You are on page 1of 24

Dopamina Beta Hidroxilasa

Introduccin: Generalidades. Reaccin. Papel Biolgico. Rol de la Norepinefrina como NT. Descubrimiento y Medida de su actividad. Ensayo Actividad en Humanos. Mecanismo de Catlisis. Estructura Aplicaciones

INTRODUCCIN
La Dopamina Beta Hidroxilasa (EC 1.14.17.1) es una enzima bsica de la ruta de las catecolaminas.

Las catecolaminas son unas sustancias qumicas que se conocen as por la existencia de un grupo catecol (dihidroxifenol) unido a un grupo amino. Actan de 2 formas: Neurotransmisor, colaborando en la transmisin sinptica. Hormona, regulando la fisiologa corporal.

La reaccin se hace en presencia de FUMARATO Y requiere de Cu2+ para su desarrollo.

Papel Biolgico

Esta enzima est presente en numerosas especies, de las cuales destacamos 2 para este trabajo: Homo sapiens y Bos Taurus.

Se localiza en diferentes tejidos.

Como NT se sintetiza en el soma de neuronas noradrenrgicas del Locus Coeruleus del Tronco Enceflico. Secrecin Regulada.

Como Hormona se sintetiza en las clulas cromafines de la mdula suprarrenal y de ah se vierten al torrente sanguneo.

Norepinefrina como NeuroTransmisor


A CONTINUACIN SE VERN UNA SERIE DE VDEOS QUE NOS EXPLICAN CMO, DONDE Y CMO ACTA LA NOREPINEFRINA

Descubrimiento y Medida de su Actividad

Descubrimiento y Medida de su Actividad

A partir de una hiptesis sobre la existencia de una enzima que regulase la creacin de la dopamina como parte de la cadena de las catecolaminas, los investigadores decidieron realizar un ensayo buscando simplemente la demostracin de la aparicin del producto como prueba de la existencia de la enzima. DOPA+O2+Ascorbato= NOR+DHascorbato+H2O Crearon una mezcla inicial en la que figuraban los siguientes componentes:

1.Tampn de Fosfato Potsico con un pH de 6,4 y en una concentracin de 100M. 2.cido Ascrbico (6M). 3.cido Fumrico (10M). 4.ATP (12,5 M) 5.Dopamina con un istopo de C14, lo cual, provocara que se mostrase dicho tomo en la norepinefrina formada. (1M). 6.Glucosa Deshidrogenasa hasta completar el volumen para facilitar la reaccin. 7.(1-metil-2-fenil)etilhidrazina hidroclorida (1,3E-2 M)
El volumen final de este preparado era de 0,68 mL, tras la adicin de extracto de mdula adrenal de Bos Taurus dicho volumen fue incubado a 35C mientras se le daba agitacin en tubos de test abiertos. Posteriormente, a esta mezcla inicial se le realizaban tres tcnicas de trabajo ara determinar la aparicin de norepinefrina.

Descubrimiento y Medida de su Actividad

Una vez hecho esto se someti a esa mezcla inicial a 3 pruebas diferentes. 1. Ensayo Cromatogrfico 2. Ensayo Qumico. 3. Ensayo Fluromtrico. Con este trabajo se demostr la existencia de la enzima, si bien es cierto que la reaccin que se plante no era correcta (basada slo en el oxgeno) se determinaron parmetros cinticos para la enzima de la glndula adrenal de Bos Taurus (Km Ascorbato= 6,4e-4mM). Se demostr la estequiometra de la reaccin 1 a 1. Posteriores trabajos ahondaron en la necesidad de fumarato, cobre y cido ascrbico como cofactores. As como su estudio en humanos. Se demostr as tambin la razn a la elevada concentracin de ascorbato en las mdulas adrenales de Bos Taurus. El fumarato es necesario, aparentemente como fuente de energa, es posible que esta reaccin dependa directamente del Ciclo de Krebs o est asociada al metabolismo de aminocidos.

Descubrimiento y Medida de su Actividad

Posteriores estudios consiguieron obtener la Kcat de esta enzima para Bos Taurus:
Sustrato Kcat Dopamina 110s^-1 Tyramina 121s^-1

Esta enzima puede ser inhibida por 2 clases de componentes 1. Compuestos Quelantes, inhibidores muy fuertes que atacan al centro de cobre
impidiendo que se de la primera etapa de reaccin.

1-alquil-2-mercaptoimidazol

2. Compuestos orgnicos,que actan como inhibidores competitivos.


Tambin hemos de incluir a los derivados del cido fusrico, que adems pueden resultar hepatotxicos.

Feniloxamina y Fenilhidrazina.
Dando lugar a un valor de KI en Bos Taurus de 4,6 (en presencia de 1-(3,4-Dihydroxybenzyl) imidazol.

Ensayo de Actividad en Humanos

DBH Plasma Sanguneo (Normal) Km= 5,2*10^-4 mM


Otros estudios establecen una Km mucho mayor 0,8 para personas sanas, y sobre otras reacciones que cataliza la enzima, (tyramina), le dan un valor de 2mM.

Vmx= 1,1*10^-4 mU. Otros factores a tener en cuenta como el pH o la temperatura: pH


Homo Sapiens

T
37C 50C

5(pI 5,8) 6

Bos Taurus

Mecanismo de la Reaccin

Mecanismo de la Reaccin
Dopamina + O2+ Ascorbato Fumarato Cu2+
Esta enzima tambin puede trabajar sobre otros sustratos como la Tiramina o la Phe.

Noradrenalina + Deshidroascorbato + H2O

La reaccin se da en 2 fases: En la primera asistimos a la oxidacin del ascorbato en dehidroascorbato y la Cu2+ del centro activo a Cu+.

reduccin del

Mecanismo de la Reaccin

En la segunda fase de la reaccin, se produce la entrada en la enzima del oxgeno molecular y de la dopamina.

Errata, es el carbono beta.

Mecanismo de Reaccin

Estructura

Estructura
Dopamine beta-hydroxylase OS=Homo sapiens GN=DBH PE=1 SV=3

MPALSRWASLPGPSMREAAFMYSTAVAIFLVILVAALQGSAPRESPLPYHIPL DPEGSLELSWNVSYTQEAIHFQLLVRRLKAGVLFGMSDRGELENADLVVLW TDGDTAYFADAWSDQKGQIHLDPQQDYQLLQVQRTPEGLTLLFKRPFGTCD PKDYLIEDGTVHLVYGILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEPELPS DACTMEVQAPNIQIPSQETTYWCYIKELPKGFSRHHIIKYEPIVTKGNEALVHH MEVFQCAPEMDSVPHFSGPCDSKMKPDRLNYCRHVLAAWALGAKAFYYPE EAGLAFGGPGSSRYLRLEVHYHNPLVIEGRNDSSGIRLYYTAKLRRFNAGIME LGLVYTPVMAIPPRETAFILTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKV VTVLVRDGREWEIVNQDNHYSPHFQEIRMLKKVVSVHPGDVLITSCTYNTED RELATVGGFGILEEMCVNYVHYYPQTQLELCKSAVDAGFLQKYFHLINRFNN EDVCTCPQASVSQQFTSVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQG EWNLQPLPKVISTLEEPTPQCPTSQGRSPAGPTVVSIGGGKG

Estructura

Estructura

Estructura

Estructura

Aplicaciones y Enfermedades

Diagnstico traumas crnicos en personas con SSP y polimorfismo del gen DBH. Diagnstico de enfermedades relacionadas con el alcoholismo. Diagnstico de enfermedades esquizofrenoides por elevada concentracin de Dopamina, y por tanto baja actividad de la enzima. Diagnstico de enfermedades sobre linfocitos T y NK.

Enfermedad de Alzheimer. Drogadiccin. Desrdenes multiorgnicos.

Referencias, Bibliografa y Agradecimientos

AGRADECIMIENTOS: Dr. Rafael Luque lvarez de Sotomayor, Dpto Qumica Orgnica, Facultad de Ciencias, por su inestimable ayuda en el mecanismo cataltico.

REFERENCIAS:

The enzymatic conversion of 3,4-Dihydroxyphenylethylamine to Norepinefrine; Levin, Levenberg y Kaufman, Journal of Biological Chemistry, Febrero 1960. 3,4-Dihydroxyphenylethylamine beta Hydroxylase: physical properties, copper content, and role of copper in the catalytic activity: Firedman y Kaufman, Journal of Biological Chemistry, Diciembre 1965. The primary structure of human dopamine-3-hydroxylase: insights into the relationship between the soluble and the membrane-bound forms of the enzyme; Varios, The EMBO Journal, 1987. Reduced dopamine-beta-hydroxylase activity in Alzheimer's disease; Varios, British Medical Journal, Enero 1981. The Copper-Enzyme Family of Dopamine Beta-Monooxygenase and Peptidylglycine Alfa Hydroxylating Monooxygenase: Resolving the Chemical Pathway for Substrate Hydroxylation;Klinman, Journal of Biological Chemistry, Noviembre 2005. Dopamine beta-hydroxylase deficiency ; Senard, Rouet, Orphanet Journal of Rare Diseases, Marzo 2006. Dopamine-beta hydroxylase polymorphism and cocaine addiction ; Varios, Behavourial and Brain Functions, Enero 2008. Human Plasma Dopamine Beta Hydroxylase, Frigon y Stone, Journal of Biological Chemistry, Mayo 1978

Referencias, Bibliografa y Agradecimientos

WEBS CONSULTADAS:

http://www.brenda-enzymes.org/php/result_flat.php4?ecno=1.14.17.1

http://www.cathdb.info/

http://www.rcsb.org/pdb/explore/explore.do?structureId=1ZHB

http://www.proteinmodelportal.org/?aid=getModelQualityAnalysis&sid=PMPSID-D56553F837D3BB12EA84D59927FE2C7F&queryfromto=0_617

www.wikipedia.org (artculos sobre DBH, Dopamina, Noradrenalina y Catecolaminas).

BIBLIOGRAFA:
Fisiologa Dinmica, A. Crdova. Tema 9: Reacciones Bisustrato, Manuel Tena, Jess Jorrn Novo, Enzimologa. Texto Atlas de Histologa, Gartner y Hiatt.