIRHMRKSR]SYVWTIGMÁG
WLSSXMRKWMXYEXMSR

8XLITVIWWPEYRGLSJXLI
2MOSR(7-[EWZIV]
MQTVIWWIH[MXLXLIUYEPMX]SJ
XLIMQEKIWSRHMWTPE]FYX[EWIEKIV
XSWIILS[XLIGEQIVE[SYPHTIVJSVQ
MRQ]S[RLERHW%WMWGPIEVLIVIXLI
(7JEVIH[IPP-XWFSH]ERHQER]SJ
MXWJIEXYVIW[MPPGSQIEWPMXXPIWYVTVMWI
XSXLSWIEPVIEH]JEQMPMEV[MXLXLI(
ERH(<FYXMXMWXLIRI[P]HIWMKRIH
WIRWSVERHPS[PIZIPWSJRSMWIXLEX
WXIEPXLIWLS[-XMWRS[VIEPMWXMGXS
WLSSXEX-73WIRWMXMZMXMIWXLEX[SYPH
TVIZMSYWP]LEZIQIERXTYWLMRK-PJSVH
(IPXEF]X[SWXSTWERHIZIR
XLIRVIWYPXW[IVII\XVIQIP]KVEMR]
;LIRXLMWXIGLRSPSK]MWGSQFMRIH

[MXLLMKLHIÁRMXMSRZMHISXLI(7
FIGSQIWEXVYP]GVIEXMZIXSSPJSV
TVSJIWWMSREPTLSXSKVETLIVW%WQYGL
EWELMKLIVVIWSPYXMSR[SYPHLEZIFIIR
RMGIEQMPPMSRTM\IPTTMMQEKI
MWSRP]EVSYRHEGSYTPISJMRGLIWPEVKIV
EPSRKIEGLWMHIXLEREQMPPMSR
TM\IPMQEKI8LMWVIWSPYXMSRWLSYPHFI
TIVJIGXP]ÁRIJSVQSWXTLSXSKVETLIVW
YRPIWWXLIMQEKIWEVIKSMRKXSFI
TVMRXIHEPSXPEVKIVXLER%MRWM^I
*SVWTSVXW[MPHPMJIERHTVIWW
TLSXSKVETLIVWVIUYMVMRKWTIIHERH
TIVJSVQERGIXLI2MOSR(7MW
GYVVIRXP]XLIVEGIPIEHIVFYXI\TIGX
XSWIIEWXVSRKGLEWMRKTEGOKEMRMRK
KVSYRHRI\X]IEV

:OP`SacZba
4SObc`Sa
<]WaS`Sa]ZcbW]\
2g\O[WQ`O\US
:12dWSe¿\RS`
0cWZRVO\RZW\U
/cb]T]Qca
;SbS`W\U
/E0Q]Z]c`

'
&!
&
'
'
'
'
&

<WY]\2!A
BSabSROa(>`]TSaaW]\OZ2A:@
@ObSR(DS`gU]]R

&'  

'

/cb]T]Qca

%PXLSYKL2MOSRGPEMQWXLEXXLI
EYXSJSGYWLEWFIIRMQTVSZIHMR
XLI(7MXYWIWXLIWEQI1YPXM
'%1*<W]WXIQEWXLIIEVPMIV
(ERH(<8LMWW]WXIQSVMXW
(<JSVQEXIUYMZEPIRXMWYWIHMRXLI
QENSVMX]SJ2MOSR¸W(706GEQIVEW
ERHEKEMRMXMWEGEWISJ2MOSRYXMPMWMRK
EREPVIEH]XVMIHERHXIWXIHTMIGISJ
IUYMTQIRXERHJYVXLIVVIÁRMRKMX
-RYWI-HMHR¸XRSXMGIER]HMJJIVIRGI
FIX[IIRXLIEYXSJSGYWSJXLI(7
ERHXLEXSJXLI(2IIHPIWWXSWE]
MXMWI\XVIQIP]JEWXERHVIWTSRWMZI
TEVXMGYPEVP][LIRYWIH[MXLXLI2MOOSV 
QQJ)(-*%*7PIRW
;LIRW[MXGLMRKXLIEYXSJSGYWXS 
TSMRX(QEXVM\XVEGOMRKMXGERFI
PSGOIHXSETEVXMGYPEVWYFNIGXMRXLI
JVEQI%WXLMWWYFNIGXQSZIWWSHSIW
XLI%*TSMRX8LMWGERFIWIIRXLVSYKL
XLIZMI[ÁRHIVERHMWI\XVIQIP]YWIJYP
[LIRTLSXSKVETLMRKQSZMRKWYFNIGXW
;LMPITLSXSKVETLMRKHIIV-[EWEFPI
XSJSGYWSREHIIVMWSPEXIHEKEMRWXE
FEGOKVSYRHERH[MXLSYXQSZMRKXLI
GEQIVEXLIEYXSJSGYWXVEGOIHXLI
HIIVYRXMPMXQSZIHSYXSJXLIJVEQI
7TSVXWERH[MPHPMJITLSXSKVETLIVW
WLSYPHÁRHXLI(XVEGOMRKKVIEX
JSVLIPTMRKXSJVEQIMQEKIW[MXLSYX
LEZMRKXSVIEHNYWXXLIJSGYW 

'

7

1O\]\3=A2;O`Y7D

A]\g/Z^VO'

B=03B3AB32

B3AB32#<=D3;03@ &

2XLITEWXJI[]IEVW2MOSRLEWWXSPIRELYKIWLEVISJXLITVSJIWWMSREP
(706QEVOIXJVSQ'ERSR;LIRXLISVMKMREP([EWPEYRGLIHQER]
TLSXSKVETLIVWW[MXGLIHEPPIKMERGIERHXLIEVVMZEPSJXLI(ERH(<
LEZILIPTIHGIQIRXXLITVSJIWWMSREPQEVOIXJSV2MOSR
,S[IZIV[MXLXLII\GITXMSRSJXLI(<EPPSJ2MOSR¸WTVSGEQIVEWJIEXYVI 
QMPPMSRTM\IPWIRWSVWERH[LMPIXLMWLEWOITXMQEKIRSMWIXSEQMRMQYQ
'ERSRLEWEQMPPMSRTM\IPWIRWSVMRMXW)37(1EVO--ERHEQMPPMSR
TM\IPWIRWSVMRMXWRI[)37(1EVO-:EPXLSYKLXLIPEXXIVMWRSXJYPPJVEQI
-X[MPPFIMRXIVIWXMRKXSWIILS[XLIMQEKIRSMWITVSHYGIHF]XLI)37(1EVO
-:GSQTEVIW-XWWQEPPIVQMPPMSRTM\IPWIRWSVWLSYPHGETXYVIQSVIHIXEMP
XLERXLI(7FYX-[SYPHI\TIGXMQEKIWXSLEZIQSVIMQEKIRSMWI
*SVRS[XLI2MOSR(7MWUYMXIWMQTP]EWYTIVFGEQIVEERH-[SYPHR¸XI\TIGX
2MOSRXSVIPIEWIMXWVITPEGIQIRXTVIWYQEFP]XLI(JSVEXZIV]PIEWXERSXLIV 
QSRXLW8LMWMWEPSRKXMQIMRXLIHMKMXEPGEQIVEQEVOIXERHMJXLILMKLIV
VIWSPYXMSR'ERSR)37(1EVO-:GERTVSHYGIER]XLMRKPMOIXLIWEQIPS[PIZIPW
SJMQEKIRSMWI2MOSRQE]SRGIEKEMRLEZIEÁKLXSRMXWLERHWJSVXSTWTSX
7SR]MWXLISRP]SXLIVQERYJEGXYVIVXLEXTVSHYGIWJYPPJVEQI(706W³XLI
%PTLEERH&SXLLEZIQMPPMSRTM\IPWIRWSVWFYXGSRXMRYSYW
WLSSXMRKVEXIWSJNYWXXLVIIERHÁZIJVEQIWTIVWIGSRHVIWTIGXMZIP](IWTMXI
ETTIEPMRKQSWXP]XSWXYHMSTLSXSKVETLIVWXLI7SR]GEQIVEWEVIPIWWXLERLEPJ
XLITVMGISJXLI2MOSR(<QEOMRKXLIQEFIXXIVSTXMSRJSVXLIIRXLYWMEWX

#7eeeO[ObSc`^V]b]U`O^VS`Q]cY7 8O\cO`g 

www.storemags.com & www.fantamag.com

acPaQ`WPS&"#$%$%%%&

|

www.st
storemags.com & www.fa
st
fant
fa
ntamag.com
nt

:SbbVS/>bSO[O\aeS`g]c`^V]b]U`O^VWQ_cS`WSa
23>B6=4473:2

23>B6=44=1CA

*SGYWSRWYFNIGX

2IEVPMQMX
SJEGGITXEFPI
WLEVTRIWW

8SXEPHITXL
SJÁIPH

4WSZR
O\RT]Qca
;]`S
_cSabW]\a 
O\aeS`a
OdOWZOPZS
Ob¬

(EZMH1YVVE]EWOW(YIXSTSSV
I]IWMKLX-LEZIWXEVXIHYWMRK
0IMGEFSHMIWXLEXLEZIRIMXLIV
EZMI[ÁRHIVRSVEVERKIÁRHIV
WYGLEWXLI1(ERH1(-
WSYVGIHEY\MPMEV]ZMI[ÁRHIVWJSV
IEGLSJQ]PIRWIWJVSQQQ
XSQQEWXLIWIKMZIEQYGL

*MPQSVWIRWSV

*EVPMQMXSJ
EGGITXEFPI
WLEVTRIWW

FVMKLXIVERHGPIEVIVZMI[ERH
[LMPI-VIP]SRXLIL]TIVJSGEP
HMWXERGIWGEPIQIXLSHJSV
JSGYWMRK-¸QEPMXXPIGSRJYWIHF]
XLIXIVQWHITXLSJÁIPHERH
HITXLSJJSGYW%VIXLIWIXLI
WEQISVMWXLIVIEHMJJIVIRGI#
1EXX+SPS[G^]RWOMVITPMIW(ITXL
SJÁIPHERHHITXLSJJSGYWHIÁRI
X[SWITEVEXIXLMRKW(EZMH(ITXL
SJÁIPHMWXLIEVIEMRJVSRXSJERH
FILMRHXLITSMRXSJJSGYWXLEXMW
EGGITXEFP]WLEVTERHJSGYWIH8LMW
EVIEMRGVIEWIWEW]SYJSGYWJYVXLIV

DWRS]e]PPZS
.SLR,EVTIVEWOW-¸ZIRSXMGIHSRQ]2MOSR(XLEXMXWZMHISJSSXEKI
GERETTIEVUYMXIHMWSVMIRXEXMRK[LIRQSZMRKEGVSWWEWGIRI[MXL
XLIJIIHETTIEVMRKXS[SFFPI%W-¸ZIEPWSWIIRXLMWGSQQIRXIH
YTSRMRVIZMI[WSJ(706WXLEXWLSSXZMHISGSYPH]SYI\TPEMR[L]XLMW
LETTIRW#;L]HSIWR¸XXLMWEJJIGXZMHISGEQIVEWMRXLIWEQI[E]#

2]g]cVOdSO
^V]b]U`O^VWQ
_cSabW]\bVOb
g]ce]cZRZWYS
O\aeS`SR0SWbOP]cb[]RS`\bSQV\]Z]Ug
dW\bOUSS_cW^[S\b^V]b]U`O^VWQ
aQWS\QS]`VSZ^eWbVbSQV\W_cS³
VS`SOb/>eSVOdSbVSbSO[
bVObQO\VSZ^g]c
AW[^ZgaS\Rg]c`_cSabW]\ab](
O^O\aeS`a.W^Q[SRWOQ][
]`Pg^]abb](/>/\aeS`a
/[ObSc`>V]b]U`O^VS`;OUOhW\S
7>1;SRWO0ZcS4W\0cWZRW\U 
A]cbVeO`YAb`SSb:]\R]\
A3AC

1EXX+SPS[G^]RWOMVITPMIW8LMWMWERIJJIGXGSQQSRP]WIIRSR(706W
[MXLEZMHISJEGMPMX]ERHMWHYIXSXLI[E]MR[LMGLEWIRWSVSTIVEXIW3RE
(706[MXLEZMHISJEGMPMX]XLIWIRWSV[MPPX]TMGEPP]VIEHSYXMRJSVQEXMSRVS[
F]VS[MRETEVXMGYPEVHMVIGXMSRVEXLIVXLEREPPEXSRGI%JXIVXLIMRJSVQEXMSR
LEWFIIRVIEHSYXXLIVS[[MPPFIVIWIXMRSVHIVXSGETXYVIXLIRI\XJVEQI
EPXLSYKLEKEMRXLMWHSIWR¸XEPPLETTIREXSRGI8LIVIJSVIMJ[IEWWYQIXLEX
XLMWMWFIMRKHSRIMREHS[R[EVHHMVIGXMSRXLIYTTIVQSWXVS[W[MPPGETXYVI
XLIWEQIJVEQIWSSRIVXLERXLSWIXS[EVHWXLIFSXXSQ8LMWMWORS[REWE
VSPPMRKWLYXXIV*SVWXEXMGWYFNIGXWMXMWR¸XEKVIEXGSRGIVRFYX[LIRXLIGEQIVE
MWQSZIH WYGLEW[LIRTERRMRK MXMWQSVIPMOIP]XSVIGSVHXLIWIIJJIGXW
:IVXMGEPWGERETTIEVWOI[IHSVXLIIRXMVIWGIRIQMKLXHMWXSVXERH[SFFPI
:MHISGEQIVEW
EVIR¸XEJJIGXIH
MRXLIWEQI[E]
FIGEYWIYWYEPP]
XLIX]TISJWLYXXIV
XLI]YWISTIVEXIW
KPSFEPP]³MRSXLIV
[SVHWEPPVS[W
EVII\TSWIH
WMQYPXERISYWP]
&IGEYWISJXLMW
XLI]EVIFIXXIV
WYMXIHXSQSZMRK
WYFNIGXW

# 7eeeO[ObSc`^V]b]U`O^VS`Q]cY7 8O\cO`g 

www.storemags.com & www.fantamag.com

(ITXLSJJSGYW
MRXSXLIHMWXERGIERHMWX]TMGEPP]
[IMKLXIHWSXLIVIMWEPEVKIV
^SRISJJSGYWFILMRHXLIWYFNIGX
XLERMRJVSRXSJMX
(ITXLSJJSGYWQIER[LMPIMW
QIEWYVIHEXXLIMQEKMRKTPERI
ERHRSXXLIWYFNIGXERHHIWGVMFIW
XLIHITXLEGVSWW[LMGLXLIÁPQ
SVWIRWSVMWEFPIXSQSZI[LMPI
WXMPPOIITMRKERSFNIGXEGGITXEFP]
WLEVT%W[MXLHITXLSJÁIPHXLMW
MRGVIEWIWEW]SYWXSTHS[R]SYV
ETIVXYVIEPXLSYKLEW]SYGER
MQEKMRIMXMWQIEWYVIHSRE
QYGLWQEPPIVWGEPI

5]W\Ua]Tb

4/MRKXSREWOW%WWSQISRI[LSMW
FSXLSPHERHSPHJEWLMSRIH-HSRSX
LEZIEGSQTYXIVWS-RIIHXSTVMRX
Q]MQEKIWHMVIGXP]JVSQEQIQSV]
GEVH;LEXMWXLIPIEWXEQSYRXSJ
QSRI]-[SYPHRIIHXSWTIRHXSKIX
E(706XLEXHSIWRSXTVSHYGIWSJX
MQEKIWWXVEMKLXJVSQ.4)+W#)ZIV]
VIZMI[-VIEHSJIRXV]PIZIPGEQIVEW
WIIQWXSLEZIXLMWHS[RWMHI;SYPH
FY]MRKERI\TIRWMZIPIRWERH
QSYRXMRKMXSRERIRXV]PIZIPFSH]
WSPZIXLITVSFPIQ#
1EXX+SPS[G^]RWOMVITPMIW8LI
UYEPMX]SJ.4)+WJVSQ(706WZEVMIW
JVSQGEQIVEXSGEQIVEKMZIRXLI
HMJJIVIRXTVSGIWWMRKW]WXIQWYWIHF]
QERYJEGXYVIVW)ZIRTVSJIWWMSREP

BVS^c`^]aS]TOaS\a]`Wab]QO^bc`S
ZWUVbOZbV]cUVWbaS\bW`SW[OUW\UO`SO
e]\¸bPSaS\aWbWdSb]bVWa>V]b]aWbSa
[OgPSaS^O`ObSRb]^`SdS\bZWUVbT`][
]dS`À]eW\UT`][]\S^WfSZb]bVS\Sfb 
eVWQVQOcaSaPZ]][W\UO\RO\gQW`QcWb`g

acPaQ`WPS&"#$%$%%%&

4@=;
B63/>
4=@C; 

G]c`_cSabW]\aO\aeS`SR

<SfbeSSY
=\aOZSBcSaROg#8O\cO`g

8]W\]c`]\ZW\SQ][[c\WbgO\R
PSW\T]`[SRO\RS\bS`bOW\SR

:S\aQ][^ObWPWZWbg

A]\g/Z^VO&#

[ZO\aRSZZOaYa 

-¸QMRXLIQEVOIXJSVE(706XLEXGERWLSSXJEMVP]
HIGIRX,(ZMHIS-RXLITEWX-¸ZILEHE4IRXE\/ERHEGSYTPISJ
1)7YTIVWERHEPXLSYKLZEVMSYWFMXWSRXLIGEQIVEWKEZIYTXLIKLSWX
PSRKEKSXLIPIRWIW-LEZIJSVXLIQEVIEPPMRXSTJSVQ;SYPH-FIEFPI
XSYWIXLIQ[MXLXLI4IRXE\/\#

/ZSf;]\`]`S^ZWSa

/b "$;>bVS/Z^VO&#VOabVSVWUVSab^WfSZQ]c\b
T]`bVSZSOabO[]c\b]T[]\SgT]`O\gTcZZT`O[S[]RSZ
/\USZO<WQV]Za]\UWdSaVS`dS`RWQb
© PAUL HOBSON 

%PP4IRXE\(706WLEZIFEGO[EVHGSQTEXMFMPMX][MXL
SPHIVPIRWIW*SVI\EQTPI-¸ZIYWIHEQQJ71'1[MXLQ]/(
%WWYQMRKXLI/\MWWMQMPEVXSTVIZMSYWQSHIPWXLIVIEVIEJI[XLMRKW]SY
RIIHXSHSXLSYKL*MVWX]SY¸PPRIIHXSWIX9WMRK%TIVXYVI6MRKXS4IVQMXXIH
MRXLI'YWXSQ7IXXMRKQIRY=SY¸PPRIIHXSIRXIVXLIJSGEPPIRKXLSJXLI
PIRW[LIRTVSQTXIHEXW[MXGLSR*SVPIRWIW[MXLSYXER·%¸TSWMXMSRSRXLI
ETIVXYVIVMRK]SY¸PPFIPMQMXIHXSETIVXYVITVMSVMX]SVQERYEPQSHIWERH
]SY¸PPRIIHXSYWI3TXMGEP4VIZMI[XSIREFPIXLIWXSTHS[RQIXIVMRK8LI
ETIVXYVIWIXXMRK[SR¸XFIHMWTPE]IHSVVIGSVHIHMRXLI)\MJHEXE

H]c`S^ZWSa 

8LIWMQTPIERW[IVMWXLEXER]/QSYRXPIRWMWYWEFPISRXLI
/\EPXLSYKLXLIVIEVIEGSYTPIXLEXEVIRSXVIGSQQIRHIH³6MGSLSRIW
MJ-VIGEPPGSVVIGXP]³EWXLI]GERHEQEKIGSRXEGXWSVWS-¸ZILIEVH%WXLI
WIRWSVMWWQEPPIVXLERÁPQ]SYSRP]KIXXLIGIRXVITEVXSJXLIMQEKIGMVGPI
WS[LMPIQ]71'1QQJ[EWRIZIVKVIEXSRÁPQSRQ]/(MX
GVIEXIWVIEPP]RMGIWLEVTGSRXVEWX]MQEKIW IJJIGXMZIP]QQ 1]71'1 
QQJMWEPWSEKSSHZEPYITIVJSVQIV IJJIGXMZIP]QQ 
KVEHIGEQIVEWGERSYXTYX
GSQTEVEXMZIP]WSJX.4)+WWSXLIVI
MWR¸XVIEPP]EWMQTPIGSVVIPEXMSR
FIX[IIRXLITVMGISJEGEQIVEERH
XLIHIJEYPXWLEVTRIWWSJMXWMQEKIW
%WXLIETTVSTVMEXIPIZIPSJ
WLEVTRIWWJSVERMQEKIMWHITIRHIRX
SRMXWSYXTYXWM^IXLMWQE]RSXFIER
MWWYIMJ]SYSRP]TPERXSTVSHYGI
WQEPPIVTVMRXW-X¸WSRP][LIRMQEKIW
EVIQEKRMÁIHGPSWIVXSXLIMV
QE\MQYQWM^IXLEXHMJJIVIRGIWMR
WLEVTRIWWGERFIJYPP]ETTVIGMEXIH
(706WHSLS[IZIVSJJIVXLIYWIV
GSRXVSPWSZIVERYQFIVSJ.4)+
TVSGIWWMRKTEVEQIXIVWSRISJ[LMGLMW
WLEVTRIWW8LMWMWXLIQSWXMQQIHMEXI
[E]]SYGERMQTVSZIXLIWLEVTRIWW
SJ]SYVMQEKIWEPXLSYKLIUYEP
GSRWMHIVEXMSRWLSYPHEPWSFITEMH

]\bVSaS\a]`\SQSaaO`gb]^`]QSaabVS
aWU\OZeWZZOZa]bOYSc^a^OQSBVS[]`S
ZWUVbOaS\a]``SQSWdSabVSZSaaWb\SSRab]
PSO[^ZW¿SRW\]`RS`b]Q`SObSO\W[OUS
ObORSaW`SRaSbbW\U³T]`eVWQV`SOa]\O
T]`[ObW]\]T[WQ`]ZS\aSaWabg^WQOZZg^ZOQSR
]dS`OaS\a]`b]VSZ^S\VO\QSWbaZWUVb
UObVS`W\UQO^OPWZWbWSa
;WQ`]ZS\aSaOQbZWYSTc\\SZaQVO\\SZZW\U
ZWUVbT`][OZO`US`O`SOO\RQ]\QS\b`ObW\U
WbW\b]Oa[OZZS`]\S0g[OfW[WaW\UbVS
RSU`SSb]eVWQVbVWaWa^]aaWPZSbVWa
W\Q`SOaSabVSaS\a]`¸aaS\aWbWdWbgeVWQVW\

acPaQ`WPS&"#$%$%%%&

XSGSVVIGXXIGLRMUYIPIRWX]TI
ETIVXYVIWIXXMRKWERHWSSR
%FIXXIVSTXMSRQMKLXFIXSMRZIWX
MRE(706WYGLEWXLI2MOSR(
EVSYRH†[MXLQQ:6
PIRW [MXLVE[TVSGIWWMRKJYRGXMSREPMX]
FYMPXMRXSMX-RXLMW[E]]SYGEREHNYWX
XLIVE[YRTVSGIWWIHÁPIMRGEQIVE
VEXLIVXLERE.4)+XS[LMGLERYQFIV
SJTVSGIWWMRKJYRGXMSRWLEZIEPVIEH]
FIIRETTPMIH=SYGSYPHEPWSXV]ZMI[MRK
]SYVMQEKIWSR]SYVXIPIZMWMSR ZME
XLIWYTTPMIH%:GEFPISVERSTXMSREP
,(1-GEFPIMJ]SYVGEQIVELEW,(
JYRGXMSREPMX] XSKMZI]SYEFIXXIVMHIESJ
XLIMVUYEPMX]2SRISJXLIWIWSPYXMSRWMW
MHIEPFYXYRPIWW]SYGERWIILS[]SYV
GEQIVEMWTVSGIWWMRK]SYVMQEKIWMX
[SYPHFIEJEPWIIGSRSQ]XSMRZIWXMR
ERI\TIRWMZIPIRW

bc`\UWdSaSOQV^V]b]aWbSOPSbbS`¿ZZTOQb]`
BVWaWaW[^]`bO\bOabVS[]`SO^V]b]aWbS
QO\PS¿ZZSReWbVW\Q][W\U^V]b]\abVS
ZSaaa^OQSbVS`SWaT]`\]WaSUS\S`ObSRPg
bVSbVS`[OZOQbWdWbg]TbVSaS\a]`BVWaWa
Y\]e\OaOaWU\OZb]\]WaS`ObW]
;WQ`]ZS\aSaO`S^O`bWQcZO`ZgW[^]`bO\b
ObbVS^S`W^VS`WSa]TOaS\a]`O\RSdS\
[]`Sa]eVS\aV]]bW\UObeWRS`O^S`bc`Sa
eVS`SbVSSTTSQba]TdWU\SbbW\UO`S[]`S
^`]\]c\QSRBVSgQO\OZa]W\b`]RcQS
OPS``ObW]\a]TbVSW`]e\V]eSdS`acQV
Oa^c`^ZST`W\UW\U;Obb5]Z]eQhg\aYW

@SORS`[OabS`QZOaa
EWZRZWTS^V]b]U`O^VS`>OcZ6]Pa]\ZSORa]c``SORS`a
W\bVSQO^bc`S]T`SRYWbSaO\RbVSW`OQ`]PObWQRWa^ZOga
5S[[O>ORZSg`S^]`ba

1O\]\>]eS`AV]bA'
EWZZObS\ZZW]\
^WfSZaS\a]`O\R`Oe
QO^bc`S[OYSbVWa
bVSWRSOZS\bVcaWOab
Q][^OQb-@WQVO`R
AWPZSgTW\Ra]cb

EVWbSVS`S 5S]TT`Sg
eVWbS\]e 1`OeZSg
1`OWU@]PS`baabWQYa
Sf^ZOW\a
QZ]aSb]V][SO\R
`SdSOZaV]ePSab
b]e]`YeWbVeVWbS
eW\b`gZO\RaQO^Sa

5S]TT`Sg1`OeZSgT]QcaSa
]\ZS\aSaO\RV]ebVS
dO`W]caRWTTS`S\bQO[S`O
T]`[ObaOTTSQbT]QOZZS\UbV 

8O\cO`g 7eeeO[ObSc`^V]b]U`O^VS`Q]cY7

www.storemags.com & www.fantamag.com

N:H

>LDJA9A>@:IDHJ7H8G>7:
ID6B6I:JGE=DID<G6E=:G
6C9H6K:JEID(*
■;`i\Zk;\Y`k1—&.#,*ZkZgn(bdci]h
jXm`e^*,d[[i]Z[jaaeg^XZd[—(%#+%
■@P\Xi1˜-/$+&jXm`e^*,e\\j^[\kbbfh_Y[e\˜'(($*&
■)P\Xij1˜'+/jXm`e^*,e\\j^[\kbbfh_Y[e\˜(**$.& 
NdjgYZiV^ah
Ch%Chi%Ci%C_ii0

<eh[dWc[0

IkhdWc[0
@]pflË[c`b\kfi\Z\`m\\dX`cj]ifd@G:8dXk\liG_fkf^iXg_\iZfekX`e`e^e\nj#jg\Z`Xcf]]\ij#gif[lZkXe[
j\im`Z\`e]fidXk`feXe[kXb\gXik`eflidX^Xq`e\i\j\XiZ_m`X\dX`c#gc\Xj\`eZcl[\pfli\dX`cY\cfn%

;cW_b0

CZlNZVgÄ
<G:6IHJ7H8G>EI>DCD;;:G
;DG6B6I:JGE=DID<G6E=:G

7ZZh[ii0  

FeijYeZ[0

>ec[J[bDe$`eZcXi\XZf[\ 0
Nflc[pflc`b\kfi\Z\`m\d\jjX^\jkfpflidfY`c\]ifd@G:8dXk\liG_fkf^iXg_\iZfekX`e`e^e\nj#jg\Z`Xcf]]\ij#
gif[lZkXe[j\im`Z\`e]fidXk`feXe[kXb\gXik`eflii\j\XiZ_6@]p\j#gc\Xj\`eZcl[\pflidfY`c\g_fe\eldY\i_\i\

CeX_b[0
O[Whe\8_hj^0 P

P P P 

>ldjaYa^`ZidhZcYV\^[iid
Gc\Xj\\ejli\pflXcjfZfdgc\k\ÊPfli;\kX`cjËj\Zk`feXYfm\%Kf^`m\dfi\k_Xefe\jlYjZi`gk`fe#gc\Xj\jlggcp
X[[i\jj\jfeXj\gXiXk\j_\\k%

Ch%Chi%Ci%C_ii0

<eh[dWc[0

IkhdWc[0
7ZZh[ii0  

FeijYeZ[0

>ec[J[bDe$`eZcXi\XZf[\ 0
@]k_\g\ijfepflËi\Ylp`e^k_`jjlYjZi`gk`fe]fi`jle[\i(/#gc\Xj\X[[k_\`i[Xk\f]Y`ik_Y\cfn%

O[Whe\8_hj^0 P

P P P 
8]ddhZndjgbZi]dYd[eVnbZci
9^[gk[%feijWbehZ[h\eh˜cWZ[fWoWXb[je?F9C[Z_WBjZ$
9h[Z_j9WhZ0■ 7c[n■L_iW■CWij[hYWhZ■CW[ijhe 

9WhZDe$0
;nf_ho:Wj[0

%

?iik[De$%LWb_Z<hec0 

DX\jkif
% 

DX\jkif

I_]dWjkh[0:Wj[0 
@Xdfm\i(/

?mekbZb_a[jefWo˜'/$-+Xo)cedj^bo:_h[Yj:[X_jZfdgc\k\[\kX`cjY\cfn  

9^gZXi9ZW^i>chigjXi^dch

<ehe\ÓY[ki[edboEh_]_dWjehÊiH[\[h[dY[Å-,*(('
7%9De

DWc[e\XWda0
7ZZh[iie\XWda0   

FeijYeZ[0

DWc[e\WYYekdj^ebZ[h0
7YYjde0  

IehjYeZ[0

@EJKIL:K@FEKFPFLI98EBFI9L@C;@E>JF:@<KP

Gc\Xj\gXp@G:D\[`XCk[%#;`i\Zk;\Y`kj]ifdk_\XZZflek[\kX`c\[fek_`j@ejkilZk`fejlYa\Zkkfk_\
jX]\^lXi[jXjjli\[Ypk_\;`i\Zk;\Y`k>lXiXek\\%@le[\ijkXe[k_Xkk_`j`ejkilZk`fedXpi\dX`en`k_@G:
D\[`XCk[%Xe[`]jf#[\kX`cjn`ccY\gXjj\[\c\Zkife`ZXccpkfdpYXebfiYl`c[`e^jfZ`\kp%

I_]dWjkh[0:Wj[0 
@Xdfm\i(/

Gc\Xj\efk\k_Xkk_`jf]]\i`jfg\ekfLBjlYjZi`Y\ijfecpXe[Zcfj\j)/k_=\YilXip)'('%JlYjZi`gk`fef]]\i
fecpmXc`[feX()dfek_d`e`dldk\id%:XeZ\ccXk`fejXi\efkg\id`kk\[lek`ck_\\e[f]k_`j`e`k`Xcg\i`f[Xe[
n\n`ccefk`jjl\pflXi\]le[%J_flc[pfln`j_kfZXeZ\cX]k\ik_\d`e`dldk\id#gc\Xj\ZfekXZkfliZljkfd\i
ZXi\k\Xd`eni`k`e^j\\ZfekXZk[\kX`cjY\cfn %=fi\ehl`i`\jXe[fm\ij\XjiXk\jgc\Xj\ZXcc"++' 
/+,()*()*(c`e\jfg\e.[XpjXn\\b]ifd/Xd$0gdLBk`d\ #]Xo"++' /+,-.,0('(fi\dX`c
`gZjlYj7hlX[iXekjlYj%Zfd%Gc\Xj\Xccfnlgkf-n\\bj]fi[\c`m\ipf]pfliÔijkjlYjZi`gk`fe`jjl\%K_\
™(0%.,f]]\i`jfecpXmX`cXYc\kfe\nLB;`i\Zk;\Y`kjlYjZi`Y\ij%8dXk\liG_fkf^iXg_\iXe[@G:nflc[c`b\
kfZfekXZkpflYpgfjkfik\c\g_fe\kfgifdfk\Xe[Xjbpflifg`e`fefeflidX^Xq`e\jXe[j\im`Z\j%Gc\Xj\
k`Zb_\i\`]pflgi\]\iefkkf_\Xi]ifd@G: @G:dXpfZZXj`feXccpgXjjpfli[\kX`cjkfZXi\]lccpj\c\Zk\[
fi^Xe`jXk`fejjfk_Xkk_\pZXeZfekXZkpflYpk\c\g_fe\figfjkn`k_i\^Xi[jkfgifdfk`e^Xe[i\j\XiZ_`e^
k_\`igif[lZkjXe[j\im`Z\j%Gc\Xj\k`Zb_\i\`]pflgi\]\iefkkfY\ZfekXZk\[ @G:n_fglYc`j_8dXk\li
G_fkf^iXg_\inflc[c`b\kfj\e[pfl\dX`cjZfekX`e`e^f]]\ij]ifdZXi\]lccpj\c\Zk\[fi^Xe`jXk`fej
Xe[YiXe[j#gifdfk`e^Xe[i\j\XiZ_`e^k_\`igif[lZkjXe[j\im`Z\j%@]pflnXekkfi\Z\`m\\dX`cj
gc\Xj\k`Zb_\i\

((8

;@I<:K;<9@K>L8I8EK<<1K_`j^lXiXek\\`jf]]\i\[YpXccYXebjXe[Yl`c[`e^jfZ`\k`\jk_XkkXb\gXik
`ek_\;`i\Zk;\Y`kJZ_\d\%K_\\]ÔZ`\eZpXe[j\Zli`kpf]k_\JZ_\d\`jdfe`kfi\[Xe[gifk\Zk\[Yp
pflifneYXebfiYl`c[`e^jfZ`\kp%@]k_\XdflekjkfY\gX`[fik_\gXpd\ek[Xk\jZ_Xe^\#@G:D\[`X
Ck[n`ccefk`]ppflXkc\Xjkk\e[Xpj`eX[mXeZ\f]pfliXZZflekY\`e^[\Y`k\[fiXjfk_\in`j\X^i\\[%
@]Xe\iifi`jdX[\Yp@G:D\[`XCk[fipfliYXebfiYl`c[`e^jfZ`\kp#pflXi\^lXiXek\\[X]lccXe[
`dd\[`Xk\i\]le[]ifdpfliYiXeZ_f]k_\XdflekgX`[%PflZXeZXeZ\cX;`i\Zk;\Y`kXkXepk`d\
Ypni`k`e^kfpfliYXebfiYl`c[`e^jfZ`\kp%Gc\Xj\Xcjfj\e[XZfgpf]k_\c\kk\ikflj%;`i\Zk;\Y`kj
ZXeFECPY\gX`[k_ifl^_XYXebfiYl`c[`e^jfZ`\kp%Pfli;`i\Zk;\Y`kgi`Z\n`ccjkXpk_\jXd\]fi
fe\p\Xi]ifdjkXik[Xk\%

www.st
storemags.com & www.fantamag.com
st

฀=i\\gfjk1

7cWj[khF^eje]hWf^[hIkXiYh_fj_edi"
<H;;FEIJ9O'&,'">WomWhZi>[Wj^"
M[ijIkii[nH>',)8H$ 
EfjkXdgi\hl`i\[

ÄCZlD[[Zg

(* 
F==

i]ZXdkZgeg^XZ
I=>HBDCI=DCAN
HJ7H8G>7:GH:C?DN/

●G 
Xpfecp™(%,*Xe`jjl\$jXm`e^fm\iXk_`i[fek_\
Zfm\igi`Z\f]™)%+'
●<8JP;`i\Zk;\Y`k`ejkXcd\ekj
●@e$[\gk_#kiljk\[i\m`\njYpkfggif]\jj`feXcj

Fi[\iFec`e\1

nnn%XdXk\lig_fkf^iXg_\ijlYj%Zf%lb&`XgaZ
F]]\idXpmXipfec`e\

%

:Xcck_\Fi[\ic`e\/Xd$0gd

%-)*&'(&'(&

www.storemags.com & www.fantamag.com

KfgcXZ\Xefi[\iZXccXe[hlfk\Zf[\ ((8 ?Xm\pfligXpd\ek[\kX`cji\X[p%

27-29 Bolton Street Brixham,
South Devon TQ5 9BZ
Shop is Open 10am-5pm Monday-Friday.
9am-5pm Saturday. 10am-1pm Sunday.

Mail Order:

01803 852400

Email - info@mifsuds.com
Web - www.mifsuds.com
PHONE LINES OPEN MON -FRI 9am - 5.30pm, SAT 9am - 5pm, SUN 10am - 1pm

Shop & Phones Closed Saturday Only 1pm till 1.30pm

CANON PROFESSIONAL STOCKIST PRO HIRE SERVICE AVAILABLE CANON PROFESSIONAL STOCKIST

EOS DIGITAL SLR + KITS
1DS MKIII body . . . . . . . . . . . . . . . . . . . .£5498
1D MKIV body + FREE 580EXII ASK! .£4479

5D MKII body

7D body

£1729

£1237

5D MKII + 24-105

£2429

7D + 15-85 £1789
7D + 18-135

£1539

50D body . . . . . . . . . . . . . . . . . . .£699
50D + 17-85 F4/5.6 IS U . . . . . . . .£975
50D + 18-200 F3.5/5.6 . . . . . . . .£1099

EOS 500D body . £528 EOS 500D + 18-55 IS £577
500D + 18-200 F3.5/5.6 IS . . . . . .£877

EOS 450D body . £447 EOS 450D + 18-55 . .£497

POWERSHOT CAMERAS
G11 . . . £469 S90 . . . . . .£369
EF-S NON FULL FRAME LENSES
10-22 F3.5/4.5 USM . . . . . .£647
10-22 F3.5/4.5 USM DEMO £599
15-85 F3.5/5.6 IS U no box .£599
17-55 F2.8 IS USM . . . . . . .£849
17-85 f4/5.6 IS USM unboxed £339
18-55 F3.5/5.6 IS unboxed .£147
18-135 F3.5/5.6 IS U no box £349
18-200 F3.5/5.6 unboxed . .£449
55-250 F4/5.6 IS . . . . . . . . .£219
60 F2.8 Mac USM . . . . . . . .£336
EF LENSES
14 F2.8 L USM MKII . . . . .£1867
15 F2.8 Fisheye . . . . . . . . . .£599
16-35 F2.8 MKII L USM . . .£1169
17 F4 TSE L . . . . . . . . . . .£2147
17-40 F4 USM L . . . . . . . . .£618
20 F2.8 USM . . . . . . . . . . . .£429
24 F1.4 L II USM . . . . . . . .£1379
24 F2.8 . . . . . . . . . . . . . . . .£399
24 F3.5 L TSE MKII . . . . . .£1899
24-70 F2.8 L USM . . . . . . . . .£997
24-105 F4 L IS USM unboxed . .£799

28 F1.8 USM . . . . . . . . . . . . . . .£389
28 F2.8 . . . . . . . . . . . . . . . . . . . .£177
28-135 F3.5/5.6 S USM . . .£389
28-300 F3.5/5.6 L USM . . .£2169
35 F1.4 L U . . . . . . . . . . . .£1159
35 F2 . . . . . . . . . . . . . . . . .£228
45 F2.8 TSE . . . . . . . . . . .£1199
50 F1.2 L USM . . . . . . . . .£1299
50 F1.4 U .£297 50 F1.8 II . .£89
50 F2.5 Macro . . . . . . . . . . .£239
55-200 F4.5/5.6 II USM . . . .£139
65 MPE F2.8 . . . . . . . . . . . .£847
70-200 F2.8 IS L USM . . . . .£1598
70-200 F2.8 non IS L USM . . . .£1039
70-200 F4 L IS USM . . . . . .£966
70-200 F4 L USM . . . . . . . .£497
70-300 F4.5/5.6 DO IS U . . .£1049
70-300 F4.5/5.6 IS USM . . .£417
85 F1.2 L II . . . . . . . . . . . .£1798
85 F1.8 USM . . . . . . . . . . . .£310
90 F2.8 TSE . . . . . . . . . . .£1199
100 F2.8 IS L U macro . . . . .£789
100 F2.8 Macro USM . . . . . . . .£437
100 F2 USM . . . . . . . . . . . .£377
100-300 F4.5/5.6 USM 1 only . .£219

100-400 F4.5/5.6IS L USM . .£1279
580EXII
135 F2 L USM . . . . . . . . . . .£877
180 F3.5 L USM Macro . . .£1119 Flashgun
200 F2.8 II L USM . . . . . . .£639
300 F2.8 L IS USM . . . . . .£3699
300 F4 L IS USM . . . . . . . .£1177
400 F2.8 IS L USM . . . . . .£6599
400 F4 DO IS L USM . . . . . .£5399
400 F5.6 L USM . . . . . . . .£1119
500 F4 IS L USM . . . . . . . .£5555 24mm f3.5 L
600 f4 IS L USM . . . . . . . .£7299
Ext tube 12 .£67 Ext tube 25 £115 TSE
1.4x or 2x converter II each .£299
FLASH & ACCESSORIES
One
Angle finder C . . . . . . . . . . .£157
Compact batt pack CP-E4 . . .£127 Only
BGE2N Grip (20/30/40D) . . .£139
BG-E5 Grip (450D) . . . . . . . . .£119 180mm f3.5
BG-E6 Grip (5D MKII) . . . . . . .£210
BG-E7 grip (7D) . . . . . . . . . . .£189 L U Macro
MR 14EX.£469 MT-24 . . . .£747
430 EXII . . £197 580 EXII . . . . .£319
Off camera shoe cord OC-E3 . . .£48
LC5 wireless set . . . . . . . . .£289
STE2 Transmitter . . . . . . . . .£147

STE2
Transmitter

£147

£319

£999

£1119

300mm f2.8
L IS U

£3699

100mm f2.8
IS L U
macro

£789

NIKON PROFESSIONAL DEALER PRO HIRE SERVICE AVAILABLE NIKON PROFESSIONAL DEALER
DIGITAL ONLY LENSES
35 F1.8 G . . . . . . . . . . . . . .£187 500 F4 AFS VR . . . . . . . . .£5789
SB-900
10.5 F2.8 DX . . . . . . . . . . . .£489 35 F2 AF-D . . . . . . . . . . . . .£258 600 F4 AFS VR . . . . . . . . .£6766 14-24mm
10-24 F3.5/4.5 G AFS DX . .£649 45 F2.8 D PCE . . . . . . . . .£1399 TC14EII converter . . . . . . . .£289 f2.8 G ED
Flash
12-24 F4 DX . . . . . . . . . . . .£789 50 F1.4 AF-S G . . . . . . . . . .£289 TC17EII converter . . . . . . . .£289 AF-S
D3X body
D3S body

DIGITAL SLR + KITS
£4769

£3989

D700 body

D300s body

£1179
£1797
D90 body . . .£629 D90 + 18-105 F3.5/5.6 G£777
D5000 body . £487 D5000 + 18-55 VR. . . . .£548
D3000 body .£340 D3000 + 18-55 VR. . . . .£399

16-85 F3.5/5.6 AFS VR DX .£429
17-55 F2.8 DX . . . . . . . . . . .£959
18-55 F3.5/5.6 VR DX no box £179
18-105 F/3.5-5.6G ED VR no box £197
18-200 F3.5/5.6 VR DX II . . .£599
55-200 F4/5.6 VR DX . . . . .£249
LENSES
14-24 F2.8 G ED AF-S . . . .£1235
16 F2.8 AF-D Fisheye . . . . .£599
17-35 F2.8 D AFS . . . . . . .£1549
20 F2.8 AF-D . . . . . . . . . . .£447
24 F3.5 D PCE . . . . . . . . .£1399
24 F2.8 AF-D . . . . . . . . . . .£355
24-70 F2.8 G ED AF-S . . . .£1189
24-85 F2.8/4 . . . . . . . . . . . .£549
24-120 AF-S VR G . . . . . . .£539
28 F2.8 AFD . . . . . . . . . . . .£239

SIGMA PRO LENS STOCKIST
Many stocked in Pentax & Sony fits price may vary according to fit
4.5 F2.8 EX DC NAF only . . .£599
8 F3.5 DG EX CAF/NAF . . . .£649
10 F2.8 EX DC CAF/NAF . . .£449
10-20 F3.5 EX CAF & NAF . .£499
10-20 F4/5.6 EX DC CAF/NAF .£369
12-24 F4.5/5.6 . . . . . . . . . . . . .£579
15 F2.8 EX DG NAF/Sony . .£469
17-70 F2.8/4.5 DC . . . . . . . .£249
18-50 F2.8 EX DC Mac . . . . .£312
18-125 F3.8/5.6 OS DC NAF £199
18-200 F3.5/6.3 DC OS . . . . .£283
18-250 F3.5/6.3 DC OS . . . .£429

50 F1.4 AF-D . . . . . . . . . . .£239
50 F1.8 AF-D . . . . . . . . . . .£107
60 F2.8 AFS . . . . . . . . . . . .£399
60 F2.8 Micro AF-D . . . . . . .£339
70-200 F2.8 VRII . . . . . . . .£1999
70-300 F4.5/5.6 VR . . . . . . .£417
80-400 F4.5/5.6 VR AFD .£1199
85 F1.4 AFD . . . . . . . . . . . .£899
85 F1.8 AF-D . . . . . . . . . . .£297
85 F2.8 D PCE . . . . . . . . .£1399
85 F3.5 G VR . . . . . . . . . . .£499
105 F2.8 VR macro . . . . . . .£597
200 F2 G VR . . . . . . . . . . .£2899
200-400 F4 VR . . . . . . . . .£4689
300 F2.8 AFS VR . . . . . . . .£3799
300 F4 AF-S . . . . . . . . . . . .£979
400 F2.8 AFS VR . . . . . . . .£6249

TC20EII converter . . . . . . . .£289
FLASH & ACCESSORIES
MBD10 Grip (D300) . . . . . . .£199
MBD80 grip (D80) . . . . . . . .£139
MBD200 grip (D200) . . . . . .£129
DR-5 angle finder . . . . . . . . . .£259
DR-6 angle finder . . . . . . . . . .£259
SBR200 wireless rem S/Lite .£139
SBR1 ringflash . . . . . . . . . .£399
SBR1CI ringflash/command £597
SB-600 . . . . . . . . . . . . . . . .£217
SB-900 . . . . . . . . . . . . . . . .£317
SC-28 . . . . . . . . . . . . . . . . . .£66
SC-29 . . . . . . . . . . . . . . . . . .£77
SU-800 flash slave . . . . . . .£349
MC36 . . . . . . . . . . . . . . . . . .£99
MC30 . . . . . . . . . . . . . . . . . .£73

SIGMA PRO LENS STOCKIST

24-70 F2.8 EX IF DG HSM
CAF/NAF . . . . . . . . . . . . . . .£749
24-70 F2.8 EX DG CAF/PAF .£389
28-300 F3.5/6.3 DG CAF . . .£199
30 F1.4 EX CAF/NAF/PAF . . . .£319
50 F1.4 EX DG CAF/NAF . . . . .£375
50 F2.8 EX DG macro . . . . . .£238
50-150 F2.8 EX DC II . . . . . .£569
50-500 CAF/NAF/Sony . . . . .£849
70 F2.8 EX DG mac CAF/NAF .£360
70-200 F2.8 DG mac II NAF/PAF .£579
70-300 F4/5.6 DG OS . . . . . . . .£299
70-300 F4.5/5.6 APO DG mac
NIK AF not D40/60 etc . . . . . . . . .£99

£317

£1235

400mm f2.8
AFS VR

£6249
SD-9 Battery
Pack

£179

70-200mm F2.8
VR II

£1999

SK-6a Flash
Bracket

£199
One
Only

HOYA FILTERS Lots more see web

70-300 F4.5/5.6 APO DG mac . .£174
SIGMA EX DG FILTERS
70-300 F4.5/5.6 DG Macro . . .£99
UV
Circ Pol
SIZE
105 F2.8 EX DG macro . . . . . .£369 46mm
£23
£59
100-300 F4 EX DG CAF . . . .£699 52mm
£23
£59
120-300 F2.8 EX DG CAF/NAF . .£1999 55mm
£26
£69
120-400 F4.5/5.6 APO OS . .£597 58mm
£30
£74
150 F2.8 EX DG Mac CAF . .£529 62mm
£39
£79
£42
£139
150-500 F5/6.3 OS . . . . . . . . .£719 67mm
£53
£139
300 F2.8 EX DG CAF/NAF .£1999 72mm
£57
£149
300-800 F5.6 EX DG CAF . .£4799 77mm
£69
£169
500 F4.5 EX DG CAF . . . . .£3299 82mm
£99
£179
1.4x conv EX DG . . . . . . . . .£219 86mm
95mm
£139
£199
2x conv EX DG CAF/NAF . . .£187
£179
£269
EM-140 DG macro flash . . . .£329 105mm

49mm
52mm
55mm
58mm
62mm
67mm
72mm
77mm
82mm
86mm
95mm

UV /
Sky
£14
£16
£17
£19
£24
£30
£39
£47
£66
£85
£110

Pro1 D
UV or SKY
----£34
£36
£38
£44
£49
£55
£59
£69
---------

Pro1 D
Protect
----£30
£32
£34
£38
£42
£45
£49
£60
---------

Circ Pol

£36
£37
£40
£47
£62
£67
£72
£79
£110
£149
-----

Pro1
D Circ Pol
----£68
£70
£80
£85
£94
£114
£132
£149
£160
-----

QUALITY USED EQUIPMENT more on web - 3 Month warranty on most equipment Part exchange welcome
ALL DIGITAL
CANON
iDS MKIII . . . . . . .£2999
1DS MKII . . . . . . .£1499
1D MKIII box . . . .£1699
1D MKIIN body . . . .£999
1D MKII . . . . . . . . .£899
1DS body box . . . .£799
5D body box . . . . .£899
50D body M- . . . . .£639
40D body . . . . . . . .£479
30D body . . . . . . . .£349
450D body . . . . . . .£349
350D body . . . . . . .£219
BG-E1 . .£59 BG-E2 £99
BG-ED3. £79 BG-E3 £59
BG-E5 . . . . . . . . . . . .£99
BG-E2N . . . . . . . . .£110
WFT-E2 . . . . . . . . .£399
FUJI
S3 body . . . . . . . . .£299
S2 body box . . . . .£199
MINOLTA/SONY
Dynax 7D body . . .£299
Sony 70-200 F2.8 £1099
Sony 1.4x conv . . .£219
Sony angler finder . .£99
Minolta VC7D grip .£149
NIKON
D3 body box . . . .£2399
D700 body box M-£1549
D2X body box . . . .£749
D300 body . . . . . . .£899
D2HS body . . . . . .£599
D200 body . . . . . . .£479
D2HS body scruffy £399
D80 body . . . . . . . .£399
D70s body . . . . . . .£269
D70 body box . . . .£249
D50 body . . . . . . . .£199
MBD-80 M- box . . .£99

MBD-200 (D200) . . .£99
MBD-100 (D100) . . .£69
BRONICA see website
CANON AF
EOS 1V HS To clear £599
EOS 1V To clear . . .£499
EOS 1N HS body . .£199
EOS 1N body . . . . .£169
EOS 1 HS body . . .£169
EOS 3 body . . . . . . .£149
EOS 1 + BPE1 . . . . .£149
EOS 5 body nice . . . .£99
EOS 30 body . . . . . . .£69
EOS 3000V/300 each .£49
EOS 5 body scruffy . .£49
EOS 100 body . . . . . .£39
EOS 500/500N b/o ea .£39
10-22 F3.5/4.5 EFS £499
14 F2.8 L MKII M- £1499
17-40 F4 L . . . . . . .£499
17-85 F4/5.6 EFS IS U£249
18-55 F3.5/5.6 IS . . .£99
18-55 F3.5/5.6 . . . . .£49
18-200 F3.5/5.6 IS .£299
20-35 F2.8 L . . . . .£379
20-35 F3.5/4.5 U . .£199
22-55 F4/5.6 U . . . . . .£79
24 F3.5 TSE M- box .£799
24-70 F2.8 L box . . .£829
24-105 F4 IS L U M- .£699
28-70 F3.5/4.5 . . . . . .£69
28-135 F3.5/5.6 U IS .£249
35-70 F3.5/4.5 . . . . . .£69
45 F2.8 TSE M- . . . . .£849
55-200 F4.5/5.6 UII . . .£99
55-250 F4/5.6 IS EFS .£169
60 F2.8 EFS . . . . . . . .£299
65 F2.8 MPE . . . . . . . .£649
70-200 F2.8 IS U L . .£1269
70-200 F4 L U . . . . . .£429
70-210 F4 . . . . . . . .£89

70-300 F4.5/5.6 DO IS .£699
70-300 F4/5.6 IS . . . . .£329
75-300 F4.5/5.6 IS . .£229
100 F2 USM . . . . . . .£279
100-300 F4.5/5.6 U .£199
100-400 F4.5/5.6 IS L£999
135 F2 L U M- . . . .£699
180 F3.5 U L . . . . .£879
300 F2.8 L U non IS£1999
300 F4 L IS U M- . .£999
400 F4 DO . . . . . .£4199
500 F4 IS U L . . . .£4499
600 F4 L non IS slight
damage see web .£2799
1.4 or 2x ext MKI ea£179
2x extend MKII . . .£249
Trip mount AB . . . . .£69
SIGMA CAF
12-24 F4.5/5.6 EX DG £469
17-35 F2.8/4 EX box .£199
20 F1.8 EX DG box . .£299
50-150 APO DC .£329/379
50-500 F5/6.3 DG .£649
55-200 F4.5/5.6 DC .£59
70-300 F4/5.6 APO £119
100-300 F4 EX DG .£499
120-300 F2.8 EX DG .£1399
170-500 F5/6.3 . . .£399
300 F2.8 EX DG . . . .£1499
2x conv EX DG . . . . . .£169
2x conv EX . . . . . . . .£139
OTHER CAF
CZ 85mm F1.4 M- .£649
TAM 17-50 F2.8 XR DiII £269
TAM 19-35 F3.5/4.5 . . . .£69
TAM 28-200 XR Di . box£139
TAM 28-200 F3.5/5.6 XR £99
TAM 28-300 XR Di VC £279
TAM 28-300 XR Di . . .£189
TAM 55-200 DiII . . . . . .£60
TAM 90 F2.8 Di box . .£269

TAM 200-400 F5.6 . . .£299
TAM 200-500 F5/6/.3 .£499
Teleplus 2x MC7 . . .£69
FUJI MED FORMAT
250 F5.6 GX680 . . .£269
GX617 + 90 F5.6 .£2899
GA645 Pro . . . . . . .£299
GA645Zi box . . . . .£399
GW690 MKIII . . . . .£679
HASSELBLAD XPAN
XPan + 45 . . . . . . . . . .£949
XPan II body . . . . . . .£1099
90 F4 lovely . . . . . . . . .£479
HASSELBLAD 6x6
503CW chr + 80 CF
+ A12 chr or blk . .£1399
503CW chr + 80 CF
+ A12 + prism . . .£1499
503CW blk body . .£699
503CX + 80 CF F2.8
+ A12 chrome . . . .£799
503CX body . . . . .£399
501CM body blk . . .£399
500CM body chr . .£169
203FCW b/o chr . .£849
203FE chr b/o box .£849
Ground glass foc scr £99
PM90 prism . . . . . .£199
45° prism late . . . .£169
45° prism early . . . .£89
Prism PM45 . . . . . .£299
Chimney . . . . . . . . .£89
WLF early . . . . . . . .£49
A12 latest blk/chr . .£199
A12 late chr/blk . . .£149
A24 chr/blk latest . .£149
A24 chr late . . . . . . .£99
E12 chrome . . . . . .£199
Polaroid Back 100 . .£39
40 F4 CF FLE . . . .£999
50 F4 CF FLE . . . .£499

60-120 F4.8 FE M- . .£999
135 F5.6 CF + macro
bellows . . . . . . . . .£899
150 F4 CFI . . . . . . .£679
150 F4 CF . . . . . . .£399
160 F4.8 CB M- . . .£399
250 F5.6 T* . . . . . .£199
Ext tube 16E . . . . . .£79
Early macro bellows .£149
Teleplus 2x conv . . .£69
LEICA SLR
R7 body blk . . . . . .£349
16 F2.8 3 cam . . . .£399
35 F2 3 cam . . . . .£379
60 F2.8 macro . . . .£349
LEICA M/COMPACT
M6 TTL body .85 blk £849
24 F2.8 ASP blk . .£1499
28 F2.8 blk . . . . . .£POA
50 F2.8 blk M- . . . .£449
90 F2 blk . . . . . . . .£699
90 F2.8 blk M- . . . .£499
CF FLash . . . . . . . . .£69
CF-20 Flash . . . . . . .£99
M6 grip . . . . . . . . . .£39
Minilux Zoom . . . . .£249
MAMIYA 7 RF 6x7
7II body black . . . .£699
7 body . . . . . . . . . .£429
50 F4.5 + VF . . . . .£499
65 F4 box . . . . . . .£579
80 F4 box . . . . . . .£429
150 F4.5 L M- . . . .£399
150/210 VF . . . . . .£149
Polarising filter . . . .£110
Panoramic kit . . . . .£69
MAMIYA RB 6x7
RB Pro SD + 90 F3.5 KL
+ RFH . . . . . . . . . .£599
Pro SD body . . . . .£299
Pro S body . . . . . .£179

Pro SD RFH . . . . . . .£99
120 RFH . . . . . . . . .£49
Prism early . . . . . . .£99
Mag hood . . . . . . . .£69
37 F4.5 fisheye . . .£449
50 F4.5 C . . . . . . .£199
65 F4 KL mint box .£299
65 f4.5 C . . . . . . . .£199
90 F3.5 KL lovely . .£279
150 F4 mint box . .£199
180 F4.5 KL mint . .£299
180 F4.5 C . . . . . . .£149
210 F4.5 APO KL M- .£399
Ext tube 45 mint box .£99
MAMIYA RZ 6x7
RZ Pro II D + 110
+ RFH M- . . . . . . .£1499
RZ67 Pro II inc 110
+ RFH M- box . . . .£799
RZ67 Pro II inc
90 F3.5 + RFH . . . .£699
RZ Pro + 127 + RFH £499
RZ Pro II body . . . .£349
RZ Pro body . . . . .£199
NIKON AF
F6 body . . . . . . . . . . .£799
F5 body TO CLEAR .£249
F4 body box . . . . .£249
F100 body M- . . . .£199
F100 + MB-15 . . . .£229
F90X body . . . . . . . .£99
F90X + MB-10 . . . . .£99
F4 or F4S body ea .£149
F90 + MF-26 . . . . .£139
F90 or F801 body ea £49
F80 Body silver . . . .£79
F70/65/50 body ea .£49
12-24 F4 G box . . . . .£599
16-85 Mint box . . . .£399
16-85 F3.5/5.6 VR M-£379
17-55 F2.8 DX . . . . .£749

18-55 F3.5/5.6 VR . . .£99
18-70 F3.5/4.5 . . . . .£169
18-105 F3.5/5.6 VR .£169
18-135 F3.5/5.6 DX .£179
18-200 Mint box . . .£429
18-200 F3.5/5.6 AFS £369
20 F2.8 AFD . . . . . . .£329
24-120 F3.5/5.6 VR .£349
28-70 F2.8 AFS . . .£699
28-70 F3.5/4.5 D . . .£89
28-85 F3.5/4.5 AF . .£79
28-200 F3.5/5.6 D . .£179
50 F1.4 G Mint box .£249
55-200 F4/5.6 VR . . .£149
60 F2.8 AFD M- . . . .£229
70-200 F2.8 VR box£1199
70-300 F4.5/5.6 VR .£349
70-300 F4/5.6 AFD . .£199
70-300 F4.5/5.6 G . . .£79
80-20 F2.8 AFS box .£849
80-200 F2.8 1 touch .£379
80-400 VR . . . . . . . .£899
85 F1.4 D box . . . . .£699
85 F2.8 PC M- . . . . .£749
135 F2 DC . . . . . . .£749
300 F2.8 AF . . . . .£1499
300 F4 AFS . . . . . .£769
500 F4 AFS VR M- £5299
500 F4 AFS . . . . .£4199
600 F4 AFS . . . . .£4499
TC20E . . . . . . . . . .£199
CZ 25 F2.8 . . . . . .£549
SIGMA NAF
17-35 F2.8/4 EX DG .£249
17-35 F2.8/4 EX . . . .£219
18-50 F2.8 EX DC . .£199
18-125 F3.5/5.6 OS .£189
18-200 F3.5/6.3 OS .£299
18-200 F3.5/6.3 M- .£149
18-200 F3.5/6.3 . . . . .£99
24-135 F2.8/4.5 . . . .£199

28-70 F2.8 non EX . . .£99
28-200 F3.8/5.6 . . . . .£49
30 F1.4 scruffy . . . . . .£179
50-150 F2.8 EX DC . .£349
50-500 F4/6.3 scruffy .£499
55-200 F4/5.6 DC Mint £69
70-300 APO mac DG £129
80-400 F4.5/5.6 OS DG .£649
105 F2.8 EX DG . . . .£299
100-300 F4 EX DG M- £599
120-400 F4/5.6 DG .£499
150-500 F5/6.3 APO DG£599
170-500 F5/6.3 . . . . .£399
1.4x EX DG . . . . . . . .£169
TAMRON NAF
17-50 F2.8 XR DiII M-£249
18-200 F3.5/6.3 DiII .£119
18-250 F3.5/5.6 Di . .£249
19-35 F3.5/4.5 Mint . .£89
28-200 F3.5/6.3 XR . .£99
28-300 XR Di VC M- . .£299
55-200 F4/5.6 DiII . . .£49
70-210 F2.8 Di M- . .£499
75-300 F4/5.6 . . . . . . .£59
200-500 F5/6.3 Di £499/599
2x MC conv . . . . . . . .£49
Kenko 1.5x DG . . . . . .£79
NIKON FLASH
SB-22S . . . . . . . . . .£39
SB-23 .£39 SB-26 . .£99
SB-28 .£99 SB-30 . . .£69
SB-28DX . . . . . . . . . .£129
SB-80DX . . . . . . . . . .£129
SB-50DX . . . . . . . . .£69
SB-600 M- box . . .£159
SD-8A . . . . . . . . . . . .79
SK-6a mint box . . .£199
NIKON ACCESSORIES
MB-10 (F90X) . . . . .£29
MB-15 . £69 MB-16 .£29
MC12A .£12 MC12B £30

Family Run Pro Dealership with Friendly, Knowledgable Staff. Open 7 days per week. Prices inc VAT.
Commission Sale & Part Exchange Welcome. Collection Service Available. P&P Extra. E&OE.

We are happy to reserve new and used stock for customers planning to visit. Prices are based on current stock at time of compilation shown bottom left.
Prices are subject to change without notice so please check availability to avoid disappointment. We keep the website updated daily - latest prices always available on-line.

WE STOCK IN DEPTH! GITZO, MANFROTTO, TAMRAC, LOWEPRO, HOYA, KATA etc.
Subscribe to our email newsletter - be amongst
the first to learn about special offers and
promotions - ask us for details

Prices correct when compiled 14th December 2009. E&OE.

BUY ONLINE (new stock only) - CHECK LATEST PRICES - UPDATED DAILY:

www.mifsuds.com
(SECURE 1024 bit SSL ENCRYPTION)
www.storemags.com & www.fantamag.com

/`bWQcZObSR:12AQ`SS\a=\BSab

/`bWQcZObSR
:12aQ`SS\a

AV]]bW\UT`][O\c\cacOZO\UZSWaOU`SObeOgb]ORRW\bS`Sabb]
O\W[OUSO\RObWZbOPZS:WdSDWSeS\OPZSRaQ`SS\[OYSaWb[cQV
SOaWS`/\USZO<WQV]Za]\^cbaT]c`O`bWQcZObSRaQ`SS\ab]bVSbSab

E

,)2-WIXSYXJSVE
HE]¸WTLSXSKVETL]-
KSTVITEVIHXSKIXE
FMXQYHH]%XXLMWXMQISJ]IEVMX
YWYEPP]QIERW[IEVMRK[EPOMRKFSSXW
[EXIVTVSSJXVSYWIVWERHEHIGIRX
[EXIVTVSSJNEGOIX%WEVIWYPX[LIR-
GSQIEGVSWWEWGIRIXLEXFIKWXSFI
WLSXJVSQEPS[ERKPI-GERKIXHS[R
SRQ]ORIIWERHIPFS[WSVIZIR
PMIÂEXSRXLIKVSYRH[MXLSYXXSS
QYGLGSRGIVR³EPXLSYKL-YWYEPP]
HVE[XLIPMRIEXP]MRKMRTYHHPIW=IXMX
LEWXSFIWEMHXLEXWLSSXMRK[MXLXLI
GEQIVEEXKVSYRHPIZIP[LMPIYWMRK
XLIZMI[ÁRHIVXSGSQTSWIERMQEKI
MWE[O[EVHXLIVIRIZIVWIIQWXS
FIIRSYKLVSSQJSV]SYVGLMRERH
KIXXMRKXLILSVM^SRPIZIP[LIR]SYV

acPaQ`WPS&"#$%$%%%&

LIEHMWXSSRIWMHIMWRSQIERJIEX
-LEZIXSGSRJIWWXLIVIJSVIXS
JIIPMRKEGIVXEMRXLVMPP[LIR-¸QYWMRKE
0MZI:MI[IREFPIHGEQIVE[MXLEÂMT
SYXSVEVXMGYPEXIHWGVIIR-XIREFPIW
QIXSXEOIPS[PIZIPWLSXWSRXLSWI
SGGEWMSRW[LIR-¸ZIXEOIRXLIGEQIVE
[MXLQIFYXTLSXSKVETL]MWR¸XXLI
WSPITYVTSWISJXLIXVMTERH-¸Q
SJXIRHVIWWIHMRGPSXLIWXLEX-HSR¸X
TEVXMGYPEVP][ERXXSKIXGEOIHMRQYH
%REVXMGYPEXIHWGVIIRKMZIW]SYXLI
STTSVXYRMX]XSI\TPSVIXLI[SVPHJVSQ
EHMJJIVIRXERKPI6EXLIVXLERLEZMRK
XSWIIXLIMQEKIMR]SYVLIEHFIJSVI
]SYKIXHS[RSRXLIKVSYRHYTSR
]SYVXMTXSIWSVWXEVXVIEGLMRKSYXXS
ERE[O[EVHP]TSWMXMSRIHWYFNIGX]SY
GERWII[LEX¸WSRSJJIVFIJSVILERH-

VIEPP]IRNS]YWMRKEVXMGYPEXIHWGVIIRW
ERHEWXLIVIEVIQSVIXMPXEFPI0'(
WGVIIRWXLERIZIVEZEMPEFPISRL]FVMH
ERH(706GEQIVEW-XLMROMX¸WXMQIXS
ÁRHSYX[LMGLSJJIVWXLIFIWXZMI[-R
XLMWXIWX-[MPPFIPSSOMRKEXXLI2MOSR
(3P]QTYW)4EREWSRMG
0YQM\(1'+ERH7SR]%PTLE

@SÀSQbW]\

3RISJXLIFMKKIWXSFWXEGPIWXSYWMRK
ER0'(XSGSQTSWIMQEKIWMWXLI
VIÂIGXMSRWXLEXGERETTIEVSRXLI
WGVIIRMRFVMKLXPMKLX%XSRITSMRX
[LIRWLSSXMRKMRFVMKLX[MRXIVWYR
[MXLXLI4EREWSRMG0YQM\(1'+
JSVMRWXERGI-JSYRHXLEX-LEHE
GPIEVIVZMI[SJQ]S[RJEGIXLER-HMH
SJXLIWGIRI-[EWTLSXSKVETLMRK

%WXLIWYRMWR¸XEXMXWFVMKLXIWXEX
XLMWXMQISJ]IEV-GSQTEVIHXLIZMI[
SRIEGLSJXLIGEQIVEW¸0'(WGVIIRW
YRHIVXLIPMKLXJVSQETEMVSJ-RXIVÁX
7YTIV'SSPPMXILIEHWMRXLIWXYHMS
EW[IPPEWMRHMVIGXWYRPMKLXSYXWMHI-R
FSXLGEWIW-JSYRHXLEXXLIFIWXZMI[
[EWTVSZMHIHF]XLI3P]QTYWWGVIIR
GPSWIP]JSPPS[IHF]XLI7SR]WGVIIR
[MXLXLI4EREWSRMG0'(ERHXLIRXLI
2MOSRQSRMXSVFVMRKMRKYTXLIVIEV
%PXLSYKL-JSYRHXLEXEPPJSYV
WGVIIRWLEZIE[MHIZMI[MRKERKPIXLI
WEXYVEXMSRSJXLI4EREWSRMGQSRMXSV
HVSTWEPMXXPIJYVXLIVXLERXLISXLIVW
[LIRWIIRJVSQERERKPIGPSWIXS 
„,S[IZIVXLMWMWR¸XE
TEVXMGYPEVP]QENSVMWWYIEW
XLI[LSPITSMRXSJLEZMRKER 

8O\cO`g 7eeeO[ObSc`^V]b]U`O^VS`Q]cY7#%

www.
ww
w.st
w.
stor
st
orem
or
emag
em
ags.
ag
s.co
s.
com
co
m & ww
www.
w.fa
w.
fant
fa
ntam
nt
amag
am
ag.c
ag
.com
.c
om

=\BSab/`bWQcZObSR:12AQ`SS\a

BVSQO[S`Oa

7VOdSQV]aS\[]RSZaT`][=Zg[^ca<WY]\>O\Oa]\WQO\RA]\gb]aSSeVWQV[]RSZVOabVS
PSabaQ`SS\OdOWZOPZST]`bV]aSeV]eO\bb]aV]]bT`][c\cacOZO\UZSacaW\UbVS:WdSDWSeTOQWZWbg
=Zg[^ca3$ bSabSRW\/>&/^`WZ '

>O\Oa]\WQ:c[Wf2;15bSabSRW\/>!2SQS[PS` &

<WY]\2#bSabSRW\/>!;Og '

A]\g/Z^VO##bSabSR <]dS[PS` '

3P]QTYW[EWXLIÁVWXGSQTER]XSVIGSKRMWIXLITSXIRXMEPSJEJYPPGSPSYV
0MZI:MI[W]WXIQERHXLI)[LMGLWXEVXIHXLI[LSPI0MZI:MI[FEPP
VSPPMRKLEHEXMPXEFPIWGVIIR%PXLSYKLXLIQERYJEGXYVIV¸WWYFWIUYIRX
(706WJIEXYVIH0MZI:MI[XIGLRSPSK]XLI]LEHÁ\IHWGVIIRWERH
EVXMGYPEXIHQSRMXSVWHMHR¸XVIETTIEVSRER3P]QTYWGEQIVEYRXMPXLI
)MR8LMWGEQIVELEWEMR8*8 ,]TIV'V]WXEP--- WGVIIR
[MXLHSXW TM\IPW ERHEZEVMERKPINSMRXSRMXWPIJXLERH
WMHI8LMWNSMRXEPPS[WXLIWGVIIRXSFITYPPIHSYXXLVSYKL„WSMXGER
FIWIIRJVSQMRJVSRX YWIJYPJSVWIPJTSVXVEMXW ERHXLIRVSXEXIHYTSV
HS[RXSTVSZMHIEZMI[JVSQEFSZISVFIPS[XLIGEQIVE

8LI2MOSR(MWXLISRP]2MOSR(706WSJEVXSJIEXYVIER
EVXMGYPEXIH0'(WGVIIRFYXJSVE2MOSRGEQIVEMXLEWEPS[VIWSPYXMSR
QSRMXSV[MXLNYWXHSXW TM\IPW 2MOSRMRXVSHYGIH 
HSX TM\IP WGVIIRW[MXLMXW(ERH(MR
ERHXLMWVIWSPYXMSRMWJEWXFIGSQMRKWXERHEVHJSVIRXLYWMEWXPIZIP
(706W%PXLSYKLXLIMRWGVIIRSRXLI(MWEREVXMGYPEXIH
VEXLIVXLERÂMTSYXSVXMPXEFPIYRMXMXMWVEXLIVYRYWYEPMRLEZMRKXLI
ÂI\MFPINSMRXEXXLIFEWISJXLI
WGVIIR;LIRWLSSXMRKEFSZI
LIEHLIMKLXXLIWGVIIRMW
WMQTP]XMTTIHJSV[EVH
JVSQXLIXSTFYX
[LIRWLSSXMRKJVSQ
EPS[ERKPIXLI
QSRMXSVQYWXFI
TMZSXIHJSV[EVH
ERHXLIRVSXEXIH
WSMXGERFIZMI[IH
JVSQEFSZI

8LI4EREWSRMG0YQM\(1'+[EWXLIÁVWX1MGVS*SYV8LMVHWGEQIVE
ERHMXSJJIVW(706WX]PILERHPMRKMREWQEPPIVFSH][MXLXLIWEQIWM^IH
*SYV8LMVHWX]TIWIRWSVEWXLI3P]QTYW)'VYGMEPP]YRPMOIEXVYI
(706MXLEWRSQMVVSVWSERSTXMGEPXLVSYKLXLIPIRWZMI[ÁRHIVMWRSX
TSWWMFPI-RWXIEHXLIGEQIVELEWERIPIGXVSRMGZMI[ÁRHIV ):* ERHER
EVXMGYPEXIHMR8*80'(WGVIIR[MXLHSXW TM\IPW 
0MOIXLI3P]QTYW)XLI(1'+LEWEREVXMGYPEXIHNSMRXSRMXW
PIJXWMHI[LMGLQIERWMXQYWXFIW[YRKSYXXSXLIWMHIFIJSVIMXGERFI
ZMI[IHJVSQEFSZISVFIPS[

8LI7SR]%PTLEMWEPMXXPIHMJJIVIRXJVSQXLISXLIVGEQIVEWMRXLMW
XIWXFIGEYWIMXWMRHSX TM\IP 0'(WGVIIRLEW
EXMPXMRKQIGLERMWQVEXLIVXLEREREVXMGYPEXIHNSMRX8LMWEPPS[WXLI
WGVIIRXSFIERKPIHYTSVHS[RJSVIEW]ZMI[MRKJVSQEFSZISVFIPS[
FYXYRPMOIXLISXLIVGEQIVEWMRXLMWXIWXXLIQSRMXSVGERRSXFIZMI[IH
JVSQXLIJVSRXSJXLIGEQIVE9RPMOIXLIWGVIIRWSRSXLIVGEQIVEW
MRXLMWXIWXMXEPWSSRP]TVSZMHIWERMQTVSZIHZMI[SJXLIWGIRI[LIR
WLSSXMRKMRPERHWGETIJSVQEX
-XWLSYPHEPWSFIRSXIHXLEX[LMPIXLISXLIVGEQIVEWMRXLMWXIWXSJJIV
ERETTVS\MQEXIP] ÁIPHSJZMI[SRXLIMV0'(WGVIIRWXLI7SR]
%PTLEMWVIWXVMGXIHXS
EVSYRH GSZIVEKI
8LMWMWFIGEYWIXLI
0MZI:MI[MQEKI
MWKEXLIVIHSRE
WQEPPIVWIGSRHEV]
WIRWSV

#&7eeeO[ObSc`^V]b]U`O^VS`Q]cY7 8O\cO`g 

www.storemags.com & www.fantamag.com

acPaQ`WPS&"#$%$%%%&

/`bWQcZObSR:12AQ`SS\a=\BSab

0YQM\(1'+ERHMXSYXTIVJSVQWXLI
2MOSR(¸WQSRMXSV
;LMPIXLIQSRMXSVSRXLI2MOSR
(HSIWVIZIEPWYJÁGMIRXHIXEMP
XSEPPS[QERYEPJSGYW-ÁRHXLEX-
KVEHYEPP]LSQIMRSRXLIGSVVIGXJSGYW
TSMRXVSXEXMRKXLIPIRWVMRKFEGOERH
JSVXLYRXMP-HIGMHIXLEXXLIWYFNIGXMW
EWWLEVTEWMXGERFI

1]\QZcaW]\

-LEHXSPIERSYXSZIVXLI[EXIVJVSQ
ETMIVXSXEOIXLMWWLSXFYX-LEHE
GPIEVZMI[MRXLI)¸W0'(WGVIIR
EVXMGYPEXIHWGVIIRMWXLEXMXGER
FIZMI[IHWXVEMKLXSRJVSQE
[MHIVERKISJERKPIW

;O\cOZT]QcaRSbOWZ

3RISJXLIKVIEXXLMRKWEFSYX
YWMRK0MZI:MI[XIGLRSPSK][LIR
TLSXSKVETLMRKQEGVSERHWXMPPPMJI
WYFNIGXWMWXLEXMXIREFPIWXLITSMRXSJ
JSGYWXSFITPEGIHZIV]TVIGMWIP]8LMW
MWYWYEPP]QEHIIEWMIVF]XLIQEKRMÁIH
ZMI[W X]TMGEPP]YTXS\ XLEXEVI
TSWWMFPISRQSWX0MZI:MI[GETEFPI
(706ERHL]FVMHGEQIVEW3FZMSYWP]
XLIGPEVMX]SJXLIHIXEMPSRXLIWGVIIR
MWEJJIGXIHF]XLIFVMKLXRIWWERH

-LIPHXLI3P]QTYW)[MXL
XLIQQJEXQQEWGPSWI
XSXLI[EXIVEW-HEVIHJSVXLMWWLSX

acPaQ`WPS&"#$%$%%%&

HMVIGXMSRSJXLIEQFMIRXPMKLX[LMGL
GEYWIWVIÂIGXMSRWFYX[LIRZMI[IH
WXVEMKLXSR-KIRIVEPP]JSYRHXLEXXLI
7SR]%PTLE¸WWGVIIRTVSZMHIW
XLIGPIEVIWXZMI[8LMWWGVIIRLEWXLI
LMKLIWXVIWSPYXMSRMRXLMWXIWXERH
[LIRGSQFMRIH[MXLE\QEKRMÁIH
ZMI[ERHVIPEXMZIP]LMKLGSRXVEWX
TMGXYVIMXMWELYKILIPT[LIR
JSGYWMRKQERYEPP]
%PXLSYKLMXLEWEVIWSPYXMSRSJSRP] 
HSXWXLI,]TIV'V]WXEP---
0'(WGVIIRSJXLI3P]QTYW)MW
ZIV]MQTVIWWMZI-RQER]WMXYEXMSRWXLI
3P]QTYWWGVIIRMWSRETEV[MXLXLI 
HSXWGVIIRSRXLI4EREWSRMG

-J-SRP]TPERRIHXSWLSSXPS[SV
LMKLPIZIPMQEKIWMRXLIPERHWGETI
JSVQEX-[SYPHLEZIRSLIWMXEXMSR
MRSTXMRKJSVXLI7SR]%PTLE-R
XLILSVM^SRXEPJSVQEXMXTVSZMHIWER
I\GIPPIRXZMI[[MXLTPIRX]SJFMXIXLEX
QEOIWQERYEPJSGYWMRKEFVII^I
9RJSVXYREXIP]XLIXMPXMRKQIGLERMWQ
MWSJRSEWWMWXERGI[LIRWLSSXMRK
MQEKIWMRXLIYTVMKLXJSVQEXERH
EPXLSYKLXLIWGVIIRLEWE[MHIERKPI
SJZMI[XLIMQEKIMWJSVIWLSVXIRIH
%WXLMWXIWXLEWVIZIEPIHXLIVI
MWQSVIXSEKSSH0'(WGVIIRXLER
NYWXELMKLTM\IPGSYRX8LIPS[IV
PIZIPSJVIÂIGXMSR[MHIERKPISJZMI[
ERHKSSHGSPSYVWEXYVEXMSRSJXLI
3P]QTYW)¸W,]TIV'V]WXEP---
0'(QSRMXSVTPE]ERMQTSVXERXTEVX
MRQEOMRKMXTPIEWERXXSYWI)ZIR
XLSYKLMXEGXYEPP]LEWXLINSMRXPS[IWX
0'(TM\IPGSYRXMRXLMWXIWXXLI
WGVIIR¸WEPPVSYRHTIVJSVQERGIMW
ZIV]KSSHERHXLIVIJSVIMXMWQ]
QSRMXSVSJGLSMGIMRXLMWXIWX

1O\]\
3=A%2
3JXLIÁ\IH0'(WGVIIRWSR
SXLIV(706WXLIYRMXSRXLI
'ERSR)37(MWSRISJXLI
FIWX-LEZIYWIH8LISTXMGEP
IPEWXMGQEXIVMEPXLEX'ERSR
LEWWERH[MGLIHFIX[IIRXLI
PMUYMHGV]WXEPWERHXLIKPEWW
GSZIVLIPTWXSOIITHS[R
MRXIVREPVIÂIGXMSRWERHXLI 
HSXW 
TM\IPW IRWYVITPIRX]SJ
HIXEMPMWZMWMFPI
%PXLSYKLXLIWGVIIRLEW
E[MHIERKPISJZMI[ „ 
XLIWGIRIETTIEVWWLSVXIRIH
ERHXLMWQEOIWEGGYVEXI
GSQTSWMXMSRXVMGO]-XMWEPWS
MQTSWWMFPIXSJSGYWQERYEPP]
ERHZIV]HMJÁGYPXXSPSGEXI
XLIGSVVIGX%*TSMRX

-XVMIHGSQTSWMRKXLMWMQEKIMR
XLIPERHWGETIJSVQEXFYXMXHMHR¸X
[SVOEW[IPPEWMRXLIYTVMKLX
JSVQEXTYXXMRKXLI%PTLE
YWIVEXEHMWEHZERXEKI 
8O\cO`g 7eeeO[ObSc`^V]b]U`O^VS`Q]cY7#'

www.storemags.com & www.fantamag.com

To advertise please call 020 3148 2516 Fax 020 3148 8155 e-mail dave_stone@ipcmedia.com
Dale Photographic .........................................82

Park Cameras Ltd ...................... 71-75, Cover: iii
Portrait Professional ..........................................4

Ace Cameras ..................................................86

Ffordes Photographic Ltd. ......................... 80-81

Premier Ink ............................................... 76-79

Grays of Westminster.......................... 16-17, 44

Sigma Imaging (UK) Ltd ..........................Cover:ii

Alpha Digital Services Ltd ..............................84
Aperture Photographic....................................70

Society of Wedding and
Blue Dimensions International Ltd .................44

Campkins Camera Centre ...............................86
Camtech .........................................................61

The Imaging Warehouse .................................44

Portrait Photographers ..................................38

Interfit Photographic Ltd ........................Cover:iv

SRS Ltd ...........................................................83

Intro 2020 Ltd ................................................20

Studio Kit Direct .............................................51

Just Ltd ...........................................................51

Warehouse Express................................... 62-69

London Camera Exchange ..............................60

York Cameras (London) Ltd.............................85

Mifsud Photographic ......................................56

Classifieds .............. 87-89

Cash4cameras ................................................86
Clifton Cameras ................................................9
Clikpic............................................................35
Collectable Cameras.......................................85

60

| www.amateurphotographer.co.uk | 2 January 2010

www.storemags.com & www.fantamag.com

subscribe 0845 676 7778

Digital Photography
CANON EOS 1DS MK II COMPLETE ........................................MINT-BOXED £1,599.00
CANON EOS 1D MK III BODY KIT (VERY LOW USE)MINT BOXED AS NEW £1,799.00
CANON EOS 1D MKII BODY KIT (LOW USE)............................MINT BOXED £1,195.00
CANON EOS 1D MKII BODY COMPL WITH ALL ACCS ..........EXC+++BOXED £795.00
CANON EOS 5D MK II COMPLETE WITH ALL ACCS ..............MINT BOXED £1,575.00
CANON EOS 5D BODY COMPLETE WITH ALL ACCS ................MINT BOXED £899.00
CANON EOS 10D BODY WITH ACCESSORIES........................EXC+++BOXED £169.00
CANON EOS 20D BODY COMPLETE WITH ALL ACCS ..............MINT BOXED £275.00
CANON EOS 40D BODY COMPLETE WITH ALL ACCS ..............MINT BOXED £475.00
CANON EOS 350D BODY KIT COMPLETE................................................MINT £249.00
CANON EOS 400D/REBEL XTi + CAN 18-55 + GRIP ..............................MINT- £329.00
CANON EOS 400D LENS KIT WITH CAN 18-55 LENS ................MINT BOXED £329.00
CANON EOS 400D BODY WITH ALL ACCS..............................EXC+++BOXED £279.00
CANON 220 EX SPEEDLITE ............................................................MINT-CASED £79.00
CANON 420 EX SPEEDLITE ..........................................................MINT-CASED £129.00
CANON 430 EX SPEEDLITE..........................................................MINT BOXED £149.00
CANON 430 EX SPEEDLITE ..........................................................MINT-CASED £135.00
CANON 550 EX SPEEDLITE ........................................................MINT BOXED £199.00
SIGMA EM-140 DG EO-ETTL MKII MACRO FLASH ....MINT BOXED AS NEW £215.00
CANON BG-E1 GRIP FOR EOS 300D ............................................MINT BOXED £65.00
CANON BG-E3 BATT GRIP FOR 350D AND 400D ......................................MINT £65.00
CANON BG-E4 GRIP FOR EOS 5D ............................................................MINT £119.00
CANON RS 80-N3,1Ds MKIII, 1D MKIII, 5D MKII, 50D ................................MINT £35.00
CANON RS 60-E3 REMOTE fits 500D,450D,1000D etc................................MINT £15.00
CONTAX SL300R T* DIGITAL ........................................................MINT BOXED £129.00
FUJI S3 BODY KIT COMPLETE ....................................................MINT BOXED £349.00
LEICA D-LUX 2 KIT COMPLETE ..................................................MINT BOXED £169.00
NIKON D2XS BODY KIT COMPLETE..........................MINT BOXED AS NEW £1,295.00
NIKON D2X BODY KIT COMPLETE ............................................EXC++BOXED £895.00
NIKON D2HS BODY KIT COMPLETE............................................MINT BOXED £799.00
NIKON D1 BODY KIT COMPLETE ................................................MINT BOXED £445.00
NIKON D700 BODY COMP WITH ALL ACCESSORIES........MINT BOXED AS NEW £1,595.00
NIKON D300 BODY COMP WITH ALL ACCESSORIES................MINT BOXED £899.00
NIKON D200 BODY KIT COMPLETE ............................MINT BOXED AS NEW £499.00
NIKON D80 BODY KIT COMPLETE (SUPERB) ............................MINT BOXED £395.00
NIKON D70 BODY COMPLETE WITH ACCESSORIES ..............................MINT £199.00
NIKON MB - D10 BATT GRIP FOR D700/D300S/D300 MINT BOXED AS NEW £225.00
NIKON FIT (MEIKE) BATT GRIP FOR D700/D300S/D300 ........MINT BOXED AS NEW £75.00
NIKON MB-200 GRIP FOR D200 ....................................................MINT BOXED £89.00
NIKON SB 50DX SPEEDLIGHT ......................................................MINT BOXED £89.00
NIKON SB 28DX SPEEDLIGHT....................................................EXC+++CASED £99.00
NIKON SB 400 SPEEDLIGHT ..........................................MINT BOXED AS NEW £95.00
NIKON SB 600 SPEEDLIGHT ........................................................MINT BOXED £169.00
NIKON BL - 3 TO USE EN-EL4/A IN MB-D10..................................MINT CASED £23.00
CAPTURE NX SOFTWARE COMPLETE ........................................MINT BOXED £49.00
NIKON EN-EL4 BATTERY (FOR D2X/S/F6 etc) ..............................MINT BOXED £49.00
NIKON EN-EL3E LATEST BATT FOR D300/D200 etc ....................MINT BOXED £45.00
NIKON ML - L3 REMOTE RELEASE ..............................................MINT AS NEW £11.00
NIKON ML3 REMOTE TRANS & RECEIVER COMP ....................MINT BOXED £150.00
NIKON MC30 REMOTE RELEASE ..................................................MINT BOXED £49.00
NIKON MC-DC1 REMOTE RELEASE FOR D90/D70etc ................MINT BOXED £24.00
OLYMPUS E3 BODY KIT ................................................MINT BOXED AS NEW £749.00
OLYMPUS 50mm f2 MACRO ZUIKO ED DIG LENS ......MINT BOXED AS NEW £389.00
OLYMPUS 150mm f2 ZUIKO ED DIGITAL ..................MINT BOXED AS NEW £1,299.00
PENTAX D-BG3 GRIP FOR PENTAX K200D ..................................MINT BOXED £99.00
SIGMA 300mm f2.8 APO DG FOR PENTAX ..............MINT BOXED AS NEW £1,195.00
RICOH GR DIGITAL II + CREATIVE KIT 10.1mp............MINT BOXED AS NEW £345.00
RICOH GR DIGITAL 8.1 Mp COMPLETE ("UNUSED")..MINT BOXED AS NEW £169.00
SEE BELOW LOTS MORE DIGITAL COMPATIBLE LENSES

Canon Autofocus
CANON EOS 1V HS BODY............................................................MINT-BOXED £799.00
CANON EOS 1V BODY ..................................................................MINT-BOXED £699.00
CANON EOS 1NRS BODY..............................................................MINT-BOXED £499.00
CANON EOS 3 BODY
....................................................EXC+++BOXED £189.00
CANON EOS 5 BODY ..............................................................................EXC+++ £65.00
CANON EOS 50E BODY ..................................................................MINT BOXED £85.00
CANON EOS 500N BODY ............................................................................MINT- £59.00
CANON EOS 650 + 35 - 80 CAN USM LENS ..............................................MINT £79.00
CANON EOS 600 BODY................................................................................MINT £79.00
CANON EOS RT BODY (PELICAL MIRROR) ............................................MINT- £119.00
CANON 17 - 35mm f2.8 USM "L" ..............................................................EXC++ £599.00
CANON 17 - 40mm f4 USM "L" ......................................MINT BOXED AS NEW £499.00
CANON 24 - 105mm f4 USM "L" IMAGE STABILISER ..................MINT CASED £699.00
CANON 24 - 105mm f4 USM "L" IMAGE STABILISER ..MINT BOXED AS NEW £765.00
CANON 28 - 300mm f3.5/5.6 USM "L" IS....................MINT BOXED AS NEW £1,775.00
CANON 35 - 350mm f3.5/5.5 USM "L" ......................................MINT CASED £1,295.00
CANON 70 - 200mm f4 USM "L" ................................................................MINT £425.00
CANON 70 - 300mm f4.5/5.6 USM DO IMAGE STABIL MINT BOXED AS NEW £799.00
CANON 100 - 400mm f4.5/5.6 USM "L" IMAGE STAB ..MINT BOXED AS NEW £999.00
CANON 14mm f2.8 USM "L" (SUPERB) ....................................MINT CASED £1,299.00
CANON 14mm f2.8 USM "L" (SUPERB) ..................................................MINT £1,175.00
CANON 35mm F1.4 USM "L" ........................................................MINT BOXED £899.00
CANON 180mm f3.5 USM "L" MACRO + HOOD..........................MINT BOXED £945.00
CANON 300mm f4 USM "L" IMAGE STABILISER ........................MINT CASED £945.00
CANON 20mm f2.8 USM ..............................................................MINT BOXED £315.00
CANON 20mm f2.8 USM ............................................................................MINT £299.00
CANON 24mm f2.8 EF ................................................................................NEW £299.00
CANON 24mm f2.8 EF ................................................................................MINT £265.00
CANON 28mm f2.8 EF....................................................................MINT BOXED £129.00
CANON 50mm f1.8 MARK 1
(RARE LENS)........................................MINT £115.00
CANON 50mm f1.8 MARK II ............................................................MINT BOXED £69.00
CANON 60mm f2.8 EFS USM MACRO LENS................MINT BOXED AS NEW £299.00
CANON 100mm f2.8 USM MACRO ................................MINT BOXED AS NEW £365.00
CANON 10 - 22mm f3.5/4.5 USM EFS ........................................................MINT £499.00
CANON 17 - 85mm f4/5.6 IMAGE STABILISER ..........................................MINT £249.00
CANON 18 - 55mm ff3.5/5.6 EFS MK II ........................................................MINT £49.00
CANON 18 - 55mm ff3.5/5.6 IMAGE STABILISING ..........MINT BOXED AS NEW £95.00
CANON 20 - 35mm f3.5/4.5 USM................................................................MINT- £195.00
CANON 28 - 135mm f3.5/5.6 USM IM STABILISER ......................MINT BOXED £285.00
CANON 35 - 105mm f3.5/4.5 EF ZOOM........................................................MINT £75.00
CANON 70 - 210mm f3.5/4.5 USM ..............................................................MINT- £99.00
CANON 75 - 300mm f4/5.6 MK II ..................................................MINT + HOOD £99.00
CANON 75 - 300mm f4.5/5.6 EF MK III ........................................MINT BOXED £129.00
CANON 75 - 300mm f4.5/5.6 EF USM MK III ............................................MINT £159.00
CANON 70 - 300mm f4.5/5.6 USM IMAGE STABILISER ..............MINT BOXED £325.00
CANON 75 - 300mm f4.5/5.6 USM IMAGE STABILISER............................MINT £299.00
CANON 100 - 300mm f4.5/5.6 EF USM ........................................MINT BOXED £169.00
CANON 100 - 300mm f5.6 EF MACRO ........................................................MINT £99.00
CANON EF 1.4x EXTENDER ........................................................MINT CASED £199.00
CANON PB E2 BOOSTER FOR EOS 1V/EOS3 etc ....................MINT BOXED £129.00
CANON PB E2 BOOSTER FOR EOS 1V/EOS3 etc ....................MINT - BOXED £99.00
CANON PB E1 BOOSTER FOR EOS 1/1N ................................................EXC++ £75.00
CANON E1 NI CAD CHARGER & NI CAD EOS 1N/RS ............................MINT- £165.00
CANON VG 10 BATT GRIP FOR EOS 5 ......................................MINT - BOXED £20.00
CANON 540 EZ FLASH + INST......................................................MINT CASED £109.00
CANON 540 EZ FLASH + INST ......................................................MINT- CASED £99.00
CANON 430 EZ FLASH....................................................................MINT CASED £75.00
KENCO TELEPLUS PRO 300 DG 1.4 x CONVERTER..MINT BOXED AS NEW £125.00
KENCO MC7 DG 2 x CONVERTER CAN........................................MINT BOXED £89.00
SIGMA 20mm f1.8 EF DG ASPHERIC RF (LATEST) ....................MINT BOXED £345.00
SIGMA 28mm f1.8 EX DG (LATEST) UNUSED ............................MINT BOXED £279.00
SIGMA 105mm f2.8 EX DG MACRO (LATEST) ............MINT BOXED AS NEW £325.00
SIGMA 150mm f2.8 EX DG MACRO HSM (LATEST)..................MINT BOXED £475.00
SIGMA 180mm f3.5 APO MAC DG EX HSM (LATEST)..MINT BOXED AS NEW £599.00
SIGMA 500mm f4.5 EX HSM APO + HOOD + CASE ............EXC+++CASED £2,695.00
SIGMA 600mm f8 MIRROR LENS MACRO 1:3 + HOOD ............MINT CASED £295.00
SIGMA 12 - 24mm f4.5/5.6 EX DG HSM (LATEST)........MINT BOXED AS NEW £465.00
SIGMA 18 - 200mm f3.5/6.3 DC ....................................MINT CASED + HOOD £149.00
SIGMA 24 - 70mm f2.8 EX DG MACRO ........................................MINT BOXED £295.00
SIGMA 50 - 150mm f2.8 MKII APO EX DC HSM ..........................MINT BOXED £459.00
SIGMA 50 - 500mm ff4/6.3 EX DG (LATEST) ..............................MINT CASED £799.00

SIGMA 55 - 200mm f4/5.6 DC ......................................................................MINT £69.00
SIGMA 70 - 200mm f2.8 EX A/F HSM APO + HOOD ................................MINT £375.00
SIGMA 70 - 200mm f2.8 EX A/F HSM MACRO DG ....................MINT BOXED £499.00
SIGMA 70 - 300mm f4/5.6 DL MACRO + HOOD ..........................................MINT £69.00
SIGMA 70 - 300mm f4/5.6 DG SLD OPT STABILISER ..MINT BOXED AS NEW £245.00
SIGMA 100 - 300mm f4 EX IF DG (LATEST) ................................MINT-BOXED £875.00
SIGMA 120 - 300mm f2.8 APO EX IF HSM ................MINT BOXED AS NEW £1,695.00
TAMRON 90mm f2.8 SP A/F MACRO 1:1 ..................................................MINT £199.00
TAMRON 17-35mm f2.8/4 LD ASPHERIC I/F SP A/F Di ................MINT BOXED £199.00
TAMRON 28 - 75mm f2.8 SP A/F Di (LATEST) ..............MINT BOXED AS NEW £265.00

Canon & Pentax Manual Focus
CANON F1 AE 1984 OLYMPIC GAMES EDITION ......"NEW AND UNUSED" £1,395.00
CANON F1 AE ("UNUSED") ..........................................................MINT BOXED £999.00
CANON F1 AE + AE MOTOR DRIVE FN................................................EXC+++ £499.00
CANON 28mm f2 FD..................................................................................MINT - £145.00
CANON 55mm f1.2 FL ................................................................................MINT £275.00
CANON 85mm f1.2 "L" ....................................................................MINT-CASED £495.00
CANON 85mm f1.8 FD ................................................................................MINT- £165.00
CANON 200mm 2.8 FD ..........................................................................EXC+++ £245.00
CANON 135mm f2 FD ..................................................................MINT BOXED £275.00
CANON 300mm f2.8 FD "L" ......................................MINT- FLIGHT CASE BOX £899.00
CANON 500mm f8 REFLEX FD ....................................................MINT BOXED £345.00
FREE KOOD FD LENS TO CANON EOS FILM AND DIGITAL ADAPTOR WITH
£300,500,800 LENSES
PENTAX LX BODY + 50mm f1.4 SMC & SOFT ERC..................................MINT £545.00
SIGMA 300mm f2.8 APO DG FOR PENTAX A/F ........MINT BOXED AS NEW £1,195.00

Contax “G” Compacts and SLR
CONTAX 21mm f2.8 BIOGON & FINDER "G" ..............................MINT BOXED £359.00
CONTAX 28mm BIOGON "G" BLACK ........................................................MINT £159.00
CONTAX 90mm f2.8 SONNAR "G" ................................................MINT BOXED £139.00
CONTAX 90mm f2.8 SONNAR "G" BLACK ................................................MINT £129.00
CONTAX 35 - 70mm f3.5/5.6 VARIO SONNAR T* ......................................MINT £379.00
CONTAX 35 - 70mm f3.5/5.6 VARIO SONNAR T* ........................MINT BOXED £425.00
CONTAX TLA 140 FLASH ................................................................MINT CASED £49.00
CONTAX TLA 200 FLASH ..............................................................MINT CASED £95.00
CONTAX TLA 200 FLASH BLACK ..................................................MINT CASED £95.00
CONTAX TITANIUM HOODS, FILTERS, etc FOR "G"....MINT BOXED PHONE PLEASE
CONTAX 45mm f2.8 TESSAR ....................................................................MINT- £175.00
CONTAX 60mm f2.8 S PLANAR AE MACRO 1:1 ......................................MINT- £399.00
CONTAX 85mm f2.8 SONNAR AE ................................................MINT BOXED £189.00
CONTAX 85mm f1.4 PLANAR AE................................................................MINT £399.00
CONTAX 135mm f2.8 SONNAR MM ............................................MINT CASED £169.00
CONTAX 135mm f2.8 SONNAR MM........................................................EXC++ £125.00
CONTAX 135mm f2.8 SONNAR ................................................................MINT £125.00
CONTAX 200mm f3.5 TELE TESS T* AE ..................................................MINT £199.00
CONTAX 28 - 85mm f3.3/4 VAR SON ........................................................MINT- £399.00
CONTAX RIGHT ANGLED FINDER (FOR SLR) ............................MINT CASED £65.00
CONTAX TLA 30 FLASH ..................................................................MINT CASED £45.00
CONTAX TLA 280 FLASH................................................MINT BOXED AS NEW £119.00

Leica “M”, “R” & Screw & Binoculars
LEICA M7 FLAG (LTD EDITION UK 30)......................................MINT BOXED £1,695.00
LEICA M6 TTL CHROME SUPERB ............................MINT BOXED AS NEW £1,075.00
LEICA M6 TITANIUM BODY......................................................................MINT- £1,195.00
LEICA M4 BODY CHROME ........................................................................MINT- £695.00
LEICA M4-2 BLACK BODY ..........................................................MINT - BOXED £775.00
LEICA M4 P BLACK BODY........................................................................EXC++ £595.00
LEICA M3 BODY D/W + LEICA ERC CASE............................................EXC+++ £445.00
LEICA M3 BODY (REALLY NICE USER) ................................EXC++CASED £399.00
LEICA M3 BODY GLASS PRESS PLATE ................................................EXC++ £425.00
LEICA IIIG BODY (REALLY NICE BODY ..............................EXC+++CASED £695.00
KONICA HEXAR RF + 50mm f2 + KONICA FLASH ......MINT BOXED AS NEW £865.00
LEITZ/MINOLTA CL (MARKED LEITZ/MINOLTA RARE) ............MINT CASED £499.00
LEICA CL BODY BLACK ..........................................................................EXC++ £365.00
LEICA 21mm f3.4 SUPER ANGULON + FINDER ....................................MINT £1,195.00
LEICA 24mm f2.8 ASPHERIC ELMARIT M ................................MINT BOXED £1,575.00
LEICA 24mm BRIGHTLINE FINDER BLACK ................................MINT CASED £325.00
LEICA 35mm f3.5 SUMMARON ..................................................................MINT- £279.00
LEICA 50mm f2.8 COLL ELMAR M ............................................................MINT- £245.00
LEICA 90mm f2 SUMMICRON ASPHERIC M (BLACK) ........MINT BOXED AS NEW £1,395.00
LEICA 90mm f2 SUMMICRON ASPHERIC M (BLACK)..........EXC+++BOXED £1,195.00
LEICA 90mm f2 SUMMICRON CHROME (11137) ..........MINT BOXED AS NEW £699.00
LEICA 90mm f2.8 TELE-ELMARIT (BLACK) M..............................MINT BOXED £395.00
LEICA 90mm f2.8 TELE-ELMARIT (BLACK) M ..........................................MINT £325.00
LEICA 90mm f2.8 ELMARIT CHROME ......................................................MINT £299.00
LEICA 135mm f2.8 ELMARIT M FOR M3....................................................MINT £345.00
LEICA 135mm f3.4 APO - TELYT - M..........................................MINT BOXED £1,295.00
LEICA 135mm f4 TELE ELMAR M B/IN HOOD M ........................MINT CASED £675.00
LEICA 135mm f4.5 HEKTOR + HOOD + FINDER M..................................MINT- £199.00
LEICA 200mm f4 TELYT + HOOD ..............................................................MINT £495.00
LEICA MOTOR M ............................................................MINT BOXED AS NEW £395.00
LEICA MINI TRIPOD+BALL & SOCKET HEAD ..........................................MINT £145.00
LEICA SF20 FLASH ........................................................................MINT CASED £119.00
LEICA SF24D TITANIUM FINISH ....................................MINT BOXED AS NEW £179.00
LEICA SF24D FLASH......................................................MINT BOXED AS NEW £165.00
LEICA ERC CASE FOR M6/M7 BLACK ..........................................MINT BOXED £99.00
LEICA 21,24,28 VIEWFINDER (12013) ..........................................MINT CASED £245.00
LEICA M4-2 WINDER BLACK ........................................................MINT BOXED £175.00
LEICA M8 BATTERY (LOW USE) ..................................................................MINT £49.00
LEICA 5cm f2 SUMMITAR & FILTER & HOOD............................................MINT £195.00
LEICA 65mm f3.5 ELMAR + 16464K FOC RING ..........................MINT/BOXED £395.00
LEICA 90mm f4 ELMAR SCREW CHR + 90mm FDR ..................MINT CASED £245.00
LEICA 9cm f4 HEAD + 16467 FOC MOUNT FOR VISO ............................MINT £199.00
LEICA 9cm f4 ELMAR SCREW BLACK......................................................EXC++ £79.00
LEICA 9cm f4 ELMAR SCREW BLACK ........................................MINT- CASED £129.00
LEICA R8 BODY BLACK (TOTALLY AS NEW) ..............MINT BOXED AS NEW £479.00
LEICA 50mm f1.4 SUMMILUX (2 CAM) ..................................................EXC ++ £359.00
LEICA 50mm f2 SUMMICRON (ROM LENS) ................MINT BOXED AS NEW £325.00
LEICA 28 - 70mm f3.5/4.5 VARIO ELMAR ................................................MINT £545.00
LEICA 28 - 70mm f3.5/4.5 VARIO ELMAR ..............................................EXC ++ £295.00
LEICA 35 - 70mm F4 VARIO ELMAR 3 CAM ..........................................EXC ++ £319.00
LEICA 70 - 210mm f4 VAR ELM 3 CAM ........................................MINT CASED £445.00
LEICA 80 - 200mm f4 VARIO ELMAR ( ROM LENS)..............................EXC ++ £425.00
LEICA 80 - 200mm f4 VARIO ELMAR (ROM LENS) ......MINT BOXED AS NEW £599.00
LEICA MOTOR WINDER FOR R (14209) ......................MINT BOXED AS NEW £195.00
LEICA TRINOVID 8 x 50 BA & CASE..............................MINT BOXED AS NEW £745.00
LEICA DUOVID 10 + 15 x 50 BINO + HARD ER CASE..............MINT CASED £1,295.00
KOWA TSN-2 SPOTTING SCOPE + 20-60 ZOOM........................MINT BOXED £345.00
SWAROVSKI 8 X 30 WB UP BINOCULARS ..................MINT BOXED AS NEW £495.00
SWAROVSKI 10 x 42 EL BINOCULAR (LATEST) ..........................NEW,NEW £1,125.00

Voigtlander
VOIGTLANDER BESSA T BODY BLACK ......................................MINT- BOXED £199.00
VOIGTLANDER BESSA L BODY SILVER ........................................MINT-BOXED £95.00
VOIGTLANDER 15mm f4.5 S/W HELIAR ASP + FDR (B) ............MINT BOXED £325.00
VOIGTLANDER 25mm f4 SKOPAR + FINDER BLK ......................MINT BOXED £265.00
VOIGTLANDER 25mm f4 SKOPAR + FINDER SIL........................MINT BOXED £265.00
VOIGTLANDER 35mm f1.2 NOKTON VM (BLK) ..........................MINT BOXED £625.00
VOIGTLANDER 35mm f2.5 COL SKOP BLACK ........................................MINT £199.00
VOIGTLANDER 50mm f1.5 NOKTON (BLK)..................................MINT BOXED £345.00
VOIGTLANDER 90mm f3.5 APO LANTHAR (BLK)........................MINT BOXED £275.00
VOIGTLANDER WINDER BESSA T + ALL R CAMS ....................MINT BOXED £129.00
VOIGTLANDER SCREW TO M ADAPTOR....................................................MINT £30.00

Medium Format
BRONICA ETRSi BODY ONLY ......................................................MINT BOXED £100.00
BRONICA 40mm f4 PE ..................................................................MINT- BOXED £249.00
BRONICA 50mm f2.8 ZENZANON MC........................................................MINT £175.00
BRONICA 135mm F4 ZENZANON PE LENS ............................................MINT- £289.00
BRONICA 150mm f3.5 PE ..........................................................EXC+++BOXED £175.00
BRONICA 150mm f3.5 ZENZANON E..........................................MINT + HOOD £159.00
BRONICA 150mm f3.5 ZENZANON E ........................................................EXC+ £120.00
BRONICA 150mm F4 E ..............................................................................MINT- £169.00
BRONICA 250mm f5.6 MC............................................................MINT + HOOD £195.00
BRONICA 500mm f8 ZENZANON ..............................................................MINT £795.00
BRONICA 220 BACK ........................................................................MINT-BOXED £49.00
BRONICA E120 BACK ETRS ........................................................................MINT £49.00
BRONICA E120 BACK................................................................................EXC ++ £35.00
BRONICA ETRS/ETRSi POLAROID BACK ................................................MINT - £85.00
METZ SCA 386 TTL LEAD ETRSi/SQAi........................................................MINT £69.00
BRONICA AEIII METERED PRISM FINDER ................................EXC++BOXED £165.00
BRONICA AEII PRISM FINDER ..................................................................MINT- £115.00
BRONICA E14 EXT TUBE................................................................MINT BOXED £79.00
BRONICA E28 EXT TUBE ............................................................................MINT £69.00
BRONICA S TELECONVERTER 2X ............................................................MINT- £69.00
BRONICA SPEEDGRIP E FOR ETRS/i ........................................................MINT- £35.00
BRONICA MOTOR DRIVE Ei II ......................................................MINT-BOXED £195.00
HASSELBLAD X PAN + 45mm COMPLETE ..............................MINT BOXED £1,295.00
HASSELBLAD 90mm f4 FOR X PAN ......................................MINT IN KEEPER £365.00
HASSELBLAD X PAN 45mm CENTRE FILTER ............................MINT BOXED £165.00
HASSELBLAD 90mm f4 FOR X PAN ........................................................MINT - £299.00
HASSELBLAD 500CM +WLF+BACK + 80mm CF ................................EXC+++ £795.00
HASSELBLAD 500EL/M + A12 + 80mm F2.8 T*............................MINT-BOXED £595.00
HASSELBLAD 500EL/M + A12 BLACK BACK..........................................EXC++ £299.00
HASSELBLAD 40mm f4 DISTAGON CF ..................................................MINT £1,095.00
HASSELBLAD 50mm f4 DISTAGON CF ................................................EXC+++ £425.00
HASSELBLAD 150mm f4 SONNAR CF..................................................EXC+++ £399.00
HASSELBLAD 180mm f4 SONNAR................................................MINT-BOXED £695.00
HASSELBALD 250mm f6 SONNAR T* CF ..................................................MINT £899.00
HASSELBLAD HC 50 - 110 f3.5 FOR H SYSTEM ........MINT BOXED + HB FILTER £2,495.00
HASSELBLAD PLAIN PRISM..........................................................................EXC £75.00
HASSELBLAD PM PRISM ..........................................................................MINT £199.00
HASSELBLAD A12 BACK BLACK AND SILVER............................MINT BOXED £145.00
HASSELBLAD A12 BACK BLACK AND SILVER ........................................MINT - £99.00
HASSELBLAD 503 MOTOR DRIVE ............................................................MINT £265.00
MAMIYA 45mm F2.8 A/F FOR 645 A/F ......................................................MINT £349.00
MAMIYA 150mm f3.5 A/F FOR 645 A/F......................................................MINT £299.00
MAMIYA 55mm f2.8 N FOR 645 ....................................................MINT BOXED £199.00
MAMIYA 80mm f2.8 N/L LEAF SHUTTER COMP ......................................MINT £299.00
MAMIYA 210mm f4 SEKOR C FOR 645 ........................................MINT CASED £195.00
MAMIYA POLAROID FILM HOLDER FOR 645 A/F ....................................NEW £159.00
MAMIYA 120 BACK FOR 645 ........................................................................MINT £70.00
MAMIYA 50mm F4.5 FOR RB ........................................................MINT BOXED £299.00
MAMIYA 120 BACK FOR RB............................................................MINT BOXED £99.00
PENTAX 55mm f4 SMC FOR 6x7 ..................................................MINT CASED £299.00
PENTAX 165mm f2.8 SMC +CASE..............................................................MINT £379.00
YASHICA MAT 124G TLR + HOOD ................................................MINT-CASED £179.00

Konica/Minolta/Sony/Meters
KONICA HEXAR RF + 50mm f2 + KONICA FLASH ......MINT BOXED AS NEW £865.00
MINOLTA TC 1 TITANIUM COMPACT............................................MINT-BOXED £495.00
TAMRON 14mm f2.8 SP A/F I/F ASP MINOLTA FIT ......MINT BOXED AS NEW £445.00

Nikon Auto-Focus
NIKON F5 BODY (REALLY NICE) ..................................................MINT BOXED £499.00
NIKON F4S BODY ......................................................................................MINT- £395.00
NIKON F80 BODY BLACK ................................................MINT BOXED AS NEW £99.00
NIKON F80 BODY BLACK..............................................................................MINT £85.00
NIKON F80 BODY SILVER ..............................................................MINT- BOXED £85.00
NIKON 10.5mm f2.8 IF-ED A/F DX "G" FISHEYE ..........................MINT CASED £419.00
NIKON 24mm f2.8 A/F "D" ..............................................................MINT BOXED £269.00
NIKON 28mm f2.8 A/F "D" ............................................................MINT AS NEW £169.00
NIKON 50mm f1.8 A/F ..................................................................................MINT- £75.00
NIKON 50mm f1.8 A/F "D" ........................................................NEW NEW NEW £109.99
NIKON 105mm f2.8 A/F MICRO NIKKOR (MACRO) ....................MINT BOXED £395.00
NIKON 105mm f2.8 "G" IF ED AF-S MACRO VIB RED ..MINT BOXED AS NEW £519.00
NIKON 300mm f2.8 ED "D" I/F AF-S MKII + HOOD....................MINT CASED £2,595.00
NIKON 12 - 24mm f4 DX AF-ED AFS (1 ONLY)..........................MINT BOXED £599.00
NIKON 14 - 24mm f2.8 "G" ED AF-S (USED ONCE) ..MINT BOXED AS NEW £1,045.00
NIKON 17 - 55mm f2.8 DX ED I/F AF-S ..........................MINT BOXED AS NEW £865.00
NIKON 18 - 55mm f3.5/5.6 "G" DX ED AF-S MKII ........................................MINT £89.00
NIKON 18 - 70mm f3.5/4.5 DX AF-S "G" ED + HOOD ..................MINT BOXED £199.00
NIKON 18 - 200mm f3.5/5.6AF-S DX "G" VIB RED........................MINT BOXED £425.00
NIKON 24 - 120mm F3.5/5.6 D I/F A/F + HOOD............................MINT BOXED £179.00
NIKON 24 - 120mm f3.5/5.6 G I/F ED AF-S VIB RED ....MINT BOXED AS NEW £419.00
NIKON 28 - 80mm f3.3/5.6 A/F "G" ..............................................................MINT £59.00
NIKON 28 - 85mm f3.5/4.5 A/F......................................................MINT BOXED £199.00
NIKON 35 - 105mmf3.5/4.5 A/F ......................................................MINT-BOXED £145.00
NIKON 70 - 200mm f2.8 ED IF AF-S VIBR REDUCTION......MINT BOXED AS NEW £1,395.00
NIKON 70 - 300mm f4./5.6 A/F "G" + HOOD ..................................MINT BOXED £79.00
NIKON 70 - 300mm f4./5.6 A/F "D" ED GLASS..............................MINT-BOXED £179.00
NIKON 80 - 200mm f2.8 "D" ED I/F 2 TOUCH LATEST ................MINT BOXED £695.00
NIKON 80 - 400mm f4/5.6 A/F "D" VIBRATION RED ....................MINT BOXED £975.00
NIKON SB 22S FLASH ....................................................................MINT BOXED £59.00
NIKON SB 26 FLASH ................................................................................EXC ++ £89.00
NIKON SB 28 FLASH ......................................................................MINT -BOXED £95.00
NIKON SD8 BATT PACK................................................................................MINT- £39.00
NIKON PS-6 SLIDE COPYING ADAPTOR ....................................................MINT £75.00
NIKON TC 17E II AF-S TELECONVERTER....................................MINT CASED £239.00
NIKON TC 20E AF-S TELECONVERTER MK II ............MINT BOXED AS NEW £239.00
NIKON TC 16 A/F CONVERTER ......................................................MINT BOXED £90.00
NIKON MH 15 CHGR + BATTERY NICAD F100........................................MINT- £129.00
NIKON MB 15 GRIP FOR NIKON F100 ..........................................MINT BOXED £59.00
NIKON DR4 RIGHT ANGLED FINDER ..........................................MINT BOXED £119.00

SIGMA 8mm f4 EX FISHEYE 180 DEG..........................MINT BOXED AS NEW £545.00
SIGMA 20mm f1.8 EX DG ASPHERIC (LATEST) ......................................MINT £389.00
SIGMA 28mm f1.8 EX DG MACRO ASPHERIC ............................MINT BOXED £265.00
SIGMA 300mm f2.8 EX DG HSM (LATEST SPEC) ..............EXC+++CASED £1,595.00
SIGMA 12 - 24mm f4.5/5.6 EX DG (LATEST) ................................MINT BOXED £499.00
SIGMA 18 - 125mm f3.5/5.6 "D"D DC ............................................MINT CASED £125.00
SIGMA 55 - 200mm f4/5.6 DC..........................................................MINT BOXED £69.00
SIGMA 70 - 210mm f4/5.6 A/F "D" UC MKII + HOOD ..................................MINT £49.00
TAMRON 90mm f2.8 SP A/F MACRO 1:1......................................MINT BOXED £199.00
TAMRON 24 - 135mm f3.5/5.6 AD ASPHER IF MACRO ..............MINT BOXED £175.00
TAMRON 28 - 300mm f3.5/6.3 A/F ASP XR LD I/F MAC ............MINT + HOOD £199.00
TAMRON 55 - 200mm f4/5.6 LD DI MK II A/F MACRO..................MINT + HOOD £69.00
TAMRON 70 - 200mm f2.8 SP A/F DI LD I/F MACRO....MINT BOXED AS NEW £495.00
TAMRON 70 - 300mm F4/5.6 LD Di TELE MACRO ......................MINT + HOOD £89.00
NEW NIKON NOW AVAILABLE AT CAMTECH PHONE FOR OUR LOW PRICES

Nikon Manual
NIKON F3 HP "P" PRESS + MF-6B BACK + P/WORK........MINT BOXED (V RARE) £1,595.00
NIKON FM2 CHROME BODY......................................................................MINT- £165.00
NIKON FE BODY BLACK BODY....................................................................EXC+ £95.00
NIKON FE BLACK BODY ................................................................................EXC £75.00
NIKON FE BODY CHROME ............................................................MINT-BOXED £119.00
NIKON FM BLACK BODY............................................................................EXC++ £99.00
NIKON FM BODY CHROME........................................................................MINT- £129.00
NIKONOS 20mm f2.8 UW NIKKOR + FDR..................................................MINT £425.00
NIKON 15mm f3.5 AIS CASED (SUPERB) ..................................MINT BOXED £895.00
NIKON 20mm F2.8 AIS ................................................................................MINT £395.00
NIKON 20mm f3.5 AIS ..........................................................................MINT £199.00
COSINA 20mm f3.8 MC MACRO AIS ..............................................MINT BOXED £59.00
NIKON 24mm f2 AIS
(SUPERB SHARP LENS) ................................MINT- £375.00
NIKON 24mm F2.8 AI ..................................................................................MINT £129.00
NIKON 24mm F2.8 AIS ................................................................................MINT £199.00
NIKON 28mm f2.8 AI......................................................................................MINT £95.00
NIKON 28mm f3.5 AI......................................................................................MINT £69.00
NIKON 35mm F2.8 AI ....................................................................................MINT £99.00
NIKON 24mm f4 PC PERSPECTIVE CONTROL ..........................MINT CASED £499.00
NIKON 35mm f2.8 PC PERSPECTIVE CONTROL ......................MINT CASED £475.00
NIKON 50mm f1.2 AIS (SUPERB LENS) ..............................................MINT £329.00
NIKON 50mm F1.4 AI ..................................................................................MINT £149.00
NIKON 50mm f1.8 AIS ......................................................................MINT BOXED £69.00
NIKON 55mm f2.8 MICRO AIS ....................................................................MINT £169.00
NIKON 55mm f2.8 MICRO AIS ......................................MINT BOXED AS NEW £195.00
NIKON 55mm ff3.5 NIKKOR P MICRO + M2 TUBE................MINT IN KEEPER £159.00
NIKON 85mm f1.4 AIS + HOOD (SUPERB CLARITY)..................MINT-CASED £575.00
NIKON 105mm f1.8 AIS ..................................................................MINT-BOXED £495.00
NIKON 105mm f2.8 MICRO NIKKOR..............................MINT BOXED AS NEW £395.00
NIKON 105mm f4 MICRO NIKKOR AI............................................MINT BOXED £295.00
NIKON 135mm f2.8 AIS................................................................................MINT £189.00
NIKON 135mm f2.8 AIS ..................................................................MINT BOXED £199.00
NIKON 200mm f4 AI........................................................................MINT CASED £169.00
NIKON 300mm f4.5 AIS ..............................................................................MINT- £269.00
NIKON 28 - 50mm f3.5 AIS ..........................................................................MINT £345.00
NIKON 28 - 85mm f3.5/4.5 AIS (GREAT ZOOM LENS) ............................MINT £265.00
NIKON 35 - 70 f3.5 AI ................................................................................EXC++ £165.00
NIKON 35 - 70mm f3.5/4.8 AIS ......................................................................MINT £99.00
NIKON 35 - 105mm f3.5/4.5 AIS ....................................................MINT-BOXED £189.00
NIKON 35 - 105mm f3.5/4.5 AIS................................................................EXC++ £149.00
NIKON 80 - 200mm F4 AI ............................................................................MINT £165.00
NIKON PK 13 EXT TUBE..................................................................MINT BOXED £59.00
NIKON PISTOL GRIP & MC3 CABLE............................................................MINT £95.00
NIKON TC14A TELECONVERTER AIS ......................................................MINT £199.00
NIKON TC 201 CONVERTER ......................................................MINT AS NEW £129.00
NIKON TC 200 CONVERTER........................................................................MINT £95.00
NIKON SB16 + F3 MOUNT + FM2/FM3/FE/FE2 FIT ....................MINT CASED £169.00
NIKON SB 10 FLASH ......................................................................MINT BOXED £49.00
NIKON DR3 R/ANGLE FINDER ....................................................................MINT £99.00
TAMRON 17mm f3.5 SP MN TO TAKE ANY MOUNT..................................MINT £129.00

Olympus Manual
OLYMPUS OM4 Ti CHAMPAGNE ..........................................................EXC+++ £395.00
OLYMPUS OM2N BODY................................................................................EXC+ £99.00
OLYMPUS OM1 BODY ..............................................................................EXC++ £119.00
OLYMPUS 24mm f2.8 ZUIKO ......................................................................MINT £115.00
OLYMPUS 24mm f2.8 ZUIKO ........................................................MINT BOXED £129.00
OLYMPUS 28mm f2 ZUIKO ....................................................................EXC+++ £179.00
OLYMOUS 28mm f3.5 ZUIKO ........................................................................MINT £49.00
OLYMPUS 35mm f2.8 ZUIKO ..........................................................MINT CASED £59.00
OLYMPUS 35mm f2.8 SHIFT ZUIKO..............................................MINT CASED £369.00
OLYMPUS 50mm f1.8 ZUIKO ........................................................................MINT £29.00
OLYMPUS 50mm f3.5 MACRO ......................................................MINT BOXED £165.00
VOIGTLANDER 75mm f2.5 COL HEL + HOOD ............................MINT BOXED £199.00
OLYMPUS 100mm f2.8 ZUIKO ....................................................................MINT £185.00
OLYMPUS 135mm f2.8 ZUIKO..................................................................EXC+++ £89.00
OLYMPUS 135mm f3.5 ZUIKO ....................................................................MINT - £55.00
OLYMPUS 135mm f4.5 MACRO ZUIKO ..................................................EXC ++ £169.00
OLYMPUS 135mm f4.5 MACRO ZUIKO....................................................MINT - £199.00
OLYMPUS 1000mm f11 ZUIKO TELE ( RARE)..............................MINT CASED £995.00
OLYMPUS 35 - 70mm f4 ZUIKO ....................................................................MINT £69.00
OLYMPUS 35 - 70mm f3.6 ZUIKO....................................................MINT CASED £99.00
OLYMPUS 65 - 200mm F4 ..........................................................................MINT £149.00
OLYMPUS 75 - 150mm f5.6 ZUIKO ..............................................................MINT- £79.00
OLYMPUS 100 - 200 f5 ZUIKO......................................................................MINT £99.00
OLYMPUS CONVERTER A............................................................................MINT £69.00
OLYMPUS WINDER 2 ..................................................................................MINT- £49.00
OLYMPUS T10 RING FLASH & CONTROLLER..........................................MINT £199.00
OLYMPUS T20 FLASH ..................................................................MINT - BOXED £25.00
OLYMPUS T32 FLASH......................................................................MINT-BOXED £49.00
OLYMPUS F 280 FLASH ................................................................MINT BOXED £159.00
OLYMPUS F 280 FLASH................................................................................MINT £99.00
OLYMPUS VARI EXT TUBE 80 - 135 1:1 ......................................................MINT £89.00
OLYMPUS VARIOMAGNIFINDER ..............................................................MINT - £89.00

We urgently require your used photographic equipment. We have
customers waiting for: Nikon, Canon, Leica, Contax, Bronica,
Hasselblad and most other makes of camera lenses, accessories,
binoculars and collectables.
We will buy for cash from you, or we are happy to sell on
your behalf on a commission basis. Best prices paid. We can
arrange collection and even call and collect and pay on the
spot if necessary anywhere in the UK.

Visitors are welcome, please phone for an appointment. PO Box 1052, Cottenham, Cambridge, CB4 8WU

www.
ww
w.storem
emag
ags.
s.co
com & www.fantamag.com

www.storemags.com & www.fantamag.com

www.storemags.com & www.fantamag.com

www.storemags.com & www.fantamag.com

www.storemags.com & www.fantamag.com

www.storemags.com & www.fantamag.com

www.storemags.com & www.fantamag.com

www.storemags.com & www.fantamag.com

www.storemags.com & www.fantamag.com

www.storemags.com & www.fantamag.com

www.storemags.com & www.fantamag.com

www.storemags.com & www.fantamag.com

www.storemags.com & www.fantamag.com

www.storemags.com & www.fantamag.com

www.storemags.com & www.fantamag.com

We are a small family owned and run company, specialising in photographic consumables.
We are based in Leamington Spa, in the heart of Warwickshire - if you are passing, or
live close by, please pop into our shop, and meet Judy - our office dog!
Premier Ink & Photographic, Longfield Road, Sydenham
Industrial Estate, Leamington Spa, Warwickshire. CV31 1XB.

www.premier-ink.co.uk
PRINTER INK CARTRIDGES

EPSON
COMPATIBLE & ORIGINAL INK
At Premier Ink Supplies, we stock two types of cartridges for Epson printers - Originals,
which are made by Epson, and Compatibles, which are made by a UK company called
Jet Tec. Using Jet Tec Compatibles is a way of saving money, without compromising on
the quality of your prints. Here’re the results from two independent ink tests that agree…

“Jet Tec’s colours were superb, with single greys and
blacks very close to Epson …so Jet Tec wins!”
- Total Digital Photography Magazine
“What we’re looking at here is not only the best choice
of ink for the R300 printer, but also the best ink in this
group test, period. There’s just no getting away from
the superb combination of performance and pricing”
- Computer Upgrade Magazine
Cartridge Code:
T001 Colour
T007 Black
T008 Colour
T009 Colour
T026 Black
T027 Colour
T036 Black
T037 Colour
T040 Black
T041 Colour
T050 Black
T051 Black
T052 Colour
T053 Colour
T0331-336 Set of 7
T0331/2/3, each
T0334/5/6, each
T0341-347 Set of 7
T0341/8, each
T0342/3/4, each
T0345/6/7, each
T0441-454 Set of 4
T0441 Black
T0452/3/4, each
T0481-486 Set of 6
T0481/2/3, each
T0484/5/6, each
T0540-549 Set of 8
T0540 Gloss
T0541/2/3/4, each
T0547/8/9, each
T0551-554 Set of 4
T0551 Black
T0552/3/4, each
T0591-599 Set of 8
T0591/2/3, each
T0594/5/6, each
T0597/8/9, each
T0611-614 Set of 4
T0611 Black
T0612/3/4, each
T0711-714 Set of 4
T0711 Black
T0712/3/4, each
T0791-796 Set of 6
T0791/2/3, each
T0794/5/6, each
T0801-806 Set of 6
T0801/2/3, each
T0804/5/6, each
T0870-879 Set of 8
T0870 Gloss
T0871/2/3/4, each
T0877/8/9, each
T0961-969 Set of 8
T0961/2/3, each
T0964/5/6, each
T0967/8/9, each
T5591-6 Set of 6
T5591/2/3, each
T5594/5/6, each

Originals:
£26.99 65ml
£22.99 16ml
£18.99 46ml
£24.99 66ml
£19.99 16ml
£22.99 46ml
£9.99 10ml
£11.99 25ml
£19.99 17ml
£19.99 37ml
£19.99 15ml
£19.99 24ml
£19.99 35ml
£19.99 43ml
£102.99
£14.99 17ml
£14.99 17ml
£119.99
£14.99 17ml
£17.99 17ml
£17.99 17ml
£40.99
£17.99 13ml
£9.99 8ml
£61.99
£13.99 13ml
£13.99 13ml
£102.99
£7.99 13ml
£13.99 13ml
£13.99 13ml
£29.99
£8.99 8ml
£8.99 8ml
£94.99
£11.99 13ml
£11.99 13ml
£11.99 13ml
£29.99
£8.99 8ml
£8.99 8ml
£29.99
£8.99 7.4ml
£8.99 5.5ml
£70.99
£11.99 10ml
£11.99 10ml
£45.99
£8.99 7.4ml
£8.99 7.4ml
£76.99
£7.99 11.4ml
£9.99 11.4ml
£9.99 11.4ml
£78.99
£9.99 11.4ml
£9.99 11.4ml
£9.99 11.4ml
£61.99
£11.99 13ml
£11.99 13ml

Jet Tec Compatibles:
£3.99 70ml, 3 for £10.99
£3.99 20ml, 3 for £10.99
£4.99 50ml, 3 for £13.99
£4.99 70ml, 3 for £13.99
£3.99 20ml, 3 for £10.99
£4.99 50ml, 3 for £13.99
£3.99 13ml, 3 for £10.99
£4.99 31ml, 3 for £13.99
£3.99 20ml, 3 for £10.99
£4.99 46ml, 3 for £13.99
£2.99 16ml, 3 for £7.99
£2.99 26ml, 3 for £7.99
£3.99 39ml, 3 for £10.99
£3.99 48ml, 3 for £10.99
£29.99, 3 sets for £87.99
£4.99 21ml, 3 for £13.99
£4.99 21ml, 3 for £13.99
Not Available.
Not Available.
Not Available.
Not Available.
£14.99, 3 sets for £42.99
£4.99 21ml, 3 for £13.99
£3.99 21ml, 3 for £10.99
£19.99, 3 sets for £56.99
£3.99 21ml, 3 for £10.99
£3.99 21ml, 3 for £10.99
£35.99, 3 sets for £99.99
£3.99 21ml, 3 for £13.99
£4.99 21ml, 3 for £13.99
£4.99 21ml, 3 for £13.99
£14.99, 3 sets for £42.99
£4.99 21ml, 3 for £10.99
£3.99 21ml, 3 for £10.99
Check Website.
Check Website.
Check Website.
Check Website.
£14.99, 3 sets for £42.99
£4.99 21ml, 3 for £13.99
£3.99 21ml, 3 for £10.99
£14.99, 3 sets for £42.99
£4.99 13ml, 3 for £13.99
£3.99 13ml, 3 for £10.99
Check Website.
Check Website.
Check Website.
£19.99, 3 sets for £57.99
£3.99 13ml, 3 for £10.99
£3.99 13ml, 3 for £10.99
Check Website.
Check Website.
Check Website.
Check Website.
Not Available.
Not Available.
Not Available.
Not Available.
Not Available.
Not Available.
Not Available.

Ink Test
Winner

Suitable EPSON Printers:
Photo 1200
Photo 790, 870, 890, 895, 900, 915, 1290
Photo 790, 870, 890, 895, 915
Photo 900, 1270, 1290
Photo 810, 830 ,830u, 925, 935
C42, C44, C46
C62, CX3200
440, 460, 660, Photo 700, 750, 1200
740, 760, 800, 850, 860, 1160
440, 640, 660, 740, 760, 1160
Photo 700, 750
Photo 950, 960

Photo 2100

C64, C66, C84, C86,
CX3600/3650, CX6400, CX6600
R200, R220, R300, R320, R340
RX500, RX600, RX620, RX640

Canon Compatibles
BCi3e Black 26ml
£2.99
BCi3e C/M/Y 15ml
£2.99
BCi6 B/C/M/Y 15ml
£2.99
BCi6 PC/PM/R/G 15ml
£2.99
PGi5 Black 29ml
£5.99
CLi8 Black 15ml
£4.99
CLi8 B/C/M/Y 15ml
£4.99
CLi8 PC/PM 15ml
£4.99
PGi520 Black 19ml
£5.99
CLi521 B/C/M/Y/GY 9ml
£4.99
BCi10 Black (3 pack)
£4.99
BCi15 Black (2 pack)
£4.99
BCi15 Colour (2 pack)
£5.99
BCi24 Black 9ml
£1.99
BCi24 Colour 16ml
£2.99
PG37 Black 12ml
£9.99
PG50 Black 28ml
£12.99
CL38 Colour 12ml
£12.99
CL51 Colour 24ml
£14.99
Canon Originals
BCi16 Colour (2 pack)
£21.99
BCi3e Black 26ml
£10.99
BCi3e C/M/Y 13ml
£9.99
BCi6 B/C/M/Y 13ml
£9.99
BCi6 PC/PM/R/G 13ml
£9.99
PGi5 Black 26ml
£12.99
CLi8 B/C/M/Y 13ml
£11.99
CLi8 PC/PM/R/G 13ml
£11.99
PGi7 Black 25ml
£11.99
PGi9 Clear 191ml
£11.99
PGi9 PB/MB/C/M/Y 14ml £10.99
PGi9 PC/PM/R/G/GY 14ml £10.99
PGi520 Black 19ml
£9.99
CLi521 B/C/M/Y/GY 9ml
£8.99
PG37 Black 11ml
£12.99
PG40 Black 16ml
£15.99
PG50 Black 22ml
£22.99
PG510 Black 9ml NEW
£11.99
PG512 Black 15ml NEW £15.99
CL38 Colour 9ml
£16.99
CL41 Colour 12ml
£19.99
CL51 Colour 21ml
£26.99
CL52 Photo 21ml
£19.99
CL511 Colour 9ml NEW £15.99
CL513 Colour 13ml NEW £19.99
KP-36IP Ink & Paper
£12.99
KP-108IP Ink & Paper
£29.99
Many more in stock!

Photo R800, R1800

Dell Compatibles
Series 1 Black (T0529)
£11.99
Series 1 Black (T0530)
£12.99
Series 5 Black (M4640)
£11.99
Series 5 Black (M4646) £12.99

Photo R240, R245,
RX420, RX425, RX520, RX525
Photo R2400

HP Compatibles
No.15 Black 46ml
£4.99
No.21 Black 20ml
£8.99
No.22 Colour 21ml
£11.99
No.27 Black 24ml
£9.99
No.28 Colour 24ml
£12.99
No.45 Black 45ml
£4.99
No.56 Black 24ml
£9.99
No.57 Colour 24ml
£12.99
No.58 Photo 24ml
£12.99
No.78 Colour 45ml
£9.99
No.88XL Black 58ml
£9.99
No.88XL C/M/Y 17ml
£8.99
No.110 Colour 12ml
£10.99
No.336 Black 10ml
£7.99
No.337 Black 24ml
£10.99
No.338 Black 24ml
£10.99
No.339 Black 34ml
£12.99
No.342 Colour 12ml
£10.99
No.343 Colour 21ml
£12.99
No.344 Colour 21ml
£14.99
No.348 Photo 21ml
£12.99
No.363 Black 20ml
£6.99
No.363 C/M/Y/PC/PM 8ml £4.99
No.363 Set of 6
£24.99
HP Originals
No.21 Black 5ml
No.22 Colour 5ml
No.38 PB/MB/GY 27ml
No.38 C/M/Y/PC/PM 27ml
No.56 Black 19ml
No.57 Colour 17ml
No.58 Photo 17ml
No.59 Grey 17ml
No.100 Grey 15ml
No.110 Colour 5ml
No.300 Black 4ml
No.300 Colour 4ml
No.336 Black 5ml
No.337 Black 11ml
No.338 Black 11ml
No.339 Black 21ml
No.342 Colour 5ml
No.343 Colour 7ml
No.344 Colour 14ml
No.348 Photo 13ml
No.350 Black 4.5ml
No.350XL Black 25ml
No.351 Colour 3.5ml
No.351XL Colour 14ml
No.363 Black 6ml
No.363 C/M/Y/PC/PM
No.363 Set of 6
No.364 Black 6ml
No.364 PB/C/M/Y 3ml
No.901 Black 4ml
No.901 Colour 9ml

Many more in stock!
D68, D88,
DX3800/3850, DX4200/4250, DX4800/4850

£13.99
£15.99
£26.99
£26.99
£16.99
£24.99
£22.99
£22.99
£22.99
£18.99
£11.99
£13.99
£13.99
£17.99
£17.99
£24.99
£15.99
£18.99
£26.99
£22.99
£13.99
£27.99
£15.99
£29.99
£13.99
£8.99
£39.99
£8.99
£7.99
£11.99
£16.99

Many more in stock!

Lexmark Compatibles
No.1 Colour
£10.99
No.2 Colour
£11.99
No.3 Black
£14.99
No.16 Black
£10.99
No.17 Black
£9.99
No.26 Colour
£12.99
No.27 Colour
£11.99
No.31 Photo
£11.99
No.32 Black
£9.99
No.33 Colour
£11.99
No.34 Black
£11.99
No.35 Colour
£12.99
Lexmark Originals
No.1 Colour
£16.99
No.14 Black
£16.99
No.15 Colour
£18.99
No.17 Black
£13.99
No.23 Black
£14.99
No.24 Colour
£16.99
No.27 Colour
£14.99
No.28 Black
£13.99
No.29 Colour
£14.99
No.31 Photo
£24.99
No.32 Black
£15.99
No.33 Colour
£17.99
No.34 Black
£20.99
No.35 Colour
£24.99
No.36 Black
£16.99
No.37 Colour
£18.99
No.43 Colour
£22.99
No.44 Black
£18.99
Many more in stock!

Brother Compatibles
LC900 Black
£3.99
LC900 C/M/Y
£2.99
LC900 Set of 4
£11.99
LC970 Black
£3.99
LC970 C/M/Y
£2.99
LC970 Set of 4
£11.99
LC1000 Black
£3.99
LC1000 C/M/Y
£2.99
LC1000 Set of 4
£11.99
LC980 / 1100 Black
£3.99
LC980 / 1100 C/M/Y
£2.99
LC980 / 1100 Set of 4
£11.99
Brother originals also in stock!

Kodak Original Ink / Paper
ESP Black Series 10 Ink
£6.99
ESP Colour Series 10 Ink
£9.99
ESP Black & Colour Ink
£15.99
PrinterDock Ink/Paper £CALL
Many more in stock!

PHOTOGRAPHIC PAPERS

S20, S21, SX100/105/110/115/200/205/210/215
SX400/405/415/515, D78/92/120, B40W, BX300
DX4000/4400/5000/6000/7000/7400/8400/9400
Photo 1400

As an Ilford Pro Centre, we stock the complete
range of Ilford Galerie papers, including A2,
17, 24 and 44 inch rolls. Below is just a selection.

Photo P50, R265, R285, R360
RX560, RX585, RX685
PX650, PX700/710W, PX800/810FW
Photo R1900

Photo R2880

Photo RX700

Please call or check our website if you cannot find cartridges for your printer.

WIDE FORMAT INK
EPSON Stylus Pro 3800
T5801/5802/5803/5804/5805/5806/5807/5808/5809 80ml each

£44.99

EPSON Stylus Pro 4000, 4400, 7600, 9600
T5431/5432/5433/5434/5435/5436/5437/5438 110ml each
T5441/5442/5443/5444/5445/5446/5447/5448 220ml each

£44.99
£69.99

EPSON Stylus Pro 4800, 4880:
T6051/6052/605B/6053/6054/6055/6056/605C/6057/6138/6059 110ml £44.99
T6061/6062/606B/6063/6064/6065/6066/606C/6067/6148/6069 220ml £69.99
EPSON Stylus Pro 7800, 7880, 9800:
T6021/6022/602B/6023/6024/6025/6026/602C/6027/6118/6029 110ml £44.99
T6031/6032/603B/6033/6034/6035/6036/603C/6037/6128/6039 220ml £69.99
Please call or check our website for further details

Smooth Gloss 290g, 6x4, 100 sheets
Smooth Gloss 290g, 7x5, 100 sheets
Smooth Gloss 290g, A4, 25 +10 FREE
Smooth Gloss 290g, A4, 100
Smooth Gloss 290g, A3, 25 sheets
Smooth Gloss 290g, A3+, 25 sheets
Smooth Pearl 290g, 6x4, 100 sheets
Smooth Pearl 290g, 7x5, 100 sheets
Smooth Pearl 290g, A4, 25 +10 FREE
Smooth Pearl 290g, A4, 100
Smooth Pearl 290g, A3, 25 sheets
Smooth Pearl 290g, A3+, 25 sheets
Gold Fibre Silk 310g, A4, 20 sheets OFFER
Gold Fibre Silk 310g, A3+, 50 sheets
Heavyweight Matt 200g, A4, 50 sheets
Heavyweight Matt 200g, A3+, 50 sheets
Smooth Fine Art 190g, A4, 10 sheets
Smooth Fine Art 190g, A3+, 10 sheets
Smooth High Gloss 225g, A4, 25 sheets
Smooth High Gloss 225g, A3+, 25 sheets
Smooth Lustre Duo 280g, A4, 25 sheets
Smooth Lustre Duo 280g, A3+, 25 sheets

£14.95
£19.95
£9.95
£29.95
£23.95
£25.95
£14.95
£19.95
£9.95
£29.95
£23.95
£25.95
£14.50
£79.95
£9.95
£27.95
£10.95
£23.95
£14.95
£29.95
£17.95
£39.95

ICC profiles available for all Ilford papers

As a PermaJet Premier Stockist, we supply the
ENTIRE PermaJet range, including Baryta, Smooth and
Textured Fine Art and Canvas. Below is just a selection.

Sample Pack 30 sheets, 21 different papers!
£14.95
Digital Gloss or Oyster 271g, 6x4, 50
£7.95
Digital Gloss or Oyster 271g, 7x5, 50
£10.95
Digital Gloss or Oyster 271g, A4, 50
£19.95
Digital Gloss or Oyster 271g, A3, 25
£21.95
Digital Gloss or Oyster 271g, A3+, 25
£29.95
Double Sided Oyster 285g, A4, 25
£26.95
Matt Proofing 160g, A4, 150
£19.95
Matt Plus 240g, A4, 25
£9.95
Matt Double Sided 220g, A4, 100
£21.95
Baryta Fibre Base Matt 271g, A4, 25
£18.95
Baryta Fibre Base Gloss 295g, A4, 25
£24.95
Baryta Fibre Base Royal 271g, A4, 25
£28.95
Smooth Fine Art Portfolio 200g, A4, 25
£19.95
Smooth Fine Art Portrait 300g, A4, 25
£26.95
Smooth Fine Art Omega 310g, A4, 25
£19.95
Textured Fine Art Artist 210g, A4, 25
£19.95
Textured Fine Art Museum 310g, A4, 25 £25.95
Textured Fine Art Parchment 285g, A4, 25 £21.95
Canvas Artistic 400g, A4, 10
£14.95
Canvas Photo Matt 350g, A4, 10
£16.95
Canvas Photo Semi-Gloss 350g, A4, 10 £17.95
ICC profiles available for all PermaJet papers

Sample Pack 14 sheets, A4 £8.95
Photo Rag 308 A4, 20
£23.95
Photo Rag Satin A4, 20 £25.95
Photo Rag Pearl A4, 20 £26.95
Established in 1584, the Hahnemuhle Photo Rag Baryta A4, 20 £28.95
£25.95
name is synonymous with fine art printing. Fine Art Pearl A4, 20
Full range now available at Premier Ink. Fine Art Baryta A4, 20
£26.95

E&OE. Prices may be subject to change, but hopefully not!

www.storemags.com & www.fantamag.com

William Turner A4, 20
Museum Etching A4, 20
German Etching A4, 20
Torchon A4, 20
Bamboo A4, 20
Sugar Cane A4, 20
Natural Art Duo A4, 20

£26.95
£28.95
£21.95
£17.95
£20.95
£19.95
£17.95

Orders are shipped promptly by Royal Mail 1st class post, for which we charge just £1.72
per order. All prices include VAT, and a full VAT receipt is provided with every order. Payment
accepted by credit/debit card, cheque or postal order. Orders accepted securely online,
www.premier-ink.co.uk, over the telephone, 01926 339977, by post, or by visiting our showroom:
Premier Ink & Photographic, Longfield Road, Sydenham Ind Estate, Leamington Spa, CV31 1XB.

01926 339977

www.premier-ink.co.uk
BATTERIES

MEMORY
SAVINGS!
UP TO

34%
OFF RRP!

SD & SDHC
1GB Inov8, Standard
£6.99
2GB Kingston, Standard
£6.99
2GB Inov8, Standard
£6.99
2GB Sandisk, Standard £7.99 £5.99
2GB Sandisk, Ultra II £10.99 £7.99
4GB Kingston, Class 4
£8.99
4GB Inov8, Class 6
£9.99
4GB Sandisk, Standard £11.99 £8.99
4GB Sandisk, Ultra II £14.99 £11.99
4GB Sandisk, Extreme III
£32.99
8GB Kingston, Class 4
£17.99
8GB Inov8, Class 6
£16.99
8GB Sandisk, Standard
£19.99
8GB Sandisk, Ultra II
£24.99
8GB Sandisk, Extreme III
£56.99
16GB Kingston, Class 4
£32.99
16GB Inov8, Class 6
£29.99
MicroSD & MicroSDHC
1GB Kingston, Standard £4.99 £2.99
2GB Kingston, Standard
£6.99
4GB Kingston, Class 4
£9.99
Compact Flash
1GB Kingston, Standard
£9.99
1GB Transcend, 133X
£13.99
2GB Kingston, Standard
£12.99
2GB Inov8, 100X
£10.99
2GB Sandisk, Ultra II £17.99 £13.99
4GB Kingston, Standard
£14.99
4GB Inov8, 100X
£13.99
4GB Sandisk, Ultra II £23.99 £18.99
4GB Sandisk, Ext III £37.99 £25.99
8GB Kingston, Standard
£20.99
8GB Inov8, 100X
£19.99
8GB Transcend, 133X
£24.99
8GB Sandisk, Ultra II
£29.99
8GB Sandisk, Ext III £62.99 £42.99
16GB Kingston 133X
£42.99
16GB Inov8, 100X
£35.99
16GB Transcend, 133X
£47.99
16GB Sandisk, Ext III £94.99 £67.99
xD Picture Cards
256MB Fuji
£9.99
1GB Olympus
£11.99
2GB Olympus
£15.99
Memory Stick Pro Duo
2GB MS Pro Duo
£12.99
4GB MS Pro Duo
£19.99
Smart Media
128MB Samsung
£29.99

Camera Batteries

P-Type Filter System

A comprehensive range of
rechargeable li-ion
batteries.
Manufactured by
respected independent
battery manufacturers
Energizer and Blumax. All
batteries come with a 2 year guarantee.

The P-Type square/rectangular filter system
consists of three parts:
1) An adapter ring that screws onto the front
of your lens
2) A filter holder clips onto the ring
3) One or more P-Type (84mm wide) filters

NB-1L for Canon
NB-2L/LH for Canon
NB-3L for Canon
NB-4L for Canon
NB-5L for Canon
NB-6L for Canon
NB-7L for Canon
BP-511 for Canon
LP-E5 for Canon
NP20 for Casio
NP40 for Casio
NP60 for Casio
NP40 for Fuji
NP45 for Fuji
NP50 for Fuji
NP60 for Fuji
NP70 for Fuji
NP80 for Fuji
NP95 for Fuji
NP120 for Fuji
NP140 for Fuji
NP150 for Fuji
NP200 for Minolta
NP400 for Minolta
EN-EL1 for Nikon
EN-EL2 for Nikon
EN-EL3/3A for Nikon
EN-EL3E for Nikon
EN-EL5 for Nikon
EN-EL7 for Nikon
EN-EL8 for Nikon
EN-EL9 for Nikon
EN-EL10 for Nikon
EN-EL11 for Nikon
EN-EL12 for Nikon
Li10B/12B for Olympus
Li40B/42B for Olympus
Li50B for Olympus
BLM-1 for Olympus
BLS-1 for Olympus
CGA-S005 for Panasonic
CGR-S006 for Panasonic
CGA-S007 for Panasonic
CGA-S008 for Panasonic
D-Li8 for Pentax
D-Li50 for Pentax
D-Li78 for Pentax
DB60 for Ricoh
DB70 for Ricoh
SLM-1137D for Samsung
SLM-1674 for Samsung
BD-1 for Sony
BG-1 for Sony
NP-FM55H for Sony
NP-FM500H for Sony

£9.99
£9.99
£9.99
£9.99
£9.99
£9.99
£12.99
£12.99
£12.99
£9.99
£9.99
£9.99
£9.99
£9.99
£9.99
£9.99
£9.99
£9.99
£9.99
£9.99
£12.99
£14.99
£9.99
£12.99
£9.99
£9.99
£9.99
£15.99
£9.99
£19.99
£9.99
£12.99
£9.99
£9.99
£9.99
£9.99
£9.99
£9.99
£12.99
£12.99
£9.99
£9.99
£9.99
£9.99
£9.99
£12.99
£9.99
£9.99
£9.99
£9.99
£12.99
£19.99
£19.99
£19.99
£22.99

£6.99
£9.99
£18.99
£32.99

Please check our website for the
full range, and up-to-date pricing

Memory Cases

£2.99
Kenro MC5

2 cards, 8 AA batteries

£6.99

P-Type Holders
Holder Standard
£5.99
Holder Wide Angle
£9.99
Hood Modular
£9.99
Hood Bellows
£34.99
A to P Type Adapter
£9.99
P-Type Bellows Hood
A new design of
Bellows Hood that
slots into the front
slot of a standard
P-Type Holder.

£34.99
P-Type Filter Wallet
A smooth cushioned filter
wallet, to protect
and store up to
8 P-Type filters

£9.49
We also stock Z-Pro (100mm)
and A-Type (67mm) filters,
holders and adapter rings

For Canon 30/40/50D:

£99.99

For Canon 350/400D:

£59.99

+1x NB-2L:

£68.99 +2x NB-2L:

£77.99

For Canon 450/500/1000D: £69.99
+1x LP-E5:

£81.99 +2x LP-E5:

£93.99

For Nikon D40/D60:

£59.99

For Nikon D80/D90:

£89.99

+1x EN-EL9:

£71.99 +2x EN-EL9:

£83.99

+1x EN-EL3E: £104.99 +2x EN-EL3E: £119.99

For Nikon D300/D700:

£139.99

For Sony A200/A350:

£69.99

+1x EN-EL3E: £154.99 +2x EN-EL3E: £169.99
+1x EN-EL3:

£88.99 +2x EN-EL3:

£107.99

Standard Rechargeables

Universal Charger

High-power Ni-MH rechargeable AA and
AAA batteries - all sold in packs of 4.

The NEW Hahnel UniPal
charger is able to charge
AA, AAA, Li-Ion batteries,
cameras, phones, iPods
and more! Mains power
cable, plus 12V car charger.
Full details on our website.

AAA 600mAh Energizer
£3.99
AAA 1000mAh Energizer
£6.99
AA 1300mAh Energizer £3.90 £1.99
AA 2450mAh Energizer
£7.99
AA 2650mAh Duracell
£7.99
Charger +2500mAh Energizer £9.99
ReCyko+ Rechargeables
New technology, combining the benefits
of Alkaline and Ni-MH rechargeable
batteries. They come pre-charged, retain
90% of their charge after 6 months, and
last 4 times as long as alkaline batteries!

AAA 850mAh equivalent (4)
AA 2050mAh equivalent (4)

£5.99
£7.99

Ultimate Lithium
Energizer Ultimate Lithium:
The longest lasting AA and
AAA batteries in the world!

£6.99
AAA Ultimate Lithium (4)
AA Ultimate Lithium (4) £6.99 £5.99

P-Type Filters (84mm wide)
£27.99
Circular Polarizing
£29.99
Infra Red R72
£8.99
ND2
£8.99
ND4
£10.99
ND2 Soft Graduated
ND2 Hard Graduated NEW £10.99
£10.99
ND4 Soft Graduated
ND4 Hard Graduated NEW £10.99
£10.99
Light Blue Graduated
£10.99
Dark Blue Graduated
£10.99
Cool Blue Graduated
Light Sunset Graduated £10.99
Dark Sunset Graduated £10.99
Light Tobacco Graduated £10.99
Dark Tobacco Graduated £10.99
Light Mauve Graduated £10.99
£10.99
Dark Mauve Graduated
£10.99
Light Red Graduated
£10.99
Dark Red Graduated
£10.99
Light Green Graduated
£10.99
Dark Green Graduated
Light Yellow Graduated £10.99
£10.99
Dark Yellow Graduated
£11.99
Starburst x4/6/8, each
£11.99
Close-Up +1/2/4, each
£8.99
Fog Light/Strong, each
Diffuser Light/Strong, each £8.99
£8.99
Spot White/Clear, each
£8.99
80A, 80B, 80C, each
£8.99
81A, 81B, 81C, each
£8.99
82A, 82B, 82C, each
£8.99
85A, 85B, 85C, each
£8.99
Red, Orange, each
£8.99
Yellow, Green, each
Many more P-Type filters in stock!

£42.99

Neutral Density filters have a multitude of uses - from increasing detail in landscapes
and reducing over-exposed skies, to creating stunning motion scenes by reducing shutter
speeds. Here's a kit which includes all the popular ND filters, and everything you need
to get started! The kit contains: 1x ND2 Filter, 1x ND2 Soft Graduated Filter, 1x ND4
Filter, 1x ND4 Soft Graduated Filter, 1x P-Type Filter Holder, 1 x P-Type Adapter Ring
of your choice (49-82mm). Just £39.95 - saving £6 on the individual prices.

Bayonet-Fit Lens Hoods

ES-62 Canon 50/1.8
£9.99
ES-71II Canon 50/1.4
£9.99
ET-60 Canon 75-300/4-5.6
£9.99
ET-65B Canon 70-300/4-5.6 £9.99
ET-65III Canon 85/1.8
£9.99
ET-67 Canon 100/2.8 Macro £9.99
ET-67B Canon 60/2.8
£9.99
EW-60C Canon 18-55 IS
£7.99
EW-63II Canon 28/1.8, 28-105 £9.99
EW-73B Canon 17-85 IS
£9.99
EW-78BII Canon 28-135 IS £9.99
EW-78D Canon 18-200 IS
£9.99
EW-83E Canon 17-40/4.0 £12.99
EW-83J Canon 17-55/2.8
£12.99
HB-25 Nikon 24-85, 24-120 £12.99
HB-32 Nikon 18-105, 18-135 £7.99
HB-37 Nikon 55-200 VR
£7.99
HB-45 Nikon 18-55 VR
£7.99

Screw-Fit Lens Hoods
52mm Shaped Petal Hood
£6.99
55mm Shaped Petal Hood
£6.99
58mm Shaped Petal Hood
£6.99
62mm Shaped Petal Hood
£7.99
67mm Shaped Petal Hood
£7.99
72mm Shaped Petal Hood
£9.99
77mm Shaped Petal Hood
£9.99
82mm Shaped Petal Hood £11.99
46mm Rubber Hood
£3.99
52mm Rubber Hood
£3.99
55mm Rubber Hood
£3.99
58mm Rubber Hood
£3.99
62mm Rubber Hood
£4.99
67mm Rubber Hood
£4.99
72mm Rubber Hood
£5.99
77mm Rubber Hood
£5.99
Lens Caps
30mm, 37mm, 40mm, 43mm,
46mm, 49mm, 52mm, 55mm,
58mm, 62mm, 67mm, 72mm,
77mm, 82mm, 86mm, 95mm
£3.99 each

Bubble Spirit Levels

£29.99

Li-Ion Charger
A universal Li-Ion charger, able to charge
most camera batteries. Mains
cable, plus 12V car charger. £14.99

Twin Axis Normal Hotshoe
Twin Axis Sony Hotshoe
Triple Axis Normal Hotshoe
Triple Axis Sony Hotshoe

Seculine Digital Spirit Level

£7.99
£7.99
£9.99
£9.99

A digital spirit level that mounts onto the
hot shoe in the usual
manner, and uses
LEDs to confirm
when the camera
is perfectly level.

CR123A Energizer Lithium (1)
CR2 Energizer Lithium (1)
2CR5 Energizer Lithium (1)
CRV3 Energizer Lithium (1)
LR44 Energizer Alkaline (2)
CR2025, CR2032 etc

£1.99
£1.99
£3.99
£5.99
£1.99
£1.99

Full range of coin cells in stock

£5.99
£5.99
£6.99
£7.99
£8.99
£9.99
£11.99
£14.99
£17.99
£22.99

More sizes in stock, from 24 to 86mm!

£17.99
£17.99
£19.99
£21.99
£24.99
£27.99
£34.99
£39.99
£44.99
£49.99

More sizes in stock, from 27 to 86mm!

Neutral Density Filters

These work in a very similar way to a UV
filter, but have a pinkish tinge to add a
gentle warmth to your photos.

Used reduce the amount of light passing
through the lens, reducing shutter speed
without affecting colour contrast or balance.
Available as ND4 (2 stop) and ND8 (4 stop).

46mm Skylight
52mm Skylight
55mm Skylight
58mm Skylight
62mm Skylight
67mm Skylight
72mm Skylight
77mm Skylight
82mm Skylight
86mm Skylight

£6.99
£6.99
£7.99
£8.99
£9.99
£10.99
£12.99
£15.99
£18.99
£24.99

52mm ND4 / ND8
55mm ND4 / ND8
58mm ND4 / ND8
62mm ND4 / ND8
67mm ND4 / ND8
72mm ND4 / ND8
77mm ND4 / ND8

Close Up Filter Sets
Sets containing three filters, rated at +1, +2,
and +4 diopters. Increases close up / macro
ability of the lens they are fitted to.
52mm Close-Up Set
£25.99
55mm Close-Up Set
£28.99
58mm Close-Up Set
£32.99
62mm Close-Up Set
£37.99
67mm Close-Up Set
£44.99
More sizes in stock, from 46 to 77mm!

£10.99
£12.99
£14.99
£16.99
£19.99
£24.99
£29.99

More sizes in stock, from 37 to 82mm!

Starburst Filters

More sizes in stock, from 30 to 105mm!

DHG Lens Protection
£12.99
52mm DHG Lens Protect
£13.99
55mm DHG Lens Protect
£14.99
58mm DHG Lens Protect
£16.99
62mm DHG Lens Protect
£18.99
67mm DHG Lens Protect
£21.99
72mm DHG Lens Protect
£24.99
77mm DHG Lens Protect
£27.99
82mm DHG Lens Protect

These add a dramatic star cross flare to
bright light sources, such as streetlights.
They also give a slight soft focus effect.
52mm Starburst x4/6/8, each £11.99
58mm Starburst x4/6/8, each £15.99
67mm Starburst x4/6/8, each £21.99
72mm Starburst x4/6/8, each £27.99
More sizes in stock, from 46 to 82mm!
We stock many other filter types, including
multi-image, fog, split-field, red, orange,
yellow and green filters in a range of sizes.

Cleaning Kit £3.90

Kenair

4-in-1 lens cleaning kit:
blower brush, lens solution,
lint free tissues, and pack
of cotton cleaning buds.

Kenair compressed air is used to
blow dust, fluff and other unwanted
particles from your delicate camera
equipment and accessories.

Small Hurricane Blower £1.99
Large Hurricane Blower £3.99

Kenair Master Kit
Kenair Spare Aerosol

£13.99
£7.99
£4.49
£5.99

DHG Circular Polarisers
52mm DHG Circ. Polarizing £35.99
55mm DHG Circ. Polarizing £38.99
58mm DHG Circ. Polarizing £41.99
62mm DHG Circ. Polarizing £46.99
67mm DHG Circ. Polarizing £49.99
72mm DHG Circ. Polarizing £55.99
77mm DHG Circ. Polarizing £61.99
72mm DHG Circ. Polarizing £74.99

STEPPING RINGS
Step-Up and Step-Down Rings
Stepping rings are used to “step-up” or “step-down”
from one filter thread size to another.

27-30mm
34-37mm
37-43mm
43-46mm
46-49mm
49-52mm

52-46mm 58-55mm 67-58mm
52-55mm 58-62mm 67-62mm
This is just a tiny
52-58mm 58-67mm 67-77mm fraction of our range.
160 different sizes
55-52mm 62-58mm 72-67mm Over
in stock, from 25mm to
55-58mm 62-67mm 72-77mm
105mm. Probably
58-52mm 62-72mm 77-72mm the largest selection
in the UK.
All just £4.99 each!

MACRO PHOTOGRAPHY
Reversing Rings - £12.99

Extension Tubes

These fit to the camera body, between the
camera and lens, leaving a screw thread
to enable the reverse mounting of lenses.
A way of obtaining a high reproduction ratio,
allowing extreme Macro photography.

Set of 3 tubes. They contain no optics,
they simply move the lens further from the
camera body, allowing closer focusing.

Canon: 52mm, 55mm, 58mm
Nikon: 52mm, 55mm, 58mm
Pentax K: 52mm, 55mm, 58mm
Olympus: 52mm, 55mm, 58mm
Sony: 52mm, 55mm, 58mm
Coupling Rings - £11.99
52-52mm, 52-55mm, 52-58mm
55-55mm, 55-58mm, 58-58mm

£9.99 Spudz 6x6 inch
£9.99 Spudz 10x10 inch

46mm Circular Polarizing
52mm Circular Polarizing
55mm Circular Polarizing
58mm Circular Polarizing
62mm Circular Polarizing
67mm Circular Polarizing
72mm Circular Polarizing
77mm Circular Polarizing
82mm Circular Polarizing
86mm Circular Polarizing

Skylight Filters

Used to attach two lenses together via their
filter threads, achieving high magnifications

CLEANING

LensPen Original
LensPen DigiKlear

46mm UV / Haze
52mm UV / Haze
55mm UV / Haze
58mm UV / Haze
62mm UV / Haze
67mm UV / Haze
72mm UV / Haze
77mm UV / Haze
82mm UV / Haze
86mm UV / Haze

£29.99

Coin Cells, etc
A comprehensive range of specialist
batteries - see our website for full range.

Circular Polarising Filters
These remove reflections from surfaces
such as glass and water, as well as
increasing contrast and saturation.

We also stock a range of
body caps and rear lens
caps for Canon, Nikon,
Olympus, Sony, Pentax, etc

SPIRIT LEVELS
These simply mount onto the
hot shoe of a DSLR camera.

UV / Haze Filters
Used both to protect the lens of your
camera, and to absorb ultraviolet rays
that can cause photos to appear hazy.

Marumi Digital High Grade (DHG) filters have an extra-thin, low-profile
frame, to help prevent vignetting. Multiple digital anti-reflection coatings
and black-rimmed Japanese optical glass, combined with a satin frame,
further reduce unwanted reflections, ghosting and flare.

LENS HOODS & CAPS

This is just a sample, more in stock!

BATTERIES & CHARGERS

KOOD
Japanese Optical Glass Filters
Coated to reduce lens flare and reflections.

P-Type Neutral Density Filter Kit

A comprehensive range of aftermarket
matt black bayonet-fit lens hoods
compatible with Canon and Nikon lenses.

Battery Grips
A range of professional battery
grips from Hahnel. All can take
two Li-ion batteries for double
the battery power. AA
battery compartment
and/or vertical shutter
release and/or infrared
remote, depending on model.
+1x BP-511: £111.99 +2x BP-511: £123.99

A range of protective
shock-resistant rubber
lined memory card
cases to keep your
memory cards safe
and secure.
Vanguard 3D
4 cards, with keychain

P-Type Adapter Rings
49mm Adapter Ring
£4.99
52mm Adapter Ring
£4.99
55mm Adapter Ring
£4.99
58mm Adapter Ring
£4.99
62mm Adapter Ring
£4.99
67mm Adapter Ring
£4.99
72mm Adapter Ring
£4.99
77mm Adapter Ring
£4.99
82mm Adapter Ring
£4.99

Many more batteries in stock!

USB Pen Drives
2GB Kingston Datatraveler
4GB Kingston Datatraveler
8GB Kingston Datatraveler
16GB Kingston Datatraveler

SCREW-TYPE FILTERS

SQUARE FILTERS

T2 Mounts - £12.99
Canon, Nikon, Sony, Oly, Pentax

Canon (Manual)
Canon (Autofocus)
Nikon (Manual)
Nikon (Autofocus)
Sony (Manual)
Sony (Autofocus)

£17.99
£129.99
£17.99
£129.99
£17.99
£129.99

Extension Bellows
Acting like an adjustable
set of extension tubes,
they allow fine control
over focusing distance

Canon £49.99
Nikon £49.99
Series 7 Rings, Rollei Rings and
Hasselblad Rings also in stock.

Telephone: 01926 339977 or 0800 1077 211

www.premier-ink.co.uk
Premier Ink, Longfield Road, Leamington Spa, CV31 1XB

www.storemags.com & www.fantamag.com

We are a small family owned and run company, specialising in photographic consumables.
We are based in Leamington Spa, in the heart of Warwickshire - if you are passing, or
live close by, please pop into our shop, and meet Judy - our office dog!
Premier Ink & Photographic, Longfield Road, Sydenham
Industrial Estate, Leamington Spa, Warwickshire. CV31 1XB.

01926 339977 www.premier-ink.co.uk
CAMERA BAGS

FLASH DIFFUSERS
Inverted Dome Pro Flash Diffuser Set
Comprising a clear vinyl body that simply slips onto the head of the flash
gun, and an inverted frosted dome that clips onto the front.
In addition to diffusing the flash directly hitting your subject, the
inverted dome spreads light evenly through the sides of the clear
vinyl body, lighting up the surrounding environment, thus producing
a natural soft daylight effect. Especially useful for shooting interiors
and portraits, and is a firm favourite with wedding photographers.

Expedition Backpack
Tamrac’s famous range of
Expedition backpacks have
recently been upgraded and
continue to lead the way in
carrying huge amounts of
camera kit in comfort!
Fully MAS compatible.

Supplied with four domes - neutral, yellow, amber and
blue, giving you a full range of natural, cool, or
warm-up tones. Available in four sizes, to fit the
heads of most flash guns:

£29.95

Size 1: 62-65 x 39-42mm Nikon SB600, SB800, etc
Size 2: 64-68 x 35-38mm Canon 420EX, 430EX, etc
Size 3: 68-72 x 46-49mm Nikon SB26, 27, 28, etc
Size 4: 73-77 x 46-49mm Canon 550EX, 580EX, etc

Expedition 4X
Expedition 5X
Expedition 6X
Expedition 7X
Expedition 8X

£67.95
£82.95
£95.95
£119.95
£137.95

Velocity 6X
Velocity 7X
Velocity 8X
Velocity 9X
Velocity 10X

£29.95
£36.95
£42.95
£49.95
£59.95

Modular Accessory System
The patented Tamrac Modular Accessory
System (MAS) allows photographers to
customise their bags using accessories
that attach to MAS slots on Tamrac bags.

Bounce Flash Diffuser
These popular, simple opaque plastic diffusers simply fit onto the front
of your flash gun, creating a diffused bare bulb effect with even
coverage. Huge range available for Canon, Nikon, Sony, Olympus,
Pentax, Metz & Nissin. Below is just a sample of the range:

Canon 270EX / 380EX / 420EX
Canon 430EX / 430EXII / 550EX
Canon 580EX / 580EXII
Nikon SB600 / SB800 / SB900
Nikon SB24 / SB25 / SB26 / SB28
Sony: HVL-F42AM / HVL-F58AM, Metz: 48AF1 / 58AF1
Nissin: Di466 / Di622 / Di866, Pentax: AF-540FGZ

Kata 3N1 Sling

Velocity Sling
A unique design of sling
backpack, that opens away
from your body for even
faster access to your gear!

Water Bottle With Holder
Lens Case Pro 50
Lens Case Pro 100
Aero Speed Pack
Lens Case Pro 200
Dual access, dual compartment Flash Case Medium
photo backpacks, with front Flash Case Large
and side openings.
Rain Cover Medium
SpeedPack 75 £56.95 Rain Cover Large
SpeedPack 85 £75.95 MAS Belt Medium

£9.95
£11.95
£12.95
£13.95
£8.95
£9.95
£17.95
£19.95
£15.95

This unique range of bags
provides three carrying options
in one, morphing from sling to
backpack and back again
quickly and easily by use of its
quick release buckles.
In sling position, the bag easily
swings around from back to
front to achieve quick draw
access to your main camera
and lenses.
Left
Backpack
Right
In backpack position you can
Mode
Sling Mode
Sling Mode
comfortably carry your equipment for long distance walking
when needed. The included chest belt and balancing hip strap helps
take the load of your heavy equipment off your shoulders.
Arrange your equipment in the bottom main compartment of the pack
taking full advantage of the modular dividers to custom fit the bag to
your exact equipment, while the large top compartment can be used
as a daypack or for holding additional camera gear. Two external pockets
allow quick access to accessories without opening the main
compartments. The included rain cover folds neatly away into an
integrated pocket.

Kata 3N1-10

A flash diffuser that slots onto the camera hotshoe, and
mounts a contoured diffuser plate in front of the built-in
flash on SLR cameras. Not compatible with Sony cameras
Height adjustable, and supplied
with neutral, amber, and blue
diffuser plates.

£9.95

RING FLASH
Marumi DRF14 Ring Flash
The highly-acclaimed Marumi Ring Flash is a true ring flash - it consists of a main
control unit and a seperate ring light which connects to the lens filter thread. This
unit is ideal for Macro/Close-up photography due to the flash light being positioned
directly between the camera lens and subject allowing for even/shadowless
illumination. The flash has a 14m/ISO100 guide number and features auto TTL
exposure. The lens mount is 52mm, step-up rings are also supplied for 55mm,
58mm, 62mm and 67mm fittings. Available in Nikon Fit, with iTTL metering and
Canon Fit, with E-TTL and E-TTL II metering.
In a glowing report in the June 2009 issue of Photo Plus magazine, the
Marumi Ring Flash was described as “great
value“ and was ranked above two other ring
flash units costing in the region of £300!

External Dimensions: 44.0 x 23.5 x 19.0cm
Internal Dimensions: 31.5 x 22.0 x 16.0cm

External Dimensions: 45.0 x 32.0 x 19.0cm
Internal Dimensions: 32.5 x 29.5 x 16.0cm

UrbanGear U30

A spacious camera section at the bottom,
separate daypack section at the top, and
dedicated 15.4” laptop
compartment behind.
Hidden rain cover,
tripod carrying system,
padded shoulder, waist
and chest belts. Too
many features to list!
External Dimensions:
30.5 x 36.8 x 48.3cm
Interior Dimensions:
Laptop Compartment:
28.0 x 3.8 x 35.5cm
Camera Compartment:
16.5 x 29.2 x 15.2cm

The U30 is a lightweight camera backpack
that can hold a plethora of equipment: the
main compartment can accommodate a
DSLR (such as the Nikon D60
or Canon 1000D) with up to
a 70-200 lens attached, as
well as 2-3 additional lenses.
External Dimensions:
25.4 x 29.2 x 20.3cm
Internal Dimensions:
22.9 x 26.7 x 11.4cm

£29.95

UrbanGear U60

Adventure K4L

£109.95

£82.95

A larger version of the K3L,
able to accommodate
most 17” laptops.
External Dimensions:
33.0 x 35.6 x 52.1cm
Interior Dimensions:
Laptop Compartment:
33.0 x 3.8 x 40.6cm
Camera Compartment:
19.0 x 29.8 x 17.8cm

Sahara 115F
A shoulder bag
large enough to
take a 15” laptop.

...worth £15 with every
Nissin Flash Gun!

£39.95

Medium camera backpack,
capable of holding a
medium-sized DSLR with
80-400 lens attached.
The camera compartment
is also removeable.
External Dimensions:
30.5 x 26.0 x 19.0cm
Internal Dimensions:
26.7 x 24.8 x 12.7cm

UrbanGear U120
Large camera backpack, capable
of holding a full camera
system with accessories,
with a separate 15”
laptop compartment.
External Dimensions:
44.5 x 31.8 x 28.6cm
Internal Dimensions:
36.2 x 26.7 x 13.3cm

An advanced and versatile flash gun, with a guide number of
33m/ISO100, 46m/ISO200 at 105mm. Featuring the latest
TTL flash control technology, specification includes adjustable
bounce flash head, wide angle diffuser and catch light reflector,
wireless remote slave flash on manual mode and energy saving
auto-off circuit.
Available in Nikon Fit, with iTTL metering and
Canon Fit, with E-TTL and E-TTL II metering.

For Kata 3N1 bags.

Analogue, incident and
reflected, ambient
light only.

£90.95

£69.95

Sekonic L308S
FlashMate

Nissin Di622 Speedlite (GN:44)
An impressively powerful flash gun, with a guide number of
44m/ISO100, 62m/ISO200 at 105mm. Incredible specification,
including bounce and swivel flash head, wide angle diffuser
and catch light reflector, wireless slave flash with power ratio,
active AF assist light and energy saving auto-off circuit.
Available in Nikon Fit, with iTTL metering and
Canon Fit, with E-TTL and E-TTL II metering.

We are an official
Authorised Sekonic
Demonstration
Centre, and have
the Sekonic range
on display and
available for demonstration in our
showroom in Leamington Spa.

Digital, incident and
reflected, ambient and
flash light.

IMPROVED - Kata DPS Digital Rucksack

DR-465i £57.95

DC
445

£102.95

Digital, incident and reflected,
simultaneous ambient and flash
light, rotating
head.

£209.95

The Nissin Di866 Professional Flashgun is an extremely powerful flashgun
(guide number of 60m/ISO100) with an easy to read colour LCD panel,
making this advanced unit very easy to use. Designed for use with Canon
and Nikon digital SLRs, the Nissin Di866 fully supports Canon's E-TTL
and Nikon’s i-TTL functionality with the option for full manual
overrides. Covering a range of focal lengths from 24-105mm and
including a secondary fill in flash unit, the Nissin Di866 is the
flashgun professionals have been waiting for. A built in USB port
means upgrades can be downloaded via an internet connection.
Available in Nikon Fit, with iTTL
metering and Canon Fit, with
E-TTL and E-TTL II metering.

L758DR
DigitalMaster

£132.95

£439.95

Gossen
DigiSix

Gossen
DigiFlash

Vanguard Pampas
Sling Backpack

Shoulder bags,
with separate
carryling handle
and shoulder
strap. Capable of
carrying most DSLRs with kit lens attached.
Two separate end compartments keep your
accessories safe, tidy and well protected.

A range of innovative
sling backpacks, with
day pack at the top and
separate camera section
at the bottom.The bag
sits comfortably on your
back, and when needed,
it revolves round to your
front for easy access to your
camera, without having to take the bag off.
Additionally, the bag then provides a secure
platform for lens changing or photo taking.

We stock Metz flash guns for Canon,
Nikon, Sony, Samsung, Olympus and Pentax
36 AF-4

48 AF-1

58 AF-1

Guide Number:
36m / ISO100

Guide Number:
48m / ISO100

Guide Number:
58m / ISO100

£72.95

£175.95

£289.95

£18.95

External Dimensions: 29.0 x 22.0 x 17.0cm
Internal Dimensions: 21.0 x 15.0 x 11.0cm

Peking 25

£21.95

External Dimensions: 34.0 x 23.0 x 19.5cm
Internal Dimensions: 25.0 x 17.0 x 12.0cm

*NEW* Up-Rise Range
£49.95
Up-Rise 34 Slingbag
Up-Rise 43 Slingbag
£59.95
Up-Rise 45 Backpack £79.95
Up-Rise 48 Backpack £89.95

£29.95

Pampas 37

External Dimensions: 34.0 x 21.5 x 21.5cm
Internal Dimensions: 17.0 x 19.0 x 13.0cm

£35.95

Pampas 47

External Dimensions: 42.0 x 21.5 x 21.5cm
Internal Dimensions: 25.0 x 19.0 x 13.0cm

£39.95

Pampas 57

External Dimensions: 44.5 x 24.0 x 22.0cm
Internal Dimensions: 30.0 x 22.0 x 15.0cm

£119.95

£139.95

We are proud to announce that we have been appointed
as an Authorised Billingham Specialist Centre.
Billingham’s exquisite range of hand-made camera bags are now on display in our
recently-extended showroom in Leamington Spa. If you are considering investing in a
professional camera bag that will protect your equipment for many years to come, we
strongly recommend first-hand inspection of the Billingham range - only then can
Billingham’s preoccupation with excellence and attention to detail be fully appreciated.

£149.95

The Hadley Pro
PC-1
MP-1
CM-N3
N90-M3

The 5 Series

Based on the Hadley
Original, the Hadley Pro
features a number of
additional features,
including a carrying handle and
waterproofed zippered back pocket.
Available in Khaki & Tan, Sage & Tan,
Black & Tan, and Black & Black

Nissin SC-01 Universal Flash Shoe Cord
An incredibly useful Universal Flash Shoe Cord, with 1.5m coiled cable,
allowing off camera flash photography. It has a multiple pin configuration,
allowing it to retain full TTL compatibility between camera and flash on Canon,
Nikon, Fujifilm, Pentax and Samsung DSLRs. The TTL shoe which fits
to the main camera body features a secondary hot shoe enabling you to
attach 2 flash units, one on the top of the camera and another off to the side.

DR-467i £72.95
£26.95 Insertrolley
£28.95
Compatible
with many
£31.95
Kata bags
£35.95
£47.95
£39.95
£42.95

Vanguard Peking
Shoulder Bag

The Hadley Pro

Gossen
DigiPro F
WAS £199.95

£224.95

DR-466i £64.95

Kata DC Shoulder Bags DC-435
A range of understated, yet DC-437
surprisingly roomy and DC-439
well-padded shoulder DC-441
bags, each including
a detachable rain DC-443
cover. DC-445

Sekonic L358
FlashMaster

RRP: £169.95 Save: £67.00

Nissin Di866 Speedlite (GN:60)

L398A
Deluxe III

£129.95

NEW PRODUCT - Kata 3N1-33
Based in the award-winning 3N1-30, the new 3N1-33
has additional features, the most notable being a 15”
laptop compartment. See website for details.

The Kata DPS Digital Rucksack gives top level protection to
two DSLRs with mounted lenses, 3-4 single lenses, a flash, as
well as your personal items. The rucksack can be converted
from a camera bag into a daypack when not shooting by
removing the padded bottom camera insert. When used as a
camera bag, the main compartment will hold your DSLR in a
top grip position while the modular dividers system separates,
organises and protects your lenses, flashes and other
accessories. There is an included rain cover which folds neatly
away, and an ergonomic chest belt and balancing waist strap
for maximum comfort while transporting your gear.

Peking 21
L208 TwinMaster

RRP: £149.95 Save: £59.00

£47.95

Kata 3N1-Tripod
Holder £12.95

£69.95

£59.95

LIGHT METERS, TRIGGERS

Nissin Di466 Speedlite (GN:33)

£89.95

Kata 3N1-30
Adventure K3L

£69.95

FLASH GUNS

£73.95

Kata 3N1-20

£10.95

Camera Built-in Flash Diffuser Set

£65.95

External Dimensions: 41.0 x 22.0 x 16.5cm
Internal Dimensions: 28.5 x 19.0 x 15.0cm

£8.95
£13.95
£96.95
£64.95

PocketWizard
Mini TT1

PocketWizard
Flex TT5

£209.95

£229.95

PocketWizard
Plus II

PocketWizard
Plus II
Twin Set

PocketWizard
MultiMax

£169.95

£299.95

£229.95

Full cable range stocked

£134.95

More Billingham Bags
NEW Billingham f2.8 £129.95
NEW Billingham f1.4 £139.95
The Hadley Digital
£89.95
The Packington
£189.95
The Classic 550
£399.95
Billingham Accessories
Superflex Inserts (all) £12.95
Shoulder Pads
£17.95
Tripod Straps
£14.95

www.storemags.com & www.fantamag.com

A firm favourite with
serious photographers
the world over, the “5
Series” range comprises
four sizes of bag, available in
Khaki & Tan, Black & Tan, or Black & Black.

Billingham 225
Billingham 335
Billingham 445
Billingham 555

£199.95
£209.95
£229.95
£249.95
The 07 Range

New Billingham bags
for 2009, constructed
from FibreNyte - a
lighter alternative to
traditional Canvas.
Available in Khaki &
Chocolate or Black & Black.

Billingham 107
Billingham 207
Billingham 307

£209.95
£219.95
£239.95

Orders are shipped promptly by Royal Mail 1st class post, for which we charge just £1.72 per order.
All prices include VAT, and a full VAT receipt is provided with every order. Payment accepted by
credit/debit card, cheque or postal order. Orders accepted securely online, www.premier-ink.co.uk, over
the telephone, 01926 339977, by post, or by visiting our new showroom: Premier Ink & Photographic,
Longfield Road, Sydenham Industrial Estate, Leamington Spa, Warwickshire. CV31 1XB.

01926 339977

www.premier-ink.co.uk

TRIPODS, MONOPODS & HEADS
Tripod & Head
Special Deals
190XDB Tripod
RRP: £99.95
056 Three Way Head RRP: £29.95
2-Axis Spirit Level
RRP: £29.95

055XDB Tripod
RRP: £119.95
222 Grip Ball Head RRP: £89.95
3-Axis Spirit Level
RRP: £34.95
Special Deal
Price:

Special Deal
Price:

£89

£139

SAVING £70
While Stocks Last

SAVING £105
While Stocks Last

MANFROTTO TRIPODS
055XPROB Tripod

Aluminium 3-section legs, Q90 column

Aluminium 3-section legs, Q90 column

Weight: 2.40kg
Load: 7.0kg
Folded: 65cm
Height: 178cm

£92.95

£112.95
190CXPRO4

055CXPRO3

055CXPRO4

Carbon Fibre 3-section
legs, Q90 column

Carbon Fibre 4-section
legs, Q90 column

Carbon Fibre 3-section
legs, Q90 column

Carbon Fibre 4-section
legs, Q90 column

Weight: 1.29kg
Load: 5.0kg
Folded: 58cm
Height: 146cm

Weight: 1.34kg
Load: 5.0kg
Folded: 50cm
Height: 146cm

Weight: 1.65kg
Load: 8.0kg
Folded: 65cm
Height: 175cm

Weight: 1.70kg
Load: 8.0kg
Folded: 54cm
Height: 170cm

£219.95

£239.95

£249.95

MANFROTTO MONOPODS
790B Monopod

776YB Monopod

695CX Monopod

Aluminium 5-section

Aluminium 4-section

Carbon Fibre 5-section

Weight: 0.29kg
Load: 1.0kg
Folded: 39cm
Height: 145cm

Weight: 0.33kg
Load: 4.5kg
Folded: 48cm
Height: 152cm

£21.95

£29.95

679B Monopod
Aluminium 3-section

680B Monopod

Weight: 0.60kg
Load: 5.0kg
Folded: 47cm
Height: 160cm

£129.95

£34.95

Weight: 0.78kg
Load: 12.0kg
Folded: 67cm
Height: 161cm

£41.95

£42.95

492 Ball Head

234 Tilt Head

234RC Tilt Head

non quick-release 1/4” thread

Ideal for monopods

with RC2 quick release

Weight: 0.27kg
Load: 2.5kg

£14.95

£27.95
494 RC2 Ball Head
with RC2 quick release

496 RC2 Ball Head
with RC2 quick release

Weight: 0.27kg
Load: 2.5kg

£22.95
498 RC2 Ball Head
with RC2 q/release

Weight: 0.32kg
Load: 4.0kg

Weight: 0.46kg
Load: 6.0kg

Weight: 0.67kg
Load: 8.0kg

£41.95

£50.95

£74.95

468MG RC2
468MG RC4
Hydrostatic Ball Head Hydrostatic Ball Head

222 Grip Action
Ball Head

magnesium, with RC2 q/release

magnesium, with RC4 q/release

with RC2 q/release

Weight: 0.65kg
Load: 10.0kg

Weight: 0.65kg
Load: 10.0kg

Weight: 0.78kg
Load: 5.0kg

£167.95

£167.95

£69.95

804 RC2 Pan / Tilt

808 RC4 Pan / Tilt

410 Geared Head

with RC2 quick release

with RC4 quick release

with RC4 quick release

Weight: 0.79kg
Load: 4.0kg

Weight: 1.42kg
Load: 8.0kg

Weight: 1.22kg
Load: 5.0kg

£50.95

£89.95

£139.95

056 3D Head

460MG 3D Head

non quick-release 1/4” thread

magnesium, with RC2 q/release

Weight: 0.50kg
Load: 3.0kg

Weight: 0.43kg
Load: 3.0kg

£23.95

£61.95

KOOD

This is just a small
selection of the
MANFROTTO range
now available to try in
our new showroom
in Leamington Spa

Aluminium 3-section

Alta+ 263AT Tripod
Aluminium 3-section legs, magnesium
canopy, standard central column.

£49

A284 Tripod
Aluminium 4-section

Weight: 0.57kg
Load: 8.0kg
Folded: 54cm
Height: 169cm

Weight: 2.17kg
Load: 8.0kg
Folded: 56cm
Height: 154cm

£69.95

£73.95

CF284 Tripod
Carbon Fibre 4-section

Weight: 1.69kg
Load: 8.0kg
Folded: 56cm
Height: 160cm

£197.95

Aluminium 4-section legs, magnesium
canopy, standard central column.

KOOD HEADS
BH22 Ball Head

BH52 Ball Head

Quick release plate,
spirit level, 360 degree rotation,
dual control knobs

Sliding quick release plate,
spirit level, 360 degree rotation,
triple control knobs

Heavy duty sliding quick
release plate, 360 degree
rotation, triple control knobs

Weight: 0.21kg
Load: 6.0kg

Weight: 0.40kg
Load: 8.0kg

Weight: 0.37kg
Load: 8.0kg

£22.95

£31.95

£33.95

Hahnel Cable Remote Shutter Release
An innovative cable remote control for digital SLRs, with
interchangeable camera connectors and a 2 metre
extension lead, giving the choice of shutter release
from 0.8 or 2.8 metres. Autofocus, Bulb Function
and Continuous Shooting functions.
Available for Canon, Nikon, Sony, Olympus, and Pentax.

£99.95

Alta+ 233AT

Alta+ 234AT

Alta+ 235AT

Alta+ 224CT

Aluminium 3-section
legs, standard column

Aluminium 4-section
legs, standard column

Aluminium 5-section
legs, standard column

Carbon Fibre 4-section
legs, standard column

Weight: 1.26kg
Load: 3.0kg
Folded: 53cm
Height: 151cm

Weight: 1.21kg
Load: 3.0kg
Folded: 43cm
Height: 136cm

Weight: 1.18kg
Load: 3.0kg
Folded: 38cm
Height: 116cm

Weight: 0.92kg
Load: 3.0kg
Folded: 41cm
Height: 125cm

£69.95

£74.95

£79.95

£179.95

Special Package Deals
Alta+ 233AT Tripod
PH22 Pan/Tilt Head
Special Deal Price:

Alta+ 264AT Tripod
PH31 Pan/Tilt Head
Special Deal Price:

£69.95
£34.95

£99.95
£54.95

£19.95

Seculine Twin-1 ISR Interval Shutter Release
The new Seculine Twin-1 ISR is a wired interval shutter
release with a built in timer and large, clear, easy to read
LCD display. Easy variable interval time setting - from 1 sec
to 99 hours, 99 minutes and 99 seconds. Can be set to take
up to 9999 shots in one session. Multiple exposure option.
Convenient navigation button. Shutter lock for bulb shooting.
Half shutter release control. Intuitive beep sound indication.
Available for Canon, Nikon, Sony, Fuji, Pentax and Samsung.

£109 SAVING £45

SAVING £25

AP324 Monopod

CP324 Monopod

Aluminium 4-section legs

Aluminium 4-section legs

Caron Fibre 4-section legs

Weight: 0.57kg
Load: 8.0kg
Folded: 51.5cm
Height: 158cm

Weight: 0.69kg
Load: 10.0kg
Folded: 53.5cm
Height: 167cm

Weight: 0.55kg
Load: 10.0kg
Folded: 53.5cm
Height: 167cm

AP284 Monopod

£38.95

£33.95

£89.95

VANGUARD HEADS
SBH30 Ball Head

SBH50 Ball Head

SBH100 Ball Head

Lightweight magnesium alloy,
single adjuster knob, 2 spirit
levels, quick release plate

Lightweight magnesium alloy,
single adjuster knob, 2 spirit
levels, quick release plate

Lightweight magnesium alloy,
twin adjuster knobs, 2 spirit
levels, quick release plate

Weight: 0.22kg
Load: 5.0kg

Weight: 0.25kg
Load: 6.0kg

Weight: 0.39kg
Load: 10.0kg

£39.95

£49.95

£64.95

PH21 Pan / Tilt

PH31 Pan / Tilt

2-way fluid head, magnesium,
spirit level, quick release

2-way fluid head, magnesium,
spirit level, quick release

Weight: 0.35kg
Load: 3.0kg

Weight: 0.43kg
Load: 5.0kg

£34.95

£54.95

PH22 Pan / Tilt

PH32 Pan / Tilt

3-way fluid head, magnesium,
spirit level, quick release

3-way fluid head, magnesium,
spirit level, quick release

Weight: 0.34kg
Load: 3.0kg

Weight: 0.42kg
Load: 5.0kg

£34.95

TRIPOD BAGS
BAG50 £7.95
BAG60 £8.95
BAG70 £9.95
Durable, lightweight,
with shoulder strap.

£54.95

This is just a small
selection of the
VANGUARD range
now available to try in
our new showroom
in Leamington Spa

£49.95

TREKKING POLES

VANGUARD MONOPODS

Trek Tech was formed in 2004 after the founders identified
a market need based on personal outdoor experience – the
need for a sturdy, lightweight, multi-purpose device with the
functionality of both a tripod and trekking pole/hiking staff.
The result is the TrekPod, a lightweight, height-adjustable
walking/hiking staff, with a fully integrated tripod, and a
magnetic quick-release ball head system called the MagMount.
The unique MagMount quick release system incorporates
a Neodymium "super magnet" as the initial connection
between the ball head and a steel quick-release plate,
called a MagAdapter, that screws into the bottom of
your camera. A safety clip that stores below the ball
head securely locks your device to the MagMount
ball head. Each MagMount ball head is supplied
with two MagAdapter quick release plates.

TrekPod II - £69.95
A refined version of the original TrekPod, using aircraft-grade aluminium alloy, it comes
complete with a MagMount ball head, weighs 765g, and is capable of supporting a
camera system weighing up to 4kg. Maximum height in tripod mode of 146cm, and a
maximum height in monopod mode of 158cm. The TrekPod II collapses down to 90cm.

TrekPod GO PRO - £129.95
The TrekPod GO PRO is a more compact TrekPod, collapsing down to just 58cm, yet
still expanding to the same maximum height as the TrekPod II. Supplied with a travel
case, it is small enough to qualify as aircraft hand luggage. Weighing 794g including the
MagMount STAR ball head that comes as part of the package, it is able to support 4kg.

TrekPod XL - £259.95
The TrekPod XL is the top of the range TrekPod. Utilizing Carbon Fibre tubes, this is the
lightest TrekPod ever, weighing in at just 480g, yet retaining the same dimensions as
the TrekPod GO. It includes the larger MagMount PRO ball head.

Gorillapod Original (GP1)
The original gorillapod, designed for compact
cameras, available in grey, yellow, green, blue,
red and pink.

Trek Tech
Optera 460

Weight: 0.04kg
Load: 0.35kg

£13.95
Gorillapod SLR (GP2)
An sturdier gorillapod, designed
to take an SLR camera.

Weight: 0.16kg Load: 0.7kg

BH02 Ball Head

SAVING £40
While Stocks Last

Weight: 1.64kg
Load: 5.0kg
Folded: 53cm
Height: 171cm

£89.95

RRP: £59.95
RRP: £29.95

Special Deal
Price:

Alta+ 264AT Tripod

Weight: 1.59kg
Load: 5.0kg
Folded: 63cm
Height: 181cm

£59.95

Pro Remote Special Deal
HW433 Wireless Pro Remote
2-Axis Spirit Level

£129.95

£119.95

£79

Ultra high frequency 433MHz professional radio remote
control, with a range of up to 80 metres! Autofocus,
Bulb Function and Continuous Shooting functions.
4 digit code selector allows individual codes to be
set to eliminate interference from other sources.
Each kit contains a wireless transmitter, a receiver
with camera shoe and connectors to allow it to
plug into your camera, plus a short distance cable
operated shutter release.
Available for Canon, Nikon, Sony, Olympus, Pentax
and Samsung.
Winner of the 2009 Gear of the Year Best Accessory Award!

Weight: 2.10kg
Load: 7.0kg
Folded: 53cm
Height: 159cm

A range of sturdy, value-for-money
Tripods, Monopods and Ball Heads.

KOOD MONOPODS & TRIPODS
C324 Monopod

AltaPRO 264AT Tripod
Aluminium 4-section legs, magnesium
canopy, Multi-Angle-Central-Column.

Aluminium 3-section

Weight: 0.83kg
Load: 10.0kg
Folded: 51cm
Height: 154cm

MANFROTTO HEADS
Weight: 0.12kg
Load: 2.0kg

AltaPRO 263AT Tripod
Aluminium 3-section legs, magnesium
canopy, Multi-Angle-Central-Column.

681B Monopod

Aluminium 4-section

Weight: 0.60kg
Load: 10.0kg
Folded: 64cm
Height: 162cm

The 2009 TIPA “Best Accessory”
award-winning Vanguard AltaPRO
tripod range is set to revolutionise
the way you think about tripods!

Weight: 2.05kg
Load: 7.0kg
Folded: 63cm
Height: 169cm

190CXPRO3

£209.95

Hahnel HW433 Wireless Pro Remote Shutter Release

Unlike traditional tripods, the AltaPRO’s Multi-Angle-CentralColumn (MACC) allows the user to position the hexagonal
central column at ANY angle from 0 to 130 degrees, without
removing it from the tripod, while also allowing it to rotate a
full 360 degrees! The clever Instant-Swivel-Stop-and-Lock (ISSL) mechanism
allows photographers to securely reposition the central column in one simple
movement, in a matter of seconds.
Other features include: Independent height and angle adjustable legs, patented
magnesium die-cast canopy, spiked and rubber feet, non-slip rubberised foam
leg warmers, anti-shock column ring - true professional specification tripods!

190XPROB Tripod
Weight: 1.85kg
Load: 5.0kg
Folded: 57cm
Height: 146cm

SHUTTER RELEASES

£29.95
Gorillapod SLR-ZOOM (GP3)
An even sturdier gorillapod,
designed to take an SLR camera
with zoom lens.

Weight: 0.24kg Load: 3.0kg

£34.95

BH05 Ball Head

BH25 Ball Head

BH55 Ball Head

Weight: 0.30kg
Load: 8.0kg

Weight: 0.53kg
Load: 12.0kg

Weight: 0.51kg
Load: 12.0kg

£26.95

£35.95

£38.95

BH08 Ball Head

BH28 Ball Head

BH58 Ball Head

Weight: 0.49kg
Load: 12.0kg

Weight: 0.74kg
Load: 18.0kg

Weight: 0.72kg
Load: 18.0kg

Gorillapod Ball Head

£29.95

£45.95

£49.95

£39.95

Gorillapod FOCUS
Designed for professionals, is
the strongest Gorillapod yet!

Weight: 0.5kg Load: 5.0kg

£92.95
For the SLR-ZOOM or FOCUS.

MagMount

MagMount STAR

MagMount PRO

The original MagMount ball
head. Weighing in a just 73g,
it is capable of
holding 4kg.

The same size as a standard
MagMount, with a Square
Tooth Anti Rotation (STAR)
connection surface between
the ball head and the
MagAdapter quick release
plate. Weighing 79g, with a
maximum load rating of 4kg.

Utilising the same Square
Tooth Anti Rotation system
as the MagMount STAR, the
MagMount PRO is a larger
ball head, weighing 127g,
and capable of holding an
impressive 6kg.

£24.95
£45.95
The Trek Tech Optera 460 is the next
generation of portable tripods - capable
of holding 5kg.
The flexible legs are padded, covered in
a soft yet hard-wearing water resistant
fabric, and have integrated rubber feet for
extra grip. They can be bent in practically
any direction, allowing you to mount you
camera on almost any object! The D-ring
cord system attaches to the legs, ensuring
that they will not splay out. A camera is
attached using Trek-Tech’s clever magnetic
quick release system, and two MagAdapter
quick release plates are supplied.
The Optera 460 PRO has
an extra long 460mm leg
to support up to a 400mm
zoom lens. Uniquely, it can
also be wrapped around your
camera for protection while being carried.

Trek Tech Optera 230
A smaller version of the above,
with 230mm long legs.

£37.95

All MagMount ball
heads come with two
MagAdapter quick
release plates. These
are also available
separately:

£64.95

£34.95

MagAdapter
Light

MagAdapter
Heavy

MagAdapter
STAR

£5.95

£6.95

£9.95

Telephone: 01926 339977 or 0800 1077 211

www.premier-ink.co.uk
Premier Ink, Longfield Road, Leamington Spa, CV31 1XB

E&OE. Prices may be subject to change, but hopefully not!

& www.fantamag.com

Bronica ETRS/Si
ETRSi Complete + AEII Prism......................E+ £299
ETRSi Complete + Rotary Prism .........Exc / E+ £299
ETRSi Body Only........................................E++ £139
ETRS Complete + SpeedGrip E...................E+ £239
40mm F4 E ...................................................E+ £129
40mm F4 PE .....................................E++ £199-£249
45-90mm F4-5.6 PE...................................E++ £549
50mm F2.8 E...............................................Exc £125
50mm F2.8 PE ................................E++ / Mint- £199
60mm F2.8 PE.................................Mint- £229-£299
75mm F2.8 E ..............................................E++ £119
135mm F4 PE.........................E++ / New £299-£349
150mm F3.5 E...................As Seen / Mint- £79-£179
150mm F3.5 PE..........................................E++ £199
200mm F4.5 E .......................E++ / Mint- £149-£325
200mm F4.5 PE.........................E+ / E++ £139-£199
250mm F5.6 E..................As Seen / E++ £129-£249
2x Converter E .............................Exc / E++ £49-£99
120 E Mag .....................................E+ / E++ £25-£45
120 Ei Mag ....................................E+ / E++ £34-£59
220 E Mag.....................................................Exc £30
Polaroid Mag E ..............................E+ / E++ £35-£75
AEIII Meter Prism ........................................Exc £129
AEII Meter Prism.................As Seen / E++ £59-£129
Rotary Prism E........................As Seen / E+ £59-£99
Prism Finder E...............................................Exc £59
Extension Tube E14 .......................E+ / E++ £59-£79
Extension Tube E28......................................E++ £79
M Bracket .....................................................E++ £35
SCA386 Flash Adapter..........................E++ £29-£59
Speed Grip E.................................E+ / E++ £25-£59
Bronica GS1
GS1 Body Only..........................E+ / E++ £159-£179
65mm F4 PG ................................................E+ £199
110mm F4 PG Macro..................................E++ £299
150mm F4 PG ............................................E++ £149
250mm F5.6 PG .........................................E++ £199
GS 220 Mag (6x4.5)....................................Mint- £89
Polaroid Mag G..............................E+ / E++ £39-£69
AE Prism Finder G.............................E++ £149-£199
Speed Grip G ...............................................E++ £39
Bronica RF645

RF645 + 65mm F4 ............Unused / E++ £529-£849
45mm F4 + Finder................................Unused £399
RF20 Speedlight...................................Unused £169
Bronica SQA/Ai
SQB Complete......................................Unused £549
SQB Complete + Prism ..............................E++ £349
SQA Body Only.............................................E+ £119
40mm F4 PS.......................As Seen / E+ £159-£299
40mm F4 S.................................................E++ £299
50-100mm F4-5.6 PS.................................E++ £599
50mm F3.5 PS .................As Seen / E++ £129-£249
50mm F3.5 S.............................E+ / E++ £159-£249
65mm F4 PS..............................E+ / E++ £179-£299
105mm F3.5 S ............................................E++ £129
110mm F4 PS Macro..................................E++ £249
135mm F4 PS.............................................E++ £279
150mm F3.5 S....................As Seen / E++ £99-£165
150mm F4 PS ............................Exc / E++ £99-£199
SQA 120 Mag................................E+ / E++ £35-£39
SQA 120J Mag ..............................E+ / E++ £45-£95
SQA 135N Mag .....................................E++ £49-£79
SQA 220 Mag...............................Exc / E++ £20-£59
SQA 220J Mag ...............................................E+ £75
SQAi 120J Mag ..........................................E++ £135
SQAi 220 Mag...............................................Exc £79
Polaroid Mag S ..............................E+ / E++ £25-£49
ME Prism Finder S........................................E+ £119
45 Degree Prism...........................................E++ £99
Prism Finder S................................................E+ £69
CDS MF Finder S..........................E+ / E++ £79-£99
Autobellows S.............................................E++ £249
Extension Tube S36......................................E++ £79
Motordrive SQAi ..................................E++ £99-£109
Pro Shade S .................................................E++ £29
SCA356 Flash Adapter.................................E++ £39
Speed Grip S ........................................E+ / E++ £25
Canon EOS
EOS 1V + E2 Booster...................................E+ £399
EOS 1V Body Only..............................E+ £399-£449
EOS 1N RS Body Only.................................E+ £449
EOS 1N Body Only.....................................E++ £199
EOS 1 Body Only.......................Exc / E++ £99-£179
EOS 3 Body Only..................................As Seen £99
EOS 5 Body Only.........................Exc / E++ £49-£59
EOS 10 Body Only .........................................E+ £30
EOS 100 Body Only .....................................E++ £35
EOS RT Body Only ........................................E+ £69
15-85mm EFS IS USM.......................Ex Demo £549
17-40mm F4 L USM ...............E++ / Mint- £459-£509
17-85mm F4-5.6 IS USMEx Demo / Mint- £199-£319
18-55mm F3.5-5.6 IS EFS....................Unused £149
18-200mm F3.5-5.6 IS EFS......................Mint- £379
20-35mm F3.5-4.5 USM.............................E++ £159
24mm F2.8 EF ..........................................Mint- £299
24-105mm F4 L IS USM .............................Exc £599
28-80mm F3.5-5.6 USM.................................E+ £59
28-105mm F3.5-4.5 USM ......................E+ £75-£119
28-135mm F3.5-5.6 IS USM .....E+ / E++ £239-£259
35-70mm F3.5-4.5 EF ..................................E++ £35
50mm F1.2 L USM ..................................E++ £1,099
50mm F1.8 EF MK1 .....................................E+ £149
50mm F1.8 EF MkII......................................E++ £45
50mm F2.5 EF Macro ...............................Mint- £179
65mm F2.8 MPE Macro............................Mint- £599
70-300mm F4.5-5.6 DO IS USM
................................................E++ / Mint- £699-£749
75-300mm F4-5.6 EF .....................................E+ £99
75-300mm F4-5.6 IS USM .........................E++ £249
75-300mm F4-5.6 USM III ..........................E++ £119

80-200mm F4.5-5.6 EF II......................E++ £59-£69
80-200mm F4.5-5.6 II...................................E++ £69
80-200mm F4.5-5.6 USM...............................E+ £75
85mm F1.2 L USM....................................Mint- £899
85mm F1.2 L USM MkII.........................Mint- £1,399
90mm F2.8 TSE .........................................E++ £899
100-400mm F4.5-5.6 L IS USM..........E+ £899-£999
100-400mm F4.5-5.6 L USM .....................E++ £949
135mm F2 L USM.......................................E++ £749
135mm F2.8 EF Soft Focus......................Mint- £249
180mm F3.5 L USM Macro.......................Mint- £999
200mm F2.8 L USM II ..............................Mint- £529
300mm F4 L IS USM .................................E++ £799
300mm F4 L USM ......................................E++ £749
400mm F2.8 L USM ..................................E+ £3,299
400mm F4 IS DO USM ...........................E++ £4,499
400mm F5.6 L USM..................................Mint- £799
500mm F4.5 L USM ..................................E+ £1,799
1.4x EF MkII Extender................................E++ £199
2x EF Extender MK1.................................Mint- £169
Sigma 8mm F4 EX Fisheye........................E++ £449
Sigma 15-30mm f3.5-4.5 EX DG................E++ £199
Sigma 24mm F1.8 EX DG ........................Mint- £259
Sigma 24mm F2.8 II.....................................E++ £85
Sigma 28mm F1.8.......................................Mint- £89
Sigma 30mm F1.4 DC ..............................Mint- £259
Sigma 70-300mm F4-5.6 DL........................E++ £59
Sigma 90mm F2.8 Macro.............................E++ £89
Sigma 100-300mm F4 APO DG HSM .......E++ £799
Sigma 105mm F2.8 EX Macro...................Mint £269
Sigma 120-300mm F2.8 Apo HSM .........E++ £1,699
Sigma 150mm F2.8 Apo DG Macro HSM ..E++ £399
Sigma 170-500mm F5-5.6 Apo ..................E++ £399
Sigma 300mm F4 Apo ..............................Mint- £299
Sigma 300mm F2.8 Apo EX HSM.............E+ £1,299
Sigma 500mm F4.5 Apo...............................E+ £599
Sigma 500mm F4.5 Apo EX HSM ..........E++ £2,599
Tokina 12-24mm F4 ATX Pro DX ................E++ £299
Tokina 100-300mm F5.6-6.7.........................E++ £79
300EZ Speedlite............................E+ / E++ £20-£39
380EX Speedlite...........................................E++ £79
420EZ Speedlite...........................................E++ £59
430EX Speedlite.........................................E++ £149
430EZ Speedlite ............................E+ / E++ £39-£79
480G Speedlite.............................................E+ £129
540EZ Speedlite....................................E++ £59-£69
ML3 Macrolite......................................E++ £75-£139
ST-E2 Transmitter.......................................Mint- £129
BP50 Battery Pack..................................Unused £35
E1 Booster....................................................E++ £79
E2 Booster......................................................E+ £99
Extension Tube EF12 ..................................Mint- £49
Extension Tube EF25 .................E++ / Mint- £49-£79
LC3 Wireless Set ........................................Mint- £99
LC5 Wireless Set........................................E++ £229
VG10 Vertical Grip (EOS 5) ...........E+ / E++ £15-£35
Canon Manual

F1NAE Black Body Only ............Exc / E+ £179-£299
U.S.Coastguard F1 + 50mm F1.4.................E+ £399
U.S.Marine F1 Body Only.............................E+ £499
T90 Body Only........................As Seen / E+ £69-£99
T70 Body Only...............................E+ / E++ £29-£39
A1 Black Body Only........................................E+ £79
AE-1 Chrome Body Only ................................E+ £49
AE1P Black Body Only...................................E+ £59
AE1P Chrome Body Only...............................E+ £59
AV1 Chrome Body Only ...............................E++ £39
EF Black + 50mm F1.8...................................E+ £99
EX Auto + 50mm F1.8............As Seen / E+ £59-£79
20mm F2.8 FD..............................................E+ £129
24mm F1.4 FD L ...............................E++ £650-£699
24mm F2.8 B/lock...........................................E+ £65
24mm F2.8 FD................................................E+ £79
24-35mm F3.5 FD L ..................E+ / E++ £249-£399
28mm F2.8 FD .....................As Seen / Mint £20-£49
35mm F2 FD...............................................E++ £119
35mm F2.8 FD...............................E+ / E++ £35-£45
35mm F2.8 Tilt/Shift ...................................E++ £399
35mm F3.5 B/lock..........................E+ / E++ £25-£35
35-70mm F3.5-4.5 FD..................................E++ £39
35-105mm F3.5 FD .................................E+ £69-£75
50mm F1.8 B/lock (Sample Lens)................E++ £99
50mm F3.5 FD Macro ..................................E++ £95
70-210mm F4 FD .................As Seen / E++ £29-£65
75-200mm F4.5 FD......................Exc / E++ £29-£59
80-200mm F4 B/lock ......................................E+ £69
80-200mm F4 FD .........................................E++ £99
100mm F2.8 B/lock .................................E+ £59-£75
100mm F2.8 FD .........................................E++ £109
100mm F4 B/lock Macro ............................E++ £199
100mm F4 FD Macro ............................E+ £99-£169
100mm F4 FD Macro + Tube .....E+ / E++ £179-£199
100-200mm F5.6 B/lock ................E+ / E++ £39-£49
100-200mm F5.6 FD .....................E+ / E++ £29-£39
100-300mm F5.6 FD ......................................E+ £79
135mm F3.5 FD ....................................E++ £15-£25
200mm F4 FD .......................................As Seen £20
200mm F4 FD Macro .................................E++ £299
300mm F2.8 FD L.......................................Exc £850
300mm F4 FD.............................................E++ £179
300mm F5.6 B/lock ........................................E+ £65
300mm F5.6 FD ............................E+ / E++ £75-£79
500mm F8 Reflex .........................................E+ £159
U.S.Marine 400mm F4.5 B/lock .................E++ £499
1.4x Extender A.......................................E+ £49-£59
2xB Extender .................................E+ / E++ £39-£59
177A Speedlite...............................E+ / E++ £10-£15
199A Speedlite .............................................E++ £29
277T Speedlite .............................................E++ £35
299T Speedlite................................................E+ £29
300TL Speedlite...........................E+ / Mint- £39-£59
533G Speedlite............................E+ / E++ £99-£109
577G Speedlite...............................................E+ £79
ML1 Macrolite ...............................................E++ £89
ML3 Macrolite ............................E+ / E++ £129-£149

AE Motordrive FN..........................................E+ £119
AE Powerwinder FN.....................E+ / E++ £79-£119
Powerwinder F................................................E+ £59
Winder A2................................................E+ £25-£39
Winder A..........................................E+ / E++ £9-£29
Angle Finder B ............................E++ / Mint £59-£79
Autobellows + Release...............................E++ £109
FL Bellows.............................................E++ £59-£99
FL Bellows + Copier..................................Mint- £109
Waist Level Finder F ...................................Mint- £49

Leica M8 Panda Body Only ....................New £3,390
Leica M8 Black Body Only ..........E++ £1,749-£1,899
Leica Digilux 4.3....................................As Seen £99
Mamiya ZD + 80mm F2.8 AF ..................E++ £2,999

Contax 645

645 Body Only..............................................E+ £449
35mm F3.5 Distagon.............Exc / E++ £799-£1,299
45mm F2.8 Distagon............E++ / New £749-£1,099
55mm F3.5 Distagon ....................................E+ £899
140mm F2.8 Sonnar ............E++ / New £749-£1,099
210mm F4 Sonnar ....................................Mint- £899
Magazine + Insert ...................E++ / New £169-£249
Polaroid Magazine.......................E+ / New £99-£199
AE Prism Finder......................E++ / New £199-£299
MP1 Battery Grip ........................................E++ £189
MSB1 Flash Bracket...................................E++ £199
TLA480 Flash .............................................E++ £279
Contax G Series
G2 + 35-70mm .............................................E+ £699
G1 + Databack ...........................................E++ £249
90mm F2.8 G...........................Exc / New £109-£239
Black/Tan Holdall..........................................New £80
G1 Leather Case ..........................................E++ £49
TLA140 Flash................................E+ / New £45-£75
Contax SLR
N1 + 24-85mm .........................E+ / Mint- £399-£699
NX + 28-80mm........................E++ / New £399-£499
AX Body Only...........................Exc / E++ £299-£499
RTS3 Body Only..................................E+ £399-£499
RX Body Only...................As Seen / E++ £179-£299
RTS + 50mm F1.7........................................E+ £245
RTS + Winder ...............................................E+ £195
Aria Body Only ...........................................E++ £249
167MT Body Only.........................................E+ £109
137MA Body Only...........................................E+ £99
139 Body Only..............................................E++ £75
Preview Body Only.....................E+ / E++ £179-£249
15mm F3.5 AE...........................................E+ £1,099
18mm F4 MM...........................Exc / E++ £499-£599
25mm F2.8 MM ............................................E+ £349
28-70mm F3.5-4.5 MM.............E+ / Mint- £249-£379
28-85mm F3.3-4 MM...............E++ / New £349-£749
35mm F2.8 AE Shift ...................................E++ £949
35-70mm F3.4 MM .................E++ / New £299-£649
35-135mm F3.3-4.5 MM .........E++ / New £849-£949
60mm F2.8 AE Macro ...............E+ / New £349-£749
70-300mm F4-5.6 AF.............E++ / Mint- £499-£699
80-200mm F4 MM ....................E+ / New £279-£599
85mm F1.2 MM (60 Year Edition)...........New £3,500
100mm F2 MM........................E++ / New £699-£799
100mm f2.8 AE Macro................................E++ £649
100mm F2.8 AF Macro ..............................New £999
135mm F2 (60 Year Edition) ..............Unused £2,499
135mm F2.8 AE..........................................E++ £145
135mm F2.8 MM ............................................E+ £99
180mm F2.8 AE .......................E+ / Mint- £349-£550
180mm F2.8 MM.......................E+ / New £329-£649
200mm F2 MM.......................................Mint- £3,249
200mm F3.5 AE ...............As Seen / E++ £149-£245
200mm F4 MM ...........................................E++ £199
300mm F4 AE ............................................E++ £429
300mm F4 MM..........................E+ / New £349-£750
500mm F8 Mirotar .....................................New £649
Mutar II Converter ...................E++ / New £179-£249
Mutar III converter .....................E+ / New £139-£199
Hasselblad-Contax Adapter..........................E++ £29
FE-1 LCD Viewfinder..................................E++ £269
P7 Battery Holder.........................................New £99
P9 Battery Holder .......................................E++ £129
Right Angle Finder N...................................Mint- £89
TLA280 Flash ...........................E++ / Mint- £99-£119
TLA30 Flash ..................................E+ / E++ £45-£59
TLA360 Flash.............................E+ / E++ £179-£199
W7 Winder (159MM) ....................................E++ £49
Digital Cameras
Canon EOS 1DS MKIII Body Only..........E++ £3,999
Canon EOS 1DS Body OnlyAs Seen / E+ £699£899
Canon EOS 1D MkIIN Body Only.................E+ £899
Canon EOS 1D MKII Body OnlyE+ / E++ £699-£999
Canon EOS 1D Body Only.......Exc / E++ £349-£599
Canon EOS 5D Body Only........E+ / E++ £799-£949
Canon EOS 40D Body Only.......................E++ £499
Canon EOS 30D Body Only.......................E++ £349
Canon EOS 20D Body Only.......................E++ £249
Canon EOS 10D + BG-ED3 Grip ...............E++ £179
Canon EOS 10D Body Only .......................E++ £199
Canon EOS 500D Body Only.....................Mint £419
Canon EOS 400D Body Only.......................E+ £249
Canon EOS 350D Body Only .......................E+ £159
Canon Angle Finder C......................Mint- £119-£129
Canon BG-E1 Grip (300D) ............E+ / E++ £45-£49
Canon BG-E2 Grip (20/30/40D) ....E+ / E++ £59-£79
Canon BG-E4 Grip (5D) ................E+ / E++ £89-£99
Canon BG-ED3 Grip..........................E++ / Mint- £79
Canon Powershot G1 ............................As Seen £59
Canon Powershot S2 IS ...............................E++ £89
Epson RD1 Body Only ...............................E++ £999
Fuji S2 Pro Body Only ................................E++ £249
Fuji S8100FD................................................E++ £99
Kodak Pro14N Body Only...........................E++ £499
Kodak DCS Pro SLR/N Body Only ...............E+ £399
Kodak DCS520 Body Only..................As Seen £349
Leica M8.2 White Body Only...........Ex Demo £4,500
Leica M8.2 Black Body Only ...................E++ £2,599
Leica M8.2 Chrome Body Only.......Ex Demo £2,699

Nikon D3 Body Only...............................Mint- £2,449
Nikon D2x Body Only ................E+ / E++ £849-£949
Nikon D1X Body Only................E+ / E++ £399-£499
Nikon D1 Body Only .....................................E+ £249
Nikon D700 Body Only............................E++ £1,499
Nikon D300 Body Only......................E++ £849-£949
Nikon D200 Body Only......................E++ £479-£499
Nikon D100 + MB-D100 ...............................E+ £239
Nikon D80 Body Only........................E++ £349-£399
Nikon MB-D100 Grip ............As Seen / E++ £45-£89
Nikon MB-D200 Grip ....................................E++ £79
Nikon Coolpix 3500 ......................................E++ £39
Nikon Coolpix 7600 ......................................E++ £49
Nikon Coolpix 990 + FC-E8 + EC-E63As Seen £129
Nikon Coolpix P6000..................................E++ £199
Olympus E3 + HLD4 Grip .........................Mint- £799
Olympus E1 + 14-45mm.............................E++ £299
Olympus E1 + HLD2 Grip.............................E+ £279
Olympus E1 Body.......................................E++ £199
Olympus E420 + 14-42mm.........................E++ £249
Olympus FL-50R Flash .............................Mint- £299
Olympus FS-FP1 Flash Bracket.................E++ £199
Olympus HLD-2 Battery Holder.................Mint- £139
Olympus RM-CB1 Remote Control.............Mint- £39
Olympus SRF-11 Ringflash Set..................Mint £449
Olympus VA-1 Right Angle Finder................E++ £99
Olympus Camedia C8080...........................E++ £179
Olympus E-P1 + 14-42mm........................Mint- £449
Olympus FL14 Flashgun.............................Mint- £99
8mm F3.5 Zuiko fisheye............................Mint- £449
7-14mm F4 ED Zuiko..................................E++ £959
12-60mm F2.8-4 SWD................................E++ £599
14-42mm F3.5-5.6 Zuiko ....Unused / Mint- £59-£149
14-54mm F2.8-3.5 II Zuiko........................Mint- £379
14-54mm F2.8-3.5 Zuiko ............................E++ £299
18-180mm F3.5-6.3 Zuiko ..........................E++ £279
40-150mm F3.5-4.5 Zuiko ..........................E++ £109
40-150mm F4-5.6 Zuiko ......Unused / E++ £79-£139
50-200mm F2.8-3.5 Zuiko.................E++ £499-£549
50mm F2 Macro Zuiko................................E++ £299
Sigma 24mm F1.8 E DG............................E++ £269
Sigma 30mm F1.4 DC HSM.......................E++ £249
Panasonic DMC L10 + 14-50mm ..............Mint- £349
Pentax K200D + D-BG3 Grip .....................E++ £299
Pentax D-BG3 Grip .....................................Mint- £79
Ricoh GR Digital ...........................................E+ £185
Ricoh GR Digital Creative Set....................E++ £329
Ricoh GX100 + VF Finder .........................New £220
Ricoh GX200 + Finder...............................New £399
Sony BG-30 Battery Grip..............................E++ £79
Sony HVL-F36M Flash................................E++ £119
Sony HVL-F58AM Flash .............................E++ £249
Flash & Lighting - Please Phone
Fuji - Please Phone
Hasselblad

503CW Gold Supreme ............................Mint £3,499
503CX Complete .....................................E++ £1,049
503CX Chrome Body Only
.........................................Ex Demo / E++ £449-£749
501CM Complete....................E+ / E++ £999-£1,199
501C Complete.......................E+ / E++ £799-£1,099
500CM Complete........................................E++ £749
500ELX Black Body Only..................E++ £449-£450
201F Complete ........................................E++ £1,250
2000FCW Complete..................E+ / E++ £699-£899
30mm F3.5 Cfi Fisheye ...........................E++ £3,299
40mm F4 CF FLE..................Exc / E++ £899-£1,199
50mm F4 C Black......................E+ / E++ £299-£399
50mm F4 C Chrome.....................................E+ £449
50mm F4 CF ..............................Exc / E+ £379-£449
50mm F4 CF FLE................................E+ £599-£749
50mm F4 Cfi FLE ....................................E++ £1,199
60-120mm F4.8 FE....................E+ / E++ £749-£849
60mm F3.5 C Black ....................................Exc £399
120mm F4 CF Macro.................E+ / E++ £599-£949
135mm F5.6 C Macro................E+ / E++ £299-£349
150mm F3.2 HC ......................................E++ £1,399
150mm F4 C Black...........As Seen / E++ £149-£299
150mm F4 C Chrome.................Exc / E+ £149-£249
150mm F4 CF.....................As Seen / E+ £299-£399
150mm F4 Cfi....................................E++ £799-£899
160mm F4.8 CB .........................................E++ £649
180mm F4 CF............................E+ / E++ £649-£749
250mm F4 F ..............................E+ / E++ £279-£349
250mm F4 FE......................................E+ £649-£749
250mm F5.6 C Black...........................E+ £199-£249
250mm F5.6 C Chrome....As Seen / E++ £149-£299
250mm F5.6 CF............................................E+ £499
350mm F5.6 C Black ..................................Exc £449
500mm F8 C Black.......................................E+ £450
2xE Converter.............................................E++ £399
Cambro 2x Converter....................................E++ £60
Komura 2x Converter......................................E+ £59
Vivitar 2x Converter .......................E+ / E++ £45-£79
70 Chrome Mag....................................E+ / E++ £69
A12 Black Mag .......................As Seen / E+ £79-£99
A12 Chrome Mag..................As Seen/E++ £59-£149
A16 Chrome Mag ................................E++ £99-£149
A16S Chrome Mag .........................................E+ £69
A24 Black Mag...............................E+/E++ £49-£145
A24 Chrome Mag........................Exc/Mint- £75-£125

A24 TCC Black Mag .....................................E+ £139
E16 Chrome Mag......................................Mint- £279
Polaplus Mag.........................................E++ £69-£79
Polaroid 100 Mag ....................................E+ £25-£75
Polaroid 80 Mag............................................E++ £35
Extension Tube (40630)................................E++ £45
Extension Tube 10...........................................E+ £35
Extension Tube 21 ........................................E++ £35
Extension Tube 32 ..........................................E+ £30
Extension Tube 55 ........................................E++ £35
Extension Tube 56 ........................................E++ £35
D Flash .........................................................E+ £199
HC Prism ........................................Exc / E+ £39-£75
Magnifying Hood.............................................E+ £45
Meter Prism ...........................................As Seen £49
NC2 Prism .............................................As Seen £29
PM Prism ......................................................E+ £149
PM5 Prism ..................................................E++ £249
PME Meter Prism..........................................E+ £149
PME3 Meter Prism......................................E++ £299
PME51 Meter Prism......................................E+ £299
PME90 Meter Prism...................E+ / E++ £299-£399
SWC/M Viewfinder ................................As Seen £65
Hasselblad H Series
H3D Complete .........................................E++ £4,999
H2F Body + Prism + Magazine ...............E++ £2,999
H2 Body Only .............................................E++ £999
Phase One H10 Back................................E+ £1,250
1.7x H Converter.........................................E++ £599
HC Film Insert.............................................E++ £129
HM 16/32 Magazine ..................E+ / E++ £199-£369
HMi100 Polaroid Mag .................................E++ £149
Quick Tripod Coupling H...............................E++ £79
Hasselblad XPan Series
Xpan II + 45mm F4..............E+ / E++ £1,499-£1,699
Xpan + 45mm F4 ....................Exc / E+ £999-£1,099
30mm F5.6 Asph + Finder E++ / Mint £1,799-£1,899
90mm F4 ..................................E+ / Mint- £319-£399
49mm Centre Filter.......................................E+ £149
Large Format/Panoramic
Arca Pro3 Monorail .......................................E+ £299
Arca 6x9 Monorail.........................................E+ £349
Ebony SW45 Body Only..........................E++ £1,599
Gandolfi Variant MDF Field Camera...........E++ £699
Horseman 450LX Monorail.........................E++ £399
Linhof S45 Technikardan...............................E+ £999
Linhof Super Tech IV + 105mm F3.5............E+ £399
Linhof Tech 70 Complete ..............................E+ £895
Linhof Technika III + 105mm........As Seen / E+ £449
Noblex Pro150 ..............................................E+ £799
Shen Hao 45 Shift Field Camera...............New £700
Silvestri T30 + 100mm F5.6 Apo.............E++ £1,199
Sinar 10x8 P Mono Rail Camera..................E+ £699
Sinar F Monorail Body Only .........................E+ £199
Sinar F1 Monorail Body Only .....................E++ £199
Sinar F2 Monorail Body Only....E+ / New £159-£799
Sinar P1 Monorail Body Only.....................E++ £499
Toyo View 45E Monorail .......................Unused £499
Wista 45DX Field Camera..........................E++ £549
Wista 45VX Field Camera ..........................E++ £899
47mm F5.6 Super Angulon...........................E+ £349
47mm F8 Super Angulon..............................E+ £350
60mm F4 Apo Digitar....................................E+ £299
65mm F4.5 Sinaron W..................................E+ £399
65mm F5.6 Super Angulon .................E+ £349-£399
65mm F8 Super Angulon.....................E+ £179-£199
75mm F5.6 Super Angulon ........................E++ £399
90mm F5.6 Super Angulon ........................E++ £349
90mm F5.6 Super Angulon XL ...................E++ £749
90mm F8 Super Angulon ....................E+ £279-£299
90mm F8 SW Nikkor ....................................E+ £399
90mm F6.8 Grandagon N .........................Mint- £499
100mm F5.6 Symmar S ...............................E+ £149
120mm F5.6 HM Macro Symmar..............Mint- £649
135mm F5.6 Symmar S .............................E++ £249
135mm F5.6 Sironar N ...............................E++ £249
150mm F5.6 Rodagon...........................As Seen £59
150mm F5.6 Sironar N ...............................E++ £249
150mm F9 Apo Ronar ..................................E+ £199
150mm F5.6 Symmar S................................E+ £219
180mm F5.6 Apo Symmar..........................E++ £499
180mm F5.6 Symmar S..............................E++ £199
210mm F5.6 Symmar S .............................E++ £249
210mm F6.8 Geronar .................................E++ £249
240mm F5.6 Sinaron S ..............................E++ £299
240mm F9 APO Ronar........................As Seen £149
240mm F5.6 Symmar...................................E+ £149
270mm F6.3 ED T.....................................Mint- £549
300mm F5.6 Symmar S ......................As Seen £149
360mm F6.8 Symmar S .............................E++ £299
420mm F9 Aop Ronar ................................E++ £299
Arca 6x7 R/F/Holder .....................................E+ £129
Arca 6x7 RFH For 5x4....................................E+ £99
Arca Polaroid Mag ........................................E+ £199
Calumet 6x7 R/F/Holder........................As Seen £75
4x D/D/Slides (5x4).........................................E+ £39
4x D/D/Slides 6.5x4.75cm............................E++ £39
5x D/D/Slides (5x4)...............................E+ / E++ £49
Fuji Quickload Holder ...................................E++ £75
Horseman 6x7cm R/F/Holder.....................E++ £199
Horseman 6x9cm R/F/holder.......E+ / E++ £99-£125
Linhof 6x6cm Rollex ..............................As Seen £75
Linhof 6x7cm Super Rollex..................E+ £109-£125
Linhof 6x7cm Super Rollex (5x4) ...............E++ £175
Linhof 6x7cm Super Rollex (S23)...............E++ £325
Linhof 6x9cm Super Rollex...........................E+ £249
Wista 6x7cm R/F/Holder ..............E+ / E++ £99-£119
Wista 6x9cm R/F/Holder.............................E++ £129
Wista 6x9cm R/F/Holder (5x4) ...................E++ £145
Leica M Series

M6 Jubilee Set...................................Unused £4,999
M6 Ein Stuck + 35mm F1.4 Asph ..........Mint- £3,999

www.st
storemags.com & www.fa
st
fant
ntamag.com
nt

M6TTL Titanium + 50mm F2
...................................Unused / Mint- £2,499-£3,250
M6TTL 0.85x LHSA Black Body OnlyUnused £2,999
M6 Royal Photo Society ....................Unused £2,999
M6TTL Millennium Body Only................Mint- £1,750
M7 0.58x Black Body Only......................E++ £1,599
M7 0.72x Black Body Only......................E++ £1,449
M7 0.72x Chrome Body Only
.....................................Unused / E++ £1,550-£1,899
M6 0.72x Ttitanium Body Only...............Mint- £1,450
M6TTL 0.72x Black Body Only .........E++ £899-£999
M6TTL 0.85x Black Body Only .........E++ £899-£949
M6TTL 0.85x Chrome Body Only...............E++ £949
M5 Chrome Body Only...............................E++ £750
M4-2 Black Body Only...............E+ / E++ £550-£599
M4 Chrome Body Only........................E+ £599-£750
CL + 40mm + 90mm ..................................E++ £799
CL Black Body Only .....................................E+ £349
MD2 Black Body Only ..................................E+ £399
MDA Chrome Body Only ..............................E+ £499
Hexar RF + 50mm F2 + Flash..............Unused £999
16/18/21mm F4 Tri Elmar .......................Mint- £2,399
21mm F2.8 Asph M Black 6bit ................E++ £1,599
24mm F2.8 Asph M Black 6bit ................E++ £1,699
28mm F2 Asph M Black ..........................E++ £1,599
35mm F2.8 Chrome (M3) .............................E+ £299
35mm F3.5 Chrome (M3) .............................E+ £299
50mm F1.0 M Black ..................................E+ £2,499
50mm F1.4 M Chrome ............................E++ £1,099
50mm F2.8 Chrome......................................E+ £225
90mm F2 Black.............................................E+ £399
90mm F2 M Black ......................................E++ £649
90mm F2.8 Chrome......................................E+ £349
90mm F4 C.................................................E++ £249
90mm F4 Chrome...........................................E+ £99
90mm F4 Collapsible....................................E+ £249
135mm F2.8 Black........................................E+ £249
135mm F2.8 M Black .................As Seen £225-£250
135mm F4 Black...........................................E+ £249
135mm F4.5 Chrome..............As Seen / E+ £45-£99
Minolta 28mm F2.8 M...................................E+ £399
Minolta 90mm F4 M......................................E+ £179
Voigtlander 50mm F2 Heliar Classic.........Mint- £399
Zeiss 18mm F4 ZM + Hood ......................Mint- £849
Zeiss 21mm F2.8 ZM + Hood...................Mint- £849
Zeiss 50mm F1.5 ZM - Black.....................Mint £699
14127 M to R Adapter.....................................E+ £99
16/18/21 Universal Finder ..................Ex Demo £499
24mm Finder.................................................E+ £199
28mm Finder ..............................................E++ £199
A42 Swing Polariser..............................E++ £69-£85
Bellows II ........................................................E+ £79
Leicavit - Black Paint..................................New £399
Leicavit - Chrome.......................................New £399
M2 Leather Case.....................................E+ £25-£30
M4 Leather Case ............................................E+ £30
M6 Leather Case.....................................E+ £45-£59
SF20 Flash ....................................E+ / E++ £79-£85
Universal Polariser M .............E++ / Mint- £195-£199
Leica R Series
R3 Gold + 50mm F1.4.......................Unused £1,999
R9 Anthracite Body Only........................Mint- £1,099
R9 Black Body Only............E++ / Mint- £999-£1,199
R8 Chrome Body Only .............E+ / Mint- £399-£449
R8 Black Body Only ...................................E++ £399
R7 Chrome Body Only ...............................E++ £349
R6.2 Chrome Body Only........E++ / Mint- £699-£799
R6 Black Body Only ..................E+ / E++ £399-£449
RE Black Body Only.....................................E+ £249
R4 Black Body Only......................................E+ £159
R3 MOT + Winder.......................................E++ £299
R3 MOT Black Body Only .....................As Seen £99
R3 Black Body Only ...................................E++ £139
SL2 Anniversary Body Only .......................E++ £649
SL MOT Black Body Only...........................E++ £299
SL Black Body Only....................................E++ £349
SL Chrome Body Only..................................E+ £199
15mm F2.8 Asph Super ROM................Mint- £2,999
19mm F2.8 ROM.....................................E++ £1,149
21mm F4 R 3cam.........................................E+ £399
24mm F2.8 R 3cam..........As Seen / E++ £249-£399
24mm F2.8 ROM ...................E++ / Mint- £599-£699
28mm F2.8 PCS Shift ............E++ / Mint- £899-£950
28-70mm F3.5-4.5 ROM............E+ / E++ £319-£399
28-90mm F2.8-4.5 Asph ROM
.........................................E++ / Mint- £1,499-£1,599
35mm F1.4 ROM ...................................Mint- £1,250
35mm F2 ROM ...............As Seen / Mint- £599-£799
35mm F4 Shift ...........................E+ / E++ £239-£349
35-70mm F3.5 R German .........E+ / E++ £399-£449
35-70mm F4 ROM.....................E+ / E++ £349-£450
60mm F2.8 Macro ROM.............................E++ £649
70-210mm F4 R 3cam...............E+ / E++ £375-£449
75-200mm F4.5 3Cam ................................Exc £159
75-200mm F4.5 R 3cam...............................E+ £199
80-200mm F4 ROM................E++ / New £649-£999
80-200mm F4.5 R 3cam ..............................E+ £249
100mm F2.8 Apo Macro R 3cam
.................................................E+ / Mint- £849-£999
100mm F2.8 Apo Macro ROM ................E++ £1,099
100mm F4 Bellows.......................................E+ £199
105-280mm F4.2 ROM............................E++ £1,999
135mm F2.8 R 3cam.........................E++ £245-£249
180mm F2.8 3rd Cam...................................E+ £349
180mm F2.8 R 3cam................Exc / E++ £399-£499
180mm F4 R 3cam..............................E+ £249-£299
250mm F4 R 3cam.......................................E+ £449
400mm F6.8 Telyt .........................................E+ £395
2x Apo Extender R.................E++ / Mint- £449-£499
2x Extender R ............................E+ / Mint £119-£189
11842 Lens Head 400/560//800mm.......Mint- £3,499
11843 Focus Module 280/400mm F2.8 .Mint- £1,650
11844 Focus Module 400/560mm F4 ....Mint- £1,999
11845 Focus Module 560/800mm F5.6..Mint- £2,150
Angle Finder R (14300)..........E++ / Mint- £125-£199
Klaus Bree Holdall........................................E++ £95
Macro Adapter R .......................................Mint- £125
Motordrive R + Grip ....................................E++ £135
Motordrive R4...............................Exc / E++ £69-£79
Motorwinder R ................................................E+ £59
Motorwinder R4 ..............................................E+ £59
Motorwinder R8/R9....................E+ / E++ £149-£199
R Longnose Leather Case.............E+ / E++ £35-£49
SL/SL2 Leather Case ....................E+ / E++ £30-£35

Leica Screw
Oscar Barnack Edition No 800...............New £1,250
Standard + 50mm F3.5 ...............................Exc £499
IIIF R/Dial D/A Chrome Body ..............E+ £299-£349
IIIF R/Dial Chrome Body...............................E+ £299
IIIF B/Dial Chrome Body............E+ / E++ £219-£299
IIIC Chrome + 50mm F3.5............................E+ £299
III Chrome + 50mm F2................................Exc £295
III Chrome Body .........................Exc / E+ £225-£275
IIF R/Dial Chrome Body................................E+ £350
IIF B/Dial + 50mm F3.5.......................E+ £449-£450
IIC Chrome Body..........................................E+ £275
II Chrome + 50mm F3.5 ...............................E+ £295
90mm F4 Elmar ....................As Seen / Exc £45-£59
135mm F4.5 Hektor......................Exc / E+ £49-£125
200mm F4.5 Telyt........................................Exc £225
280mm F4.8 Telyt .....................Exc / E++ £175-£245
Ricoh 28mm F2.8 GR + Finder ....................E+ £699
ADVOO Close Up Set ..................................E++ £95
FIKUS Hood................................................Mint- £79
FISON Hood.................................................E++ £29
IUFOO Hood...................................................E+ £30
Film Trimming Template ................................E++ £49
SBLOO 35mm Finder.................................E++ £149
SBOOI 5cm Finder ........................E+ / E++ £75-£95
SFTOO 20cm Finder ......................................E+ £79
SGVOO 90mm Finder ....................................E+ £49
SGVOO 9cm Finder .....................................E++ £75

Mamiya RB67
Pro SD Complete......................E+ / Mint- £549-£599
Pro S Complete ........................Exc / E++ £299-£399
Pro S Body Only.......................Exc / E++ £125-£149
50mm F4.5 ............................................As Seen £99
50mm F4.5 C.............................................New £490
65mm F4 KL...............................................E++ £249
65mm F4.5 ....................................................Exc £99
65mm F4.5 C................................................E+ £149
90mm F3.5 ....................................................Exc £99
90mm F3.8 C .............................Exc / E++ £99-£199
140mm F4.5 C Macro...................................E+ £239
150mm F4 C Soft Focus ...................E++ £149-£159
180mm F4.5........................As Seen / E++ £99-£179
180mm F4.5 C....................As Seen / E++ £89-£189
180mm F4.5 KL .........................................New £325
250mm F4.5 C.....................................As Seen £125
120/220 Powerdrive Mag ..............................E+ £149
Pro 220 Mag..........................................As Seen £35
Pro SD 120 Mag ............................E+ / E++ £65-£75
ProS 220 Mag..............................E+ / E++ £49-£145
Extension Tube No1........................................E+ £79
Extension Tube No2......................................E++ £59
Flash L Grip..................................................E++ £25
Polaroid Mag...................................................E+ £45
Mamiya RZ67

Mamiya 6/6MF
6 + 50mm/75mm/150mm Lenses
...........................................E+ / Mint- £1,699-£1,899
6 Body Only..................................................E+ £599
150mm F4.5 L (6/6MF)...............................E++ £349
Mamiya 645 AF/D/DII

645AFDIII Complete........................Ex Demo £2,999
645AFDIII Body Only ......................Ex Demo £1,999
645AFD Complete ......................................E++ £899
ZD Digital Back ......................................Mint- £2,999
28mm F4.5 AF D.............................Ex Demo £2,699
35mm F3.5 AF.................Ex Demo / E++ £599-£649
55mm F2.8 AF..........................Ex Demo / E++ £499
55-110mm F4.5 AF............................E++ £799-£899
75-150mm F4.5 AFD.......................Ex Demo £1,499
80mm F2.8 AF....................................Ex Demo £269
80mm F2.8 AF D................................Ex Demo £499
105-210mm F4.5 AF ULD...........................E++ £699
120mm F4 Macro MF ..............................E++ £1,099
150mm F3.5 AF..............Ex Demo / New £349-£449
210mm F4 AF ULD..........Ex Demo / E++ £699-£749
300mm F4.5 AF Apo ...............................E++ £1,399
120/220 Insert 645AF/D ...............................E++ £79
120/220 Mag 645AF/D.............E++ / Mint- £99-£199
Auto Extension Tube NA401 .........................E++ £99
Auto Extension Tube NA402.........................E++ £99
Auto Extension Tube NA403.........................E++ £99
Mamiya 645
ProTL Complete + AE Prism.......................E++ £549
Pro TL Complete.........................................E++ £449
ProTL SV Kit ...............................................E++ £499
Pro Complete ................................................E+ £499
Super Complete + AE Prism ......Exc / E+ £249-£329
Super Complete..........................................E++ £199
35mm F3.5 N................................................E+ £249
45mm F2.8 C..............................................E++ £149
45mm F2.8 N..............................................E++ £199
50mm F4 C Shift....................E++ / Mint- £349-£450
55mm F2.8 N..........................E++ / Mint- £159-£179
70mm F2.8 Leaf Shutter...............................E+ £125
80mm F2.8 Leaf Shutter...............................E+ £199
105-210mm F4.5 C ULD .....................E+ £199-£249
105-210mm F4.5 C ULD............................New £379
150mm F2.8 A ............................................E++ £249
150mm F3.5 C ....................As Seen / E++ £39-£115
150mm F3.5 N ..................As Seen / Mint- £65-£145
150mm F3.8 Leaf Shutter...........................E++ £295
150mm F4 C.........................As Seen / E++ £59-£99
210mm F4 C.......................As Seen / E++ £75-£199
210mm F4 N..............................E+ / E++ £109-£125
300mm F2.8 A Apo..................................E++ £1,949
500mm F8 Reflex .......................................E++ £399
2x Teleconverter .........................................New £145
Teleplus 2x Converter ...................................E++ £45
120 Insert .....................................E+ / Mint- £15-£20
120 Pro Mag ..........................................E++ £39-£45
135N Pro Mag.................................................E+ £75
135N Super Mag........................E++ / Mint- £75-£85
135W Mag ......................................................E+ £85
220 Insert ..............................................E++ £15-£20
Polaroid Mag .................................E+ / New £25-£79
AE Prism Finder (FK402).............E+ / E++ £99-£109
AE Prism Finder N.....................E+ / E++ £109-£199
Prism Finder (FP401)..............Mint / New £109-£149
Prism Finder N.....................................E++ £75-£119
Plain Prism 645...............................................E+ £49
Auto Extension Tube 1...................E+ / E++ £20-£25
Auto Extension Tube 2 ..........................E+ / E++ £25
Auto Extension Tube 3S ......................E+ / Mint- £25
Flash L Grip..................................................E++ £25
Power Drive N.................................................E+ £45
SCA396 Flash Adapter.................................E++ £45
Super Loupe N .............................................E++ £35
Tripod Adapter N...........................................E++ £25
Mamiya 7/7II
7II Black + 80mm F4 L................E++ £1,049-£1,249
7 + 80mm F4 L..........................E+ / E++ £899-£949
43mm F4.5 L + Finder ...........E++ / Mint- £949-£999
50mm F4.5 L + Finder ...........E++ / Mint- £699-£899
65mm F4 L................................................Mint- £549
150mm F4.5 L........................E++ / Mint- £399-£499
Close-up Adapter........................................E++ £149
Panoramic Adapter AD701 ................E++ / Mint- £75

Pro II Complete...........................................E++ £849
Pro Complete + AE Prism .............................E+ £599
Pro Complete .............................E+ / E++ £499-£599
50mm F4.5 ..................................................Exc £350
50mm F4.5 ULD ........................................New £699
65mm F4 L-A .............................................New £549
65mm F4 W ..................................................E+ £299
75mm F4.5 SB / LM + Spacer....................E++ £949
75mm F4.5 Shift W....................E+ / E++ £449-£599
100-200mm F5.2 W......................................E+ £399
110mm F2.8 W............................................E++ £199
140mm F4.5 Macro ML-A..................E++ £299-£449
140mm F4.5 W Macro ................................E++ £259
150mm F3.5 W .......................E++ / New £350-£499
180mm F4 VSF / DL .........................E++ £499-£599
180mm F4.5 W ...........................Exc / E+ £189-£199
180mm F4.5 WN............Ex Demo / Mint- £125-£395
210mm F4.5 Apo ........................................E++ £599
250mm F4.5..................................................E+ £179
250mm F4.5 K/LA.........................................E+ £299
350mm F3.5 Apo ..........................................E+ £799
350mm F5.6 Apo ........................................E++ £749
360mm F6 ....................................................E+ £299
1.4x Converter ...................................E++ £199-£249
120 Pro Mag .......................As Seen / E++ £59-£145
120 Pro Mag (6x4.5) .....................................E+ £145
120 ProII Mag ................................E+ / E++ £75-£89
Polaroid Mag..................................E+ / E++ £35-£45
AE Prism Finder ...............As Seen / E++ £149-£219
PD Prism Finder ...........................................E+ £225
Waist Level Finder........................................E++ £69
Mamiya Twin Lens
C330S + 80mm F2.8..................................E++ £299
C330 Body Only ...........................................E+ £125
55mm F4.5 Sekor..........................................E+ £119
135mm F4.5 Sekor.................As Seen / E+ £85-£99
180mm F4.5 Sekor .........................................E+ £99
Prism Finder ............................................E+ £49-£75
Meters - Please Phone
Minolta - Please Phone
Nikon AF
F6 Body Only .........................................Mint- £1,099
F5 Body Only........................................Unused £750
F5 Body Only..............................Exc / E+ £199-£399
F4E Body Only ...........................................E++ £349
F100 Body Only.........................E+ / E++ £159-£599
F90X + MB10 Grip................As Seen / E+ £59-£129
F90X Body Only ......................................E+ £79-£89
F90 Body Only.............................E+ / E++ £59-£125
F80 Black Body .............................E+ / E++ £79-£99
F80 Chrome Body......................E++ / Mint- £79-£99
F801S Body Only .........................................E++ £59
F801 Body Only..............................................E+ £59
10.5mm F2.8 G IFED DX..........................Mint- £419
12-24mm F4 G AFS IFED DX.........E++ / Mint- £449
14mm F2.8 AFD........................................Mint- £950
17-55mm F2.8 G AFS DX IFED.E+ / E++ £639-£699
18mm F2.8 AFD .........................................E++ £799
18-55mm F3.5-5.6 G AFS VR ......................E++ £99
18-70mm F3.5-4.5 G AFS ED DX
...................................................E+ / E++ £149-£159
18-105mm F3.5-5.6 G AFS DX ..................E++ £149
18-135mm F3.5-5.6 G AFS DX
...............................................E++ / Mint- £159-£169
18-200mm F3.5-5.6 G AFS DX ED VR......E++ £399
24-50mm F3.3-4.5 AFN................................E+ £109
24-50mm F3.5-4.5 AFD..............................E++ £149
24-70mm F2.8 G AFS ED...E++ / Mint- £999-£1,049
24-120mm F3.5-5.6 ED AFD........................E+ £159
24-120mm F3.5-5.6 G AFS ED VR...E++ £389-£449
28-80mm F3.5-5.6 AFD.........................E++ £69-£79
28-85mm F3.5-4.5 AF..................................New £79
35mm F2 AFD ............................................E++ £189
50mm F1.8 AFD ...........................................E++ £79
55-200mm F3.5-5.6 AFS DX G
.........................................Ex Demo / E++ £119-£129
55-200mm F4-5.6 AFS...............................E++ £129
70-200mm F2.8 G AFS ED VR
.........................................E++ / Mint- £1,199-£1,249
70-300mm F4-5.6 AFD...............................E++ £179
70-300mm F4-5.6 AFG .........................E++ £85-£89
80-200mm F2.8 ED AF ................................E+ £399
80-400mm F4.5-5.6 AFD VR ...E+ / Mint- £899-£949
85mm F1.4 AFD........................................Mint- £699
85mm F2.8 AFD PC ...................................E++ £849
300mm F4 ED AFN...................E+ / E++ £399-£499

TC20EII Converter......................................E++ £249
Quantary 70-210mm F4-5.6 ...........................E+ £49
Sigma 10-20mm F4-5.6 EX DC HSM ........E++ £339
Sigma 15mm F2.8 EX ..................................E+ £329
Sigma 18-35mm F3.5-4.5 Asph ..................E++ £119
Sigma 20mm F1.8 DG RF..........................E++ £299
Sigma 30mm F1.4 DC EX HSM.................E++ £279
Sigma 50mm F2.8 EX Macro .....................E++ £179
Sigma 55-200mm F4.5-5.6 DC HSM.........New £110
Sigma 70-210mm F2.8 Apo..........................E+ £299
Sigma 70mm F2.8 EX DG Macro .............Mint- £289
Sigma 70-300mm F4-5.6 Apo DG..............E++ £109
Sigma 70-300mm F4-5.6 Apo Macro .........E++ £109
Sigma 70mm F2.8 DG Macro.......................E+ £279
Sigma 80-400mm F4.5-5.6 Apo DG OS ......E+ £659
Sigma 100-300mm F4 D Apo DG HSM....Mint- £599
Tamron 14mm F2.8 SP AF.........................New £599
Tamron 18-200mm F3.5-6.3 XR Di II..........E++ £139
Tamron 28-105mm F4-5.6 AF.......................E++ £49
Tamron 70-210mm F2.8 SP AF LD ............E++ £399
Tamron 200-400mm F5.6 LD .....................E++ £249
Tokina 10-17mm F3.5-4.5 DX Fish Eye ATX
...................................................................New £400
Tokina 12-24mm F4 Pro DX ......................Mint- £349
Tokina 17mm F3.5 AT-X ..............................E++ £199
Tokina 50-135mm F2.8 ATX Pro DX ...........E++ £399
DR4 Right Angle Finder ..............................Mint- £79
DW20 Waist Level Finder .............................E++ £89
DW4 Waist Level Finder..............................Mint- £85
MB10 Grip (F90/X) ........................E+ / E++ £35-£50
MB15 Grip (F100) .......................E++ / Mint £39-£69
MB16 Grip (F80)...........................................E++ £29
MC12B Release............................................E++ £20
MC35 Remote Cord......................................E++ £89
MF20 Databack ..............................................E+ £50
MF21 Multi Control Back ..............................E++ £45
MF25 Databack ..............................................E+ £29
MF27 Databack (F5)....................................New £99
MF29 Databack ............................................E++ £49
SB20 Speedlight....................................E++ £39-£49
SB21 Ringflash..................................E++ £149-£179
SB23 Speedlight...........................................E++ £39
SB24 Speedlight...........................................E++ £79
SB28 Speedlight...........................................E++ £79
SB29S Speedlight Macro ...........................E++ £199
SB400 Speedlight ........................................Mint £79
SB50DX Speedlight ..............................E++ £69-£79
SB80DX Speedlight......................................E++ £79
Nikon Manual - Please Phone
Olympus

OM4Ti Black + 50mm F1.8 .................E+ £299-£349
OM4 Black Body .........................................Exc £129
OM2N Chrome Body ..............As Seen / E+ £59-£85
OM2 Black Body.............................................E+ £79
OM2 Chrome Body..................................E+ £79-£89
OM1N Chrome + 50mm F1.8........................Exc £59
OM40 Black Body...........................................E+ £79
OM30 Chrome + 50mm F1.8 ................As Seen £69
OM10 Black Body Only ................................E++ £39
OM10 Chrome + 50mm F1.8........................E++ £69
OM10 Chrome Body.......................Exc / E+ £29-£39
21mm F3.5 Zuiko................................E+ / E++ £299
28mm F2 Zuiko...........................................E++ £219
28mm F3.5 Zuiko...........................E+ / E++ £29-£55
35mm F2.8 Zuiko..........................................E++ £65
35mm F2.8 Zuiko Shift ...............................E++ £299
35-70mm F3.5-4.5 Zuiko.......................E++ £49-£95
35-70mm F4 Zuiko........................................Exc £39
35-105mm F3.5-4.5 Zuiko ..............................E+ £99
50mm F2 Macro Zuiko..................................E+ £329
50mm F3.5 Zuiko Macro.................................E+ £99
50-250mm F5 Zuiko ...................................E++ £349
65-200mm F4 Zuiko ..................E+ / E++ £109-£159
75-150mm F4 Zuiko........................................E+ £49
80mm F4 Auto Macro Zuiko .........................E+ £225
80mm F4 Macro Zuiko...............E+ / E++ £159-£199
100-200mm F5 Zuiko ...........................E+ / E++ £69
135mm F4.5 Macro Zuiko...........Exc / E+ £129-£139
135mm F4.5 Zuiko Macro...........................E++ £249
180mm F2.8 Zuiko.....................E+ / E++ £349-£499
300mm F4.5 Zuiko........................................E+ £149
400mm F6.3 Zuiko .....................................E++ £599
600mm F6.5 Zuiko ..............................E+ £599-£649
2xA Converter.................................................E+ £59
Autobellows + Release ...............................E++ £119
Auto Extension Tube 7..................E+ / Mint- £19-£25
Auto Extension Tube 14................................E++ £25
65-116 Extension Tube..................................E++ £79
Varimagnifier ................................E+ / Mint- £49-£99
250 Film Back......................Unused / E++ £95-£195
F280 Flash.....................................E+ / E++ £75-£79
T10 Ringflash..............................................E++ £195
T10 Ringflash + Control 1...........................E++ £249
T20 Flash.........................................E+ / E++ £9-£25
T32 Flash.......................................E+ / E++ £25-£55
T32 Zoom Adapter........................................E++ £25
Handy Copystand .........................................E++ £39
Winder 2 .........................................................E+ £19
Pentax 645 - Please Phone
Pentax 6x7 - Please Phone
Pentax AF - Please Phone
Pentax Manual - Please Phone
Rollei 6003/6/8 - Please Phone
Rollei SL66/E/SE - Please Phone
Rollei Twin Lens - Please Phone
Voigtlander - Please Phone
Zeiss - Please Phone

www.storemags.com & www.fa
fantamag.com

Phone 0113 2454256
Visit our showroom 60-62 The Balcony, Merrion Centre, Leeds, LS2 8NG.

Open Mon - Fri 9.30am - 5.00pm Sat 9.30am - 12.30pm

email dalephotographic@btconnect.com Fax 0113 2343869

“A family run Independent supplier since 1985”

Canon PROFESSIONAL EQUIPMENT STOCKIST UK STOCK
“DALES SENSOR CLEAN” SPECIAL OFFER
2 Free sensor cleans worth £90 when you buy a 5DII, 1DS MKIII or ID MKIII**
1 Free sensor clean worth £45 when you buy a 50D / 500D or 7D camera**

EOS 1DS MK III
£5199
EOS 1D MK4 orders taken £4499
2 Year Warranty -1DSMK3 + 1DMK4
5D MKII Body
£1799
5D MK II + 24 -105mm IS £2549
5D MK II + 17 - 40mm L £2439
5D MK II + 24-70mm f2.8L Lens £2749
5D MK II + 16 - 35mm f2.8L MKII Lens £ 2999
£659
£836
£438
£ 499
£365
£1189

17-40mm f4L
£619
24-70mm f2.8L
£969
24-105 f4L IS Whitebox£749
28-135mm f3.5/5.6 IS £389
TSE 17mm f4L
£1995
TSE 24mm f3.5L II
£1895

1 Free sensor clean worth £45 when you buy a
7D camera body or kit**

New EOS 7D Body
EOS 7D +18-135mm IS Lens
EOS 7D + EFS 15 - 85 IS Lens

£1299
£1549
£1799

1 Free sensor clean worth £45 when you buy a
50D / 500D camera or kit**

EOS 50D + 18-200 IS Lens
EOS 50D + 17 - 85 IS Lens
EOS 50D Body
EOS 500D+18/55 IS
EOS 500D Body

ALL OUR KIT IS GENUINE UK STOCK
10-22 EFS
17-55mm EFS
17-85mm EFS IS
18 - 200mm EFS IS
60mm Macro EFS
16- 35mm f2.8L MKII

-

£1099
£989
£729
£579
£529

D300s

D700

D3

D3s

D3X

£1199
£1439
£1999
£1699
£1599
£2249
£1759
£2029
£3039
£2939
£2339
£2059
£3199
£3999
£3495
£4399
£4499
£4795
£5085
£6095
£5995

£99
£309
£1321
£529
£949
£1062

70-200 f2.8L IS
70 - 300 IS
85mm f1.8
85mm f1.2 II L
100 f2.8 Macro
100mm f2.8L Macro IS

£1599
£439
£321
£1827
£449
£799

D90 D5000 LENSES FLASHGUNS ACCESSORIES

500mm AFS VR
£5899
£6999
D5000 Body
£ 519 600mm AFS VR
D5000 18-55 VRII
£578 1.4x / 1.7x / 2x Converter £310
£247
D90 Body
£ 699 MB-D10 Grip
£530
D90 + 18 - 105mm VR £ 849 10.5mm f2.8 DX
£179
14-24mm f2.8AFS
£1299 35mm f1.8 AFS G
£110
24-70mm f2.8 AFS
£1229 50mm f1.8 AFD
£289
PC-E 24mm f 3.5
£1399 50mm f1.4 AFS G
£299
PC-E 45mm f 2.8
£1399 85mm f1.8 AFD
£895
10 - 24mm AFS DX
£655 85mm f1.4 AFD
£392
16-85mm AFS VR
£439 60mm f2.8 Micro AFS
£613
12-24mm f4 DX
£818 105mm f2.8 Micro VR
£329
17-55mm f2.8 DX
£1064 SB900 Speedlight
£229
18 - 105mm DX VR
£228 SB600 Speedlight
£409
18 - 200mm DX VR II
£599 SB-R1 Macro flash
70-200mm f2.8 AFS VRII £1995 SB-R1C1 Commander kit £589
800 Commander
£299
70-300mm AFS VR
£433 SU
SD - 9 Battery Pack
£169
80-400mm AFD VR
£1187 WT - 4B Transmitter
£509
200-400 f4 AFS VR
£4834 GP1 - gps unit
£189
200mm f2 AFS VR
£3154 ML-3 Remote Set
£199
300mm f2.8 AFSVR
£3949 MC-30 £69
MC-36 £140
£149
400mm f2.8 AFS VR
£6699 Capture NX2 Software
Claim £50 Cashback - 5000D lens kit

Bowens 500R + PRO Bowens Lighting
500R /500R Softbox/brolly Kit
500R /500R Trigger Kit
500R /500R Travel pak Kit
500R / 500R / 500R Kit
500/500 PRO Kit
500/500 PRO Travelpak Kit
500/500/500 PRO Kit
750/750 PRO Kit
750/750 PRO Travelpak Kit
750/750/750 PRO Kit
1000/1000 PRO Kit
1000/1000PRO Travelpak Kit

£ 858
£ 1049
£ 1232
£ 1319
£ 1070
£ 1477
£ 1669
£ 1239
£ 1649
£ 1912
£ 1455
£ 1917

“BRITISH AND BEST”

10% ACCESSORY OFFER - PHONE
Bowens 200/ 200 Kit
£ 475
Bowens 400/ 400 Kit
£ 542
Bowens 200/ 400 Kit
£ 535
NEW 200/200 Travel Pack Kit £ 825
NEW 400/400 Travel Pack Kit £ 902
Travel pak - Small
£ 455
Travel Pak - Large
£ 516
Pulsar Radio Trigger Twin Pack £ 199
NEW Ringlight Converter
£ 249
Bowens Fresnel 200 Spot
£ 463
Flash kits
Pulsar
Radio
Trigger
Single
129
180/ 180 Kit with a softbox + brolly £279 Pulsar Radio Trigger Twin Pack ££ 199
300/ 300 Kit with a softbox + brolly £349 Pulsar Trigger Card
£ 73
£ 199
300/ 300 Kit - Creative Kit £449 Pulsar Trigger Kit

Proline

Manfrotto Tripods + Heads
190XProB
£ 99.95
190XDB 056 KIT £ 89.95
7332 CY Carbon kit £169
190 CXPro 3
£ 229.00
190 CXPro 4
£ 237.00
055XDB+ 222 Kit £ 139.95
055 XProB
£ 127.00
055 CX Pro 3
£ 266.00
055 CX Pro 4
£ 275.00
322 RC2 head
£ 93.00
460 mg head
£ 68.00
484 RC2 head
£ 42.45
486 RC2 head
£ 49.00
804 RC2 head
£ 55.00
808 RC4 head
£ 92.00
410 geared head £ 139.00

USED EQUIPMENT

Hasselblad 50mm f4 CF FLE £595
MONOPODS
£225
MN 679B
£33.95 Hasselblad 50mm CT
250mm f4 FE
£ 695
MN 680B
£43.00 Hasselblad
Hasselblad PME 90 Prism £ 450
MN 681B
£43.00 Hasselblad PM90 Prism
£ 125
MN 682B
£76.00 Hasselblad E16 Magazine £ 295
MN 694CX £127.00 Hasselblad A12 Latest type £ 295
£75
MN 695CX £144.00 Hasselblad A12 Back
Proshade + 060 £75
234RC head £26.95 Hasselblad
Hasselblad XPan + 45mm
£895

WE STOCKGIOTTOS
TRIPODS

We stock LEE filters 10 %
discount off all LEE items.

BUY SECURELY ONLINE

Hasselblad XPan II + 45mm £999
Bronica 645 RF + 3 Lenses £1195
Bronica E 150mm MC
£125
Bronica 250mm E MC
£195
Bronica Prism Finder E
£ 75
Bronica 120 Back E
£ 50
Bronica Polaroid Back E
£ 75
Bronica SQAi + 80mm PS £495
Broniac 35mm PS Lens
£495
Bronica 40mm PS Lens
£395
Bronica 50mm PS Lens
£250
Bronica 65mm PS Lens
£250
Broniac 110 PS Macro
£295

1.4 X EXTENDER II
£299
2 X EXTENDER II
£299
EF12 EXTENSION TUBE
£79
EF25 EXTENSION TUBE
£149
580EX MK II SPEEDLITE
£369
430 EX II SPEEDLITE
£216
MACROLITE MR14EX
£ 466
MACRO TWIN LITE MT24EX
£755
STE2 TRANSMITTER
£199
OFF CAMERA SHOE CORD 3
£60
KENRO EXTENSION TUBE SET £129
BP511A BATTERY 20/30/40/5D £89
LP-E6 BATTERY 5D MKII
£69
LP-E4 BATTERY 1DMK3 1DSMK3 £129
LP-E5 BATTERY 450D
£44
RS-80N3 REMOTE CORD
£44
RS-60E3 REMOTE CORD
£24
BGE2N GRIP - 40D + 50D
£159
BG-E6 GRIP - 5D MKII
£229
BG-E7 GRIP - 7D
£159

NOT GREY IMPORT - “We now sell ZEISS lenses”

50mm f1.8 II
50mm f1.4
50mm f1.2L
70-200mmf4L
70-200 f4L IS
70-200 f2.8L

VISIT OUR SHOWROOM TO SEE QUALITY NIKON EQUIPMENT. “ASK ABOUT NIKON PLUS”
D300S Body In Stock
D300S + MB-D10 Grip
D300S + 12 - 24mm DX
D300S + 18-200 VRII
D300S + 16-85mm VR
D300S + 17-55 f2.8 DX
D700 Body
D700 + 50mm f1.4 AFS
D700 + 14 -24 f2.8
D700 + 24 -70 f2.8
D700 + 105mm VR
D700 + SB900
D3 Body
D3S Body
D3 + 50mm f1.4 AFS
D3 + 24-70 f2.8 + NX2
D3 + 14-24 f2.8 + NX2
Nikon D3X Body
D3X + 50mm f1.4 AFS G
D3X +14-24 f2.8 + NX2
D3X + 24-70 f2.8 + NX2

CANON ACCESSORIES

METERS + FLASH
Gossen Sixtomat Digital
£ 170
Gossen DigiPro F
£159
Gossen Starlite
£ 329
SEKONIC L 308S
£ 128
SEKONIC L 358
£ 192
SEKONIC L758D
£ 349
SEKONIC L758DR
£ 389
SEKONIC L758 Cine
£ 409
New Sekonic C-500 Colour
£ 695
New Sekonic C-500R Colour £ 799
Kenko KFM 2100
£ 349
Sunpak PZ42X
£ 125
Sunpak Auto 16R pro Ringflash£ 289
METZ 45 CL-4 Digital Basic £ 373
METZ 45 CL-4 Digital Nimh
£466
METZ 54 MZ 4i
£ 327
New METZ 58 AF 1 Nik/ Can £ 288
METZ 76 MZ5
£ 679

100-400L IS
300mm f2.8L IS
400mm f5.6L
400mm f2.8 L IS
400mm f4 DO IS
500mm f4 L IS
600mm f4 L IS
POWERSHOT G11

PHONE TO ARRANGE YOUR Free DEMO
H3D II 31 + 80mm AF LENS Kit £ 10610
H3D II 39 + 80mm AF LENS Kit £ 13499
NEW H3D II 50 Kit (No Lens)
£ 16499
NEW H4D 60 Kit (No Lens)
£ 28974
NEW CFV - 39 for 500 series
£ 8999
503CW + 80mm CFE + A12
£ 4216
“HIRE A H3D - 39II KIT £ 249 per day”
28mm f 4 HCD
£ 2892
35mm f 3.5 Lens HC
£ 2437
NEW 35 - 90mm f4 / 5.6 HCD
£ 4755
50mm f 3.5 Lens HC
£ 2271
50 - 110 mm f3.5 / 4.5 Zoom HC £ 2892
80mm f 2.8 HC
£ 1547
100mm f 2. 2 Lens HC
£ 2168
120mm f 4 Macro lens HC
£ 2582
150 mm f 3.2 Lens HCN
£ 2230
210mm f 4 Lens HC
£ 2375
300mm f 4.5 Lens HC
£ 2892
New HTS Tilt + Shift Adapter
£ 3399
1.7 x Teleconverter
£ 1029
GIL - GPS UNIT
£ 481
HVM Waist Level Finder
£ 232
Battery Grip 7. 2V
£ 165
X-RITE COLOUR MANAGEMENT
X-RITE ColorMunki Photo
£299
X-RITE EYE-ONE display 2
£139
X-RITE ColorChecker Passport £79

SIGMA + Tokina - Nikon + Canon fits
Sigma 10mm f 2.8 EX DC
£ 569 PocketWizard
Sigma 10 - 20mm f4 / 5.6 DC
£ 399
New
New Sigma 10-20mm f3.5 EX DC £ 599
Sigma 12 - 24 mm f 4.5/ 5.6 EX
£ 499 Mini TT1 CE Canon
Sigma 24 - 70mm f 2.8 EX DG
£ 430
£ 209
Sigma 24 - 70 f2.8 EX DG HSM
£ 749
Sigma 30mm f 1.4 EX DC
£ 389 Flex TT5 CE Canon
NEW 70 - 300mm f4 /5.6 DG OS £ 329
£229
Sigma 70 -200mm f2.8 DG MK2 £ 649
Sigma 120 - 400mm OS
£ 599
PLUS II
Sigma 150 - 500mm OS
£ 730
£169
Sigma 105mm Macro f2.8 EX DG £ 367
Tokina 10- 17mm f 3.5/4.5 ATX DX £489
PLUS II TWIN
Tokina 11 - 16mm f2.8 ATX ProDX £499
£315
Tokina 12- 24mm f 4 ATX Pro DX £ 499
Tokina 16-50mm f 2.8 ATX ProDX £599
Multi Max £229
Tokina 50-135mmf2.8 ATX Pro DX £599
Tokina 100mmf2.8 Macro ATXDX £349 Multi Max Twin £439
Tokina 80- 400mm f 4.4/5.6 ATX £599

WANTED quality photographic kit for PX or Commission Sale

Bronica 150mm PS
£195
Bronica 250mm PS
£ 195
Bronica AE Prism SQ i
£ 195
Bronica 645 RF + 65mm
£ 595
Bronica 645 RF + 3 Lenses £995
RZ 67 180mm lens Mint - £ 395
RZ 67 50mm f4.5W
£250
RZ 67 180mm Lens Exc ++ £195
RZ 67 350mm APO Mint - £ 680
RB67 ProSD +90 + 50mm
£599
RB67 180mm Sekor C E++ £195
RB67 Pro S 110mm back
£ 295
Mamiya 7 II Body Ex Demo £649
Mamiya 7 II Body Ex Demo £649
Mamiya 7 - 50mm Ex Demo £995
Mamiya 7 - 65mm Ex Demo £795
Mamiya 7 - 150mm Ex Demo £695
Mamiya 645AFD + 3 Lenses £2000
Mamiya 55-110 AF Lens New £995
Mamiya 6 - 50mm Lens
£ 350
Contax 645 Film back + insert £195
Rollei 180 f2.8TeleXenar PQ £1199
Rollei 90 Degree prism6000 £ 225

£1343
£3820
£1149
£6659
£5436
£5620
£ 7346
£ 489

Fuji GA 645Z i + Close up kit
£495
Nikon D3 Body
Boxed £1995
Nikon D300 Body
Boxed £849
Nikon D2X Body
£995
Nikon MB - D200 Grip
Boxed £85
Nikon D80 Body
£ 225
Nikon D70 Body
£ 149
Nikon WT-2 Transmitter
£ 125
Nikon F100 + MB15 Grip
£ 195
Nikkor 12 - 24mm f4 DX
£595
Tokina 12 - 24mm ATX Pro -AFD£375
Nikkor 17 - 55mm f2.8 DX
£695
Nikkor 18 - 70mm AFS DX
£125
Nikkor 24 - 120mm AFS VR
£350
Nikkor 80 - 200mm f2.8 AFDN £595
Nikkor 80 - 400mm AFS VR
£849
Nikkor AFI 300mm f2.8 AFD £1495
Nikon SuperCoolscan 4000ED £395
Kirk BL D2H/D2X L bracket
£ 75
Leica Minilux - Boxed + case
£249
Leica R3 Body
£145
Leica Vario Elmar 28 - 70mm R £350
Leitz 90mm f2 Summicron M
£645

Used Sekonic L408
£149
Contax G1 Body
£ 195
Contax TVS
£ 195
Contax AX Body + 50mm f1.7 £ 475
Canon EOS 1body + booster
£175
Canon EOS 1D MKIII
Mint £1995
Canon EOS 400D + 18/55
£250
£325
-EOS 400D + Sigma 18 -200
Cambo Ultima 35 - CanonEOS £2500
Canon EF 20mm f2.8 USM
£250
Canon EF 14mm f2.8 L II Mint- £1495
Canon EF 50mm f1.4 USM
£259
Canon EF 24 - 70 f2.8L Mint
£869
Canon EF 24 - 105mm f4L IS £699
Canon EF 35 - 135mm USM
£ 145
Canon EF 55 - 200mm USM
£125
Canon EF 70 - 200mm f4L
£395
Canon EF 400mm f2.8L IS
£4995
Canon BG-E4 Grip + battery
£125
Sigma 1000mm f8 APO EOS £1100
Canon ACK - E2 Mains adapter £ 49
Olympus E20P + converters
£200
Metz 60 CT4
£150

www.dalephotographic.co.uk
www.
ww
w.st
stor
st
orem
emag
ags.
s.co
com
m & ww
www.
w.fa
fant
fa
ntam
nt
amag
ag.c
.com
om

Lowepro
SPECIAL OFFERS
PRO ROLLER 3
£229
DRYZONE ROVER £159
ELITE AW
£79
PRO TREKKER 300 £249
PRO TREKKER 400 £259

Rezo 20
Rezo 40

£5.99
£7.99

DSLR Sensor Cleaning.
from £35
Phone for full details

Prices subject to change. Created 14.12 .2009

www.storemags.com & www.fantamag.com

www.storemags.com & www.fantamag.com

YORK CAMERAS
Agfa Isolette II, 6x6 on 120, 85mm f4.5 Apotar nr mint . .£25
Benbo small black ball and socket head. Nr mint . . . . . .£25
Binoculars Pentax 8x24 modern design, nice quality . . . .£39
Brewster type hand held stereoscope, mahogany, nice .£149
Bronica S/2/A bellows, with movements / focus rack . . .£39
Bronica S2A 120 6x6 mag, chrome, good condition . . . .£29
Canon AE1-P chrome + 50mm f1.8 FD VGC new seals .£59
Canon EF 100-200mm ff4.5-5.6 II, nr mint condition . . . .£49
Canon EF 100-300mm f4.5-5.6 USM, like new boxed .£149
Canon EF 100mm f3.5 Cosina Macro lens, VGC . . . . . .£79
Canon EF 18-50mm f2.8 Sigma EX DC mint boxed . . .£189
Canon EF 18-55mm f3.5-5.6 EF-S MKII Digital only lens £49
Canon EF 20-35mm f3.5-4.5 Ultrasonic USM, super . .£189
Canon EF 28-105 f3.5-4.5 USM, with caps and hood . .£69
Canon EF 28-80mm f3.5-5.6 Zoom lens, VGC, caps . . .£29
Canon EF 28-90mm f4-5.6 USM lens, nr mint, caps . . . .£39
Canon EF 2X ; Tamron C-AF1 MC 7 element, nr mint . .£69
Canon EF 70-300 f4-5.6 Sigma DG Macro mint boxed . .£59
Canon EF fit M42 mount for M42 lens on EOS body . . .£12
Canon EF fit T mount for T mount lens on EOS body . . . .£8
Canon EF hood EW-62 good condition . . . . . . . . . . . . . . .£8
Canon EF Sigma EX 2X apo tele converter, mint boxed £119
Canon EOS 10D plus grip, lovely condition, boxed . . . .£199
Canon EOS 5 body, good usable condition, boxed . . . . .£49
Canon EOS L6 Digital Wide strap, brand new sealed . .£10
Canon EOS5 plus VG10 grip, vgc with strap, cap . . . . . .£59
Canon F1 (n) with 50mm f1.4 SSC breech lens, super .£269
Canon F1 flash coupler VGC . . . . . . . . . . . . . . . . . . . . .£15
Canon F1 focussing screen C, VGC, cased . . . . . . . . . .£10
Canon F1N focus screen PE (split image ) mint cased . .£12
Canon FD 100-200mm f5.6 Breech zoom lens, super . .£35
Canon FD 100mm f2.8 SSC Breech, lovely, hood, caps .£69
Canon FD 135mm f3.5 SC Breech mount, nr mint . . . . .£29
Canon FD 200mm f2.8 SSC breech, lovely, cased . . . .£189
Canon FD 200mm f4 SSC lens breech mount type, VGC£49
Canon FD 24mm f2.8 SSC breech realy nice caps hood £79
Canon FD 28mm f2.8, VGC, caps . . . . . . . . . . . . . . . . . .£30

Minolta MC 100-200mm f5.6 Zoom Rokkor, near mint . .£39
Minolta MC 135mm f2.8 MC Tele Rokkor PF, caps . . . . .£25
Minolta MC 200mm f3.5 Tele Rokkor QF lens, lovely . . .£49
Minolta MC 28mm f2.8 Minolta Celtic lens, near mint . . .£35
Minolta MC 35mm f2.8 W.Rokor lens, lovely cond, caps .£29
Minolta MD 135mm f3.5 lens, VGC, caps . . . . . . . . . . . .£25
Minolta MD 28-70mm f3.5-4.5 Tokina SD lens, VGC . . . .£20
Minolta MD 28mm f2.8 lens, VGC . . . . . . . . . . . . . . . . . .£25
Minolta MD 28mm f3.5 lens, VGC, caps . . . . . . . . . . . . .£29
Minolta MD 35-70mm f3.5 Macro Zoom, two touch, VGC£29
Minolta MD 70-210mm f4-5.6 Tokina SD lens, VGC . . . .£25
Minolta MD fit 28mm f2.8 Vivitar MC lens, nr mint, caps .£15
Minolta MD fit 2X converter, Tokina RMC dedicated . . . .£12
Minolta MD Tele-Rokkor X 135mm f2.8 lens, good cond .£29
Minolta Riva Zoom 105i, black, with 35-105mm Zoom . .£29
Minolta SR mount Vivitar TX 24mm f2.8, VGC . . . . . . . .£29
Minolta SR1+ 55mm f1.8/shoe/clip on meter (meter us) .£29
Minolta X-300 chrome body, Very good condition . . . . . .£29
Minolta X300, chrome, with 50mm f1.7 MD lens, super .£49
Minolta X500, black, with 50mm f2 MD lens, VGC . . . . .£49
Minolta XE, chrome, with 50mm f1.7 MC Rokkor PF . . .£69
Nikon AF 19-35mm f3.5-4.5 Tokina AF, mint, boxed . . . .£89
Nikon AF 28-200mm f3.8-5.6 Tamron XR (IF) mint, box .£89
Nikon AH-4 Hand Strap mint, boxed, £45 new . . . . . . . .£22
Nikon AI 180mm f2.8 Nikkor, superb glass, scruffy paint .£99
Nikon AI 200mm f24Nikkor lens VGC, lovely glass, caps £69
Nikon AIS 50mm f1.8 Series E lens VGC . . . . . . . . . . . .£29
Nikon AIS 70-210mm f4-5.6 Sigma UC APO zoom vgc .£49
Nikon AIS 70-210mm f4-5.6 Tokina SD lens, super . . . .£29
Nikon AS-1 shoe adaptor for F2 . . . . . . . . . . . . . . . . . . . .£17
Nikon CF-14 case for EM. Long nose version, unused . .£10
Nikon DA-2 Action finder for F3, good condition, cap . . .£99
Nikon EM body plus motordrive MD-E, chrome button/ . .£39
Nikon F80 body, black, mint, boxed as new, unused . . .£109
Nikon FM body, black, serviced, small ding and marks . .£79
Nikon MB-10 grip for F90 & F90X vgc . . . . . . . . . . . . . . .£29
Nikon MB-16 grip for F80, Mint, boxed as new . . . . . . . .£39

We are always keen to purchase collections however large or small.
Instant decisions and fair prices paid. Please ring us now...
You are welcome to visit our showroom - please ring us for an appointment.
We wish all of our customers a happy and Prosperous New Year.
Canon FD 35mm f2.8 very nice . . . . . . . . . . . . . . . . . . . .£39
Canon FD 35mm f3.5 SC breech lens, VGC, caps . . . . .£29
Canon FD 400mm f4.5 SSC breech, SUPERB! cased .£349
Canon FD 50mm f1.4 FD bayonet lens, VGC, caps . . . .£49
Canon FD 70-210mm f4 zoom, lovely example, caps . . .£49
Canon FD fit 28mm f2.8 Sigma Mini Wide II lens, VGC .£20
Canon FD fit 70-210mm f4.5 Sigma Zoom II lens, VGC, .£20
Canon FD fit body to M42 lens adaptor, VGC, . . . . . . . .£12
Canon FD hood B52 good condition . . . . . . . . . . . . . . . . .£4
Canon FD hood BS-55 Good Condition . . . . . . . . . . . . . .£5
Canon FD hood BT-52 good condition . . . . . . . . . . . . . . .£5
Canon FD hood BT-55 good condition . . . . . . . . . . . . . . .£6
Canon FD hood BW-52B good condition . . . . . . . . . . . . . .£7
Canon FD hood BW-72B good condition . . . . . . . . . . . . .£10
Canon FD hood ES-62 good condition . . . . . . . . . . . . . . .£8
Canon FTBn black+ 50mm f1.8 good overall ding on top £39
Canon Motordrive MA, working perfectly, good cond. . . .£45
Canon Remote Switch 60 T3, mint, boxed, unused . . . . .£10
Canon Speedlite 133D, with Flash Auto Ring B2 cased .£25
Canon Speedlite 199A, VGC, cased . . . . . . . . . . . . . . . .£20
Canon Speedlite 420EX, VGC, case, manual . . . . . . . . .£99
Canon T70 body in VGC . . . . . . . . . . . . . . . . . . . . . . . . .£39
Canon T80 + 50 and 35-70 AC lenses, manuals, scarce £89
Canon T90 body, VGC with signs of normal use . . . . . . .£89
Contax AA Powerpack P-6 battery holder for P-5 . . . . . .£19
Contax electronic cable switch, 1m long, suit 167 etc . . .£12
Contax GD-1 Databack for G series, mint, boxed . . . . . .£39
Contax T2 Titanium Databack (replaces Std Back) M- . . .£29
Contax TLA 20 flashgun good condition . . . . . . . . . . . . .£25
Ensign 220 Autorange, CRF, 75mm f4.5 Ensar/Epsilon . .£49
Exakta VX 1000, + Domiplan, lovely example, prism . . .£59
Finetta 88, with grey covering, 45mm f2.8 Finetar . . . . .£29
Fuji Finepix S3 Pro body, mint and boxed as new . . . . .£349
Fuji GW670 III, lovely condition, VERY low use (390 shots!)
90mm f3.5 EBC Fujinon, a lovely 6x7, with manual . . . .£699
Hasselblad fit Komura Telemore 2x converter, VGC . . . .£49
Houghton Ticka "Pocket Watch" Camera, with cap . . . .£139
Kenlock Beacon 200 infrared transmitter kit, up to 60m .£35
Kiev 60TTL, with 80mm f2.8 Volna 3 lens, WLF, Prism . .£89
Kiev IV, metered, 50mm f2 Jupiter 8M, case, all nice . . .£49
Kiev IV, metered, 50mm f2, leather covered, c.1960 . . . .£59
Kodak Retina 1 Type 010, post war,coated 3.5 Ektar . . .£35
Kodak Retina C 35mm f5.6 Schneider Curtar Xenon lens . .£49
Kodak Retina C 80mm f4 Schneider Longar Xenon lens £25
Kodak Retina Copying stand set+ lighting set, boxed . . .£39
Kodak Retina Ib, with 50mm f2.8 Xenar lens, good user .£39
Kodak Retina IIIc, 50mm f2 Xenon, nice to use, case . . .£99
Kodak Retina IIIc, f2 Heligon, nice to use, good condition£99
Kodak Retina Reflex / S 135mm f4 Rodenstok Rotelar .£49
Kodak Retina Reflex / S 135mm f4 Tele Xenar, keeper . .£29
Kodak Retina Reflex / S 35mm f2.8 Schneider Curtagon £39
Kodak Retina Reflex / S 60mm Yellow Filter, boxed . . . .£10
Kodak Retina Reflex / S 85mm f4 Tele Arton, keeper . . .£49
Kodak Retina Reflex / S fit 50mm f1.9 Schneider Xenon £29
Kodak SAV 1030 carousel projector, with 70-210 lens . .£49
Konica AR 135mm f3.5 Hexanon lens, VGC . . . . . . . . . .£25
Konica AR 200mm f3.5 Hexanon lens, superb . . . . . . . .£59
Konica AR 28mm f3.5 Hexanon lens, near new cased . .£25
Konica Auto Winder F AR, black, VGC, boxed, manual .£15
Konica FC-1 SLR, black + 50mm f1.8 AR Hexanon VGC£49
Konica FS-1 SLR+ 40mm f1.8 "Pancake" lens . . . . . . . .£49
KW Praktina FX + f2 Biotar, Prism ,VGC works well . . . .£69
Leica IIIF B/D body, VGC, working very well, SALE . . .£169
Leica SOOPD barn door hood for 5cm f2 Summitar . . .£39
Leica XOOIM hood for 50mm f1.4 Summilux. . . . . . . . . .£49
M42 135mm f4 Jupiter 11A lens, cased . . . . . . . . . . . . . .£29
M42 2X converter, Tamron F BBAR MC 7 element mint £19
M42 500mm f8 Russian 3M-5A mirror lens, top quality . .£69
M42 Russian manual bellows set Very well made VGC .£15
M42 screw mount 28mm f2.8 Ricoh Auto Rikenon VGC .£15
Mamiya 645 / C series TLR Pistol grip/ trigger release . .£19
Mamiya 645 150mm f3.5 Sekor-C lens, just serviced . . .£89
Mamiya C TLR 135mm f4.5 Sekors, chrome VGC . . . . .£59
Mamiya C TLR 180mm f4.5 Sekor Super, black, nice .£119
Mamiya C TLR 180mm f4.5 Sekor Super, superb, caps £149
Mamiya C TLR 180mm f4.5 Sekors, VGC . . . . . . . . . . . .£69
Mamiya TLR grip, fits under camera, with leather strap . .£15
Minolta 16 MG Presentation set, camera, flash, cased . .£49
Minolta AF 24-70mm f3.5-5.6 Sigma UCII AF boxed . . . .£49
Minolta AF 35-80mm f4-5.6 Minolta AF Zoom . . . . . . . .£29
Minolta AF 70-210mm f4-5.6 Sigma UCII AF, boxed . . .£39
Minolta AF 70-300mm f4-5.6 Sigma DL Macro Super m- £69
Minolta AF 80-200mm f4-5.6 Minolta AF Zoom lens . . . .£39
Minolta Dynax 7000i body,VGC, works well . . . . . . . . . . .£35
Minolta Dynax 7Xi body, good working order . . . . . . . . . .£49

Nikon MB-16 grip for F80, near mint condition . . . . . . . . .£29
Nikon MC-10 remote release, like new in original box . .£20
Nikon MC12A cable release good condition . . . . . . . . . .£12
Nikon MD-12 motordrive, for FM FE etc, lovely example £59
Nikon MD-E motordrive, very nice example. . . . . . . . . . .£19
Nikon Nikkormat EL body, black, well used . . . . . . . . . .£49
Nikon Non AI 28mm f3.5 Nikkor, later type (waffle grip) .£49
Nikon Non AI 35mm f2.8 PC-Nikkor Shift lens, SALE . .£189
Olympus OM 100-200mm f5 Zuiko nr mint, filter, caps . .£59
Olympus OM 135mm f3.5 Zuiko Auto T lens, VGC . . . . .£35
Olympus OM 14mm and 25mm manual ext. tubes pair .£20
Olympus OM 180mm f2.8 MC Zuiko A1 glass SALE! . .£249
Olympus OM 28mm f2,8 Zuiko Auto-W lens, VGC . . . . .£39
Olympus OM 28mm f3.5 Zuiko Auto-W lens, VGC, . . . . .£35
Olympus OM 75-150mm f4 Zuiko zoom lens, VGC . . . .£45
Olympus OM Cobra D650 LCD dedicated flash /bracket £25
Olympus OM fit 2x , Tamron SP Multi Coated mint . . . . .£19
Olympus OM Winder 1, VGC working perfectly . . . . . . . .£29
Olympus OM Winder 2, good condition and working . . . .£29
Olympus OM1N MD, chrome, 50mm f1.8 good user . . .£69
Olympus Pen, 2.8cm f3.5, original model, average . . . . .£19
Olympus SM-R endoscope / borescope adaptor for OM/ £39
Olympus Stylus (Mju for US), 35mm f3.5 AF, VGC case .£29
Olympus T32 flash, good condition, no cracks, working .£29
Paterson High Speed Print Washer, up to 16x12, boxed .£15
Pentaflex SL, variant of Praktica Nova + lens SALE . . . .£25
Pentax 67 waist level finder, later type, good used cond .£39
Pentax K 28mm f2.8 SMCPentax -M lens, VGC . . . . . .£29
Pentax K mount 24mm f2.8m Tokina RMC lens, VGC . .£39
Pentax K mount 80-200mm f4.5 Pentax SMC-M zoom . .£49
Pentax K1000 body,chrome, ding on base, good user . .£25
Pentax KA 70-210mm f4-5.6 Sigma UC zoom nr mint . .£35
Pentax KM + 50mm f1.7 SMC-M lens, VGC . . . . . . . . .£69
Pentax M42 135mm f3.5 SMC Takumar, case, hood . . .£29
Pentax M42 200mm f4 Super Takumar, VGC, caps . . . .£59
Pentax M42 28mm f3.5 SMC Takumar, nr mint, case . . .£39
Pentax M42 35mm f3.5 Super Takumar good condition .£20
Pentax MX, chrome +50mm f1.7 SMC-M, VGC . . . . . . .£69
Pentax PK-A fit Teleplus MC4 2X converter, mint, caps . .£20
Pentax Program A, black, in VGC + 50mm f1.7 SMC-A .£69
Pentax SP1000, chr.+ 55mm f2 SMC, lovely, cased . . . .£59
Praktica BX20, with 35-70 MC Pentacon nr mint . . . . . . .£29
Ricoh KR10, black, with 50mm f2 Rikenon XR VGC . . . .£35
Rollei 6000 / SLX series 50mm f4 HFT Distagon lens . .£299
Rollei 6006 MK2, with WLF, 120 back, 80mm f2.8 lens .£449
Rolleicord V, 75mm f3.5 Xenar /Synchro Compur vgc . . .£89
Rolleiflex QBM 28mm f2.8 Rolleinar MC lens, VGC . . . .£49
Rolleiflex SL35E, black + 50mm f1.8 HFT Planar VGC . .£79
Samsung NV7, 7.2 megapix, schneider 7x lens, boxed £129
Slik SL67 Prototype QR tripod + head, nr mint, cased . .£49
Sunpak Auto 4205G Thyristor Hammerhead flash, VGC .£29
Super Frankarette 35mm CRF, 45mm f2.8 Xenar lovely .£39
Tamron Adaptall 2 28-50mm f3.5-4.5, model 07A, mint .£29
Tamron Adaptall 2 24-48mm f3.5-3.8 SP model 13A . . . .£69
Tamron Adaptall 2 35-70mm f3.5 nr mint boxed . . . . . . .£25
Tamron Adaptall Mount for M42 screw lenses . . . . . . . . .£19
Tripod: HamaOmega Premium III, pro quality . . . . . . . . .£49
Voigtlander Bessa 6x9, f4 Voigtar in Compur, usable . . .£29
Voigtlander Bessamatic + Color Skopar X 2.8 not wkg . .£25
Voigtlander Bessamatic fit 135mm f4 Super Dynarex . . .£49
Voigtlander Bessamatic fit 35mm f3.4 Skoparex lens . . .£49
Voigtlander Prominent fit 100mm f4.5 Dynaron lens VGC£89
Voigtlander Prominent fit 35mm f3.5 Skoparon lens VGC .£119
Voigtlander Superb, TLR, Skopar, Compur mirror poor . .£79
Voigtlander Vito B, 50mm f3.5 Color Skopar VGC . . . . . .£29
Voigtlander Vito BL, bright line f2.8 Color Skopar VGC . .£39
Voigtlander Vitomatic II, CRF, meter, 2.8 Color Skopar l .£35
Watkins Bee Meter, very nice, box, paperwork . . . . . . . .£25
Weston Master II meter, VGC cased . . . . . . . . . . . . . . . .£25
Wynnes Infallible Actinometer, pocket watch style . . . . . .£19
Yahica DSB 135mm f2.8 lens, VGC overall, caps . . . . . .£25
Yashica 28-80mm f3.8-4.8 DSB lens, super condition . . .£35
Yashica 635 35mm kit, complete except finder mask . . .£19
Yashica FX-103 Prog. body, blk, boxed, leather peeling .£39
Yashica J Reflex 35, with 5cm f2 Yashinon (M42 SLR) . .£29
Zeiss Ikon 28.5mm push on Proxar set, 4 lenses cased .£19
Zeiss Ikon Contax IIIa, b/d + f1.5 Opton Sonnar T case £259
Zeiss Ikon Contina 1C, 45mm f2.8 Pantar, B/L finder . . .£19
Zeiss Ikon Contina Matic III, scarce model nr mint . . . . .£39
Zeiss Ikon Icarette 500/2, Convertible: 6x9 on 120 or plates,
10.5cm 4.5 tessar, Dial Compur, case, slides, screen . . .£49
Zeiss Ikon Icarex 35S + 50mm f2.8 Tessar, as seen . . . .£49
Zeiss Ikon Icarex 35S + 50mm f2.8 Tessar, serviced . . . .£99
Zeiss Ikon Ikonta 520, 16 on, f3.5 Tessar, V nice . . . . . . .£49

WEBSITE www.collectablecameras.com UPDATED REGULARLY
Insured P&P most cameras £9. Smaller items from £2.

MILL HOUSE. BARMBY ON THE MARSH.
EAST YORKSHIRE. DN14 7HQ
Tel: 01757 638649 (9am-9pm) Fax: 01757 630835
Mobile: 07970 630287
Email: sales@collectablecameras.com

Mail order specialists. Showroom open by appointment
subscribe 0845 676 7778

(LONDON) LTD
Telephone: 020 7242 7182
Fax: 020 7831 8082
www.yorkcameras.co.uk

USED BARGAINS
CANON EOS DIGITAL SYSTEM
1DS MKII Body Box ............................Mint- £1990
1DS MKII Body Box ..........................Exc++ £1699
1DS MKII Body ....................................Exc+ £1499
1DS MKI Body......................................Exc++ £999
1D MKII Body ......................................Exc+ £1299
1D MKI Body........................................Exc++ £599
5D MKII Body ......................................Mint £1699
5D MKI Box..........................................Exc++ £979
5D MK1 Box ........................................Exc++ £949
20D Body................................................Exc+ £249
30D Body Box ........................................Mint- £399
30D Body Box ......................................Exc++ £349
300D + EF 28-90....................................Exc++ £27
400D + EFS 18.55mm II ......................Exc++ £379
580 EX MKI Case ..................................Mint- £279
580 EX MKI Case ..................................Mint- £279
BG-E2 Box ..............................................Mint- £99
BG-ED3..................................................Exc++ £89
BG-ED3 (10D)..........................................Exc+ £79
BG-E3 (350/400D) Box ............................Mint- £89
BG-E4 Box ............................................Mint- £159
4CD Body ..............................................Mint- £499
Ansmann C-400 Box................................MInt- £69
550 EX....................................................Mint- £249
220 EX......................................................Mint- £99
EOS FILM SYSTEM
EOS1 + E1 Booster....................................Exc £99
EOS 5 body ....................................exc++ £129.00
EOS 5 body ....................................exc++ £119.00
EOS A2E body ..................................exc++ £99.00
EOS 10 body ....................................exc++ £60.00
EOS 30 Date body ............................mint £179.00
EOS 50E f28-90mm ........................exc++ £179.00
EOS 50E body ................................exc++ £129.00
EOS 100 body ..................................exc++ £49.00
EOS 300 V body ..................................mint £99.00
EOS 300 V+EF35-80 box ..................mint £169.00
Powerbooster E1 ....................exc++ £79.00/89.00
Powerbooster E2 ............................exc++ £125.00
NP-E2 battery ..............................................£49.00
420EZ Speedlite ................................exc++ £65.00
Sigma 500mm f7.2 + case ....................Exc+ £199
Sigma 28-200mm DG + Hood ................Mint £199
CANON 'L' SERIES
EF 20-35mm f2.8L ..............................Exc++ £550
EF 28-70mm f2.8L L/H Box..................Exc++ £699
EF 35-350mm f3.5/5.6L + Hood..........Exc £799.00
EF 70-300mm f4.5/5.6 DO IS ..............Exc++ £799
EF 70-200mm f4L Box ......................MInt £449.00
EF 70-200mm f2.8 L Hood ................Mint £899.00
EF 70-300mm DO IS USM Box ..............Mint £899
EF 85mm f1.2 L MkII Hood ............MInt- £1499.00
EF 85mm f1.2 L Mk1 Hood ....................Mint- £999
EF 1.4x Extender Mk2............................Mint- £260
EF 1.4x Extender MkII Box......................Mint £279
CANON EF/EFS LENSES
EFS 17-85mm IS USM + Hood............Exc++ £289
EFS 17-85mm IS USM + Hood............Exc++ £299
EF 24-85mm f3.5/4.5 USM......................Mint £230
EF 12mm Tube ..........................................Exc £45
EF 24mm f2.8 Box ............................Mint- £289.00
EF 28mm f2.8 ....................................Mint £159.00
EF 100mm f2.8 Macro + Hood ..........MInt £429.00
EF 28-200mm USM ..........................Mint- £245.00
EF 70-300mm IS USM + Hood ..........Mint £369.00
EF 75-300mm MKIII Box ..................MInt- £149.00
EF 75-300mm f4/5.6 ........................Exc++ £99.00
EF 90-300mm f4.5/5.6 Box ..............Mint- £139.00
EF 100-300mm f4.5/5.6 USM ..........Mint- £149.00
EF 100mm f2.8 Macro ............................Mint £379
EF 24mm f2.8 + Hood..........................Exc++ £249
EF 28-105mmm f3.5/4.5 + Hood USM....Mint £169
EF 35mm f2 + Hood ............................Exc++ £219
EFS 17-85 IS + Hood + Filter ................Mint- £299
EF 20mm f2.8 + Hood Box ....................Mint- £399
SIGMA LENSES
10-20mm DC EX f4/5.6 ..........................Mint £349
17-35mm f2.8/4 DG EX..........................Mint- £289
18-50mm f2.8 DC Box ............................Mint £269
50-500mm f4/6.3 APO HSM....................Mint £599
SIGMA EX SYSTEM
10-20mm f4/5-6 HSM + Hood ..................Mint £49
17-35mm f2.8 4 HSM + Hood ................Mint-£289
50-500mm f4/6.3 APO HSM....................Mint £599
35MM COMPACT SYSTEM
Konica Hexar..........................................Mint- £399
Sea & Sea Motor Marine........................Exc+ £150
Minolta Riva 160 ....................................Exc++ £99
Samsung 115G ........................................Mint- £45
Ricoh FF1 ................................................Exc+ £59
Canonet 28 ..............................................Mint- £89
XA + A16 ................................................Mint- £169
XA ............................................................Exc+ £79
TOKINA
19-35mm f3.5/4.5 ..............................mint £199.00
MINOLTA SCANNER
Scanner with 16mm, Imps, 35mm 6x6, 6x4.5, 65.7
Film Carrier, SCS Circuit Board ..........Exc++ £499
CANON FD SYSTEM
F1N AE Body ....................................Exc+ £229.00
T90 Body ..........................................Exc+ £199.00
F1 Body ..........................................Exc++ £249.00
A1 + 50mm f1.8 FD ......................Exc+ £175/£179
A1 + 50mm f1.4 FD..............................Exc++ £249
AE1-P + 50mm f1.8 + Hood ..............Mint- £159.00
AE1 + 50mm f1.8 ..............................Exc+ £139.00
AE1 + 50mm f1.8 BL ......................Exc++ £119.00

FTB + 50mm f1.8 ..............................Exc+ £149.00
FTQL + 50mm f1.8 FL ....................Exc++ £199.00
TLB + 50mm f1.8 ..............................Mint- £199.00
F1 Speed Finder + case ................Exc++ £129.00
FN Waist Level Finder Box ................Mint £149.00
FN Winder ....................................Exc++ £49/69.00
T90 Case ............................................Mint- £25.00
300TL Speedlite ................................Exc++ £69.00
199A Speedlite ....................................Mint- £99.00
188A Speedlite ....................................Exc+ £35.00
177A Speedlite ..................................Exc++ £39.00
155A Speedlite ..................................Exc++ £39.00
244T Speedlite ..................................Exc+ £30.00
CANON FD ZOOM SYSTEM
FD 24-35mm f3.5 SSC B/L ............Exc++ £299.00
FD 35-105mm f3.5 Macro ..............Exc++ £149.00
FD 50-300mm f4.5L ........................Mint- £1499.00
FD Tokina 70-210mm f4/5.6................Exc+ £45.00
FD Kiron 70-210mm f4.5 ......................Exc £29.00
FD 75-200mm f4.5 Macro ................Exc++ £99.00
FD Soligor 70-220mm f3.5................Exc++ £99.00
FD Vivitar 70-300mm f4.2/5.8 ..........Exc++ £39.00
FD Tamron 80-200mm f3.8/4 ............Exc++ £45.00
FD 100-200mm f5.6 SC ......................Mint £69.00
FD 100-300mm f5.6 D ......................Mint- £179.00
CANON FD PRIME SYSTEM
FD 7.5mm f5.6 fisheye + box ............mint £799.00
FD 15mm f2.8 fisheye ......................mint- £475.00
FD 24mm f2.8 + filter ......................exc++ £129.00
FD 24mm f2.8 + box ........................mint- £149.00
FD 28mm F2 ......................................Exc £149.00
FD 28mm f2.8 + filter ........................exc++ £49.00
FD 28mm f2.8......................................mint- £55.00
FD 28mm f2.8......................................mint- £59.00
FD 28mm f2.8 + box ............................mint £99.00
FD 35mm Tilt+Shift f2.8 B/L
+ hood + box..................................as new £899.00
FD 35mm Tilt+Shift f2.8 B/Lock ......exc++ £499.00
FD 50mm f1.8 + box........................NEW !! £99.00
FD 50mm f3.5 MACRO + box ..........mint- £149.00
FD 85mm f1.8 ................................Exc++ £149.00
FD 85mm f1.8 + box ..........................mint £249.00
FD 100mm f2.8....................................mint- £99.00
FD 100mm f2.8..................................exc++ £89.00
FD 100mm f2.8....................................exc+ £75.00
FD 100mm f2.8 + box........................mint- £119.00
FD 135mm f2.8 + box ........................mint- £99.00
FD 135mm f3.5....................................exc+ £39.00
FD 200mm f2.8 + box ........................mint £299.00
FD 200mm f2.8 Mk1..........................Exc+ £129.00
FD 200mm f4 ........................................exc £49.00
FD 300mm f4 + tripod clamp ..........exc++ £299.00
FD 300mm f4 + box ......................as new £399.00
FD 400mm f4.5 + tripod clamp..........mint- £799.00
FD 500mm f8 Mirror + hood ..............exc+ £179.00
FD 1.4xA type A extender + case + box ....mint- £249.00
FD 2xA extender ..........................................£49.00
FD 2xA extender ..........................................£79.00
FD 2xB extender + case + box ..........mint £199.00
EXACTA
EXA 1A 450mm f2.8............................Exc+ £49.00
MAMIYA 6X6
C330 Professionals
Sekor 80mm f2.8 Lens ........................Exc++ £399
Sekor 55mm f4.5 ............................Exc++ £199.00
Sekor 250mm f6.3 ..........................Exc++ £199.00
or Body + 3 lenses ..........................Exc++ £599.00
HASSELBLAD SYSTEM
500 ELM Black Body, A12 Back, Snood Finder,
80mm Planar T Star f2.8......................Exc++ £899
Distagon T Star 40mm f4 ....................Exc++ £899
Distagon T-Star 50mm f4 ....................Exc++ £499
Sonnar T Star 50mm f4........................Exc++ £499
Extension Tube No16 ..............................Exc+ £40
Extension Tube No32 ................................Exc £50
Grip Flash Bracket ................................Exc++ £79
A12 Back Box ........................................Mint- £199
LIGHT BOX
47cm x 14cm ....................................................£39
50cm x 33cm ....................................................£79
CONTAX G SYSTEM
G1 + 40mm f2 + Hood ..........................Mint- £399
G2 Body ..............................................Exc++ £349
G2 + 35-70mm + TLA-200 ..................Exc++ £799
35mm f2 Planar T Hood ..........................Mint £199
GH-B..................................................................£20
B2 46mm 82A....................................................£30
TRIPOD
Manfrotto 074 Tripod
141 RC Head ..................................Exc++
NIKON AF SYSTEM
D200 Body Box ......................................Mint- £499
F5 Body................................................Exc++ £399
F4S Body..................................................Exc £279
F80 Body Box............................................Mint £99
F601 Body ..................................................Exc £69
AFS 17-55mm f2.8-G Box ......................Mint £769
AF 18-35mm f3.5/4.5 D + Hood ..........Exc++ £349
AFS 18-200mm GVR Box ......................Mint £449
AF 35-135mm f3.5/4.5..............................Exc £129
AF 75-240mm f4.5/5.6 D + Hood ............Mint- £99
Sigma AF 100-300mm f4 APO HSM....Exc++ £699
SB-28 Speedlite ..................................Exc++ £129
MB-16 Battery Grip....................................Mint £49
MB-10 Battery Grip....................................Mint £49
MF-22 Databack Box ........................................£££

£299

NIKON MF SYSTEM
F3H P + MD Body ..................................Exc+ £349
MF3A Black Body Box............................Mint- £449
FM2N Chrome Body ............................Exc++ £249
FM2N Black Body ..................................Exc+ £169
FM2N chrome + 50mmm f1.4 AIS..........Mint- £399
FM Chrome + 50mm f1.8 AI ................Exc++ £299
FG + 35-105mm f3.5/4.5 AIS ......................VG £79
Nikkormat FT2 + 50mm f2 ..................Exc++ £199
Speedlite SB27 ......................................Mint- £159
SC-17 Multiflash Sync Lead ......................Mint £29
CFV-27D Case Base................................MInt- £25
SB-29 Ring Flash ..................................Exc+ £179
PK-13 Tube Box ........................................Mint £49
DR-3 Right Angle Finder ..........................Mint £99
Dioptre-1.3 FE/FM/FA Series ....................Mint £25
Nikkor 24mm f2.8 AI............................Exc ++ £329
Nikkor 50mm f1.4 AIS ............................Mint- £299
Nikkor 50mm f1.8 AIS ............................Exc++ £79
Nikkor 85mm f2 AIS ................................Mint £299
Nikkor 43-86mm f3.5................................Mint- £99
ARSAT H Perspective Control 35mm f2.8 Shift
Lens......................................................Exc++ £125
Cosiva 28-80mmm f3.5/5.6 AIS ................Mint £60
Vivitar 100mm f3.5 Macro ........................Mint- £89
HN-23 Hood Box ......................................Mint- £19
AS-17 Flashshoe....................................Exc++ £99
OLYMPUS SYSTEM
OM1N Body............................................Exc+ £149
OM2N Body............................................Exc+ £169
OM4 (black) body ............................exc++ £199.00
OM2N body ....................................exc++ £199.00
OM2N body ....................................exc++ £199.00
OM10+50mm f1.8 Zuiko ..................exc++ £119.00
Olympus Winder 2................................mint £99.00
Olympus Winder 2 ............................exc++ £70.00
Zuiko 28mm f2.8................................exc++ £79.00
Zuiko 28mm f2.8................................exc++ £79.00
Zuiko 50mm f1.4 ..................................mint £89.00
Zuiko 110mm 100mm ............................Exc+ £199
Zuiko 300mm f4.5 box+case ..............mint £399.00
OM 2XA Teleconverter ......................exc++ £99.00
Sigma 28-70mm f3.5/4.5 ..................exc++ £65.00
Tokina 70-150mm f3.8 ......................exc++ £25.00
Zuiko 75-150 f4+case......................exc++ £199.00
Zuiko 70-150mm f4 ............................Exc+ £99.00
Vivitar 28-200mm f3.5/5.6 ................exc++ £39.00
Tokina 70-210mm f4/5.6....................exc++ £69.00
Zuiko 85-250mm f5..........................exc++ £175.00
Sigma 75-300mm f4.5/5.6 ................exc++ £50.00
Olympus shoe 4 from ......................£15.00-£25.00
Olympus type 3 shoe....................................£15.00
Olympus 49mm polariser ............................£10.00
Olympus body cap........................................£10.00
OM extension tube 7 box ....................mint £39.00
PENTAX PK SERIES
ME Super+50mm f1.7 case ............exc++ £179.00
MZ-M+35-80m f4..................................mint £99.00
Vivitar V3000S+50mm f1.7 ..................mint £99.00
SMC-M 28mm f2.8 ............................exc++ £89.00
Takumar 28mm f2.8 ..........................exc++ £50.00
SMC-M 40mm f2.8 (pancake) ............mint £150.00
SMC-M 120mm f2.8 ..........................mint £275.00
SMC-M 200mm f.4 ..............................mint £89.00
Pentax-A 28-80mm f3.5/4.5..................exc++ £125
Vivitar 28-70mm f3.5/4.8A ................exc++ £39.00
Tokina 35-200mm f3.5/4.5 ................exc++ £49.00
SMC-M 80-200mm f4.5 ......................mint £149.00
SMC-M 80-200mm f4.5 ......................mint £125.00
Sigma EF 430S+Speedlite ..................mint £59.00
Winder MkII ......................................exc++ £39.00
Magnifier S+case ..............................exc++ £49.00
Anglefinder + case................................mint £99.00
PENTAX M42 SERIES
SP500+55 f2+case ..........................exc++ £179.00
Travenar 50mm f2.8 ..........................exc++ £69.00
Vivitar Teleconverter 3x ........................mint £19.00
SP Spotmatic + 55mm f1.8 + case Exc++ £179.00
Super-Takumar 200mm f4 Lens Hood
& case ..............................................Exc++ £89.00
MIRANDA 35MM SYSTEM
Miranda Sensomat RE + 50mm f1.9
+bellows + case ..............................mint- £169.00
Miranda F + 50mm f1.9 + case ........mint- £199.00
Miranda Fv + Meter Head T
+ 50mm f1.9 + case ........................mint- £199.00
Miranda Extension Tubes + box........exc++ £45.00
Miranda Chest Level Finder Type 1 + box..exc++ £89.00
YASHICA 35MM FILM
FX-2+50mm f2 ................................exc++ £149.00
ML 200mm f4......................................mint £125.00
ML 42-75mm f3.5/4.5..........................mint £120.00
ML 28-50mm f3.5................................mint £299.00
ML 80-200mm f4 ..................................mint £99.00
EXPOSURE METER
Lunasix-F box ....................................mint £129.00
Lunasix 3 + case ............................exc++ £149.00
Gossen Tele unit + case ......................mint £79.00
LEITZ
Summicron-R 35mm f2....................exc++ £349.00
Winklesucher box ................................mint £99.00
Elmarit-R 180mm f2.8......................exc++ £279.00
Mini Lux 40mm Summarit ..................Mint £199.00
Elmarit-R 135mm f2.8 ........................Exc £169.00
Summicron-12 35mm f2....................Exc+ £349.00
MAMIYA 6X6
C350 P + 80mm f2.8............................Exc++ £399
Sekor 55mm f4.5..................................Exc++ £199
Sekor 250mm f6.3................................Exc++ £199

18 Bury Place, London WC1A 2JL
opposite the British Museum
Mastercard/Visa accepted E. & O.E. Next Day Delivery £10.00
2 January 2010 | www.amateurphotographer.co.uk | 85

www.storemags.com & www.fantamag.com

Campkins
CAMERA

CENTRE

11 Rose Crescent,
Cambridge CB2 3LP

PART-EXCHANGE STILL POSSIBLE
LEICA R
35-70/3.5 Japan......................£330
28-70 3.5/4.5 ..........................£450
35/2.8 R ..................................£399
135/2.8 R ................................£250
180/f4 R ..................................£330
180/3.4 APO ..........................£500
35mm f1.4 Summilux R ........£1200
80mm f1.4 Summilux R ........£1200
28mm f2.8 Elmarit R ..............£300
LEICA M LENSES
28/2.8 Elmarit M......................£740
50/f2 Summicorne M ..............£659
50/f2.8 Collapsable M ............£359
90/2.8 Elmarit..........................£320
135/f4 Tele Elmar ....................£480
135/f2.8 Elmarit M ..................£499
Bellows 2 inc Viso 2 ..............£199
Leica M8 Black boxed ........£2250
CANON FD LENSES + ACCESS
Canon 70-210/F4 FD ................£80
Canon 28/2.8 FD ......................£50
Canon 35-105/3.5 FD ............£125
Canon 35-75/3.5/4.5 FD............£65
Canon 135/2.8 FD ....................£65
Canon 100-200/5.6 FD..............£75
Canon 50-135/F3.5 FD..............£99
Canon 135/3.5 FD ....................£39
Canon 50/F1.4 FD ....................£89
Canon 400/4 FD ....................£389
Canon FL 50/F1.4 ....................£99
Canon fit set of 3 extn tubes ....£35
Canon fit 75-300 Sigma FD ......£50
Canon fit 75-205/3.5 Soligor FD ......£35

LATEST FILM SLR’S
Olympus OM2N + f1.8 ..........£110
Min Dynax 40 + 28/80 ..............£79
Olympus OM25P F1.8 ............£149
Minolta X700 + F1.7 ..............£149
EXA 500, 2.8 Iscotar ................£50
Fuji ST60N, F2.2........................£79
Canon E05 30 b/w..................£275
Canon E05 50E b/w ..................£85
Minolta SRT1016 F1.4/50 ......£150
Canon FT GL +F1.8/50 ............£90
Olympus OM10 +F1.8/50 ........£60
Minolta X300 +35/70 MO..........£99
Cosika CS2 +F1.7/50................£60
Pentax Prog A +F2/50A..........£120
Minolta XGM +F1.7/50 ..............£80
Canon T50 +F1.8/50 ................£50
Pentax MZ7 +28-80 ..................£89
Minolta XE7 +F1.4/50 ............£150
Canon A1 +F1.8/50 ................£140
Olympus OM250 +F1.8/50 ....£140

F2 Prof +43-86........................£375
F5 +35-70/F28 ........................£550
F90X +35-80 AF ....................£190
28-105 F3.5/4.5 AFD ..............£175
24-50 F3.3/45 AF ....................£170
55-200 DX AFD ......................£129
300/F4.5 N/AIS........................£270
135/F2 N/AI ........................£440
35/2.8 NAIS ........................£100
105/F1.8 Nikkon A15 ..........£379
75-300 F4.5/5.6 NAF ..........£229
105/2.8 Macro AIS ..............£150
28-85 35/4.5 AIS ................£150
18-200mm VR ED IF............£399
80-200mm f4 AIS ................£130
FE2 chr b/o..........................£200
18-70 AFS DX ..................£169.99
28/f1.8 Sigma D-AF ............£150
FM2 Black b/o ....................£200

LEICA SCREW ITEMS
3G +F2/50 Summicron ........£1299
3F RD DA Black ....................£399
3F RD F2/50............................£399
2 Chrome b/w ........................£299
2F RD F2/50............................£399
50/F2.8 Elmar..........................£275
90/F4 Chrome ........................£190
90/F4 Black ............................£120
IUFOO low hood ......................£70
5cm Xbook v/f ........................£100

STOCK AVAILABILITY
Canon EOS 7D
Canon EOS 5D Mk 2
Nikon D700
Nikon D300S (sugar)
Nikon D300
Nikon D5000/D3000
AFS ;18-200 Mk2
AFS DV 35f1/9 G
AFS 85/3.5 GVR
AFS 24-70/2.8
AFS 14-24 2.8G
as of December 11/2009

NIKON LATEST SELECTION
F100 +28-70 AFD ..................£450

LOOKING FOR ITEMS? WRITE/FAX ‘E’ YOUR REQUIREMENTS

Post & Packing add £6 extra — Prices include 15% VAT
Callers welcome Mon-Sat 8.45am to 5.30pm. - Fax line 24 hours

Tel: 01223 364223

86

Fax 01223 313852 www.campkinsonline.co.uk
You can Skype us
username: campkinscameras
11 Rose Crescent,
Cambridge CB2 3LP

| www.amateurphotographer.co.uk | 2 January 2010

www.storemags.com & www.fantamag.com

subscribe 0845 676 7778

020 3148 2929 Classified
Cameras for Sale

Accessories

COMMERCIAL CAMERAS
SUPPLIERS OF QUALITY NEW AND PRE-OWNED EQUIPMENT
AS AT 11-12-09
LEICA M WANTED- MINT LEICA OUTFITS. OLD OR NEW
Leica M8 Silver chrome body New 01/09 ..............Mint boxed £1,895
Leica 135mm f3.5 APO-Telyt M. 6 bit con ............Mint boxed £1,395
Leica Filters 39-55mm selection ....................Mint boxed Please call
Leica 90mm f2.5 Summarit latest (new unused)..........................£820
Leica 13.5cm Hektor lens. Used (screw fit)....................................£75

MAMIYA
645 AF body + 120/220 back ..................................Mint- boxed £349
Mamiya Macro MF 120mm f4 (645 AF) ....................Mint boxed £895
Mamiya 7 body boxed ......................................................Exc++ £375
Mamiya 7 65mm f4L lens ....................................................Mint- £425
Mamiya 7 210mm lens plus viewfinder ........................................£525
Mamiya 645 Pro TL body ..........................................Mint/boxed £225
Mamiya AE Prism Type FE401 ..................................Mint boxed £95
NIKON. WANTED. PLEASE ASK US TO QUOTE YOU
Mamiya Power Drive. WG401 ....................................Mint boxed £70
Rare. Unused Brand new SP 2005 edition kit/35mm f1.8 ........£3,495 Mamiya 120 Filmback..................................................Mint/boxed £95
Nikon 8000 ED Scanner (35mm-6x9cm) 4000dpi ............Boxed £920 Mamiya 35mm f3.5N Lens ........................................Mint/boxed £249
Nikon 17-55mm f2.8 AF-S. New unused. One only ....................£795 Mamiya 80mm Macro F4N + tube ............................Mint/boxed £214
Nikon 80-400mm VR Brand new One only ..................................£995
Nikon D2x outfit just arriving. 60/105 Macro, lots more ................Call LARGE FORMAT
Horseman 6x12cm back ..................................Near Mint boxed £290
Toyo 45 A II Field Camera ............................Mint- (new £1700) £875
PHASE ONE DIGITAL
Schneider 90mm f5.6 XL Super Angulon ............................Mint £890
P25 Digital back. Blad V fit inc case + acc’s ............................£2,700 Schneider 150mm 5.6 APO-Symmar ..................................Mint £420
HASSELBLAD DIGITAL. COMMERCIALCAMERAS.CO.UK
Please check our website for latest promotions and prices
H3D-39m complete. As new boxed, only 1,300 Actuations ..........Call
HCD-28mm f4 AF Lens ................................Near Mint boxed £2,150
HC-35mm f3.5 AF lens ..........................Near Mint boxed Please Call
CF Lens Adaptor for H.Cameras ......................Near Mint boxed £595
Rare Hasselblad Arc body outfit just arrived inc 35/45/75 lenses
RMX finder, extension tube CTR filter etc........................Mint- £6,750
NEW CFV-39mm back in stock for V system ..................Only £8,995

BRONICA RF
RF 645 c/w 65mm lens ....................................................Exc++ £495

ROLLEIFLEX SL66
Zeiss Distagon 50mm f4 ..................................................Exc++ £399
Zeiss Macro-Planar 120mm f5.6 ......................................Exc++ £395
Zeiss Sonnar 150mm f4 leaf shutter lens ..........................Mint- £449
Zeiss Sonnar 250mm f5.6 (Quite rare) ............................Exc++ £475
120 Filmback for SL66. Near Mint................................................£169
Rollei SL66 Extension tube set ............................................Mint- £85
Rollei Bay VI filters. Selection inc Infra red ......................Please Call
Rollei adators. SL66 to large format lenses ......................Please Call
V SYSTEM
503CW body c/w WLF. Black (1998) ......................Mint- boxed £795 Rollei left hand grip c/w Quick release ..........................................£85
Hasselblad Flex body (1996) ........................Near Mint boxed £1,295
Hasselblad 501 CM kit (2001) 80 CFE/A12 ..Near Mint boxed £1,295 MISC
Hasselblad 555 ELD c/w WLF (1999), chrome ..........Near Mint £749 Fuji GSW 690 III 65mm lens..................................Exc++/Boxed £590
Rolleiflex T grey boxed + case ....................................................£370
Hasselblad Winder CW ....................................................Exc++ £229 Gossen spot master II meter inc case ................................Mint- £249
Hasselblad D.Flash ..........................................................Exc++ £195 Metz 45 CL-4 N1-cad ..........................................................Mint- £170
Hasselblad Snap lock flash bracket ..................................Exc++ £115 Metz 3951/3000 C SCA for Mamiya 645........................................£60
Hasselblad HM2 Viewfinder ................................As new boxed £270
Hasselblad Prism Magnifier 42462 ..........................Latest Mint- £175 USED STUDIO FLASH
Elinchrom 500 Classic 3 head kit inc case etc ............................£495
New Bowens 250/250 Esprit Gemini kit ..............................Only £495
HASSELBLAD LENSES & ACC’S
40mm f4 CF FLE. Distagon ................................................Mint- £990
50mm f4 CFI FLE Distagon ................................................Mint- £995 CANON
Canon ML-3 Macro Ringlite ......................................Mint/boxed £120
60mm f3.5 CFI Distagon ........................................Mint/boxed £1,149
Canon EOS in camera. Unused! Boxed as new ..........................£225
60mm f3.5 CFI Distagon ..............................Exc++/Mint- Boxed £875
Canon E1 Power booster. Unused! boxed ....................................£69
120mm f4 CFI Makro-Planar ..................................Mint boxed £1,295 Canon 50mm f2.5 Macro EF lens ............................Mint- boxed £149
150mm f4 CF Sonnar ..............................................Exc++/Mint- £449 Canon Flash. 430EZ, 540EZ, 550EX in stock ..............................Call
250mm f5.6 CF Sonnar............................................Exc++/Mint- £439
250mm f5.6 CFI Sonnar ........................................Mint boxed £1,195 LAST BUT NOT LEAST
1.4 XE Teleconverter ..................................................Near Mint £320 Darkroom. Just arrived. inc Devere 504 bench, lenses, Nova
SCA 390 TTL Lead ........................................................................£49 Equipment, Beard Easel
Rare 905 SWC 38mm CFI/V/F ................................Near Mint £2,750
COMMERCIALCAMERAS.CO.UK
503 CX chrome body + WLF....................................Mint- boxed £490

Focalpoint has been established over 25 years in the
photo and optics trade. We have a wide selection in
our showroom - cameras, telescopes, binoculars,
tripods and many more. Over 1000 products
available online via our secure website
RICOH CX2

501CM COMPLETE 80MM CB with
A12 back mint condition, £1200. Phone
John 07814807801 Bucks
5 X 4 TOYO. MONORAIL. Equipment.
Fitted Box. Tel: 07816 841139. Kent
£225
CANON 50D BODY as new. used once.
£525. Unopened Canon LP-E6 battery
£50.
Illness
foreces
sale.
Tel
01476590683

MINOLTA DYNAX 9 body very good
condition, manual £300. Also Minolta AF
28-70mm F2.8 excellent condition £650.
Tel 01132842957

Items under £100
MINOLTAAF 28MM F2.8 £70, 50 mm
f1.7 £62, 3-200x1 £80. Pentax af 50mm
f1.7 £62 nikon AF 50mm f1.8 f8015
body unused from new £62 mostly
mint/boxed
plus
p+p
reading
01189790466

HASSELBLAD 100MM F3.5 Planar CF
lense. Near mint. £525ono Hasselblad
150mm F2.5 Planar CF lense. Near mint
£395ono. Other Hasselblad items also
available
Tel:
01619732718
or
07795203536

OMI LENS - 50MM/28MM/70-200.
500mm mirror lens F8. All under £100.
Tel: 01908316736 Steve Milton Keynes

HASSELBLAD AUTO BELLOWS kit +
comp/hood 60-adapter slide holder, extring, mint boxed £650 60 polar 70 polar
boxed £50 each. ext tube 16E boxed
£50 lots more 01708755462 (Essex)

FILTERS 49MM HOYA multi image
variable 2-8. Also 49mm Hoya variable
star burst 2-12. Also Cokin A series
barnish 08’ ‘oil painting’ and Cokin A
series mirage 220. Steve 01908316736

LEICAFLEX EARLY MODEL body self
timer not operational serviced £160.
Leica CL plus 40mm and 90mm lenses
strap excellent condition £660. Plus post
insurance Telephone 01733 252678
(Peterborough Stamford area)
subscribe 0845 676 7778

Wanted

Camera Fairs
CAMERA FAYRE MANCHESTER Sun
Jan 3rd, 11am. Shawe Hall Comm
Centre,
Church
Rd,
Flixton.
Tel:07979913156

PENTAX KX

NIKON D5000

INC 18-55 LENS

18-55 VR KIT

£299

£709

£749
SAVE: £50
RRP: £799

More info visit website

More info visit website

More info visit website

LEICA ULTRAVID

FAT GECKO

INTUOS A4

£1,320.74
SAVE: £169.26
RRP: £1490

£64.99
SAVE: £5
RRP: £69.99

£329
SAVE: £20
RRP: £349

More info visit website

More info visit website

More info visit website

8x32 HD

Finance available
Call us on: 01925 730399
www.fpoint.co.uk
2 January 2010 | www.amateurphotographer.co.uk | 87

www.storemags.com & www.fantamag.com

Classified 020 3148 2929
Accessories

Holidays & Courses

P h o t o g ra p h i c
Backgrounds
PLAIN
CLOUDED
8’ x 8’ .£15 8’ x 8’ .£27
8’ x 12’ £24 8’ x 12’ £44
PLUS P&P
8’ x 16’ £29
PLAIN 10 COLOURS INC BLACK, WHITE & CHROMA
CLOUDED 20 COLOURS. SPECIAL OFFER: 8X12 CLOUDEDS - 2 FOR £80 OR 3 FOR £115

Hard wearing

!
!

Low crease

!
!

Washable

01457 764140 for free colour brochure or visit

www.colourscape.co.uk
Black & White Processing

Internet Services

Camera Repairs

Develop and Contacts £5.50 each
2 or more films £4.50 each
Develop/5x7s @ £12 per roll
Develop/6x8s @ £18 per roll
10x8’s £4.20/12x16 £6.20
16x20’s £9 each
Digital prints from 4x4 to 18x12 from 40p each.
All prints on genuine photographic papers
Cheques & £2 P&P to:
Karl Howard, 16 Chalfont Close,
Hemel Hempstead, Hertfordshire, HP2 7JR
Tel: 01442 231993

PENTAX
Classic - Modern - Digital
PENTAX TRAINED TECHNICIANS
Free Estimates / Next Day Repairs
*WE SELL SPARE PARTS*
for discontinued and current cameras.
Speak to a technician Direct;
Tel: 020 8232 8111
Asahi Photo,
5 Albany Parade, High Street,
Brentford, Middlesex, TW8 0JW

REPAIRS

CAMERA

PROFESSIONAL B/W COLOUR AND DIGITAL PRINTING AND
PROCESSING AND PRINTING EST 25 YRS. ALL TYPES OF B/W
& COLOUR, C41, INFRA RED FILMS, 35M TO 5X4

www.asahiphoto.co.uk

Cine & Slide Projectors
CINE TRANSFERS TO DVD & VHS
CINE & SLIDE PROJECTORS
CINE CAMERAS
PROJECTOR LAMPS
PHOTOGRAPHIC LAMPS

LEE’S CAMERAS

Miscellaneous

To advertise here
please call
Ellie on
0203 148 2929

Tel: 020 8202 9918
Fax: 020 8203 6684
Email: sales@leescameras.demon.co.uk

Clubs & Events
3
its
in

ye
rd

ar

!

The

Photographer of the Year 2010
First Prize £1,000
Open to all talented photographers, amateur and professional.
Entries will be accepted from 1st December 2009
until 31 January 2010. Entry Fee: £20

No

w

To enter and for further information,
please visit www.erophoto.org
You can now buy The Erotic Review’s
Photographer
of the Year 2009 - The Book for £9.99 at

www.eroticprints.org
Printing
Cheshire Photo Lab
Traditional hand processing of 35mm / 120mm
B+W and Colour Films
B+W hand printing up to 20” x 16”
in traditional darkroom.
Colour or B+W inkjet printing
Slides and negatives scanned to CD

www.cheshirephotolab.co.uk
For full details of prices and services
Cheshire Photo Lab, PO Box 487, Crewe,
Cheshire, CW1 9FP

88

Specialist Services
SELL YOUR PHOTOS TO NATIONAL
NEWSPAPERS AND MAGAZINES.

Visit our website
www.sell-my-photo.co.uk
to find out how.
email: pix@cash4yourpix.co.uk
Or call 01603 765346

| www.amateurphotographer.co.uk | 2 January 2010

www.storemags.com & www.fantamag.com

Send with your remittance to: Amateur Photographer Classified Advertisement Department, Blue Fin Building, 110 Southwark Street, London, SE1 0SU

KAREN WILLSON BRISTOL, Superior
quality processing & printing. Tel: 01179
515671 www.kwfilmprocessing.co.uk

subscribe 0845 676 7778

www.storemags.com & www.fantamag.com

BVS4W\OZ4`O[S

@]US`6WQYa

3RWb]`WOZ

/[ObSc`>V]b]U`O^VS`7>1;SRWO0ZcS4W\0cWZRW\U 
A]cbVeO`YAb`SSb:]\R]\A3AC
BSZS^V]\S !"&"!&4Of !"&&!
3[OWZO[ObSc`^V]b]U`O^VS`.W^Q[SRWOQ][
>WQbc`S`Sbc`\a(BSZS^V]\S !"&" 
3[OWZO^^WQbc`SRSaY.W^Q[SRWOQ][

AcPaQ`W^bW]\a

… PONDERS THE WORTH OF MAKING
ANY NEW YEAR’S RESOLUTIONS

@=53@6719AWaO
[cQV^cPZWaVSROcbV]`
]\^V]b]U`O^Vg6S
VOae`WbbS\[]`SbVO\
bV`SSR]hS\P]]Ya]\
bVSacPXSQb[O\gW\
^O`b\S`aVW^eWbVVWaeWTS
4`O\QSaAQVcZbh@]US`
abO`bSR^V]b]U`O^VgOaO
bSS\OUS`W\bVS'$aO\R
e]`YSR^`]TSaaW]\OZZg
W\O:]\R]\ORdS`bWaW\U
abcRW]W\bVS[WR'%a
6SVOaPSS\OT`SSZO\QS
^V]b]U`O^VS`e`WbS`
aW\QS'&Q]\b`WPcbW\U
b][O\g^V]b]U`O^Vg
[OUOhW\SaW\QZcRW\U
·AVcbbS`PcU¸W\/[S`WQO
DWaWbVWaeSPaWbSObeee
`]US`O\RT`O\QSaQ][

B

,)YRI\EQMRIHPMJIEGGSVHMRKXS7SGVEXIWMWRSX[SVXLPMZMRK8LMW
QE]FIERI\EKKIVEXMSR8LIVIGIVXEMRP]WIIQXSFITPIRX]SJTISTPI
[LSVINSMGIMRPMZMRKXLIMVPMZIWMRTVIHIWXMREXIKVSSZIWVSPPMRKXVEQPMOI
JVSQFMVXLXSHIEXLLETT]GSRWYQIVWEXPIEWXEWPSRKEWXLI]KIX
XLIMVFVIEHERHGMVGYWIWERHÁXXIHOMXGLIRW
4LSXSKVETLIVW-WYWTIGXEVIPIWWMRGPMRIHXSFIPMOIXLEX;IEVI
QSVIPMOIP]XSFISRXLIWMHISJ7SGVEXIW2SXSRP]HS[IPMXIVEPP]
I\EQMRIPMJIXLVSYKLSYVZMI[ÁRHIVWFYX[IEVIEPWSMRGPMRIHXS
EKSRMWIJVSQXMQIXSXMQISZIV[LEX[IHS[L][IHSMXERH
MRHIIHEFSYXXLIIUYMTQIRX[IYWIXSHSMX
8LIRI[]IEVGERFIEWTIGMEPXMQIJSVEKSRMWMRKFIGEYWIMXMWXVEHMXMSREPP]XLI
XMQIJSV2I[=IEV¸WVIWSPYXMSRW%VI[IKSMRKXSTYXSYVWIPZIWMRLSGOMRSVHIVXS
FY]XLEXRI[GEQIVE[IVIEPP][ERX#3VEVI[IKSMRKXSKIXVMHSJEPPXLIKIEV[I
HSR¸XYWI#%VI[IKSMRKXSXV]XSQEOIXLEXXVMTSJEPMJIXMQISVWLSYPH[IJSPPS[
XLISJXVITIEXIHEHZMGIXLEXXLIFIWXTMGXYVIWEVIMRSYVS[RFEGO]EVHW#
8LIRXLIQSVI[IXLMROEFSYXMX³EWWYQMRK[IVIEPP]HSXLMROJSVSYVWIPZIW
VEXLIVXLERFIMRKFPS[RF]XLI[MRHWSJSXLIVW¸EHZMGISVF]ÂEWLIWSJ
EGUYMWMXMZIRIWWWTEVOIHF]XLIPEXIWXIUYMTQIRXVIZMI[W³XLIQSVI[IQE]
VIEPMWIXLEXEGXYEPP].IER4EYP7EVXVI[EWRSXXLITVIXIRXMSYWX[IVTLIWSQIXMQIW
WIIQIH)\MWXIRGILIWEMHTVIGIHIWIWWIRGI8LMWMWXLIGSVISJXLISJXHIVMHIH
TLMPSWSTL]SJI\MWXIRXMEPMWQ
-RSXLIV[SVHWI\MWXIRXMEPMWQWE]WXLEX[LEXLETTIRWLETTIRWERH[IXV]XS
QEOIWIRWISJMX3JXIRXLMWQEOIWEPSXQSVIWIRWIXLERXV]MRKXSÁXSYVPMZIW
EVSYRHEJVEQI[SVOSJTVIGSRGITXMSRW%JXIVEPP[ILEZIEPPQIXTISTPI[LS
[LIRGSRJVSRXIH[MXLEGSRÂMGXFIX[IIRVIEPMX]ERHTVIGSRGITXMSRTVIJIVXLI
TVIGSRGITXMSR6IEPMX]XLI]GSRGPYHIMWEXJEYPXSVXSFIQSVIKIRIVSYWVIEPMX]
LEWFIIRQMWVITSVXIHF]SXLIVWSVQMWYRHIVWXSSHF]XLIQWIPZIW8LII\MWXIRXMEPMWX
F]GSRXVEWXPSSOWEXVIEPMX]ERHXVMIWXSÁXLMW SVLIV PMJIEVSYRHMX
8LMWHSIWRSXLS[IZIVQIERXLEX[IWLSYPHIWGLI[EPPTPERWERH
TVIGSRGITXMSRWSVIZIR2I[=IEV¸WVIWSPYXMSRW-J[IHMH[I[SYPHLEZIRS
GSQTEWWXSKYMHIYW;IRIIHTPERWSXLIV[MWI[I[MPPKSRS[LIVIFYX[LEX
TPERWHS[IRIIHERHLS[SJXIRWLSYPH[IYTHEXIXLIQ#
8LMWMW[LIVI-WYKKIWX2I[=IEV¸WVIWSPYXMSRWGERGSQIMRLERH]8LIVIMW
RSVIEWSR[L]2I[=IEV¸WVIWSPYXMSRWWLSYPHFI[SVXLER]QSVIXLERER]SXLIV
VIWSPYXMSRQEHISRER]SXLIVHE]SJXLI]IEVFYXXLI]GERWLEOIYWSYXSJSYV
KVSSZIWERHVIQMRHYWXSI\EQMRISYVPMZIWQSVISJXIR4VSFEFP]XLIVIJSVIXLI
QSWXYWIJYP2I[=IEV¸WVIWSPYXMSRMWXSQEOIQSVIVIWSPYXMSRWERHXLMWMW[LEX
-¸QXLMROMRKSJHSMRK%XÁVWX-GSRWMHIVIHUYEVXIVP]FYXXLIR-XLSYKLX[L]RSX
QSRXLP]#8LIR-VIEPMWIH
-GSYPHQEOIXLIQ
QMHQSRXLEW[IPP
VIWSPYXMSRWE]IEV*VSQ
XLIVIMX[EWEWLSVX
WXITXS[IIOP]ERH
MRHIIHHEMP]
8LMWMWLS[IZIVVIWSPYXMSRSZIVPSEH*MVWXXLIVINYWXEVIR¸XIRSYKLMQTSVXERX
VIWSPYXMSRWXSKSVSYRHXLI]FIGSQIPSWXMRXLIFEGOKVSYRHRSMWISJHE]XSHE]
PMJI%PWSMX[SYPHFIUYMXIIEW]XSWTIRHWSQYGLXMQIJVEQMRKVIWSPYXMSRWXLEX
SRIHMHRSXLMRKIPWI8LMWMWXLISZIVI\EQMRIHPMJII\EQMRIHWSQYGLXLEXMXMWRSX
EGXYEPP]FIMRKPMZIH7STIVLETWUYEVXIVP]MWFIXXIVEJXIVEPP3VIZIREX2I[=IEV#
8LIREKEMR[LEXMJVIWSPYXMSRWRIIHXSFIQEHIEXSXLIVXMQIW#7YTTSWIXLIVI¸W
RSXLMRK[IIWTIGMEPP][ERXXSVIWSPZIEXXLI2I[=IEV#&YXWYTTSWI[IRIIHXS
QEOIEVIWSPYXMSRSRWE]%YKYWX#
8LMW-VIEPMWIH[EWXLIERW[IV+IXMRXSXLILEFMXSJQEOMRKVIWSPYXMSRWERH
WXMGOMRKXSXLIQFYXSRP][LIRXLI]EVIRIIHIH/RS[MRK[LIRXLI]EVIRIIHIH
MW[LIVII\MWXIRXMEPMWQGSQIWMRFIGEYWII\MWXIRXMEPMWQQIERWQEOMRKWIRWI
I\XVEGXMRKIWWIRGI JVSQGLESXMGVIEPMX] I\MWXIRGI (SR¸XQEOIVIWSPYXMSRWJSVXLI
WEOISJQEOMRKXLIQ XLI2I[=IEVXVET FIGEYWIXLI]QE]RSXFI[SVXLQYGL
ERHFIWMHIWXLI]EVIXSSIEWMP]FVSOIR&YXIUYEPP]HSR¸XEZSMHXLIQFIGEYWI
WSQIXMQIWXLI]¸VIRIIHIH8LIRQEOIXLIQERHXV]XSWXMGOF]XLIQ9RPIWW
]SY[ERXXSPMZIXLIYRI\EQMRIHPMJI/> 

5SbW\b]bVSVOPWb]T[OYW\U`Sa]ZcbW]\a
O\RabWQYW\Ub]bVS[Pcb]\ZgeVS\\SSRSR

'7eeeO[ObSc`^V]b]U`O^VS`Q]cY7 8O\cO`g 

www.storemags.com & www.fantamag.com

BSZS^V]\S&"#$%$%%%&

/RdS`bWaW\U

/[ObSc`>V]b]U`O^VS`7>1;SRWO0ZcS4W\0cWZRW\U
A]cbVeO`YAb`SSb:]\R]\A3ACBSZS^V]\S( !"& #%
3[OWZZSSM[]``Wa.W^Q[SRWOQ][
1ZOaaW¿SRbSZS^V]\S !"& ' '4Of( !"&&#&
2Wa^ZOgbSZS^V]\S !"& #%4Of( !"&&#&
7\aS`baQOZZ7\\]dOb]`]\ !"&!%

3RWb]`WOZbSO[

3RWb]`
3RWb]`¸a>/
/`b3RWb]`
>`]RcQbW]\3RWb]`
BSQV\WQOZ3RWb]`
<Sea3RWb]`
2S^cbg>`]RcQbW]\3RWb]`
2S^cbg/`b3RWb]`
4SObc`SaE`WbS`
2SaWU\S`
BSQV\WQOZE`WbS`
4SObc`SaE`WbS`
AcP3RWb]`
>V]b]AQWS\QS1]\acZbO\b
AbcRW];O\OUS`
>WQbc`S@SaSO`QVS`

2O[WS\2S[]ZRS`
1V`WabW\S:Og
;O`Y8OQ]Pa
:SaZSgC^b]\
/\USZO<WQV]Za]\
1V`Wa1VSSa[O\
0`SO\RO\;OUcW`S
AW[]\EO``S\
8STT;SgS`
/\b]\g5`SS\
@WQVO`RAWPZSg
5S[[O>ORZSg
=ZWdS`1]bb]\
5S]TT`Sg1`OeZSg
/ZO\;Q4ORS\
@]aWS0O``Obb

A^SQWOZbVO\Yab]

BVS[]RS`Ob]`a]TbVS/>eSPaWbS/\R`Se@]PS`ba]\
1V`Wa1]]Z2OdWR8EVWbS4S\`Wa=aeW\6S\`g@]US`aZWaORP
<WQY@]PS`ba@WQVO`R6O`ReWQYBVS4Ob1]\b`]ZZS`

/RdS`bWaW\UbSO[

5`]c^/RdS`bWaS[S\b;O\OUS` :SS;]``Wa
AS\W]`2Wa^ZOgAOZSa3fSQ
8cZWOA^S\QS`
AS\W]`2Wa^ZOgAOZSa3fSQ
AW[]\5S`O`R
2Wa^ZOgAOZSa3fSQcbWdS
@]PASZdSg
0caW\Saa2SdSZ]^[S\b;O\OUS` 2OdSAb]\S
1ZOaaW¿SRAOZSa;O\OUS`
0S\Bc`^Wbb
1ZOaaW¿SRAOZSa3fSQcbWdS
3ZZWSA[WbV
2Wa^ZOg/R>`]RcQbW]\
8]V\8]\Sa  

!"& #% 
!"& $!% 
!"& # 
' " %  
!"& #$ 
!"& ### 
!"& ' ' 
!"& $%

;O`YSbW\UO\R^`][]bW]\a

AS\W]`;O`YSbW\U;O\OUS` 3abSZZS6WQYa0S\\Sbb  !"&"! 
=\ZW\S;O\OUS`
9O`S\AVSO`R 
!"&"'"!
A>7/R[W\Wab`Ob]`
1VO`ZS\S0OYS` 
!"&"! $

>cPZWaVW\UbSO[

/RdS`bWaS[S\b2W`SQb]`1V`WaBS[^ZS[O\
5`]c^;OUOhW\Sa3RWb]` 5O``g1]eO`REWZZWO[a
>cPZWaVW\U2W`SQb]` /ZSf@]PP OZSfM`]PP.W^Q[SRWOQ][
;O\OUW\U2W`SQb]`
>OcZEWZZWO[a
/ZZQ]\b`WPcbW]\ab]/[ObSc`>V]b]U`O^VS`[cabPS]`WUW\OZ\]bQ]^WSa]`Rc^ZWQObSR
b]]bVS`^cPZWQObW]\aBVSSRWb]``SaS`dSabVS`WUVbb]aV]`bS\]`[]RWTgO\gZSbbS`]`
[ObS`WOZacP[WbbSR7>1;SRWO]`WbaOaa]QWObSRQ][^O\WSa`SaS`dSabVS`WUVbb]`ScaSO\g
acP[WaaW]\aS\bb]bVSZSbbS`aQ]Zc[\]T/[ObSc`>V]b]U`O^VS`[OUOhW\SW\O\gT]`[Ob
]`[SRWc[E63B63@>@7<B323:31B@=<71=@=B63@E7A3
/[ObSc`>V]b]U`O^VS`•WaO`SUWabS`SRb`ORS[O`Y]T7>1;SRWO–7>1;SRWO 
/[ObSc`>V]b]U`O^VS`W\Q]`^]`ObW\U>V]b]BSQV\W_cS1O[S`OESSYZg3[OWZ(
O[ObSc`^V]b]U`O^VS`.W^Q[SRWOQ][ESPaWbS(Vbb^(eeeO[ObSc`^V]b]U`O^VS`Q]cY
7>1AeWbQVP]O`RbSZ( !"&#/[ObSc`>V]b]U`O^VS`Wa^cPZWaVSReSSYZg]\bVS
BcSaROg^`SQSRW\UbVSQ]dS`RObSPg7>17<A>7@3^O`b]T7>1;SRWO5`]c^]T1][^O\WSa
2Wab`WPcbSRPg;O`YSbT]`QSC9:bR0ZcS4W\0cWZRW\UA]cbVeO`YAb`SSbA3=AC–
7>1;SRWO7AA< $&"–1]^g`WUVb7>1;SRWO:bR<]^O`b]TbVWa^cPZWQObW]\[Og
PS`S^`]RcQSRab]`SRW\O`Sb`WSdOZ]`b`O\a[WbbSRW\O\gT]`[Ob]`[SRWc[eVSbVS`
^`W\bSRSZSQb`]\WQ]`]bVS`eWaSeWbV]cbbVS^`W]`e`WbbS\^S`[WaaW]\]TbVS^cPZWaVS`
]`bVSSRWb]`BVWaWaQ]\aWRS`SROP`SOQV]TQ]^g`WUVbO\ROQbW]\eWZZPSbOYS\eVS`SbVWa
]QQc`aBVWa[OUOhW\S[cab\]bPSZS\ba]ZRVW`SR]`]bVS`eWaSRWa^]aSR]TW\O[cbWZObSR
Q]\RWbW]\]`W\O\gOcbV]`WaSRQ]dS`PgeOg]`Pgb`ORS]`O\\SfSRb]O\g^cPZWQObW]\
]`ORdS`bWaW\U[ObbS`eWbV]cb¿`ab]PbOW\W\Ue`WbbS\^S`[WaaW]\T`][bVS^cPZWaVS`7>1
;SRWO:bRR]Sa\]bOQQS^b`Sa^]\aWPWZWbgT]`Z]aa]`RO[OUSb]c\a]ZWQWbSR^V]b]U`O^VaO\R
[O\caQ`W^baO\R^`]RcQbaO[^ZSa7>1;SRWO`SaS`dSabVS`WUVbb]caSO\gacP[WaaW]\a
aS\bb]/[ObSc`>V]b]U`O^VS`;OUOhW\SW\O\gT]`[Ob]`[SRWc[W\QZcRW\USZSQb`]\WQ
CAOUS\b(;S`Qc`g7\bS`\ObW]\OZ!$#0ZOW`@]OR/dS\SZ<8%>S`W]RWQOZa^OWROb
@OVeOg<8>=AB;/AB3@(AS\RORR`SaaQVO\USab]/[ObSc`>V]b]U`O^VS`!$#0ZOW`@]OR
/dS\SZ<8%

www.storemags.com & www.fantamag.com

Sign up to vote on this title
UsefulNot useful