Scribd
Upload
65 views2 pages

HTR2A Gene Partial CDS Sequence

The document describes a partial coding sequence of the human serotonin receptor 2A gene (HTR2A) from an individual with the HTR2A-C allele. It includes information on the source organism, references, and features of the sequenced region such as the gene, mRNA, CDS, and translated protein sequence.

Uploaded by

dilla nurul
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as DOCX, PDF, TXT or read online on Scribd
65 views2 pages

HTR2A Gene Partial CDS Sequence

The document describes a partial coding sequence of the human serotonin receptor 2A gene (HTR2A) from an individual with the HTR2A-C allele. It includes information on the source organism, references, and features of the sequenced region such as the gene, mRNA, CDS, and translated protein sequence.

Uploaded by

dilla nurul
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as DOCX, PDF, TXT or read online on Scribd

Homo sapiens serotonin (HTR2A) gene, HTR2A-C allele,

partial cds
GenBank: JX682563.1
FASTA Graphics
Go to:

LOCUS JX682563 395 bp DNA linear PRI 09-JAN-


2013
DEFINITION Homo sapiens serotonin (HTR2A) gene, HTR2A-C allele, partial cds.
ACCESSION JX682563
VERSION JX682563.1
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 395)
AUTHORS Sujitha,S.P. and Anilkumar,G.
TITLE Serotonin Receptor 2A Polymorphism in Schizophrenia patients of
Vellore (Indian) population
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 395)
AUTHORS Sujitha,S.P. and Anilkumar,G.
TITLE Direct Submission
JOURNAL Submitted (12-SEP-2012) Medical Biotechnology, Molecular
Endocrinology Lab, VIT University, Katpadi, Vellore, Tamil Nadu
632014, India
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..395
/organism="Homo sapiens"
/mol_type="genomic DNA"
/db_xref="taxon:9606"
/haplotype="CC"
/PCR_primers="fwd_seq: caaggtgaatggtgagcagaaa, rev_seq:
tggcaagtgacatcaggaaatagt"
gene <40..>395
/gene="HTR2A"
/allele="C"
mRNA <40..>395
/gene="HTR2A"
/allele="C"
/product="serotonin"
CDS 40..>395
/gene="HTR2A"
/allele="C"
/note="5-HT"
/codon_start=1
/product="serotonin"
/protein_id="AGB76027.1"

/translation="MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFN

WTVDSENRTNLSCEGCLSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLE
KKLQNATNYFLMSLAK"
ORIGIN
1 ccgccgggct tcaatctcgc tacaagttct ggcttagaca tggatattct ttgtgaagaa
61 aatacttctt tgagctcaac tacgaactcc ctaatgcaat taaatgatga caccaggctc
121 tacagtaatg actttaactc cggagaagct aacacttctg atgcatttaa ctggacagtc
181 gactctgaaa atcgaaccaa cctttcctgt gaagggtgcc tctcaccgtc gtgtctctcc
241 ttacttcatc tccaggaaaa aaactggtct gctttactga cagccgtagt gattattcta
301 actattgctg gaaacatact cgtcatcatg gcagtgtccc tagagaaaaa gctgcagaat
361 gccaccaact atttcctgat gtcacttgca aaaag
//

You might also like