You are on page 1of 31

GUA DE LABORATORIO

1er. CUATRIMESTRE 2012

Cada vez que empezamos a hablar de nuestros sentimientos te heterocromatinizs!


Profesores: Esteban Hopp ehopp@fbmc.fcen.uba.ar Beatriz Saidman saidman6@yahoo.com.ar Pablo Cerdn pcerdan@leloir.org.ar Mara Isabel Remis mariar@ege.fcen.uba.ar

CITOGENTICA HUMANA
Introduccin Las metodologas para estudiar los cromosomas dependen de las caractersticas de los organismos. En algunas especies, los cromosomas se estudian durante la meiosis, mientras que en otras durante la mitosis. En los mamferos, el estudio de los cromosomas se realiza a partir de metafases mitticas. Existen dos clases de mtodos segn cul sea el tipo de tejido a utilizar: a. mtodos directos: basados en tejidos cuyas clulas estn en divisin mittica espontnea ( por ej.: mdula sea); b. mtodos de cultivo: basados en tejidos cuyas clulas deben ser estimuladas con un agente mitgeno, para inducir la desdiferenciacin y la reiniciacin de la divisin mittica (por ej.: linfocios de sangre perifrica, siendo stos los ms utilizados en citogentica humana). Bsicamente, las tcnicas poseen cinco pasos comunes (Fig. 1): SIEMBRA: obtencin de clulas en divisin mittica activa. COSECHA: 1. detencin de la mitosis en metafase 2. separacin de los cromosomas; 3. fijacin; 4. preparacin de los extendidos citogenticos y coloracin. Siembra Recoleccin de aproximadamente 5 ml de sangre en condiciones de esterilidad con una jeringa con heparina (anticoagulante). Preparacin de un recipiente estril con medio de cultivo (10% de suero fetal bovino (aporta nutrientes), fitohemaglutinina (agente mitgeno) y bicarbonato de sodio (regula el pH entre 7,2 - 7,4). Los medios de cultivo ms usados son RPMI 1640, Mc Coy 5A, F10, entre otros. Adicin de 0,2 o 0,5 ml de sangre entera, o bien 0,5 ml de buffycoat (plasma enriquecido en clulas blancas). Incubacin del cultivo a 37C durante 72 horas. Cosecha 1. Adicin al cultivo de un agente antimittico (inhibe la polimerizacin de la tubulina, impidiendo el alineamiento de los cromosomas, que es dependiente del huso, y el movimiento de las cromtidas hacia los polos opuestos de la clula). En consecuencia, los cromosomas permanecern formados por un par de cromtidas condensadas, dispersos por todo el citoplasma. La droga ms usada como antimittico es la colchicina, un alcaloide extrado de las semillas de Colchicum antumnale. 2. El tratamiento del cultivo celular con una solucin hipotnica permite la entrada del agua al citoplasma, debido a la diferencia de concentracin de sales entre el interior y el exterior celular. En consecuencia, las clulas se hinchan convirtindose en una gran bolsa de agua con cromosomas suspendidos en su interior. La solucin hipotnica ms usada es la de KCl 0,075M. 3. Fijacin: para evitar la etapa de autlisis (destruccin propia) celular, y conservar el material tal cual se encontraba en la clula viva, se utilizan soluciones fijadoras. Las mismas actan provocando deshidratacin y desnaturalizacin de las protenas celulares. El fijador ms usado es: metanol : cido actico glacial (3:1). 4. Preparacin de extendidos y coloracin. Este es el paso clave y requiere especial dedicacin. El objetivo del citogenetista, al realizar los extendidos, es obtener metafases de la mejor calidad considerando: 1) que la contraccin cromosmica no debe ser muy elevada, 2) que las cromtidas no deben estar muy juntas, debiendo distinguirse como estructuras separadas, 3) que la dispersin de los cromosomas de cada clula debe ser ptima evitando las superposiciones, tambin es importante que la suspensin celular, con la que se realizan los extendidos, tenga la concentracin adecuada, ya que suspensiones muy concentradas dificultan la dispersin cromosmica, y si estn muy diluidas la cantidad de metafases ser escasa. Uno de los mayores problemas en la preparacin de extendidos es obtener preparaciones homogneas, no slo entre los preparados de un mismo cultivo sino tambin entre reas de un mismo preparado y en cada metafase. Coloracin: existen diversos colorantes con distintos grados de afinidad por el ADN. Los colorantes ms utilizados pertenecen al grupo Romanovsky: Giemsa, Leishmann, Wright, y pueden ser preparados con agua o buffers. La orcena se usa comnmente en preparaciones convencionales. Estos colorantes tien los brazos cromosmicos uniformemente y en general el centrmero queda menos coloreado. El colorante Giemsa es el ms utilizado, ya que es estable y sus resultados reproducibles. Anlisis citogentico En metafase cada cromosoma est formado por dos cromtidas hermanas unidas por el centrmero, que controla la segregacin cromosmica durante la divisin celular. El centrmero divide al cromosoma en brazos: el brazo corto se llama p y el brazo largo se llama q, tiene una posicin fija y nica para cada cromosoma. Esta puede ser medial (cromosoma metacntrico), submedial (cromosoma submetacntrico), subterminal (cromosoma acrocntrico) o terminal (cromosoma telocntrico). El cariotipo es el ordenamiento sistematizado de los cromosomas de una clula. El nmero, la morfologa (dada por el tamao y posicin del centrmero) y la estructura de los cromosomas definen las constantes cromosmicas. Las metodologas de bandeo (ver ms adelante) han hecho posible el anlisis detallado de la estructura cromosmica. El cariotipo humano

Las clulas somticas de Homo sapiens sapiens contienen 23 pares de cromosomas homlogos (22 pares de autosomas y un par sexual: XX en la mujer, XY en el varn). En humanos se utiliza una nomenclatura especfica: primero se escribe el nmero cromosmico (2n), seguido por la descripcin del par sexual, y a continuacin se indica la alteracin cromosmica, si la hubiere. Por ejemplo: la nomenclatura correspon-

diente a los complementos cromosmicos normales es 46,XX (mujer) y 46,XY (varn). Los 23 pares cromosmicos presentan diferente tamao y morfologa. Segn las variables cromosmicas, se distinguen 7 grupos de cromosomas humanos; los autosomas se enumeran del 1 al 22 en orden decreciente de tamao. (Tabla 1, fig. 2 y 3). Tabla 1

Figura 1

Figura 2. Morfologa cromosmica

Figura 3. Los cromosomas humanos ordenados segn los diferentes grupos.

Bandeo cromosmico Las tcnicas de bandeo permiten detectar, a lo largo de cada cromosoma, bandas alternantes de mayor y menor tincin (o fluorescencia), que forman un patrn estable y caracterstico de cada cromosoma. Este patrn de bandas es de gran utilidad prctica porque facilita la identificacin precisa de cada cromosoma y, adems, hace posible la caracterizacin de regiones particulares dentro de cada brazo cromosmico. El primer bandeo utilizado fue el llamado Q (por la sustancia fluorescente empleada, quinacrina) que exhibe uno de los patrones de bandas ms informativos, aunque requiere de microscopa de fluorescencia. Posteriormente, se comprob que el mismo patrn de bandeo poda ser obtenido mediante la extraccin selectiva de componentes cromosmicos, utilizando la enzima tripsina o soluciones salinas y una tincin con el colorante de Giemsa (usado habitualmente en hematologa). Este patrn de bandas llamado G (de Giemsa), es el utilizado como estndar (figuras 4 y 5).

Figura 4. Metafase humana con bandeo G.

Figura 5. Cariotipo humano con Bandeo G.

El patrn de bandeo vara segn el estado de elongacin de los cromosomas; en los cromosomas ms acortados, propios de la metafase (y tambin acortados por mayor tiempo pasado en presencia de colchicina), el nmero total de bandas detectables en el cariotipo humano es de aproximadamente 400 (figura 6). Cuando se observan clulas en prometafase, con cromosomas ms elongados, el nmero de bandas visibles puede llegar a sobrepasar las mil. Este patrn de bandas es llamado de alta resolucin (figura 7). Las diferencias entre el primer patrn y el segundo consisten en el desdoblamiento de bandas metafsicas en subbandas en la prometafase. El bandeo Q y el bandeo G producen bandas que estn relacionadas con la composicin de bases del ADN en las regiones bandeadas. Las bandas oscuras del bandeo G y las brillantes (fluorescentes) del bandeo Q, representan regiones cuyo ADN es rico en el par A-T, de manera que su coloracin es proporcional a la concentracin de A+T. Esto es apoyado por los resultados obtenidos con sustancias de afinidad especficas por el par de bases A-T, tales como la daunomicina y el Hoechst 33258; mientras que las sustancias que se

unen preferencialmente al par G-C, como la cromomicina A3, dan un patrn de bandeo fluorescente inverso al bandeo Q y al G. Adems de poseer riqueza en el par A-T, las bandas oscuras del bandeo G se caracterizan por poseer relativamente pocos genes y por contener protenas diferentes a las halladas en las bandas claras (no coloreadas). Figura 6. Representacin esquemtica del cariotipo humano en el estadio de 400 bandas con bandeo G.

Figura 7. Representacin esquemtica del cromosoma 14 con bandeo G. Estadio de 320 bandas (izquierda), 500 (centro) y 900 (derecha); ilustrando el uso del Sistema Internacional de Nomenclatura para designar a las regiones, bandas y sub-bandas cromosmicas.

Existen otras tcnicas de bandeo, como el bandeo C (de constitutivo) que tie exclusivamente la heterocromatina constitutiva, compuesta por ADN de tipo satlite, muy repetido (figura 8). Por consiguiente difiere completamente del bandeo G y Q, ya que slo tie las regiones centromricas y los bloques de heterocromatina-C de los cromosomas 1, 9, 16 y del brazo largo del cromosoma Y. Dado que las regiones de bandas C son altamente polimrficas en la poblacin humana, este es el bandeo indicado para la bsqueda de polimorfismos de heterocromatina. El bandeo R es simplemente el inverso del bandeo clsico (G o Q); las bandas claras de un tipo de bandeo son oscuras en el otro tipo. Se usa la cromomicina A3 y las bandas fluorescentes son ricas en C-G. El bandeo N o bandeo de los organizadores nucleolares, tie exclusivamente las regiones que contienen organizadores nucleolares (constricciones secundarias en los cromosomas 13-15 y 21-22) y tambin es totalmente diferente al bandeo clsico, puesto que se basa en la presencia de protenas argentfilas en esas regiones; se tie con nitrato de plata. Figura 8. Metafase con bandeo C.

Objetivo Familiarizarse con la metodologa empleada en la Citogentica Humana. DESARROLLO DEL TRABAJO PRCTICO El TP se divide en tres partes: 1) Observacin de preparados ya listos al microscopio ptico: Los alumnos recorrern los preparados en 10X y 45X tratando de localizar clulas en metafase. El objetivo de esta parte es determinar el nmero cromosmico, y detectar la presencia de un cromosoma extra en algunos preparados de un cultivo de linfocitos de sangre perifrica humano. Algunos vidrios corresponden a metafases con tincin standard y otros, bandeo G. Pueden verse con aceite de inmersin sin necesidad de ponerles cubreobjeto. Tener la precaucin de limpiarlos con papel absorbente y NO olvidar limpiar la lente del microscopio!!! 2) Realizacin de extendidos: Para ello encontrarn una serie de tubos eppendorf de 1,5 ml en gradillas o tachitos de telgopor. Los extendidos deben realizarse de la siguiente manera:i) Limpiar un vidrio con aliento o bien con papel de cocina o tissue. ii) Tomar 0,5 ml del eppendorf con pipeta pasteur y dejar que se deslice la gota por el porta, o lanzar la gota desde una altura prudencial (20 cm por ej). Esta parte de la tcnica, dicen los que saben, es artesanal y meramente experimental! iii) Dejar secar al aire o pasar sobre mechero si hay mucha humedad. Limpiar restos del borde del porta con papel por absorcin.iv) Colocar en recipiente con Giemsa 5 minutos.v) Lavar con agua destilada en frascos de vidrio que dicen p/lavar Giemsa. Secar la parte de atrs del porta con papel antes de colocar el vidrio en el microscopio.vi) Mirar al microscopio ptico en 10X. Pasar a mayor aumento. Si se logran ver metafases interesantes, agregar aceite de inmersin y observar en 100X. Bioseguridad: Los pellets estn fijados en una mezcla actico: METANOL!!! Y adems, el Giemsa es txico y mancha mucho, no sale!!!! Usar guantes y guardapolvo. Los vidrios que no sirven se descartan en una caja que dice: Descarte de vidrio. Los tubos eppendorf vacos se descartan en tacho rojo, como as tambin los guantes. 3) Confeccin del cariotipo (actividad interactiva): Los alumnos realizarn un ejercicio de simulacin con imgenes digitales obtenidas de la siguiente direccin de internet: http://www.biologia.arizona.edu/human/act/karyotyping/karyotyping2.html. El ejercicio involucra la comparacin de los cromosomas por su tamao, la ubicacin del centrmero y la secuencia de bandas G. Los cromosomas se ordenarn en un cariotipo completo y se interpretarn los resultados como si se estuviera trabajando en un servicio de gentica mdica de un hospital. El cariotipo se completar electrnicamente para tres casos, buscando alteraciones citogenticas que puedan explicar el fenotipo de los pacientes.
BIBLIOGRAFA Glass, B.; Kistler, J.C. Distal hyperextensibility of the thumb. Acta Genet Statist. Med. 4:192-206, 1953 Hsu, T.C. Tongue upfolding: a newly reported heritable character in man. J. Hered. 39:187-188, 1948. Reed, D.R.; Nanthakumar, E.; North, M.; Bell, C.; Bartoshuk, L.M.; Price, R.A. Localization of a gene for bittertaste perception to human chromosome 5p15.1 (Letter) Am. J. Hum. Genet. 64:1478-1480, 1999. Rozental, S; Navarro, R y Alba, L. 1995. Gua de Trabajos prcticos. Curso Anual Terico Prctico de Gentica Mdica. Centro Nacional de Gentica Mdica. ANLIS. Ministerio de Salud. Solari, A. J. 1999. Gentica humana. Fundamentos y aplicaciones en Medicina. 2 Edicin. Ed. Mdica Panamericana.Therman E, M. Susman. 1992. Human chromosomes. Structure, behavior and effects. Ed. Springer-Verlag. Snyder, L.H. Studies in human inheritance. IX. The inheritance of taste deficiency in man. Ohio J. Sci. 32:436-440, 1932. Stutrevant, A.H. A new inherited character in man. Proc. Nat. Acad. Sci. 26: 100-102, 1940. Thompson J. S. y Thompson M. N. Gentica Mdica. Ed. Salvat. 1985. Verma R., A. Babu. 1994. Human chromosomes. Principles and techniques. Ed. McGraw-Hill.

Nota: La elaboracin de este TP fue posible gracias al material biolgico proveniente del Centro Nacional de Gentica Mdica perteneciente al ANLIS Dr. C. Malbrn.

MEIOSIS
Sergio Rodriguez Gil OBJETIVO Reconocer las distintas fases de la divisin meitica y sus caractersticas ms importantes. Material a utilizar Preparados permanentes de gnadas de araas (lycosidos) y ortpteros (Dichroplus pratensis) Metodologa Los pasos a seguir para la obtencin de preparados temporarios y permanentes de meiosis se detallan ms abajo. Desarrollo del trabajo prctico 1. Observar y dibujar clulas en las diferentes fases de divisin en forma ordenada (interfase, leptotene, cigotene, paquitene, diplotene, diacinesis, metafase I, anafase I, telofase I, metafase II, anafase II, telofase II). Identificar las caractersticas de cada fase. 2. En las clulas en diplotene, diacinesis y metafase I esquematizar junto al dibujo los distintos tipos de bi-

valentes, sealando diferencialmente las distintas cromtidas. Al final de este TP se dar un ejemplo. Sealar la heteropicnosis del cromosoma X con respecto a los autosomas durante las diferentes fases. 3. Marcar los quiasmas intersticiales y terminales con una pequea flecha colocando las iniciales qi y qt, en diplotene, diacinesis y metafase I. Sealar bivalentes abiertos y cerrados.
Bibliografa De Robertis, E. y De Robertis, E. M. (1995): Biologa Celular y Molecular. 6ta. Edicin. El Ateneo, Buenos Aires. John, B. (1990). Meiosis. Cambridge University Press. Macgregor, H. C. (1993). An introduction to animal cytogenetics. Chapman & Hall. London. Moens. P. (1987): Meiosis. Academic Press, London. Puertas, M. J. (1999). Gentica. Fundamentos y perspectivas. 2da Edicin. Interamericana. McGraw-Hill.

TCNICAS PARA LA OBTENCIN DE PREPARADOS PARA EL ESTUDIO DE LA MEIOSIS Cortar en forma transversal la parte inferior del abdomen con una tijera de diseccin. Despus cortar perpendicularme nte al primer corte hasta encontrar los testculos. Extraerlos y colocarlos en alcohol absoluto:cido actico 3:1 2:1 du- rante 0.5-2 horas como mnimo. El material fijado puede conservarse en un refrigerador. i)Preparados temporarios. 1. Pasar los testculos fijados a alcohol 70%. Con cada testculo se pueden obtener unos 10 preparados. 2. Colocar en un portaobjetos una pequea porcin de tejido y, sobre l, una gota de hematoxilina actica o propinica 2% en cido actico o propinico 45% (al preparar esta solucin hay que agregar acetato frrico hasta obtener color negro). Disgregar el material con una lanceta. 3. Colocar un cubreobjetos (eventualmente untado con albmina de Mayer). Flamear suave e intermitentemente hasta el desprendimiento de humo blanco. De esta forma se elimina la humedad del medio de montaje, pero hay que tener cuidado de no calentar demasiado. 4. Aplastar. 5. Sellar el preparado con cera, parafina o esmalte para uas. Despus de dos horas puede hacerse permanente. ii) Obtencin de preparados permanentes. a- Por congelacin. 1. Quitar la parafina o cera con una hoja de afeitar. Terminar de limpiar con papel absorbente embebido en xilol, evitando que el cubreobjetos se deslice sobre el porta. 2. Congelar sobre un trozo de hielo seco durante 30 segundos, con CO2 de un tubo como los que se usan en los micrtomos de congelacin, o sumergiendo el preparado en aire lquido. 3. Levantar el cubreobjetos con una hoja de afeitar. 4. Sumergir el porta y el cubreobjetos en un Coplin con alcohol absoluto durante 30-60 segundos. 5. Lavar el portaobjetos con alcohol absoluto con un gotero 2-3 veces. 6. Colocar una gota de Euparal sobre el material. 7. Colocar encima un cubreobjetos nuevo y limpio. 8. En forma similar, asociar el cubreobjetos levantado con un porta nuevo y limpio. 9. Si hay turbidez (se debe a una eventual hidratacin), calentar suavemente a la llama hasta que desaparezca. El medio de montaje no debe hervir. 10. Dejar secar varios das. b- Por inversin y desprendimiento del cubreobjetos. 1. Eliminar suavemente el sellado de parafina con una hoja de afeitar. Tener cuidado que el porta no se deslice. 2. Limpiar los bordes del cubreobjetos con un papel embebido en xilol primero y luego en cido actico 45% 3. Colocar el preparado invertido (con el cubre hacia abajo) en una caja de Petri con cido actico 10% sobre una var i- lla de vidrio doblada en U, hasta que el cubre se desprenda. 4. Lavar, dejando gotear desde un extremo del porta, con alcohol 96% dos veces durante un minuto cada vez. 5. Repetir el lavado con alcohol 100%. No dejar secar 6. Colocar una gota de Blsamo de Canad sinttico (soluble en alcohol), Euparal o aceite de cedro sobre un portaobje- tos limpio. Depositar el cubreobjetos con el material sobre el medio de montaje.

Meiosis en ortpteros: clulas en diplotene, diacinesis y metafase I de diferentes especies de orthoptera y sus correspondientes esquemas de interpretacin.

10

EVALUACIN DE GENOTOXICIDAD UTILIZANDO ALLIUM CEPA A. F. Wulff Objetivo tamao uniforme, pequeo a mediano (10-30 g.). Despo- Evaluacin del dao cromosmico causado por agentes jarlos de las catfilas externas ya sueltas. Recortar las genotxicos utilizando como modelo Allium cepa. races viejas a nivel de la base de modo que - Observar al microscopio, reconocer y analizar las disslo queden expuestos los primordios. Lavar durante 3 tintas fases del ciclo mittico en races sometidas a hs. bajo flujo de agua corriente. Colocar la base de distintos tratamientos. los bulbos en agua corriente, cuidando que slo quede la - Observar e identificar aberraciones cromosmicas y/o base (tallo) sumergida en el lquido. Mantener aireado y alteraciones del ciclo celular y asociarlos con acti- via temperatura ambiente. Al cabo de 1-3 das se esperan dad citotxica o genotxica de los compuestos ensayaobtener entre 15-20 races por bulbo de2 a 3 cm. de lardos. go. Materiales Da 2. Transferir los bulbos a las soluciones a testear, Bulbos de Allium cepa. Recipientes de vidrio (tipo yomanteniendo las condiciones de cultivo. Mantener las gur). H2O corriente. Sustancias xenobiticas solubles en races sumergidas en las soluciones de 48 a 50 hs. agua provistas por la ctedra y sustancias a testear aporDa 3. Despus de las 48 hs. de exposicin al agente, tadas por los alumnos. Solucin fijadora: alcohol cosechar (cortando races de 2 a 3 cm. long.) y fijar las absoluto y cido actico glacial (3:1). Alcohol 70%. races en solucin 3:1 (etanol:actico) durante 24 hs. Acido clorhdrico 1N. Porta y cubreobjetos. Colorante Luego, transferir las races a alcohol 70% y guardar a para citologa. Sellador (esmalte, cera o parafina). 4C. Desarrollo del trabajo prctico NOTA: cuando la sustancia se testea por primera vez, es Da 1. Se utilizarn bulbos jvenes de Allium cepa, de recomendable realizar, adems, un tratamiento previo a

11

la fijacin con algn veneno mittico (ej: 8Q, colchiciObtencin de resultados: na, etc.). De esta manera se puede evaluar la existencia vii) Observar al MO 20 campos al azar, registrar nmede ruptura cromosmica o cromatdica en un mayor nro de clulas en interfase y en divisin mittica. mero de clulas en metafase. A partir de estos datos calcular el ndice mittico. viii) Identificar y cuantificar las clulas en divisin - Da 4. Realizacin de los preparados: i) Hidrolizar las races en ClH 1N a temperatura ambienque presentan distintos marcadores citolgicos: puente durante 15 minutos. Transferirlas luego a un recipiente te, fragmento, rezagados, otros. Evaluar el nmero de con agua (lavado). clulas en interfase que presentan mi- croncleos. Con ii) Colocar una raz sobre un portaobjetos, secar el estos datos, completar la planilla adjunta. ix) Determinar % de aberraciones y estimar su significaexceso de agua y cortar el pice blanco (tamao 2 mm) cin respecto al control negativo sobre una gota de colorante. Desechar el resto. Bibliografa consultada iii) Dilacerar el meristema suavemente hasta disgregar el Babich, H., M.A. Segall & K.D. Fox. 1997. The Allium Test. A material, colocar un cubreobjetos. Si fuera ne- cesario Simple, Eukaryote Genotoxicity Assay. The American Biology Teachgolpetear con aguja por encima de ste agregando coloer 59(9): 580-583. Fiskesjo, G. 1985. The Allium test as a standard in enviromental monirante por los bordes. iv) Aplastar las clulas ejerciendo presin sobre el cu- toring. Hereditas 102: 99-112. Fiskesjo, G. 1988 . The Allium test as an alternative in environmental breobjetos con el dedo pulgar (squash). studies: The relative toxicity of metal ions. Mutation Research 197: v) Determinar la calidad del squash observando el pre243-260. parado al microscopio ptico con el menor au- mento. Grant W.F. 1982. Chromosome aberration assays in Allium. A report vi) Si el preparado es ptimo, bordearlo con esmalte, cera of the U.S. Environmental Protection Agency Gene-Tox Program. Mutation Research 99: 273-291. o parafina. Tabla. Censado de aberraciones cromosmicas inducidas en meristemas de raz de Allium cepa. Sustancia Indice mittico Aberraciones cromosmicas x 500 clulas ( SD) Puente Fragmento Rezagados Otros % clulas aberrantes ( SD) MCN x 1000 clulas ( SD)

MCN: microncleos en interfase.

MAPEO DE QTL PARA TOLERANCIA AL ETANOL EN Drosophila melanogaster UN EJEMPLO CON EL CROMOSOMA 3
Objetivos Aplicar e integrar conocimientos tericos adquiridos sobre QTL, gen candidato, marcadores moleculares, genmica, bioinformtica, gentica cuantitativa y mapas genticos y fsicos en el modelo de Drosophila melanogaster. Utilizar herramientas bioinformticas con el modelo Drosophila. Introducin La mayora de los caracteres cuantitativos tienen un componente ambiental y otro gentico de variacin fenotpica, y el anlisis de QTL es fundamental para estudiar sus bases genticas. Utilizaremos lneas RIL y sus mapas genticos correspondientes a marcadores (microsatlites) del genoma de D. melanogaster. Mediremos fenotipos de tolerancia al etanol. Utilizaremos el genoma secuenciado y anotado de D. melanogaster (Adams et al. 2000), para investigar si los QTL detectados incluyen genes candidatos implicados en estudios recientes sobre micromatrices (Srensen et al. 2003). Este trabajo prctico solo pretende ejercitar una investigacin hipottica (no necesariamente real) con fines didcticos exclusivamente.

12

Resistencia al estrs por etanol y genes de la respuesta al estrs por calor: El etanol puede encontrarse en los sustratos trficos y reproductivos de muchos insectos incluyendo las moscas. Las levaduras constituyen una fuente de alimento bsica para Drosophila pero, dependiendo del nivel de oxgeno, liberan variados niveles de etanol como producto de desecho durante un proceso de fermentacin. La exposicin a niveles de etanol mayores que un umbral crtico causa una rpida muerte en los insectos. En las poblaciones algunos individuos son ms tolerantes que otros al etanol y dicha variabilidad es parcialmente gentica. En insectos, la exposicin al etanol puede incapacitar a los individuos, lo que induce un estado de coma similar a lo que ocurre con la exposicin a temperaturas extremas (Scholz et al. 2005). Algunos individuos son ms resistentes y tardan ms que otros en arribar al coma bajo una misma dosis de etanol. En moscas, este carcter puede ser medido como el tiempo que tardan en alcanzar el coma, o bien como la proporcin de individuos que no arriban al coma cuando son expuestos a etanol. Los cambios celulares inducidos por etanol solapan frecuentemente con los inducidos por el estrs de calor (Scholz et al. 2005). Los loci candidatos para la resistencia al etanol incluyen los loci candidatos para termotolerancia. Entre ellos se encuentran los genes que codifican para un grupo muy conservado de protenas llamadas heat-shock proteins o abreviadamente Hsps, muchos de los cuales estn localizados en el cromosoma 3 de D. melanogaster. La mayora de las Hsps no se expresan constitutivamente sino que son inducidas por estrs (ej. un shock de calor, exposicin a etanol, etc). Existen muchas Hsps y la nomenclatura se basa en sus pesos moleculares (ej. Hsp22 es la Hsp de 22 KD, Hsp70 es la Hsp de 70 KD, etc). Hsp70 es una de la mayores Hsps inducibles en D. melanogaster, con 5 copias de su gen codificante que mapean en las bandas 87B14-15 del cromosoma 3 (ANEXOS 1-2). Las ms pequeas Hsps pertenecen a la familia de small Hsp (o s-Hsps) integrada por 4 genes hsp22, hsp23, hsp26, y hsp27 en la banda 67B del brazo izquierdo del cromosoma 3 (ANEXO 2). Las Hsps tienen estructuras primarias que estn evolutivamente muy conservadas. El regulador positivo de las Hsps es el heat-shock factor (HSF), codificado por el gen hsf (localizado en las bandas 55B7-B8 del cromosoma 2), cuya expresin se induce por estrs. HSF es un factor de transcripcin que se une a elementos de la respuesta al shock de calor en los promotores muchos genes de hsps. Las Hsps estn involucradas en funciones de limpieza de casa en la clula, como ser el transporte, encarpetado, des-encarpetado, ensamblado y des-ensamblado de unidades multiestructuradas y participan en la degradacin de protenas agregadas o desnaturalizadas (Fig. 1). Las Hsps son interesantes desde un punto de vista ecolgico porque estos chaperones moleculares pueden estar directamente relacionados con la adaptacin al estrs ambiental (revisado en Srensen et al. 2003). Sin embargo, no todos los genes candidatos para resistencia al estrs por etanol codifican para Hsps (Scholz et al. 2005). Por ejemplo, el gen slowpoke (bandas 96A14-96A17) tiene un gran efecto tolerante al etanol y no codifica para Hsps (Cowmeadow et al. 2005) Ms an, estudios basados en micro-matrices de ADN han mostrado que muchos genes que no tienen funciones de Hsps tambin resultan sobre-expresados o sub-expresados por alta temperatura y otras formas de estrs (Srensen et al. 2003; ANEXO 1).
Conformacin funcional

Estrs
Conformacin NO funcional Hsps

Degradacin

Agregacin

Estructura funcional

Figura 1. Funcin celular de las heat-shock proteins (Hsps). Con un estrs, las protenas daadas que no son Hsps pueden volver a la conformacin funcional, formar agregados con otras protenas mal encarpetadas o ser desagregadas. Las Hsps ayudan a cambiar el equilibrio en direccin a la conformacin funcional o a la degradacin.

Lneas RIL El diseo RIL permite identificar QTL con mayor precisin que otros diseos de mapeo de QTL porque la construccin de RIL implica un gran nmero de rondas de recombinacin en contraposicin a los diseos F2 y o el de retro-cruza (Falconer & Mackay 1996; Lynch & Walsh 1999). Cada RIL tiene un genotipo de marcador (microsatlites en este TP) diferente al de otras RIL en diferentes regiones genmicas (Fig. 2), de modo que la comparacin estadstica de la medida del carcter cuantitativo entre diferentes RIL permite identificar QTL. Para la construccin de RIL, las hembras F1 son retrocruzadas a los machos parentales para obtener la F2 ya que los machos de Drosophila son aquiasmticos. A partir de la F2 se inician lneas indepen-

13

dientes donde cada lnea es continuada por una nica pareja de hermanos completos en cada generacin hasta llegar a la F14 (14 generaciones de apareamiento entre hermanos completos permiten arribar a la homocigosis casi total en D. melanogaster) (Fig. 2). En este TP se utilizarn algunas RIL que fueron construidas a partir de 2 lneas parentales altamente diferenciadas para la resistencia al coma por calor. Ambas lneas parentales se obtuvieron por seleccin artificial sobre este carcter (Norry et al 2004). Las mismas no portan inversiones cromosmicas que sean citolgicamente detectables, tal que las posiciones citolgicas y genticas de los marcadores (microsatlites) coinciden con el cromosoma estndar (no invertido) y se indican en la Tabla 1. Para el mapeo de QTL se utilizan las posiciones genticas (no el mapa fsico).

Lnea resistente (parental A)

Lnea sensible (parental B)

F14 Lneas RIL (recombinantes y homocigotas)


Figura 2. Esquema general de lneas RIL. Se muestra un solo cromosoma para ejemplificar la lgica del mtodo. Algunas hembras F1 son retro-cruzadas con machos de la lnea A y otras con machos B para producir la F2 a partir de la cual se inician lneas independientes que resultan en lneas RIL luego de 14 generaciones de endocra. Desarrollo del TP Parte A. Medicin de tolerancia al etanol 1) Mapas fsicos y genticos: En clase dispondrn del mapa citolgico de los cromosomas politnicos de D. melanogaster sobre los que podrn marcar la localizacin (mapa fsico) de los microsatlites listados en la Tabla 1, para comparar los mapas fsicos y genticos. Se podr utilizar el tiempo del tratamiento de etanol indicado ms abajo para la observacin de mutantes y los mapas de cromosomas politnicos. Las lneas RIL NO portan inversiones cromosmicas, algunas de las cuales incluyen genes candidatos (ver ANEXO 1). 2) Lneas RIL: Se utilizarn 40 RIL para localizar las regiones del cromosoma 3 que contienen genes que determinan la variabilidad gentica de la tolerancia al etanol en D. melanogaster. La medicin de tolerancia al etanol (valor fenotpico) de cada RIL ya fue realizada para este TP excepto para la RIL 33 que ser medida en clase. Cada grupo recibir un tubo con una mosca de RIL 33. A los tubos de todo el turno se les colocar simultneamente un algodn embebido con etanol 70% como tapa e invertir los tubos durante 15 minutos. Medicin de tolerancia al etanol: Una vez transcurridos los 15 minutos del tratamiento de estrs por etanol, registrar inmediatamente en cada uno de ellos si la mosca arrib o no al coma (las moscas que arribaron al coma permanecern inmviles en el fondo del tubo). Calcular el porcentaje de moscas que NO llegaron al coma a travs del turno. Este dato ser utilizado para completar el archivo de datos carcter.txt para la RIL 33 segn se indica abajo. Parte B. Bioinformtica: Anlisis con QTL Cartographer versin 1.3 (Basten et al 1999) 1) Utilizar el programa Excel para abrir y completar el archivo correspondiente a la informacin del carcter (carcter.txt, disponible en la misma carpeta del disco rgido indicada por el docente). Escribir el valor del carcter (% de moscas que no sucumbieron por etanol (no llegaron al coma)) para la RIL 33 completando as este archivo, ya que el valor para el resto de las RIL ya ha sido determinado y escrito en el archivo a utilizar (ej., la fila 1 contendr el valor del carcter para la RIL 1, la fila 2 para la RIL 2, y as sucesivamente, excepto la RIL 33 que Ud completar con el dato obtenido en el turno). Salvar el archivo como texto sin formato asignndole el nombre carcter.turnoX.txt).

14

2) En la computadora est instalado el programa QTL-Cartographer. Para correr los datos deben seguir los siguientes pasos: Cargar el programa desde el explorador de Windows haciendo doble click con el mouse sobre el archivo WinQTLCart.exe presente en la carpeta del disco rgido indicada por el docente. 3) Seleccionar la opcin New de QTL-Cartographer. 4) Ir a Marker Data, desde ah buscar el archivo parametros.txt y abrirlo (este archivo est en la misma carpeta del disco rgido indicada por el docente y contiene los parmetros de entrada para el anlisis, el nmero de la primer fila indica el nmero de cromosomas analizados (1), la segunda fila corresponde al nmero de marcadores para cada cromosoma (17), y la tercer fila corresponde a las distancias o posiciones genticas para cada marcador a lo largo del cromosoma, desde 0 (telmero) hasta el otro extremo del cromosoma. Finalmente, la ltima fila contiene el nombre de los marcadores para cada cromosoma (Tabla 1). Luego, dejar el resto por default y hacer un click con el mouse en siguiente. 5) En Cross information seleccionar RI2 (porque es el cdigo del programa para el anlisis de RIL construidas mediante apareamiento entre hermanos nuestras RIL fueron experimentalmente generadas por apareamiento entre hermanos). 6) En base information escribir el sample size (40, el nmero de RILs). 7) En Trait number escribir 1 (porque estamos analizando un solo carcter). 8) En Experiments y Otrait number dejar valores por default: 1 y 0 respectivamente. Hacer click en siguiente y en el panel Marker Data buscar el archivo marcador.txt y cargarlo. 9) Ir con el mouse al panel Trait Data, buscar el archivo caracter.txt y cargarlo. 10) En la opcin Data including labels seleccionar NO (porque en el archivo marcador.txt no incluimos los nombres de los marcadores). 11) Luego hacer doble click en finalizar. Hasta ac ingres los datos para el anlisis. 12) Seleccionar Verify para corroborar que los datos han sido cargados correctamente. 13) Luego ir a Method y seleccionar Composite Interval Mapping. El programa le solicitar un nombre para el archivo de salida (escriba el nombre que quiera con extensin txt). La significacin de cada QTL estar dada por un valor de LOD convencional de 2.5 por default (o si desea puede estimar la significacin mediante re-muestreo con la opcin By permutation). 14) Hacer doble click en siguiente y ver los resultados o grfico obtenido. Puede copiar la pantalla de resultados utilizando las teclas Ctrl + C y pegarlo en un archivo Word (Cttrl + V). 15) Identificar la localizacin gentica (en cM) donde se encuentran el/los QTL. 16) Utilizar la tabla de conversin de FlyBase para convertir las posiciones genticas (en cM) en citolgicas para los QTL detectados, de modo de poder utilizar el ANEXO 1 para examinar cuales genes candidatos estn ligados a, o mapean dentro de, los QTL detectados. FlyBase Consortium (2003): Buscar en FlyBase (http://FlyBase.org) toda informacin relevante sobre la funcin biolgica de los posibles genes candidatos (ver ANEXO 2) includos dentro de la regin o regiones detectadas como QTL en este prctico. Discutir los resultados en el informe. Nota: Las lneas utilizadas en este TP son una muestra de RIL que fueron construidas con subsidios de la UBA y ANPCyT entre otros, donde participaron Fabin Norry (FN), Pablo Sambucetti, Alejandra Scannapieco y Volker Loeschcke. Este TP fue diseado por FN con propsitos didcticos y el mapa gentico asociados a las RIL en este TP puede no coincidir exactamente con el real. Los resultados que se pudieran obtener no implican necesariamente que sern los mismos que se puedan obtener con determinaciones fenotpicas y genotpicas ms precisas en un trabajo de investigacin real. BIBLIOGRAFA
Adams MD, Celniker SE, Holt RA, et al. (2000). The genome sequence of Drosophila melanogaster. Science 287: 2185-2195. Basten CJ, Weir BS & Zeng Z-B (1999). QTL Cartographer, version 1.13: A Reference Manual and Tutorial for QTL Mapping. Department of Statistics, North Carolina State University, NC. Colson I, Macdonald SJ & Goldstein DB (1999). Microsatellite markers for interspecific mapping of Drosophila simulans and D. sechellia. Molecular Ecology 8: 1951-1955. Cowmeadow RB, Krishnan HR, Atkinson NS (2005) The slowpoke gene is necessary for rapid ethanol tolerance in Drosophila. Alcoholism: Clinical and Experimental Research 29: 17771786. Gockel J, Robinson SJW, Kennington WJ, Goldstein DB & Partridge L (2002). Quantitative genetic analysis of natural variation in body size in Drosophila melanogaster. Heredity 89: 145-153. Hoffmann AA, Srensen JG & Loeschcke V (2003). Adaptation of Drosophila to temperature extremes: bringing together quantitative and molecular approaches. Journal of Thermal Biology 28: 175-216. Falconer DS & Mackay TFC (1996). Introduction to Quantitative Genetics. Addison Wesley Longman, HW.

15
FlyBase Consortium (2003). The FlyBase database of the Drosophila genome projects and community literature. Nuclei Acids Res 31: 172-175. http://FlyBase.org. Lynch M. & Walsh B. Genetics and analysis of quantitative traits. Sinauer Associates, Inc. Massachusetts Morgan TJ & Mackay TFC (2006). Quantitative trait loci for thermotolerance phenotypes in Drosophila melanogaster. Heredity 96: 232-242 Norry FM, Dahlgaard J & Loeschcke V (2004). Quantitative trait loci affecting knockdown resistance to high temperature in Drosophila melanogaster. Molecular Ecology 13: 3585-3594. Scholz H, Franz M, Heberlein U (2005), The hangover gene defines a stress pathway required for ethanol tolerance development. Nature 436: 845-847. Schug MD, Wetterstrand KA, Gaudette MS, Lim RH, Hutter CM & Aquadro CF (1991). The distribution of microsatellite loci in Drosophila melanogaster. Molecular Ecology 7: 57-70. Srensen JG, Kristensen TN & Loeschcke V (2003). The evolutionary and ecological role of heat shock proteins. Ecology Letters. 6: 1025-1037. Srensen JG, Nielsen MM, Kruhffer M, Justesen J & Loeschcke V (2005). Full genome gene expression analysis of the heat stress response in Drosophila melanogaster. Cell Stress & Chaperons 10: 312-328.

Gua para la preparacin de matrices de datos para QTL-Cartographer a) Archivo conteniendo los datos del carcter, archivo carcter.txt. Los datos deben estar ordenados de modo que se correspondan con la matriz de datos del marcador explicado en b; cada fila de la columna es un individuo. Cada fila de la matriz columna del carcter corresponder a la misma RIL de cada fila de la matriz de datos del marcador. b) Archivo conteniendo la informacin del marcador, marcador.txt: los datos (nmero de alelos que vienen de la lnea parental de alta resistencia) estn ordenados por lneas RIL (filas) y marcadores (columnas). En total hay 40 filas (40 RIL) por 17 columnas (marcadores). Los valores sern solo 0 2 porque cada RIL es homocigota.

Carcter.txt
m1 L1 L2 L3 L4 L5 L6 L7 L8 . . . L40 15 20 35 77 91 85 08 50 . . . 33 2 0 0 2 2 0 0 2 . . . 0 m2 0 2 0 2 0 2 0 2 . . . 2

Marcador.txt
m3 0 2 0 2 0 2 0 2 . . . 0 m4 0 2 0 2 2 2 0 2 . . . 2 ... ... ... ... ... ... ... ... ... . . . 0 m17 0 2 2 0 0 2 2 0 . . . 2

c) Archivo conteniendo los parmetros de entrada, parametros.dat. La primer fila indica el nmero de cromosomas, la segunda el nmero de marcadores para cada cromosoma, las siguientes filas numricas indican las posiciones genticas de los marcadores (ver Tabla 1) a lo largo del cromosoma. Cada fila representa un cromosoma. Finalmente, las ltimas filas indican el nombre de los marcadores.

Parmetros.dat
1 17 0.1 5 10 15 18 26 32 36.2 44 47 51 59 67 69 77 87 91

DMRHO DMHSP82 AC005814 DMUSBC DMU14395 AC008198 DROGTPAAP AC004438 DM22FIIT DMCATKOP DROPROSA DMEHAB

... DROROUGH

16

Tabla 1. Loci de marcadores del cromosoma 3 que fueron utilizados en forma exploratoria para determinar el genotipo de algunas lneas RIL. Las referencias para los microsatlites son: Schug et al (1991), Colson et al (1999) y Gockel et al. (2002).
___________________________________________________ Nombre del Localizacin Localizacin Nmero en marcador citolgica gentica (cM) GeneBank
______________________________________________________________

DMRHO 62 A1-A3 3-0.1 X52454 DMHSP82 63 B9 3-5 X03810 AC005814 64 A6 3-10 AC005814 DMUSBC 64 B 3-15 K01043 DMU14395 65 D 3-18 U14395 AC008198 66 D10 3-26 AC008198 DROGTPAAP 67 D-2-3 3-32 M86655 AC004438 68 C2 3-36.2 AC004438 DM22FIIT 73 A1-B7 3-44 Z83456 DMCATKOP 75 D4 3-47 X52286 DROPROSA 86 E3 3-51 D10609 DMTRX3 88 B3 3-56 DMTRXIII DRONANOS 90 E-F 3-67 M72421 DMU25686 93 F 3-72 U25686 ACOO8193 94 D 3-77 AC008193 DMSIDNA 96 E1-E4 3-87 X79340 DROROUGH 97 D5 3-91 M23629 _________________________________________________________

ANEXO 1. Brazo derecho del cromosoma 3 de D. melanogaster. Se indican las localizaciones citolgicas de la inversin In(3R)P (89C2 96A18), algunos genes candidatos para termotolerancia [hsr-omega (93D), Dca (88D), Frost ((5E2), hsp63 (95D), hsp70a,b (87A,C)], y algunos loci de microsatlites [DMU25686 (93F), AC008193 (94D) y DMTRX3 (88B3)] sobre un preparado de cromosoma politnico de un individuo heterocigota para In(3R)P. Las flechas indican micrografas electrnicas de los puntos de corte de la inversin.

17

ANEXO 2. Genes cuya expresin cambia significativamente por estrs de calor en Drosophila melanogaster (Srensen et al 2005).
Anexo 1. Continuacin
________________________________ ______________________________

Anexo 1. Continuacin
__________________________

Gen
Hsp83 Hsp22 Hsp23 Hsp26 CG7 Hsp68 Hsp70Bbb Hsp70Bc Fst GstE1 CG6781 GstD2 GstD5 Gst3-2 CG32130 CG11700 Pepck ade3 ref(2)P Fdxh CG14906 Trxr-1 aay CG5966 CG1583 CG32597 CG10383 CG2065 CG12374 CG16898 Xbp1 CG16971 Obp99b

Posicin citol.
3Lp63B11 3Lp67B1 3Lp67B2 3Lp67B1-67B2 3Lp79B2 3Rp95D11 3Rp87B14 3Rp87B14-87B15 3Rp85E2 2Rp55C6 3Lp66D5 3Rp87B8 3Rp87B8 2Rp55D4 3Lp70B2 Xp5E4-5E5 2Rp55D3 2Lp27D4 2Lp37F1 3Lp67B1 3Rp89D6 Xp7D22-7E1 3Lp67B4-67B5 Xp5D1 Xp7D16-7D17 Xp12E4-12E5 2Lp37A1 2Rp43E9 2Rp49D3 2Rp56F4 2Rp57C3-57C4 3Lp61B2 3Rp99B8

Gen
CG9673 CG5162 CG12656 NPC1b ris CG17224 CG3246 CG3244 CG18585 CG7025 TepII CG13095 CG9466 CG9468 CG17633 CG5390 CG17108 CG16743 hgo CG14935 CG9928 CG5945 CG6012 Irk3 CG13086 CG10026 CG10189 CG10680 CG9259 CG7882 CG3270 CG30502 CG8693 Cyp6a13 CG1809 lambdaTry CG30035 sug CG8093 CG8249 CG8317 CG6426 CG4847 CG6484 CG17522 Jheh3 Obp56a CG11200 Obp57c CG16799 Ance-5 CG2736 CG3344 CG16986 CG10592 CG5150 CG10477 CG10472 CG5804 CG14120

Posicin citol.
Xp15A2-15A3 Xp15F4 Xp19B1 Xp19E5 2Lp21F1 2Lp23C5 2Lp23F3 2Lp25A6 2Lp28C1 2Lp28C1 2Lp28C1 2Lp29D1-29D3 2Lp29F1 2Lp29F1 2Lp30C8 2Lp31D1 2Lp32A4 2Lp32C1 2Lp32D5 2Lp33A4 2Lp34A6 2Lp34A11 2Lp36B2 2Lp37A1 2Lp37D2 2Lp37E1 2Lp37E4 2Lp38A8 2Lp39A1 2Rp42A1 2Rp42C5 2Rp43C3 2Rp44D1 2Rp44D3 2Rp45F3 2Rp47F3 2Rp48B6-48B7 2Rp49E1 2Rp51E7 2Rp52C8 2Rp53C9 2Rp53D14 2Rp54C1 2Rp54C10 2Rp55C6 2Rp55F8 2Rp56E2 2Rp56F16 2Rp57A4 2Rp57A9 2Rp60E5 2Rp60E10-E11 3Lp61C8 3Lp62E7 3Lp64D5 3Lp64D5 3Lp65A3 3Lp65A5 3Lp66E1 3Lp69E8

Gen
CG5582 Oat CG5618 CG18249 CG7443 CG12813 CG8773 CG8774 CG3984 CG14872 CG18522 CG6126 CG17836 CG3734 CG5023 CG3301 CG6660 CG6726 CG6733 CG13607 CG10513 CG10514 CG31104 CG5107 CG6295 CG3348 CG15065

Posicin citol.
3Lp75A4 3Lp76B11 3Lp77B5 3Rp84F4 3Rp84F12 3Rp85F8 3Rp87E4 3Rp87E4 3Rp88E2 3Rp88F7 3Rp88F7 3Rp89B7 3Rp91D4-D5 3Rp92A3 3Rp92D2-D3 3Rp93D2-D3 3Rp94D3-D4 3Rp94D13 3Rp94D13 3Rp95E1 3Rp96C8-C9 3Rp96C9 3Rp96C9 3Rp96E2 3Rp97D13 3Rp97F1 2Rp55C6

________________________________

_______________________________

___________________________

A) Sobre-expresin temprana

B) Sub-expresin temprana
CG31148 CG30359 Eip71CD Est-6 Glt LvpH ry Uro v Nmdmc Myo61F Pbprp2 iotaTry Aph-4 Thor Mipp1 CG7953 CG7916 CG11378 CG14439 CG2254 CG32687 CG15201 CG33173 CG13309 3Rp95A8 2Rp44D1 3Lp71D3-71D4 3Lp69A1 2Lp29E3 2Rp44D1 3Rp87D9 2Lp28C3 Xp9F11 3Rp85C3 3Lp61F6 Xp19D1 2Rp47F5 3Rp100B1 2Lp23F6 3Lp73A7-73A9 2Lp34D7 2Lp34D7 Xp1E3 Xp6C11-6C12 Xp7D5 Xp9D2 Xp10A8 Xp13E15-13E17 3Lp66E1

C) Sobre-expresin tarda ImpL3 3Lp65A11 LvpL 2Rp44D1 MtnA 3Rp85E9 Reg-3 Xp8D8-D9 CG12116 Xp7F1 CG3106 Xp8F6 CG9675 Xp15A1-A2 Cyp4ac2 2Lp25D2 CG9497 2Lp26C3 Cyp4d21 2Lp28B4 CG7300 2Lp32A4 CG17124 2Lp32A5 CG1946 2Rp43E12 CG9080 2Rp47E1 CG8834 2Rp49A4 CG18327 2Rp50E1 CG13492 2Rp58A2 Cct1 3Lp62A9 CG6602 3Lp65A5 CG8562 3Lp65F11 CG8560 3Lp65F11 CG16749 3Rp85D11 CG8147 3Rp85D18 CG3940 3Rp85F12 Cyp313a1 3Rp88C4 CG18493 3Rp92A3 CG3739 3Rp92A3 CG13833 3Rp94D10 CG6164 3Rp95E5 CG14528 3Rp98F1 CG9702 3Rp99F9

18

Marcadores Moleculares (fingerprinting) y Anlisis de Caracteres Humanos


Daniela Tosto Objetivo del TP: Familiarizar a los alumnos con algunas metodologas del anlisis de ADN. Evaluar caractersticas gentico poblacionales de un marcador polimrfico, el locus D1S80 (minisatlite) en un grupo de individuos no relacionados. Introduccin: El ADN presenta regiones codificantes que son esencialmente iguales entre individuos de una misma especie y regiones aparentemente silenciosas, sumamente abundantes, las cuales pueden variar de un individuo a otro. La existencia de regiones polimrficas en el ADN humano permitira disponer de una herramienta capaz de identificar individuos y establecer vnculos de parentezco. La aplicacin de estas secuencias variables en el campo de la identificacin de individuos fue concebida por Alec Jeffreys en 1985. Sus estudios en la evolucin molecular de la familia de las globinas lo condujeron al anlisis del gen de la mioglobina, en el que descubrieron la existencia de secuencias hipervariables que al ser usadas como sondas moleculares, eran capaces de generar patrones de bandas de hibridacin especfica de individuo. Los patrones de hibridacin especficos para cada individuo reflejan la existencia, en nuestro genoma, de un tipo particular de regiones variables. Las variantes de longitud denominadas VNTR (Repeticiones en Tndem de Nmero Variable) se caracterizan por presentar una organizacin tal que segmentos de ADN similares (unidades de repeticin) se encuentran dispuestos en tndem en nmeros variables de veces (constituyendo los diferentes alelos) y flanqueados por secuencias no redundantes. En estas ltimas se hallan sitios de reconocimiento para el corte por parte de endonucleasas de restriccin (fig.1), o bien secuencias adecuadas para la unin de pequeas secuencias iniciadoras (primers), que posibilitan la polimerizacin del fragmento complementario a la secuencia de inters por medio de la reaccin en cadena de la polimerasa (PCR) (fig.2). Los VNTRs pueden clasificarse segn el tamao de las unidades de repeticin: los minisatlites presentan unidades de decenas a pocas centenas de pares de bases, mientras que en los microsatlites las unidades poseen de 2 a 7 pares de bases de longitud. La tipificacin del ADN (DNA fingerprinting) se vale del uso de secuencias minisatlites y microsatlites. Existen dos tipos de DNA fingerprinting: DNA fingerprinting de locus simple y DNA fingerprinting de mltiples loci, varios "loci" en el segundo caso (llamado a veces multilocus o multiplex). Se emplean dos metodologas para el estudio de los VNTRs: -en el caso de los minisatlites de ubicacin multiple se utiliza la tcnica de Southern blots, en los que se emplean enzimas que cortan por fuera de los bloques que contienen las repeticiones en tndem, dando fragmentos de distinto tamao dependiendo de la frecuencia en que se encuentra repetida la unidad. El polimorfismo es tal que el patrn de bandas obtenido (semejante a un cdigo de barras), resulta especfico de cada individuo, como lo es una huella digital y se hereda mendelianamente (fig.1)

VNTR Minisatlites
Deteccin mediante PCR

Figura 1 (Southern blot) -los minisatlites de ubicacin localizada (single locus) en

dependiendo de si se analizan los distintos "alelos" de un "locus" en el primer caso o si se analizan los "alelos" de

19

general deben evidenciarse por la tcnica de PCR, por ejemplo los loci D1S80, D7S30, ApoB, 3HVR (fig.2). -los microsatlites slo pueden ser resueltos mediante PCR y geles de alta resolucin. Figura 2 (PCR) En el trabajo prctico, se analizar un minisatlite de localizacin especfica (fingerprinting de locus simple), el locus D1S80 mediante la tcnica de PCR utilizando el ADN de distintos estudiantes obtenido a partir de mucosa bucal. El locus VNTR D1S80 es uno de los sistemas de locus simple ms utilizados en la actualidad. Se trata de un minisatlite que est ubicado en el brazo largo del cromosoma 1, consiste de un nmero variable de repeticiones en tndem de una unidad de repeticin de 16 pb. Hasta el momento se hallan descriptos 29 alelos, que varan en un rango de 200pb a 800 pb, segn la cantidad de veces que se halle repetida la unidad de 16 pb (Budowle et al., 1991; Kloosterman et al., 1993; Pinheiro et al., 1996). Se evaluarn caractersticas gentico-poblacionales del marcador polimrfico en la poblacin de estudiantes. A)- Protocolo de extraccin de ADN La extraccin del ADN se realizar a partir de clulas de descamacin bucal. El ADN luego ser utilizado en una PCR; dada la sensibilidad de esta reaccin es conveniente trabajar con mucho cuidado ya que cualquier contaminacin podra alterar el resultado. 1- Se realiza un hisopado bucal y se deja secar el hisopo durante 20 minutos. 2- Poner el hisopo durante 20 minutos en un tubo eppendorff conteniendo 1 ml de H20 y mover para facilitar el desprendimiento de las clulas. 3- Centrifugar durante 10 minutos a 15.000 rpm, descartar el sobrenadante. 4- Resuspender el precipitado (pellet) en 450 l de buffer de extraccin. 5- Agregar 5 l de proteinasa K. 6- Mezclar por inversin. 7- Incubar a 60 C durante 60 minutos. 8- Agregar un volumen de fenol (500 l) y mezclar por inversin. 9- Centrifugar durante 5 minutos a 15.000 rpm . 10- Extraer la fase acuosa (la fase de arriba) cuidadosamente sin tocar la interfase. 11- Poner en otro tubo eppendorf, agregar un volumen de cloroformo isoamlico (24:1) (500 l) y mezclar por inversin. 12- Centrifugar durante 5 minutos a 15.000 rpm . 13- Extraer la fase acuosa (la fase de arriba) cuidadosamente sin tocar la interfase. 14- Poner en otro tubo eppendorf y agregar 1/10 volumen de NaCl (3M) y 2 volumenes de etanol. Mezclar por inversin. 15- Colocar a -20 C durante 20 minutos para facilitar la precipitacin del ADN. 16- Centrifugar durante 10 minutos a 15.000 rpm. 17- Descartar el sobrenadante y dejar los tubos abiertos en la mesada para que se evapore el resto de etanol. 18- Resuspender el pellet en 15 l de H2O. B)- Protocolo de la PCR La reaccin se llevar a cabo en tubos eppendorf de 0,5 ml, en un volumen final de 30 l.

1- Preparar una "master mix" con los siguientes reactivos (para 30 reacciones) por tubo: Buffer 10X 3l MgCl2 (25 mM) 2l dNTPs (10 mM) 1l Primers a (100 ng/l) 1l Primers b (100 ng/l) 1l Taq DNA-pol (1 u/l) 0,4l H2O llevar a 25l 2- Repartir 25 l de la misma en cada tubo. 3- Agregar 5l del ADN a amplificar en cada tubo. 4- Colocar los tubos en un termociclador y se realizar el siguiente ciclado: 94 C 4 min (desnaturalizacin inicial)

95 C 65 C 70 C

1 min 1 min 8 min

25 ciclos

72 C 10 min (extensin final) C)- Visualizacin de los productos de amplificacin Se sembrar la mitad del volumen de la reaccin en un gel de agarosa 1,5% en buffer TAE 1X (tris-acetato-EDTA), conteniendo 0,5 g/ml de bromuro de etidio (CUIDADO con el bromuro de etidio que es altamente mutagnico, usar guantes!!!). La corrida electrofortica se realizar a un voltaje mximo de 5 V/cm. La visualizacin del ADN se realizar mediante la irradiacin del gel con luz ultravioleta, en esas condiciones el BrEt fluoresce es decir emite en el rango visible del espectro (ATENCIN: la luz UV es muy perjudicial para los ojos, usar anteojos adecuados o un vidrio!). Se identificarn los distintos alelos presentes en la poblacin comparando con una escalera (ladder) especfico del locus D1S80, cuyo patrn se ve en la figura 3 (L marcador de tamao molecular). Figura 3 D)- Anlisis estadstico de los datos 1- Frecuencias allicas: Se considerarn para cada uno de los sistemas analizados el nmero total de alelos contados y el nmero de cada alelo en particular. Se determinar la frecuencia allica segn: xi = ni /n xi: frecuencia allica, ni: nmero contado de un alelo, n: nmero total de alelos contados. 2- Frecuencias genotpicas: La frecuencia genotpica se expresa segn Xi= Ni/N Xi: frecuencia genotpica; Ni: nmero de veces en que se presenta un genotipo en particular; N: nmero de individuos analizados 3- Determinacin de porcentajes de heterocigosidad -Heterocigosidad observada: Se cuentan la cantidad de individuos heterocigotas en el espacio muestral considerado hO= Nind.het./Nind.tot. -Heterocogosidad esperada hE= n . [1- xi2] / (n-1)

TH

20

n: nmero total de alelos contados; xi: frecuencia del alelo i. La heterocigosidad se expresa en porcentajes. 4- Equilibrio de Hardy-Weimberg Una de las formas de analizar si un sistema se encuentra en equilibrio de H-W en un determinado grupo o poblacin es a partir de la comparacin de los valores de heterocigosidad esperados y observados, basndose en un test de 2, 2= (hO- hE)2/ hE 5- Determinacin del poder discriminativo de un sistema: PD= 1- (Xi)2 Xi: frecuencia del genotipo i. 6- Genotipo ms frecuente (probabilidad de match) P2= ga*gb*gc............... P2 es la probabilidad que dos personas no relacionadas tengan la misma combinacin de genotipos para los sistemas analizados, siendo ga, gb...., gi la frecuencia genotpica del genotipo ms frecuente para el sistema a,b,...,i. Tambin denominado probabilidad de match. *Interpretar los datos y realizar el anlisis estadstico (items D1 a D6) a partir de los resultados que se observan en la figura 4:
Soluciones: Buffer de extraccin: TrisHCl 10 mM, EDTA: 10 mM, NaCl: 0,1 M, SDS: 2 % 10X PCR Buffer:

Tris-HCl (pH 8,4) 200 mM, KCl 500 mM, TAE 1X: Tris-acetato 0,04 M, EDTA 0,001 M

Bibliografa:
Budowle, Bruce et al., 1991. Analysis of the VNTR locus D1S80 by the PCR followed by High- Resolution PAGE. Am. J. Genet. 48: 137-144. Corach, Daniel, 1995. Del DNI al ADN. Rev. Univ.de Buenos Aires n 3. Biotecnologa, El Futuro en Debate. Kloosterman, Ate D. et al., 1991. PCR-amplification and detection of the human D1S80 VNTR locus. Int. Jour. Leg. Med., 105: 257-264. Pinheiro et al., 1996. Study of three AMPFLPs (D1S80, 3ApoB and YNZ22) in the North of Portugal. Forensic Science International 79: 23-29. Saiki et al., 1985. Enzymatic amplification of -globin genomic sequences and restriction site analysis for diagnosis of sickle cell anemia. Science 230: 1350- 1354. TP: Anlisis de las caractersticas gentico poblacionales de marcadores microsatlites hipervariables en una muestra aleatoria. Curso de Elementos de Gentica y Biologa Molecular 1997, FFyB, UBA. Nota: La elaboracin de este TP fue posible gracias al asesoramiento y la colaboracin del Dr. Daniel Corach, Jefe del Servicio de Huellas Digitales Genticas de la Fac. de Farmacia y Bioquimica de la UBA.Tambin fue fundamental para la elaboracin de este TP las facilidades brindadas por el I. Biotecnologa del INTA Castelar.

Anlisis de caracteres humanos:


El anlisis de caracteres humanos es complicado por el hecho de que la mayora de los mismos son polignicos o estn influenciados por factores ambientales. Sin embargo existen ciertos caracteres que parecieran ser monognicos y no estar sujetos a factores ambientales: Sensibilidad a la feniltiocarbamida (PTC) (171200)*: dos qumicos que trabajaban con PTC descubrieron por azar que esta sustancia tena un sabor intensamente amargo para uno de ellos mientras que careca de gusto para el otro. Trabajando con soluciones acuosas de PTC de concentracin creciente se pueden establecer diferentes niveles umbrales para la capacidad gustadora. Los individuos T_ son gustadores y los tt no gustadores. Se consideran como no gustadores aquellas personas que detecten algn sabor distinto del amargo. Znyder (1932) y otros investigadores comprobaron que en la poblacin europea un 70 % de las personas examinadas eran gustadoras (sentan sabor amargo) y el 30 % no gustadoras. Mientras que en poblaciones de frica y Amrica el 40% eran no gustadores. El locus de sensibilidad a PTC est mapeado en el brazo corto del cromosoma 5 (Reed et al 1999). Enrollamiento de la lengua (189300)*: La capacidad para enrollar la lengua en sentido longitudinal, sera segn Sturtevant (1940) y Hsu (1948) una caracterstica de herencia monognica dominante y autosmica. En las poblaciones estudiadas el 65 % enrolla la lengua U_ y el 35 % no posee la capacidad de enrollamiento uu (homocigota recesivo). Hiperextensibildad del pulgar (274200)*: este carcter se debe a la presencia en homocigosis del alelo h, las personas que son homocigotos para dicho alelo, hh, tienen la capacidad dedoblar hacia atrs la ltima falange del dedo pulgar en un ngulo de casi 90. Segn Glass y Kistler (1953) el 25% y el 35% de la poblacin americana, blanca y negra respectivamente, tienen esta capacidad. En el laboratorio cada alumno analizar su fenotipo para los distintos caracteres y los volcar en la tabla:

Figura 4

21

carcter

Ntotal N de N de Frec. fende alum- alumnos alumnos otipo donos dominantes recesivos minante

Enrollam. lengua Hiperext. pulgar PTC Suponiendo que hay ajuste al equilibrio Hardy-Weimberg calcular frecuencias allicas y genotpicas:

carcter

Frec. allicas p q

Frec. genotpicas p2 2pq q2

Enrollam. lengua Hiperext. pulgar PTC Las frecuencias de los alelos para los caracteres estudiados fueron determinadas en algunas poblaciones. Con el objeto de determinar si las frecuencias allicas de los alumnos de Gentica I son iguales a las de la poblaciones estudiadas, se realizar el test de 2 : 2 = (o-e)2/e (gl: nmero de clases -1) Luego se consultar la tabla de valores crticos para la distribucin de 2 para determinar la probabilidad de la hiptesis. Bibliografa:
-Glass, B.; Kistler, J. C. Distal hyperextensibility of the thumb. Acta Genet. Statist. Med. 4: 192-206, 1953. -Hsu, T. C. Tongue upfolding: a newly reported heritable character in man. J. Hered. 39: 187-188, 1948. -Reed, D. R.; Nanthakumar, E.; North, M.; Bell, C.; Bartoshuk, L. M.; Price, R. A.Localization of a gene for bitter-taste perception to human chromosome 5p15. (Letter) Am. J. Hum. Genet. 64: 14781480, 1999. -Snyder, LH Studies in human inheritance. IX The inheritance of taste deficiency in man. Ohio J Sc. 32: 436, 1932.-Sturtevant, A. H. A new inherited character in man. Proc. Nat. Acad. Sci. 26: 100-102, 1940. * : nmero de entrada en la base de datos: Online Mendelian Inheritance in Man.

Bioinformtica
Modificada por Pablo Nez Primera parte Sistemas de bsqueda de datos: ENTREZ N. Paniego, adaptado por R. HEINZ En los ltimos aos, el desarrollo de nuevas tecnologas e incremento del acceso a la secuenciacin ha permitido un aumento exponencial de la disponibilidad de secuencias y genomas completamente secuenciados. Esta informacin se encuentra contenida en diversas bases de datos pblicas disponible a ser utilizada en investigacin. La contraparte, implica la necesidad de entrenarse en el uso de las herramientas informticas, que permitan un manejo de grandes volmenes de datos y los transformen en estudios abordables que contribuyan a responder preguntas biolgicas concretas. Bioinformtica se refiere a una amplia gama de actividades que van desde el uso de programas simples, recursos en la Web para el anlisis de secuencias hasta el desarrollo de algoritmos especficamente diseados para procesos complejos. En el TP solamente haremos mencin a describir las reas bsicas en las que se utilizan herramientas bioinformticas, para conocer una disciplina reciente, en continuo

desarrollo, fundamental para la aplicacin de nuevas metodologas de muestreo masivo de datos y capaz de generar conocimiento nuevo a partir de la integracin de la informacin y datos disponibles. El ncleo de la informacin consiste en secuencias de ADN y protenas, y los procesos ms sencillos se relacionan con el objetivo de obtener informacin de secuencias nuevas aprovechando el conocimiento previo almacenado en bases de datos. El primer paso suele ser la bsqueda en bases de datos primarias de secuencias similares a la secuencia de inters, para luego consultar diferentes bases de datos donde las secuencias identificadas puedan tener asignada alguna propiedad que aporte informacin sobre la secuencia incgnita. Estas nuevas bases de datos pueden tener informacin relacionada con patrones de secuencias (motivos), anotaciones que describan los procesos biolgicos, moleculares (funcin, interacciones), localizacin subcelular de una protena, tambin pueden relacionarse con determinados dominios en la estructura secundaria, estructuras terciarias o cuaternarias (dominios transmembrana, etc.) que puedan aportar un significado funcional o estructural para una secuencias nueva de la cual, todava, no se saba nada. Es importante recalcar que muchos programas disponibles se basan en reglas, o son capaces de identificar secuencias o patrones, en muchos casos entrenados con informacin validada experimentalmente para predecir, con mayor o menor xito, propiedades en secuencias nuevas. Por lo tanto es necesario considerarla como una prediccin, nicamente y no como una confirmacin. Bsquedas basadas en texto. ENTREZ, RSRS Las bases de datos pblicas que coleccionan informacin biolgica constituyen el punto de partida para buscar informacin confiable en distintos aspectos relacionados a la biologa molecular, la gentica y la bioqumica. En general stas archivan la informacin a partir de una organizacin o estructura lgica que facilita y optimiza los resultados de las bsquedas. Las bases de datos generales que concentran y comparten el archivo pblico de datos biolgicos y bibliogrficos ofrecen sistemas integrados de bsqueda como ENTREZ [NCBI] y SRS [EBI] que permiten extraer informacin especfica y relacionada a partir de las bases de datos que albergan estos sitios, a travs de consultas sencillas basadas en texto. Sin embargo, para aprovechar la potencialidad de estos sistemas es necesario conocer los recursos para estructurar las bsquedas a fin de acceder a informacin disponible de manera eficiente. El objetivo de este trabajo prctico es entrenar a los usuarios en el uso de los sistemas de bsqueda mencionados para acceder de manera adecuada a la informacin depositada en bases de datos pblicas. Los ms utilizados son ENTREZ (www.ncbi.nlm.nih.gov/Entrez/) y SRS (http://srs.ebi.ac.uk/). Ambas tienen usos similares, cuando se introduce algn texto o cdigo sobre el que se pretende conocer informacin relacionada, muestra un espectro de bases de datos que contienen informacin relacionada. Las bases de datos incluyen por ejemplo, bibliografa (PUBMED), libros, secuencias, genomas, motivos, taxonoma, estructuras de protenas, mapas genticos y cromosmicos, etc. Se pueden realizar bsquedas con ms de dos trminos utilizando los operadores AND, OR, NOT para ampliar o acotar la bsqueda; tambin existen diferentes alternativas para limitar las bsquedas y discrimar con mayor facilidad la informacin necesaria.

22

Bsquedas basadas en secuencia. BLAST (local) - CLUSTAL, FASTA (global). La otra forma de bsqueda es cuando el imput es una secuencia. Genbank es una base de datos primaria (NCBI, http://www.ncbi.nih.gov), o sea es donde se depositan todas las secuencias de protenas y nucletidos disponibles. Genbank est administrada por el NCBI (National Center for Biotechnology Information). Existe un consorcio (International Nucleotide Sequence Collaboration) compuesto por el NCBI, DDBJ (http://www.ddbj.nig.ac.jp/index-e.html) y EBI (http://www.ebi.ac.uk), donde un laboratorio puede depositar secuencias en cualquiera de los tres centros y la informacin est disponible para todos, porque las bases de datos se sincronizan cada da. Las bsquedas de secuencias se basan en realizar alineamientos de a pares con bases de datos de secuencias, ya sea de nucletidos o protenas, identificando secuencias que presenten identidad, para realizar inferencias funcionales o evolutivas. Estos programas permiten buscar superposiciones en secuencias y de este modo reconstruir la secuencia original. Los algoritmos que se aplican en estos casos se denominan, en forma generalizada, algoritmos de alineacin, los cuales se basan fundamentalmente en la comparacin de secuencias con el fin de buscar regiones similares, es decir que presenten una buena coincidencia (good match). Existen dos tipos de alineamientos: global (algoritmo de Needleman-Wunsch) o local (algoritmo Smith-Waterman). El alineamiento global busca exhaustivamente todo el espacio de bsqueda, o sea forzando un alineamiento completo de la secuencia, en toda su extensin, introduciendo gaps donde no puede encontrar un apareamiento adecuado. En general los algoritmos de alineacin global tienen por objeto calcular un valor de alineamiento ptimo entre dos o ms secuencias. Por ejemplo, a las coincidencias de bases (match) el programa le asigna un valor positivo, y a las discordancias (mismatch) un valor negativo. El alineamiento ptimo es aquel que presente el mximo valor. Dado que dos secuencias cualesquiera pueden ser alineadas con un valor mximo de coincidencia agregando una delecin (gap) cada vez que aparezca una no coincidencia, la incorporacin de una delecin debe ser penalizada de algn modo en el clculo de dicho valor ptimo de alineamiento, de manera tal de evitar alineamientos con una alta incidencia de gaps. Este proceso penaliza tanto la apertura de gaps como la extensin de los mismos. Los programas ms comnmente utilizado para el alineamiento global, son el CLUSTAL y el FASTA. El alineamiento local busca slo en regiones donde hay un apareamiento significativo; tienen por objeto buscar regiones dentro de una secuencia entera que presenten una buena coincidencia con otras regiones de secuencias provenientes, por ejemplo, de una base de datos. Es ms efectivo cuando se analizan regiones que incluyen sectores con muy poca similitud. El mtodo local ms utilizado es el BLAST y sobre el profundizaremos un poco ms. Este ltimo es un algoritmo de bsqueda de homologa de secuencias, que utiliza clculos estadsticos para identificar coincidencias significativas entre una secuencia provista por el usuario (llamada incgnita o query) y una secuencia de ADN del banco de datos. Se utiliza, por ejemplo para determinar si una secuencia incgnita se parece o pudiera corresponderse a parte de otra secuencia de un gen ya identificado por otros investigadores y almacenada en la base de datos en donde se est realizando la bsqueda. Los parmetros de bsqueda son elegidos por el usuario, los que deter-

minan en ltima instancia, el porcentaje de coincidencias que va a ser tomado como significativo. Luego de la bsqueda en las bases de datos, para las secuencias identificadas el BLAST ofrece un valor estadstico (puntaje SCORE) que permite distinguir entre resultados (hits) significativos. Este valor representa sencillamente la suma de puntajes especificados por el alineamiento para cada par de posiciones. Cada posicin comparada en funcin de asignar un match, mismatch o un gap, en conjunto conforma una matriz de sustitucin, de donde resulta el puntaje final. Cuanto mayor es el puntaje S, mayor es la probabilidad de que la homologa sea significativa. El valor E, depende Score (S), de la longitud de la secuencia imput, y del volumen de la base de datos; sintticamente representa el numero de alineamientos distintos con un mismo valor S que podran encontrarse por azar. En general, el valor E se considera significativo cuando es <0.01.Las opciones que se encuentran en la seccin Basic BLAST" permiten realizar bsquedas en diferentes bases de datos y tambin es posible ajustar diversos parmetros del programa. Programa Secuencia imput Base de datos Comparacin Blastn ADN ADN ADN Blastp Protena Protena Protena Blastx ADN Protena Protena Tblastn Protenas ADN Protena Tblastx ADN ADN Protena El programa BLAST tiene varios parmetros que se pueden ajustar para obtener ms o menos hits, haciendo que el proceso sea ms rpido o lento. Los ms comunes y que tiene un efecto mayor sobre la cantidad de hits son: Seleccin de la base de datos. Filtros que agreguemos. Ejemplo: determinar una nica especie. Valor mnimo de E. Existen muchos otros tipos y variaciones del BLAST. Uno de ellos, el BLAST assembled genomes es para buscar secuencias que sean similares a nuestra secuencia consultando en diferentes genomas que ya estn secuenciados y anotados, que pueden seleccionarse individualmente. Alineamiento mltiple de secuencias La mejor forma de analizar y comparar tres o ms secuencias es a travs de alineamientos. Su funcin principal es la analizar las que ocurre en las posiciones equivalentes de diferentes secuencias y definir sitios o regiones conservadas o variables, por lo que resultan muy tiles para descubrir familias de protenas, predecir estructura de protenas o para encontrar homologas para estudios evolutivos. Demostrar la funcin de las protenas an ms complejo que resolver el problema de la prediccin de estructura. Las dificultades tericas y prcticas para predecir la funcin de las protenas se suman a las dificultades de la obtencin de datos experimentales sobre funcin. Por esto la utilizacin de la informacin evolutiva acumulada en los alineamientos mltiples pueden resultar muy tiles para predecir aspectos de la funcin de las protenas. En muchos casos, los alineamientos mltiples son punto de partida (imput) de posteriores anlisis (predecir la estructura secundaria, plegamientos de protenas, construccin de rboles filogenticos, etc.). Existen diferentes mtodos y alogaritmos para generar alineamientos mltiples de un grupo de secuencias que se suponen homlogos (origen evolutivo comn). Para un anlisis exhaustivo de un alineamiento mltiple en muchos casos es importante evaluar la configuracin de determinados par-

23

metros. Muchas veces los alineamientos deben ser contrastados, analizados y hasta corregidos de forma manual. La solucin clsica se basa en la formacin de clusters de secuencias, los cuales se resuelven progresivamente. Dada una medida del parecido o semejanza entre dos secuencias, se eligen aquel par correspondiente al valor ms alto, y se alinean y agrupan entre s para formar un nico grupo o cluster de secuencias. A partir de este momento este cluster ser tratado como una sola secuencia, y el proceso se repetir hasta tener un solo cluster con todas las secuencias que intervenan en el alineamiento mltiple. Uno de los programas ms difundidos de este tipo es el CLUSTALW. La aplicacin de esta estrategia no garantiza resultados ptimos (en una primera etapa evala por coincidencias de residuos, por lo que si utilizara esquemas de puntuacin podran haber otras soluciones posibles con puntuacin mayor). Sin embargo, la calidad de los alineamientos es bastante aceptable, y permiten alinear algunos pocos cientos de secuencias. ClustalW es el mtodo ms antiguo funciona bien para secuencias relativamente parecidas, pero falla en el caso de secuencias ms distantes. En cambio, otro de los programas mas utilizados, el T-Coffee es un mtodo de alineamiento mltiple que funciona bien incluso cuando las similitudes entre las secuencias son bajas. La desventaja es que tiende a ser ms lento que ClustalW, especialmente a medida que aumenta el nmero de secuencias. Bases de datos de Motivos y Dominios. Al comparar varias protenas relacionadas es frecuente observar que mientras que la similitud global es baja, hay porciones que son similares. Ya sea para nucletidos o protenas estas similitudes pueden abarcan pocas posiciones bastante conservadas (motivos) o extenderse en una regin ms grande, posiblemente con menor similitud (dominios). Los motivos y dominios en protenas se relacionan frecuentemente con capacidades de interaccin o funcionales; mientras que para secuencias de ADN suelen relacionarse con secuencias de regulacin, interaccin con factores de transcripcin, etc. La capacidad de identificar dominios y motivos presentes en una secuencia, permite postular posibles funciones o estructura, que en muchos casos es necesario profundizar experimentalmente. Actualmente, basados en la gran cantidad de motivos y dominios caracterizados experimentalmente existen algoritmos bioinformticos para identificarlos en secuencias y tambin genomas completos. Se utilizan estos mtodos, por ejemplo, para realizar anotaciones en los genomas luego de secuenciarlos. Entre las bases de datos y herramientas para buscar perfiles, motivos y dominios distintos grupos de trabajos idearon diferentes mtodos para descubrir patrones en secuencias, por ejemplo: Prosite o Pfam. Por este motivo se recomienda que al analizar una secuencia se consulte ms de una base de datos para contrastar resultados. Para simplificar las bsquedas se cre InterPro, que es un agregador de varias bases de datos de dominios. InterPro (http://www.ebi.ac.uk/ InterPro) como tambin Conserved Domain Database (CDD) (http://www.ncbi.nlm .nih.govStructure/cdd/cdd. shtml) o SMART (http://smart.embl-heidelberg.de/) Otros sitios Web para trabajar con grupos especficos. Existen muchos sitios Web especficos para trabajar con plantas, microorganismos o con el genoma humano; incluyen herramientas para hacer anlisis BLAST contra bases de datos seleccionadas y muchas de las otras facilidades para continuar el anlisis. En su gran mayora estas bases de datos tambin estn presentes en las primarias como Gen-

bank, y por lo tanto son accesibles desde el NCBI. Sin embargo, al consultar desde estos sitios especficos se pueden acelerar las bsquedas u obtener resultados ms "limpios", porque nos restringimos a un grupo de inters particular. Plantas: Plant Genome Database (PlantGDB): http://www.plantgdb.org/cgi-bin/blast/PlantGDBblast Gramene. A Resource for Comparative Grass Genomics: http://www.gramene.org/multi/blastview GrainGenes. A Database for Triticiae and Avena: http://wheat.pw.usda.gov/GG2/blast.shtml The Arabidopsis Information Resource: http://www.arabidopsis.org/Blast SOL Genomics Network (Solanaceae and Ruaceae): http://www.sgn.cornell.edu/tools/blast/ Microorganismos: Microbes online IMG Integrated Microbial Genomes: http://img.jgi.doe.gov/cgi-bin/pub/main.cgi?page=home Fungal Genome Initiative: www.broad.mit.edu/cgibin/annotation/fgi/blast_page.cgi Resources for Fungal Comparative Genomics: http://fungal.genome.duke.edu/cgi-bin/fgblast Trypanosoma cruzi Genome Annotation Database. http://tcruzidb.org PARTE PRACTICA Primera parte. Sistemas de bsqueda de datos La gua de trabajo a desarrollar se basa en el artculo Geer, R.C. and Sayers, E.W. Entrez: Making use of its power. Briefings in Bioinformatics. 2003 4(2):1779-184. Los objetivos especficos de este tutorial son: 1) Identificar una secuencia representativa y bien anotada entre las millones de secuencias depositadas en la base de datos de nucletidos de GenBank. 2) Encontrar la bibliografa y las secuencias de protenas asociadas. 3) Identificar los dominios conservados en la secuencia de aminocidos deducida. 4) Identificar mutaciones en la secuencia nucleotdica. 5) Observar la secuencia codificante en el contexto genmico. Punto 1: Separar la paja del trigo. 1) Realizar una bsqueda no calificada de la base de datos de ENTREZ divisin Nucletidos para las palabras colon cancer (http://www.ncbi.nlm.nih.gov/Entrez/). Resultado: se encontrarn >20.000 secuencias asociadas a este trmino. Los resultados incluyen secuencias curadas, bien caracterizadas, secuencias de baja calidad (ESTs), contigs de proyectos genmicos, etc. 2) Limitar la bsqueda a la base de datos no-redundante Ref-Seq y restringir la bsqueda colon cancer al campo title. Resultado: el resultado incluye un grupo acotado de secuencias representativas. Para este ejemplo examinaremos en detalle el acceso NM_000249: Homo sapiens Mult. Homologue 1 (MLH1) y la informacin asociada a este gen. 3) Realizar una nueva bsqueda limitada a humanos en el campo Organism, combinar las dos bsquedas con el conector Booleano AND usando la opcin History. Resultado: el resultado se limita a pocas secuencias representativas. Punto2: Hacer una bsqueda transversal entre distintas bases de datos 4) Explorar en el vnculo Links para NM_000249 la asociacin a registros de PubMed.

24

Resultados: el buscador devuelve el nmero de artculos que ductos de reaccin que tienen el mismo extremo 5 terminal, discuten la informacin relevante para este gen como ma- pero diferentes extremos 3 (ver figura 1). peo, caracterizacin, fenotipo, etc. A principios de los 80, Lee Hood y colaboradores fueron los 5) Explorar en el vnculo Related Articles para pioneros en el desarrollo de esta metodologa. Ellos aplicaNM_000249. Resultados: el buscador devuelve los artculos ron por primera vez un sistema de deteccin fluorescente en que fueron encontrados usando un algoritmo que busca paralelo a una electroforesis en gel, lo que permiti precireferencias que poseen palabras similares en el campo ttu- samente la automatizacin del mtodo. Este instrumento lo, resumen y Medical Subject Headings (MeSH). comenz a ser comercializado por Applied Biosystems In6) Volver al acceso NM_000249 y explorar el vinculo corporated (ABI), y se convirti en el caballito de batalla en Protein. Resultado: Obtenemos la secuencia aminoacdica los comienzos del Proyecto Genoma Humano. El sistema correspondiente al acceso NM_000249. ABI utiliza los cuatro dinucletidos marcados con fluoro7) Explorar el vnculo Related sequences. Resultado: se cromos que emiten a longitudes de onda distintas. De esta obtendr una serie de secuencias de protenas similares que manera, puede llevarse a cabo una nica reaccin de sefueron identificadas con el algoritmo Blast. cuenciacin incluyendo las cuatro bases marcadas en un 8) Explorar el vnculo BLink`. Resultado: Obtenemos una mismo tubo, y resolver los productos de distinta longitud en vista grafica de los 200 alineamientos ms significativos a una sola calle del gel. El sistema ABI permite, adems, la la secuencia de inters. obtencin instantnea de los datos. Esto se logra a travs de Punto 3: Identificar dominios conservados la excitacin de la marca fluorescente activada por un lector 9) Volver al acceso correspondiente a la protena lser que se encuentra en el punto justo de la corrida elecNM_000249 y explorar el vnculo Domains. Resultado: trofortica, lo cual maximiza la resolucin de los fragmenobtenemos una lista de dominios conservados identificados tos. Usando este mtodo, se pueden obtener fragmentos en la secuencia de inters. confiables de secuencias de algo ms de 500 pares de bases Punto 4: Identificar mutaciones puntuales. (pb) en menos de cuatro horas. Ms recientemente se desa10) Volver al acceso correspondiente a NM_000249 y ex- rrollaron secuenciadores capilares que permiten la corrida plorar el vnculo SNP. Resultado: Obtenemos una lista de simultnea de 96 muestras que en solo dos horas arrojan las variaciones allicas depositadas por laboratorios inde- secuencias de hasta 1000 pb. pendientes a la base de datos dbSNP. Molcula de ADN original Punto 5: Visualizar el contexto genmico del gen y obtener la secuencia completa de la regin. Conjunto de 11) Explorar el vnculo Map Viewer para el link secuencias NP_000249. Una vez visualizada la regin en la cual esta cortas cuyos ubicado el gen de inters, componer el mapa adecuado para extremos se obtener la informacin necesaria para llevar adelante estusuperponen o dios mas profundos sobre el mismo. Resultado: Este recur- ............ATTCGAATCGCGATTGAAT CONTIGs so nos permite acceder a las referencias que usa GenBank CGATTGAATCGCGATTACGT...................... para estructural la regin cromosmica de inters, la cual puede ser usada para seleccionar marcadores, obtener los Figura 2. clones que representan la regin y otros recursos que facili- Secuenciacin Automtica tan el estudio detallado de la zona de inters. Los productos de reaccin que se siembran en el gel de Segunda parte. Edicin y anlisis de secuencias de ADN secuenciacin, provienen de un tipo particular de PCR (cyV.Confalonieri & V.Lia y modificado por R.Heinz cle sequencing) que implica, a diferencia de la PCR comn, Objetivos: la amplificacin desde un solo iniciador (one-side PCR). 1) Entrenarse en la interpretacin de cromatogramas de Adems, utiliza una Taq polimerasa modificada, y ciclos de secuencias provenientes de reacciones de secuenciacin temperatura que generan una gran cantidad de productos de automtica. cadena terminales a partir de una pequea cantidad de tem2) Entrenarse en el uso de programas de edicin de secuen- plado. En la actualidad existen otras tcnicas ms sofisticacias y en la construccin de CONTIGs de secuencias. das que pueden implementarse para secuenciar el ADN (p. 3) Realizar una bsqueda de homologa de secuencias en ej.: pirosecuenciacion, basada en deteccin quimioluminisuna base de datos mundial. cente de nucletidos incorporados o la utilizacin de CHIPs Introduccin. de secuenciacin, descripta en Brown, 1999 o Griffiths et El objetivo ltimo de un Proyecto Genoma es obtener la al, 2000). An con el desarrollo de estas nuevas tcnicas de secuencia de ADN completa de un organismo. En el marco secuenciacin, la obtencin de la secuencia completa de una de este tipo de proyectos, la tecnologa automatizada se ha molcula larga de ADN debe reconstruirse a partir de seconvertido en una de las herramientas de eleccin ya que cuencias ms cortas. Un conjunto de secuencias cortas que permite la recoleccin de datos a gran escala y en poco se superponen en sus extremos se denomina un CONTIG de tiempo. La secuenciacin automtica del ADN es un ejem- secuencias (ver figura 2). Es en este punto (y en muchos plo de aplicacin de este tipo tecnologas, la cual est reem- otros) en donde interviene la informtica como herramienta plazando cada vez ms a la forma manual debido a su costo indispensable para el desarrollo de Proyectos Genmicos. relativamente bajo, rapidez y mayor precisin en la obten- Como explicamos anteriormente existen programas que cin de los datos. permiten buscar superposiciones en secuencias y de este La secuenciacin automtica se basa en el mtodo de termi- modo reconstruir la secuencia original (Alineamientos: lonacin de la cadena por incorporacin de nucletidos di- cales y globales). Estos ltimos se basan en la comparacin deoxi (ddNTPs), dando como resultado la sntesis de pro- de son los que se utilizan para la bsqueda de extremos coincidentes en la construccin de CONTIGs, y tambin en

25

sos programas informticos, llamados buscadores de red (web browsers) permiten a los usuarios usar la interfase con la WWW, lo que, como es bien sabido, se logra a travs de computadoras personales conectadas a INTERNET. Es decir que actualmente, cualquier persona, pertenezca o no a un centro acadmico, puede acceder a una base de datos de secuencias de ADN. Existen muchas vas para acceder, pero uno de los ms convenientes es a travs del GenBank. Se muestra una serie de direcciones Web de utilidad para los genetistas moleculares. Desarrollo del Trabajo Prctico: Los alumnos debern editar una secuencia incgnita de aprox. 1300 pares de bases, utilizando para esto el programa BioEdit Sequence Alignment Editor (www.mbio.ncsu.edu/RnaseP/info/programa/ BIOEDIT/bioedit.html). Este programa (de utilizacin gratuita) permite abrir grficos de cromatogramas de secuencias, editarlos, armar CONTIGs (usando para esto subprogramas como el CLUSTAL y el CAP) y hacer bsquedas en INTERNET de secuencias homlogas mediante BLAST. La secuencia incgnita se construir a partir de 4 secuencias ms cortas que fueron amplificadas a partir de cebadores externos (Z1 y Z35) y cebadores internos (Z2 y Z33), como se indica en la siguiente figura.
Z33 Z35

950
5

1316
3 5

estudios de reconstruccin filogentica. Ambos programas, el CLUSTAL y el BLAST sern utilizados para el desarrollo de este trabajo prctico. 3 Acceso a la informacin sobre Gentica Molecular va Internet En la dcada de 1990 se vivi un gran desarrollo en todo lo relacionado con la informtica y la comunicacin de la informacin en general. La gentica molecular es una de las tantas disciplinas que se ha visto favorecida por este vertiginoso avance. En un principio, el objetivo de los cientficos de esta especialidad era el de almacenar y diseminar la informacin que se fuera obteniendo sobre datos de secuenDireccin de Internet Descripcin de la pgina (http:/) /www.nih.gov/ National Institute of Health /www.ncbi.nlm.nih.gov National Center for Biotechnol/ ogy Information /www.ncbi.nlm.nih.gov Sitio para iniciar una bsqueda /BLAST/ BLAST /www.ncbi.nlm.nih.gov Proyecto Anatoma del Genoma /ncicgap/ del Cancer. /gdbwww.gdb.org/ La base de datos del Genoma /www.genome.ad.jp/ Japan GenomeNet El instituto para la investigacin /www.tigr.org/ del Genoma Humano Instituto Tecnologa de Investi/wwwgacin del Genoma, Massachugenome.wi.mit.edu/ setts. /www.bio.net/ BIOSCI bio-net newsgroup. /www.elsevier.com/loc Elsevier Publishing technical ate/tto Tips. cias de ADN. Esta tarea se llevaba a cabo a travs de redes informticas subvencionadas por gobiernos, y que conectaban distintos centros acadmicos. Actualmente, en cambio, se utiliza INTERNET operando a travs de una poderosa interfase grfica, la World Wide Web (WWW). Esta red permite la apertura de archivos como objetos multimedia conectados por medio de direcciones de hipertexto. Diver-

5 3 1 Z1 Z2

5 3 350

3 5

Los cromatogramas correspondientes a los cuatro productos de amplificacin se encuentran en 4 archivos diferentes cuyos nombres y ubicacin en la computadora sern indicados por el docente. Para poder visualizarlos y analizarlos se seguirn los siguientes pasos: 1) Ingresar al programa BioEdit 2) Abrir la carpeta que contiene los cuatro archivos con los cromatogramas (seleccionando FILE, OPEN de la barra de herramientas), y dentro de ella, abrir uno de los archivos de secuencias. Se abrir una ventana que contiene una secuencia y su cromatograma correspondiente (bajo el ttulo ABI chromatogram) y otra ventana que contiene la secuencia escrita solamente o slo texto (bajo el ttulo DNA sequence), como lo muestra la figura 4. En ambos casos, dichas secuencias se encuentran numeradas cada 10 pares de bases. 3) Observar los cromatogramas en cuanto a los colores usados para cada base, forma de los picos, picos superpuestos y posiciones con base indeterminada (N). Identificar las regiones del cromatograma que permitan definir la secuencia con mayor certeza. Esta eleccin se basar en la presencia de picos bien definidos, baja frecuencia de superposicin de picos en una misma posicin que den lugar a bases no definidas (N), baja frecuencia de bases repetidas en tandem muchas veces. 4) Registrar las posiciones iniciales y finales de la porcin utilizable. 5) Dentro de cada regin elegida (porcin utilizable), ubicar las bases ambiguas (N) y resolverlas en base al cromatograma. Para esto, se debe primero transformar al cromatograma en editable, seleccionando VIEW, EDITABLE SEQUENCE.
Figura 3

26

6) Guardar los cambios. Para esto seleccionar la opcin EXPORT as FASTA del men FILE de la barra de herramientas y adjudicarle un nombre de archivo. 7) Repetir este procedimiento para cada secuencia. 8) Eliminar las regiones no utilizables de los cromatogramas de la siguiente manera: a) abrir los archivos recin creados; b) ubicarse sobre el nombre de la secuencia que aparece a la izquierda de la ventana (Ej.: PT/Z1); c) seleccionar la opcin EDIT SEQUENCE del men SEQUENCE de la barra de herramientas, lo que permitir que se abra una segunda ventana; e) pintar con el botn derecho del mouse las bases a borrar. Eliminar con DELETE, primero las ltimas de la secuencia y despus las primeras; f) oprimir APPLY and CLOSE. Las modificaciones se habrn incorporado a la ventana de secuencias slo texto; g) guardar los cambios con FILE, SAVE; h) repetir esto con cada secuencia. Armado de los CONTIGs de secuencias 1) Agrupar todas las secuencias en un mismo archivo. Para esto, ubicarse en cada ventana, pintar el nombre de la secuencia ubicado a la izquierda, seleccionar la opcin COPY SEQUENCE, del men EDIT y pegarlo en el archivo de destino con la opcin PASTE SEQUENCE, del mismo men EDIT. 2) Guardar el nuevo archivo (FILE, SAVE). 3) Para poder armar los CONTIGs, las cuatro regiones secuenciadas deben corresponderse a la misma hebra y deben estar escritas en la misma direccin (ej 5 3). Dada las caractersticas de los productos de amplificacin de los cuales provienen estas secuencias (figura 3), habr dos hebras que debern ser modificadas para que cumplan con ambos requisitos. Elegir las secuencias a modificar (pintar nombre de la izquierda) y seleccionar de la barra de herramientas SEQUENCE, NUCLEIC ACID, REVERSE COMPLEMENT. Luego guardar con FILE, SAVE. 4) Seleccionar las cuatro secuencias (pintando los nombres en la columna izquierda) y seleccionar ACCESORY APPLICATION y luego CAP (Contig Assembly Program). Apare-cer una ventana como lo muestra la figura 5. Elegir una superposicin mnima de 10 bases y 85% - 90% de homologa. Seleccionar RUN APPLICATION. Cerrar la ventana de DOS. Modificar los parmetros de tal manera de aumentar la rigurosidad y porcentaje de superposicin mnima. Pudieron armarse los CONTIGs? 5) Analizar la secuencia en las regiones de superposicin. Existen discrepancias en estas regiones o hay un 100% de coincidencia? Qu criterio utilizara para resolverlas?

6) Modificar el CONTIG (que aparecer como una secuencia ms por debajo de las otras en la ventana solo texto bajo el nombre de contig) en caso de encontrar errores. Para esto seleccionar la opcin EDIT SEQUENCE. Bsqueda de marcos abiertos de lectura (ORF) El programa buscar posibles codones de iniciacin (AUG) y codones STOP (UAG, UAA, UGA), de manera de determinar posibles marcos de lectura abiertos. Para ello seleccionar el CONTIG en la columna de la izquierda de la ventana solo texto, y elegir la opcin SEQUENCE, NUCLEIC ACID, SORTED SIX-FRAME TRANSLATION. Por qu encontr ms de un marco de lectura posible? Identificacin de la secuencia incgnita: bsqueda de homologa en INTERNET

Se proceder a identificar la secuencia con que trabajamos mediante un alineamiento local, utilizando el programa BLAST. Para ello seleccionar el CONTIG en la columna de

27

la izquierda de la ventana solo texto y seleccionar COPY SEQUENCE. Abrir vetana de Internet y copiar la direccion de NCBI: http://www.ncbi.nlm.nih.gov/ Elegir la opcin BLAST. Realizar una bsqueda en blatn y otra en blastx, pegando en cada caso la secuncia del CONTIG obtenido. Corresponder esta secuencia a una regin codificante? pudo homologarse a algn gen de algn organismo? a cul? existe homologa con un nico organismo? Por qu?. Compare los valores de significancia o scores obtenidso con ambas bsquedas. Bibliografa

Brown, T.A. 1999. Genomes. John Wiley & Son Inc., Publication. New York. Griffiths, A.J.F., Miller, J.H., Suzuki, D.T., Lewontin, R.C., Gelbart, W.M. 2000. An Introduction to genetic analysis. W.H. Freeman Publ., New York. Higgins, D.G. y Sharp, P.M. 1988. CLUSTAL: A package for performing multiple sequence alignement on a microcomputer. Gene 73: 237-244. Higgins, D.G. y Sharp, P.M. 1989. Fast and sensitive multiple sequence alignments on a microcomputer. CABIOS 5: 151-153. Hillis, D.M., Moritz, C., y Mable, B.K. 1996. Molecular Systemat>ClonA ics. Sinauer Associates, Inc. Sunderland, USA. Miesfeld, R. L. 1999. Applied Molecular Genetics. John Wiley & CCCGTTCGGCAAAGTCACAGCGAAAGAAAAATTTCTTGATATTGAASon Inc., Publication. New York. AAGAATATGTTACAAGTATGGCAGAATCAAGCTCTTAACTGAA-

empleadas frecuentemente en el estudio molecular de genomas virales. Desarrollo Se analizarn cuatro clones obtenidos a partir de una genoteca del MRCV, estudiando el nivel de identidad con otras secuencias depositadas en bases de datos pblicas y ubicando la posicin de los clones en el genoma del virus. 1. Identificar la carpeta Practica bioinformtica en el Escritorio de la computadora. Abrirla y localizar los archivos Clon A.txt, clon B.txt, clon C.txt, clon D.txt, all se encuentran la secuencia de cuatro clones correspondiente a la genoteca del MRCV. Abrir dichos archivos con el block de notas o Word. 2. Buscar en la base de datos Genbank utilizando el programa BLAST la identidad de los cuatro clones. A la secuencia enviada, la denominaremos secuencia query. Para ello acceder a travs de la pgina del NCBI, Seleccionar Nucleotide blast (blastn). 3. Copiar la secuencia de cada archivo y pegarla en la ventana del BLAST enter query sequence. En program me selection elegir somewhat similar sequence (Blastn). Enviar bsqueda (clic en blast). 4. Interpretar, analizar y discutir el resultado de las bsquedas con los docentes.

Tercera parte. Ana Distfano, Paula Fernndez, Norma Paniego Tutorial bases de datos 1) Uso de ENTREZ a) Utilizando ENTREZ, encontr cuntas protenas humanas tienen un dominio WAP Tipear human [orgn] AND WAP domain b) Acotar la bsqueda para encontrar cuantas protenas con este tipo de dominio estn localizadas en el cromosoma 20. Usar el buscador en la pgina principal de ENTREZ y tipear: 20 [chromosome] or [chr] AND human [organism] or [orgn] and WAP domain. 2) Estamos trabajando con el cDNA AF217525. Utiliz ENTREZ para obtener la secuencia FASTA y encontrar la siguiente informacin: a) Cul gen est codificado por este cDNA? b) Cuntos aminocidos tiene la traduccin? 2012 aa (la ms larga) c) Cules son los IDs de RefSeqs y confirmar si el gen fue manual o automticamente curado (NM o XM)? NM001389, NM indica que fue curado manualmente d) Qu dominios Pfam contiene la protena? Para ver el dominio en ENTREZ clickear en el link del dominio conservado bajo la protena refseq (cd00063:FN3; fibronectin type 3 domain) e) Utilizando NCBI Blast, cul es el nmero de acceso manualmente curado por RefSeq que tiene una identidad del 100% a este cDNA? Por qu hay un gap en el match contra s mismo? f) Cul es el nmero de acceso de RefSeq y el cDNA que tiene mejor similitud con ratn? URLs Entrez: http://www.ncbi.nlm.nih.gob./Entrez/ Blast searches: http://www.ncbi,nlm.nih.gob./BLAST Tutorial BLAST Objetivo Familiarizarse con el uso de herramientas bioinformticas y consulta de bases de datos disponibles a travs de internet,

AGCGAATACGCCTCCAAATTACTATTGAAAGAAAGTGCTATGGATGGGATAATTGCCAATGCCGTTAGAGATTAGAAAAACATTATTTGGAGAAATACGGTTAACCACAGAAATAATTGAATCATAATTAAAAGACATTGCTTTAGTTCTCAATAATGCTAGCGATTTAATTTTAAAACTATTCGAAAACGACGGTGGTATTGAAAAATCTTGCATCATTCCAATTTCAGTAATTGAAAAAGACATTTTTGGCGTACTACATCCGATTG >ClonB TTGAAAAAGACATTTTTGGCGTACTACATCCGATTGAAATCTTTGATTTTAATGCTTTTGGTATCGATGAAGTTAACAATTTAGCTATAAATCCTAAAATCCGTTACCTGCCAAATTGCATTGTTCAGAAATTTAGAGATACCATAGATAACTTAAAAGATGAAAGTTCATATGTTAAAGCTAAATCATTGTCAAAAGAATATGGTATAGTTTGTAATTGAATGAAAAGACAATAGTTAATTGGCGTAGATAGAATGTTTAATAAGTTAAGTATTCAGCATAGGTTTGGAACTTTTGAAAGTCAAATGTTTAGAAGTTTTCTTATGAGGCAAATTCTTACAGAGGATCAGTCATATGTTAATTAACCAGAATGTGTCTCGAAGAAAAGTATTCAGAAGCGTGGTGTTGATACTGTTTGTTGGCAAAATTTACGTGAAATTGTACATCATAATGGTTCCTTTCCATTTTATCATCATACACATAGTTCAAATTTTGGAGTCTAAGATAGTACTCGTATTTCAATCCACACTGATAA >ClonC ATAATCTCAATAAATATTTGGATGGAAATCGTGTATTGATGAGTTAAAATAGTATTGCTGTGCTACGTTCCCGCAAAATTGAAGTTTCATTTGGACTCATGTATGTCAATCATAATCGATCGAAAATTGATCAATCCTTGACAGTAAGAACTGAATCATTGGAAGAGCGATTATCTTTGGATTCAATATTCTTGAAACATGTATTATATTACAAAAAGGTTCCCAGTGATATTGAAGTTCTGAAGACGCACGCGCTTTGTTCAGTTAGATTGAGACGATATGGTGACTTTGATTACGCAGTTGAGCACGACGGATTAATTCAACCTAGTGAAGATTCGAGGTTTAATGTAATTTTACCATTTTTACCCGGATATCATTTAAATAGTTCTTACGGAAAGCTTTTCTTATATTCTAGTTTACCAACGGTGCATGACAGAGACATCTCAGGAACTTTAGGAGAGATTACAGGATCATTAGGAGCAGCTTATGATGTTGATTCAGCAGTAGAGTTTGGAGCACATGTATATAATATAAATCCTAGTTTAGTTGATGCTGCTGGTGCCGCTATTGGTATACCTCAAAGTTTACTTAAAAATTATAAAAATTTAGTTGATGCTTTCATTACGAACAATTTTAATCTAAAATATCATTCAATTTTTCAGAATGTTAAATACAATGGTTTAAATGGCAGTTTGAATCTATTCTCATCATTTGGCGATTATTCCAGTAGACTAGTACGGTTTGACGTGATTATAAAATTGTCAAAGTTTCATTTTGTA >ClonD

28
TGTTTTCAAGACTAAAAACGTTTTTAGAAATTGCCGCTAATTGTAATCTTGTAATGCGAGGTTGTCGTACAAAGCCACTTTCTATAGAATACGAAAATACAGCTATTTCAAAGAAACTTGCAGGTAAAAAGATACTTTATAATGACAGAGCGCACATAATATTTAATGGAATATATCATGCAGTTACTCCATTTATGAATAAAATCAATGATATGTTGATGGATGGTAATACTGAAATTAATTTTGATCAGATTTACAAATTCGGAAGAACGATAATTACAAAAATTAATACATATGATATGGTTTGTAAAGGTTATAGTAATATTGATCAGTTCACAGCATATTTAGTCAATCAAGCTACTCAACGAGTTATTGACAACAGAATGACAGCTAATAAATATAAAAC

Cuarta parte. Pablo Nez En esta cuarta parte vamos a estudiar un gen forma parte del sistema de secrecin: Type IV (Conjugal DNA-Protein Transfer or VirB) Secretory Pathway (IVSP) Family. Este sistema formado por mltiples subunidades proteicas forma un complejo que abarca las dos membranas bacterianas (interna y externa) y a travs de un poro permite la secrecin de macromolculas (Ej.: complejos DNA-Protenas) desde el citoplasma a una clula receptora (hacia otras bacterias, levaduras o plantas) al exterior. El sistema VirB de Agrobacterium tumefaciens es el encargado de transferir el plsmido T hacia clulas de plantas. El complejo proteico VirB esta formado por un gran nmero de protenas responsables del complejo proteico, sin embargo, las 11 protenas esenciales parecen ser VirB2-11 y VirD4. 1) Ingresar a la base de datos de ENTREZ y buscar en la base de datos de protenas, el gen gi|16119792. 2) Obtener su secuencia en formato FASTA. Copiarla en un documento de texto. 3) Buscaremos el gen homologo de VirB10 en otra bacteria llamada Ehrlichia ruminantium str. Gardel. Obtener su secuencia en formato FASTA. Copiarla en un documento de texto. Para esto debers utilizar el BLAST, seleccionando BLAST Assembled Genomes, seleccionando especficamente la bacteria sobre la cual realizar la bsqueda, para hacer ms rpido el proceso. 4) Repetiremos el proceso con otra protena del complejo de A tumefaciens cuyo cdigo de identificacin del Genbank es: gi|16119786 5) Vamos a ver la organizacin del genoma de estos organismos. Para esto podremos usar un servidor muy utilizado denominado KEGG (http://www.genome.jp/kegg) 6) Ir a Select organism > Tipear el organismo (erg o Ehrlichia ruminantium Gardel) > GO. Aqu disponemos de toda la informacin disponible del organismo a estudiar.

7) Ir a Gene catalogs y tipear el gen sobre el cual queremos estudiar: VirB10 8) Entre la informacin relacionada con este gen se encuentra, la posicin en el genoma y tambin un link hacia el Genome map. Veamos el contexto genmico del gen. 9) Realizar lo mismo para el gen VirB4. 10) Realizar lo mismo para uno de los genes en Agrobacterium tumefaciens. Que observa para la posicin relativa de estos genes relacionados en cada uno de los organismos? Qu observa la organizacin de los genes que conforman el complejo VirB? Alternativamente para visualizar los genes en el genoma se puede utilizar el se puede utilizar el programa Map Viewer del ENTREZ. Para esto seleccionar Map viewer > Small genomes bacteria > Ehrlichia ruminantium Gardel > Clikear en el cdigo del cromosoma circular NC_006831. Insertar en la forma grafica de organizacin de genes en el genoma Insertar VirB10: Observar el contexto Insertar VirB4: Observar el contexto Un grupo de investigacin describi una cepa mutante de Ehrlichia ruminantium Gardel, para el gen ERGA_CDS_03000 demostrando que la cepa posea un sistema VirB inactivo y por lo tanto eran incapaces de infectar clulas en cultivo. Al parece esta protena hipottica, podra tener algn rol en la funcionalidad del sistema. Cmo obtener informacin que permita hipotetizar acerca de la funcionalidad y rol de esta protena? >gi|58617027|ref|YP_196226.1| hypothetical protein ERGA_CDS_03000 [Ehrlichia ruminantium str. Gardel] MIDQGYFVFANLWYKIMTTISKTNDYTIKYRILKLIKDITYNNHWNQVTSAKILGVDQPKISHISNGKTA GFSLERLLIFLLRLKCDINITITVNNSEIALINKDSISDKSLESINLVILQKNN 11) Realizar un BLASTp con la secuencia ERGA_CDS_03000. Qu anotaciones encuentra par alas protenas homologas? 12) Incursione en los programas de bsqueda de dominio: - Ir a > All links from this record >Protein Clusters > INTERPRO Qu puede concluir respecto a la hipottica funcin de esta protena en la regulacin de este sistema?

Genmica funcional: Transformacin mediada por Agrobacterium tumefaciens de Arabidopsis thaliana: Floral Dip
Introduccin La transformacin gentica de plantas mediada por A. tumefaciens ya fue vista en Gentica I y se estudia en profundidad en materias como Agrobiotecnologa. Se incluye la fig 1 para repaso del proceso con los principales eventos involucrados. La transformacin de Arabidopsis por infiltracin en vaco de las inflorescencias con una suspensin de Agrobacterium fue primero introducida por Bechtold et al. Este mtodo de transformacin ha sido ampliamente utilizado ya que produce directamente semillas transformadas, sin involucrar etapas de cultivo de tejidos. Este mtodo de transformacin fue luego modificado por Clough y Bent, quienes demostraron que la tcnica es igualmente efectiva sin la infiltracin Diseado por Diego Zavallo y Gabriela Llauger en vaco, ya que la inmersin de inflorescencias de Arabidopsis en una suspensin de Agrobacterium en presencia del surfactante Silwet L-77 y sacarosa, es suficiente para generar semillas transformadas con una eficiencia de 0,5 3%. El medio de cultivo de tejidos, los ajustes de pH, los reguladores de crecimiento de la planta y el cultivo de Agrobacterium o sus distintas diluciones no resultaron esenciales para una transformacin exitosa y de alto rendimiento (Clough y Bent, 1998). El floral dip o inmersin floral es hoy en da el mtodo ms utilizado para la transformacin de Arabidopsis para estudios de genmica funcional in planta debido a su sencillez y rapidez. Para distinguir transformantes de no transformantes se requiere la presencia de un marcador de seleccin,

29

usualmente la resistencia a un antibitico o herbicida (Samuel et al. 2006).


Fig 1: Resumen de los principales eventos moleculares y estructuras dentro de la clula de Agrobabterium que generan la maquinaria de protenas Vir y la regin T que es transportado luego a la clula vegetal, llega a su ncleo y se integra en el genoma. (Tomado de Citovsky et al., 2007.)

Objetivo Generar plantas transgnicas de Arabidopsis thaliana que expresen constitutivamente GFP (green fluorescent protein) mediante la tcnica de floral dip. Se utilizar una suspensin de la cepa GV3101 de Agrobacterium tumefaciens que contiene el gen GFP en un vector binario. Materiales y Mtodos Protocolo de Transformacin de Arabidopsis La siguiente es una versin simplificada del protocolo de Bechtold et al. 1993, modificada por Clough y Bent en 1998. Ellos probaron que las concentraciones de sales, hormonas, la OD de la suspensin bacteriana o el vaco no son tan importantes siempre y cuando se tenga una cantidad suficiente de surfactante presente. S es importante tener en cuenta que el buen estado fisiolgico de la planta siempre es un factor clave para obtener buenos resultados, y este protocolo puede dar rendimientos cercanos al 1% (una transformante por cada 100 semillas cosechadas de una planta tratada) (Figura 2).

los antibiticos apropiados para seleccionar el plsmido binario. Incubar con agitacin (200 rpm) a 28C O.N. 4. Centrifugar el cultivo de bacterias durante 15 min a 4.000 rpm y a 4C, resuspender las bacterias en una solucin de sacarosa 5% y llevar a OD600 = 0,8. 5. Antes de la inmersin, agregar Silwet L-77 a una concentracin final de 0,05% (500 l/l) y mezclar. 6. Sumergir las inflorescencias de las plantas en la solucin de Agrobacterium por 30 seg con agitacin suave. 7. Acostar y cubrir las plantas durante 24 hs para mantener la humedad y mantener en oscuridad. 8. Cultivar las plantas y cubrir las inflorescencias para poder cosechar las semillas (aprox. 3 semanas). Dejar de regar para que las semillas maduren. 9. Cosechar Col 0 Cosecha Seleccin de semillas. Col 0 Floral Dip semillas T1 transformantes 10. Seleccionar las transformantes usando un antibitico o Seleccin herbicida HH (1:3), como agente Hh (2:2), de seleccin. hh (1:3) 11. TransCol Cosecha plantar las semillas T2 posibles transClula de A. tumefaciens formantes a maceta. Cultivar y evaluar la presencia del transgn. Figura 2: Esquema general de la tcnica del floral dip. Para mejorar las eficiencias de transformacin, se pue1. Cultivar Arabidopsis (deben tener aspecto saludable) de repetir el floral dip dos o tres veces con intervalos hasta que comiencen a florecer, en condiciones controde una semana. ladas. Esquema de los vectores utilizados 2. (Opcional) Cortar los primeros pednculos florales para La cepa GV3101 de Agrobacterium contiene el plsmido Ti favorecer la aparicin de ms pednculos secundarios modificado que aporta los genes Vir de virulencia pero que (crecimiento lateral). Las plantas estarn listas 4-6 das no contiene la regin T-DNA. En la Figura 3 se muestra el despus. Las ptimas son aquellas que tienen muchas sistema binario que se utilizar en el TP. flores inmaduras y pocas silicuas fertilizadas. El vector binario posee el gen de inters -en este caso GFP 3. Realizar un cultivo lquido de la cepa GV3101 de Agrobajo el control del promotor constitutivo 35S- y el marcador bacterium tumefaciens que lleva la construccin de inde seleccin resistencia a kanamicina- flanqueados por los ters en un vector binario. Con este objetivo, picar una bordes derecho e izquierdo (RB y LB) de la regin T-DNA colonia aislada y cultivarla en medio de cultivo LB con (Figura 2B).

El vector que contiene el gen GFP se denomina binario porque requiere de las funciones vir del plsmido Ti acompaante para poder transferir el T-DNA a la planta. No tan frecuentemente se lo denomina tambin shuttle (combinado) porque posee un origen de replicacin y un gen marcador seleccionable que le permite replicar y ser seleccionado tanto en E. coli como en A. tumefaciens (estreptomicina/ espectinomicina, Sm/SpR) Preguntas 1. Cul es la principal diferencia entre Floral Dip y la agroinfiltracion? 2. Se pueden evaluar promotores con esta tcnica? 3. Es necesario llegar a homocigosis? Por qu? En qu casos no sera estrictamente necesario obtener plantas homocigotas? 4. Por qu es importante tratar de obtener una relacin 3:1 en la T2? 5. De qu otra manera se puede identificar transformantes sin utilizar la seleccin por antibiticos? Qu genes utilizara?
Figura 3: Esquema del sistema binario que se utilizar para la transformacin gentica de A. thaliana
plsmido sin TDNA
attB 2 Egf p T35 S Ka n

Promotor 35S omega attB 1 R B

pbinario-35S:GFP
10603 bp

L B Sm/S pR

con el gen GFP

Referencias
Bechtold, N., Ellis, J., and Pelletier, G. (1993). In planta Agrobacterium-mediated gene transfer by infiltration of adult Arabidopsis thaliana plants. C. R. Acad. Sci. Paris, Life Sciences 316:1194-1199. Steven J. Clough and Andrew F. Bent. Floral dip: a simplified method for Agrobacterium-mediated transformation of Arabidopsis thaliana. The Plant Journal. (1998) 16(6), 735743. Citovsky, V; Kozlovsky, S V; Lacroix, B; Zaltsman, A; Dafny-Yelin, M; Vyas, S; Tovkach A; Tzfira T. Biological systems of the host cell involved in Agrobacterium infection. Cellular Microbiology (2007) Samuel J Harrison, Ellie K Mott, Kate Parsley, Sue Aspinall, John C Gray and Amanda Cottage. A rapid and robust method of identifying transformed Arabidopsis thaliana seedlings following floral dip transformation. Plant Methods 2006, 2:19 (1), 920 Matzke, A. J. M., and Chilton, M-D. (1981) Site-specific insertion of gene into T-DNA of the Agrobacterium tumor-inducing plasmid: An approach to genetic engineering of higher plant cells. J. Mol. Appl. Genet. 1: 3949. http://genome-www.stanford.edu/cgibin/biosci_arabidopsis http://4e.plantphys.net/article.php?ch=t&id=216

Algunas Reglas Bsicas de Higiene y Seguridad en Laboratorios


Las medidas de Seguridad en Laboratorios son un conjunto de medidas preventivas destinadas a proteger la salud de los que all se desempean frente a los riesgos propios derivados de la actividad, para evitar accidentes y contaminaciones tanto dentro de su mbito de trabajo, como hacia el exterior. Las reglas bsicas aqu indicadas son un conjunto de prcticas de sentido comn realizadas en forma rutinaria.

30 El elemento clave es la actitud proactiva hacia la seguridad y la informacin que permita reconocer y combatir los riesgos presentes en el laboratorio. Ser fundamental la realizacin meticulosa de cada tcnica, pues ninguna medida, ni siquiera un equipo excelente puede sustituir el orden y el cuidado con que se trabaja. 1. Se deber conocer la ubicacin de los elementos de seguridad en el lugar de trabajo, tales como: matafuegos, salidas de emergencia, mantas ignfugas, lavaojos, gabinete para contener derrames, accionar alarmas, etc. 2. No se permitir comer, beber, fumar o maquillarse. 3. No se debern guardar alimentos en el laboratorio, ni en las heladeras que contengan drogas. 4. Se deber utilizar vestimenta apropiada para realizar trabajos de laboratorio y cabello recogido (guardapolvo preferentemente de algodn y de mangas largas, zapatos cerrados, evitando el uso de accesorios colgantes). 5. Es imprescindible mantener el orden y la limpieza. Cada persona es responsable directa de la zona que le ha sido asignada y de todos los lugares comunes. 6. Las manos deben lavarse cuidadosamente despus de cualquier manipulacin de laboratorio y antes de retirarse del mismo. 7. Se debern utilizar guantes apropiados para evitar el contacto con sustancias qumica o material biolgico. Toda persona cuyos guantes se encuentren contaminados no deber tocar objetos, ni superficies, tales como: telfono, lapiceras, manijas de cajones o puertas, cuadernos, etc. 8. No se permitir pipetear con la boca. 9. No se permitir correr en los laboratorios. 10. Siempre que sea necesario proteger los ojos y la cara de salpicaduras o impactos se utilizarn anteojos de seguridad, viseras o pantallas faciales u otros dispositivos de proteccin. Cuando se manipulen productos qumicos que emitan vapores o puedan provocar proyecciones, se evitar el uso de lentes de contacto. 11. No se deben bloquear las rutas de escape o pasillos con equipos, mquinas u otros elementos que entorpezcan la correcta circulacin. 12. Todo material corrosivo, txico, inflamable, oxidante, radiactivo, explosivo o nocivo deber estar adecuadamente etiquetado. 13. No se permitirn instalaciones elctricas precarias o provisorias. Se dar aviso inmediato a la Secretara Tcnica en caso de filtraciones o goteras que puedan afectar las instalaciones o equipos y puedan provocar incendios por cortocircuitos (Interno 355). 14. Se requerir el uso de mascarillas descartables cuando exista riesgo de produccin de aerosoles (mezcla de partculas en medio lquido) o polvos, durante operaciones de pesada de sustancias txicas o biopatgenas, apertura de recipientes con cultivos despus de agitacin, etc. 15. Las prcticas que produzcan gases, vapores, humos o partculas, aquellas que pueden ser riesgosas por inhalacin deben llevarse a cabo bajo campana. 16. Se deber verificar la ausencia de vapores inflamables antes de encender una fuente de ignicin. No se operar con materiales inflamables o solventes sobre llamas directa o cerca de las mismas. Para calentamiento, slo se utilizarn resistencias elctricas o planchas calefactoras blindadas. Se prestar especial atencin al punto de inflamacin y de autoignicin del producto. 17. El material de vidrio roto no se depositar con los residuos comunes. Ser conveniente ubicarlo en cajas resistentes, envuelto en papel y dentro de bolsas plsticas. El que sea necesario reparar se entregar limpio al taller. 18. Ser necesario que todo recipiente que hubiera contenido material inflamable, y deba ser descartado sea vaciado totalmente, escurrido, enjuagado con un solvente apropiado y luego con agua varias veces. 19. Est prohibido descartar lquidos inflamables o txicos o corrosivos o material biolgico por los desages de las piletas, sanitarios o recientes comunes para residuos. En cada caso se debern seguir los procedimientos establecidos para la gestin de residuos. Consultar al Servicio de Higiene y Seguridad (Interno 275). 20. Cuando sea necesario manipular grandes cantidades de materiales inflamables (ms de 5 litros.) deber tenerse a mano un extintor apropiado para el material en cuestin. 21. Cuando se trasvase material combustible o inflamable de un tambor a un recipiente ms pequeo, realice una conexin con una cadena del tambor a tierra y con otra entre el tambor y el recipiente de manera de igualar potenciales y eliminar la posible carga esttica. 22. Al almacenar sustancias qumicas considere que hay cierto nmero de ellas que son incompatibles pues almacenadas juntas pueden dar lugar a reacciones peligrosas. Ante dudas consultar al Servicio de Higiene y Seguridad (Interno 275). 23. No almacene en estantes sobre mesadas sustancias corrosivas, hgalo en estantes bajo mesadas y en caso de cidos o lcalis

concentrados (mayor de 2N) deben ser mantenidas dentro de lo posible en bandejas de material adecuado. 24. Los cilindros de gases comprimidos y licuados deben asegurarse en posicin vertical con pinzas, grampas y correas o cadenas a la pared en sitios de poca circulacin, protegidos de la humedad y fuentes de calor, de ser posible en el exterior. 25. Los laboratorios contarn con un botiqun de primeros auxilios con los elementos indispensables para atender casos de emergencia. 26. Se informar al Dpto. de Seguridad y Control cuando se necesiten dejar equipos funcionando en ausencia del personal del laboratorio. 27. Se anotar en un lugar visible desde el exterior los telfonos de los responsables de cada laboratorio para que puedan ser consultados en caso de alguna anomala verificada por el personal de Seguridad y Control en su recorrida fuera de los horarios habituales de trabajo. Procedimientos ante emergencias Emergencias mdicas Si ocurre una emergencia tal como: cortes o abrasiones, quemaduras o ingestin accidental de algn producto qumico, txico o peligroso, se deber proceder : 1. A los accidentados se les proveern los primeros auxilios. 2. Simultneamente se tomar contacto con el Servicio Mdico (Interno 482), o al Servicio Mdico de Deportes (784-4351 / 3948) 3. Avise al Jefe de Laboratorio o autoridad del Departamento, quienes solicitarn asistencia de la Secretara Tcnica (interno 380) para que enven personal del Dpto. de Mantenimiento, Seguridad y Control o Servicios Generales segn correspondan. 4. El Jefe de Departamento notificar el accidente al Servicio de Higiene y Seguridad para su evaluacin e informe, donde se determinarn las causas y se elaborarn las propuestas para modificar dichas causas y evitar futuras repeticiones. 5. Centros para requerir ayuda mdica: S.A.M.E. Telfono 107 Hospital Pirovano Av. Monroe 3555 Tel. 4542-5552 / 9279 INTOXICACIONES: Hospital de Nios. Dr. R. Gutirrez
Snchez de Bustamante 1399. Capital Federal. Tel: 4962-6666. Hospital de Nios. Dr. P. de Elizalde Av. Montes de Oca 40 Tel. 43077491 Toxicologa 4300-2115 QUEMADURAS : Hospital de Quemados P. Goyena 369 Tel. 4923-4082 / 3022 OFTALMOLOGA Hospital Santa Luca San Juan 2021 Tel. 4941-7077 Hospital Dr. P. Lagleyze Av. Juan B. Justo 4151 Tel. 4581-0645 / 2792

31 2. Si hay alarma, accinela. Si no grite para alertar al resto. 3. Se dar aviso inmediatamente al Dpto. de Seguridad y Control (Interno 311) informando el lugar y las caractersticas del siniestro. 4. Si el fuego es pequeo y sabe utilizar un extintor, selo. Si el fuego es de consideracin, no se arriesgue y manteniendo la calma ponga en marcha el plan de evacuacin. 5. Si debe evacuar el sector apague los equipos elctricos y cierre las llaves de gas y ventanas. 6. Evace la zona por la ruta asignada. 7. No corra, camine rpido, cerrando a su paso la mayor cantidad de puertas. No utilice ascensores. Descienda siempre que sea posible. 8. No lleve consigo objetos, pueden entorpecer su salida. 9. Si pudo salir por ninguna causa vuelva a entrar. Deje que los equipos especializados se encarguen. Telfonos tiles
BOMBEROS Telfono 100 DIV.CENTRAL ALARMA: 3812222/3832222/3042222 CUARTEL V DE BELGRANO: Obligado 2254 Capital Tel. 783-2222 BOMBEROS DE VICENTE LPEZ Av. Maip 1669 Vicente Lpez. Tel. 795-2222 BOMBEROS DE SAN ISIDRO: Santa Fe 650 Martnez. Tel. 747-2222

Incendio 1. Mantenga la calma. Lo mas importante es ponerse a salvo y dar aviso a los dems. CUPN PARA ENTREGAR AL DOCENTE Fecha: El /La alumno/a.............................................................................................................. ............. de la materia................................................................................................................................ ha ledo minuciosamente la gua de Normas Mninas de Seguridad que acompaa esta gua.

Derrame de productos qumicos 1. Atender a cualquier persona que pueda haber sido afectada. 2. Notificar a las personas que se encuentren en las reas cercanas acerca del derrame. Coloque la cinta de demarcacin para advertir el peligro. 3. Evacuar a toda persona no esencial del rea del derrame. 4. Si el derrame es de material inflamable, apagar las fuentes de ignicin, y las fuentes de calor. 5. Evite respirar los vapores del material derramado, si es necesario utilizar una mscara respiratoria con filtros apropiados al tipo de derrame. 6. Ventilar la zona. 7. Utilizar los elementos de proteccin personal tales como equipo de ropa resistente a cidos, bases y solventes orgnicos y guantes. 8. Confinar o contener el derrame, evitando que se extienda. Para ello extender los cordones en el contorno del derrame. 9. Luego absorber con los paos sobre el derrame. 10. Deje actuar y luego recoger con pala y colocar el residuo en la bolsa roja y cirrela. 11. Comunquese con el Servicio de Higiene y Seguridad para disponer la bolsa con los residuos. 12. Si el derrame es de algn elemento muy voltil deje dentro de la campana hasta que lo retire para su disposicin. 13. Lave el rea del derrame con agua y jabn. Seque bien. 14. Cuidadosamente retire y limpie todos los elementos que puedan haber sido salpicados por el derrame. 15. Lave los guantes, la mscara y ropa

Lista de Alumnos EGE: es una lista de distribucin de informacin para alumnos del Departamento de Ecologa, Gentica y Evolucin, acerca de becas, cursos y otras cuestiones de inters. No es una lista de discusin. Puede Ud. suscribirse a la lista en: http://www.ege.fcen.uba.ar/mailman/listinfo/alumnos o accediendo desde el link en la pgina del Departamento. Tambin en esta pgina encontrar los correos electrnicos de los representantes estudiantiles del EGE, para realizar cualquier consulta.