Dopamina Beta Hidroxilasa

Introducción: Generalidades. Reacción. Papel Biológico. Rol de la Norepinefrina como NT. Descubrimiento y Medida de su actividad. Ensayo Actividad en Humanos. Mecanismo de Catálisis. Estructura Aplicaciones

INTRODUCCIÓN
La Dopamina Beta Hidroxilasa (EC 1.14.17.1) es una enzima básica de la ruta de las catecolaminas.

Las catecolaminas son unas sustancias químicas que se conocen así por la existencia de un grupo catecol (dihidroxifenol) unido a un grupo amino. Actúan de 2 formas: Neurotransmisor, colaborando en la transmisión sináptica. Hormona, regulando la fisiología corporal.

La reacción se hace en presencia de FUMARATO Y requiere de Cu2+ para su desarrollo.

Papel Biológico

Esta enzima está presente en numerosas especies, de las cuales destacamos 2 para este trabajo: Homo sapiens y Bos Taurus.

Se localiza en diferentes tejidos.

Como NT se sintetiza en el soma de neuronas noradrenérgicas del “Locus Coeruleus” del Tronco Encefálico. Secreción Regulada.

Como Hormona se sintetiza en las células cromafines de la médula suprarrenal y de ahí se vierten al torrente sanguíneo.

Norepinefrina como NeuroTransmisor
A CONTINUACIÓN SE VERÁN UNA SERIE DE VÍDEOS QUE NOS EXPLICAN CÓMO, DONDE Y CÓMO ACTÚA LA NOREPINEFRINA

Descubrimiento y Medida de su Actividad

Descubrimiento y Medida de su Actividad

A partir de una hipótesis sobre la existencia de una enzima que regulase la creación de la dopamina como parte de la cadena de las catecolaminas, los investigadores decidieron realizar un ensayo buscando simplemente la demostración de la aparición del producto como prueba de la existencia de la enzima. DOPA+O2+Ascorbato= NOR+DHascorbato+H2O Crearon una mezcla inicial en la que figuraban los siguientes componentes:

1.Tampón de Fosfato Potásico con un pH de 6,4 y en una concentración de 100μM. 2.Ácido Ascórbico (6μM). 3.Ácido Fumárico (10μM). 4.ATP (12,5 μM) 5.Dopamina con un isótopo de C14, lo cual, provocaría que se mostrase dicho átomo en la norepinefrina formada. (1μM). 6.Glucosa Deshidrogenasa hasta completar el volumen para facilitar la reacción. 7.(1-metil-2-fenil)etilhidrazina hidroclorida (1,3E-2 μM)
El volumen final de este preparado era de 0,68 mL, tras la adición de extracto de médula adrenal de Bos Taurus dicho volumen fue incubado a 35ºC mientras se le daba agitación en tubos de test abiertos. Posteriormente, a esta mezcla inicial se le realizaban tres técnicas de trabajo ara determinar la aparición de norepinefrina.

Descubrimiento y Medida de su Actividad

Una vez hecho esto se sometió a esa mezcla inicial a 3 pruebas diferentes. 1. Ensayo Cromatográfico 2. Ensayo Químico. 3. Ensayo Flurométrico. Con este trabajo se demostró la existencia de la enzima, si bien es cierto que la reacción que se planteó no era correcta (basada sólo en el oxígeno) se determinaron parámetros cinéticos para la enzima de la glándula adrenal de Bos Taurus (Km Ascorbato= 6,4e-4mM). Se demostró la estequiometría de la reacción 1 a 1. Posteriores trabajos ahondaron en la necesidad de fumarato, cobre y ácido ascórbico como cofactores. Así como su estudio en humanos. Se demostró así también la razón a la elevada concentración de ascorbato en las médulas adrenales de Bos Taurus. El fumarato es necesario, aparentemente como fuente de energía, es posible que esta reacción dependa directamente del Ciclo de Krebs o esté asociada al metabolismo de aminoácidos.

Descubrimiento y Medida de su Actividad

Posteriores estudios consiguieron obtener la Kcat de esta enzima para Bos Taurus:
Sustrato Kcat Dopamina 110s^-1 Tyramina 121s^-1

Esta enzima puede ser inhibida por 2 clases de componentes 1. Compuestos Quelantes, inhibidores muy fuertes que atacan al centro de cobre
impidiendo que se de la primera etapa de reacción.

1-alquil-2-mercaptoimidazol

2. Compuestos orgánicos,que actúan como inhibidores competitivos.
También hemos de incluir a los derivados del ácido fusárico, que además pueden resultar hepatotóxicos.

Feniloxamina y Fenilhidrazina.
Dando lugar a un valor de KI en Bos Taurus de 4,6 (en presencia de 1-(3,4-Dihydroxybenzyl) imidazol.

Ensayo de Actividad en Humanos

DBH Plasma Sanguíneo (Normal) Km= 5,2*10^-4 mM
Otros estudios establecen una Km mucho mayor 0,8 para personas sanas, y sobre otras reacciones que cataliza la enzima, (tyramina), le dan un valor de 2mM.

Vmáx= 1,1*10^-4 mU. Otros factores a tener en cuenta como el pH o la temperatura: pH
Homo Sapiens


37ºC 50ºC

5(pI 5,8) 6

Bos Taurus

Mecanismo de la Reacción

Mecanismo de la Reacción
Dopamina + O2+ Ascorbato Fumarato Cu2+
Esta enzima también puede trabajar sobre otros sustratos como la Tiramina o la Phe.

Noradrenalina + Deshidroascorbato + H2O

La reacción se da en 2 fases: En la primera asistimos a la oxidación del ascorbato en dehidroascorbato y la Cu2+ del centro activo a Cu+.

reducción del

Mecanismo de la Reacción

En la segunda fase de la reacción, se produce la entrada en la enzima del oxígeno molecular y de la dopamina.

Errata, es el carbono beta.

Mecanismo de Reacción

Estructura

Estructura
Dopamine beta-hydroxylase OS=Homo sapiens GN=DBH PE=1 SV=3

MPALSRWASLPGPSMREAAFMYSTAVAIFLVILVAALQGSAPRESPLPYHIPL DPEGSLELSWNVSYTQEAIHFQLLVRRLKAGVLFGMSDRGELENADLVVLW TDGDTAYFADAWSDQKGQIHLDPQQDYQLLQVQRTPEGLTLLFKRPFGTCD PKDYLIEDGTVHLVYGILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEPELPS DACTMEVQAPNIQIPSQETTYWCYIKELPKGFSRHHIIKYEPIVTKGNEALVHH MEVFQCAPEMDSVPHFSGPCDSKMKPDRLNYCRHVLAAWALGAKAFYYPE EAGLAFGGPGSSRYLRLEVHYHNPLVIEGRNDSSGIRLYYTAKLRRFNAGIME LGLVYTPVMAIPPRETAFILTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKV VTVLVRDGREWEIVNQDNHYSPHFQEIRMLKKVVSVHPGDVLITSCTYNTED RELATVGGFGILEEMCVNYVHYYPQTQLELCKSAVDAGFLQKYFHLINRFNN EDVCTCPQASVSQQFTSVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQG EWNLQPLPKVISTLEEPTPQCPTSQGRSPAGPTVVSIGGGKG

Estructura

Estructura

Estructura

Estructura

Aplicaciones y Enfermedades

Diagnóstico traumas crónicos en personas con SSP y polimorfismo del gen DBH. Diagnóstico de enfermedades relacionadas con el alcoholismo. Diagnóstico de enfermedades esquizofrenoides por elevada concentración de Dopamina, y por tanto baja actividad de la enzima. Diagnóstico de enfermedades sobre linfocitos T y NK.

Enfermedad de Alzheimer. Drogadicción. Desórdenes multiorgánicos.

Referencias, Bibliografía y Agradecimientos

AGRADECIMIENTOS: Dr. Rafael Luque Álvarez de Sotomayor, Dpto Química Orgánica, Facultad de Ciencias, por su inestimable ayuda en el mecanismo catalítico.

REFERENCIAS:

“The enzymatic conversion of 3,4-Dihydroxyphenylethylamine to Norepinefrine”; Levin, Levenberg y Kaufman, Journal of Biological Chemistry, Febrero 1960. “3,4-Dihydroxyphenylethylamine beta Hydroxylase: physical properties, copper content, and role of copper in the catalytic activity”: Firedman y Kaufman, Journal of Biological Chemistry, Diciembre 1965. “The primary structure of human dopamine-3-hydroxylase: insights into the relationship between the soluble and the membrane-bound forms of the enzyme”; Varios, The EMBO Journal, 1987. “Reduced dopamine-beta-hydroxylase activity in Alzheimer's disease”; Varios, British Medical Journal, Enero 1981. “The Copper-Enzyme Family of Dopamine Beta-Monooxygenase and Peptidylglycine Alfa “Hydroxylating Monooxygenase: Resolving the Chemical Pathway for Substrate Hydroxylation”;Klinman, Journal of Biological Chemistry, Noviembre 2005. “ Dopamine beta-hydroxylase deficiency ”; Senard, Rouet, Orphanet Journal of Rare Diseases, Marzo 2006. “Dopamine-beta hydroxylase polymorphism and cocaine addiction ”; Varios, Behavourial and Brain Functions, Enero 2008. “Human Plasma Dopamine Beta Hydroxylase”, Frigon y Stone, Journal of Biological Chemistry, Mayo 1978

Referencias, Bibliografía y Agradecimientos

WEBS CONSULTADAS:

http://www.brenda-enzymes.org/php/result_flat.php4?ecno=1.14.17.1

http://www.cathdb.info/

http://www.rcsb.org/pdb/explore/explore.do?structureId=1ZHB

http://www.proteinmodelportal.org/?aid=getModelQualityAnalysis&sid=PMPSID-D56553F837D3BB12EA84D59927FE2C7F&queryfromto=0_617

www.wikipedia.org (artículos sobre DBH, Dopamina, Noradrenalina y Catecolaminas).

BIBLIOGRAFÍA:
“Fisiología Dinámica”, A. Córdova. “Tema 9: Reacciones Bisustrato”, Manuel Tena, Jesús Jorrín Novo, Enzimología. “Texto Atlas de Histología”, Gartner y Hiatt.