Professional Documents
Culture Documents
Uds-Kelimeler Kitabı
Uds-Kelimeler Kitabı
KPDS & DS
Dr. Hikmet ahiner
VOCABULARYFORKPDS&DS 1 ____________________________________________________________________________________
VERB&ADJECTIVE COLLOCATIONS
FORKPDS&DSTESTS
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
r.
2 DR.HKMETAHNER _____________________________________________________________________________________________
accountforHesapvermek Heaccountedforsuchproblems.
agreeonAnlamak Weagreedontheprice.
Theyadaptedtothenewculture.
addSO/STtoSO/STEklemek Sheaddedmilktothegrocerylist.
addtoNedenolmak
Translationproblemsaddedtothe confusion.
adjusttoAlmak
Theyadjustedtotheirnewenvironment.
admitSTtoSOtirafetmek
Sheadmittedherrealagetoeverybody.
admittoItirafetmek Sheadmittedtocheatingonthetest.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Iagreewithyou. apologizetoSOforSTzr dilemek Iapologizedtoherforbeingrude. appealtoSOforSTBavurmak ThenationappealedtotheUNfor assistance. approveofOnaylamak Theparentsapprovedofthemarriage. arguewithSOaboutSO/ST Tartmak Timmyarguedwithhisfatherabouthis curfew.
adapttoAdapteolmak
agreewithAynfikirdeolmak
r.
VOCABULARYFORKPDS&DS 3 ____________________________________________________________________________________
arrestSOforSTTutuklamak
Thepolicearrestedthemanforstealing thecar.
arriveat(aplace)Gelmek
Theyarrivedathome.
askforIstemek Sheaskedforhelp.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
beaddictedtoSTBaml olmak Heisaddictedtoheroin. beafraidofKorkmak Iamafraidofspiders. beangryatSOforSTKzgn olmak Iamangryathimforwhathesaid. beangrywithSOforSTKzgn olmak Iamangrywithhimforwhathesaid. beannoyedatSOforST Bozulmak Heisannoyedatherforspendingso muchmoney.
r.
4 DR.HKMETAHNER _____________________________________________________________________________________________
beassociatedwithlgisiolmak Heisassociatedwiththecompany.
beawareofFarkndaolmak
Youarenotawareofalltheproblems.
beblessedwithSahipolmak
Heisblessedwithgreatmusicaltalent.
r.
beboredbySklmak
Theywereboredtodeathbyhislong speech.
w w
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
becommittedtoKararlolmak Iamcommittedtoimprovingmy languageskills. becomposedofOlumak Themeteoriteiscomposedmostlyof iron. beconcernedaboutEndie etmek Iamconcernedabouthissmoking. beconnectedtoBalolmak TheDVDplayerisconnectedtotheTV. beconnectedwithlgiliolmak Theyareconnectedwiththeproject. becontentwithMemnunolmak Heiscontentwiththeresults.
VOCABULARYFORKPDS&DS 5 ____________________________________________________________________________________
beconvincedofSTknaolmak Weareconvincedofherinnocence.
becrowdedwith(people)Dolu olmak
Theauditoriumiscrowdedwithpeople.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
bediscouragedfrom(doing something)Hevesikrlmak Theywerediscouragedfrom participating. bediscriminatedagainst Ayrmclkyapmak Hediscriminatesagainstpeoplewhoare different. bedivorcedfromSO Boanmak MaryisdivorcedfromJohn. bedonewithSTTamamlamak Heisdonewiththework.
r.
6 DR.HKMETAHNER _____________________________________________________________________________________________
beenviousofKskanmak
Iamenviousofyouforhavingthe opportunitytotravel.
beequippedwithST Donanmlolmak
Theexpeditionisequippedwiththelatest gear.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
befamiliarwithBilgisiolmak Iamfamiliarwiththatprogram. befamousforMehurolmak, bilinmek HeisfamousforclimbingMt.Everest. befilledwithDoluolmak Theboxesarefilledwithclothesand books. befinishedwithTamamlamak Iamfinishedwithmystudies. befondofSevmek Sheisfondofherniecesandnephews.
r.
VOCABULARYFORKPDS&DS 7 ____________________________________________________________________________________
befrightenedofKorkmak Thekidsarefrightenedofghosts.
begratefultoSOforST Mteekkirolmak
Iamgratefultoyouforyourassistance.
Heisguiltyofthecrime.
beguiltyofSTSuluolmak
w
belimitedtoSnrlolmak Thespeechesarelimitedtofifteen minuteseach. bemadefromSTYaplmak Thestatueismadefromoldcarparts.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
beinvolvedinSTinde bulunmak Heisinvolvedintheprogram. beinvolvedwithlikiliolmak Heisinvolvedwithmanycharities. bejealousofKskanmak JohnisjealousofMary'sclosefriendship withTom. beknownforSTBilinmek, tannmak Heisknownforhishumor.
r.
8 DR.HKMETAHNER _____________________________________________________________________________________________
beproudofGururduymak Heisproudofhisson.
beopposedtoKarolmak
Iamopposedtoincreasingtuitionprices.
r.
bepolitetoSOKibarolmak Sheispolitetothevisitors.
Heispreparedforsuchquestionsatthe conference.
bepreparedforHazrlklolmak
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Thatisnotrelevanttothisconversation. berememberedforST Hatrlanmak Heisrememberedforhisbravery. beresponsibleforSorumlu olmak Sheisresponsiblefor thenewpolicies. besatisfiedwithTatminolmak Theteacherissatisfiedwiththetest results. bescaredofKorkmak Sheisscaredofsnakes. beterrifiedofKorkmak
VOCABULARYFORKPDS&DS 9 ____________________________________________________________________________________
Hebenefitsfromthegovernment assistanceprograms.
beworriedabout Endielenmek
Iamworriedabouther.
begforYalvarmak
Theybeggedfortheanswertotheriddle.
beginwithBalamak
Everysentencebeginswithacapital letter.
believeinnanmak Hebelievesinghosts.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Heblamedhisemployeesforhis mistakes. blameSTonSOSulamak Heblamedthecompany'sfailureonhis employees. boastaboutHavaatmak SheboastedabouthernewMercedes. borrowSTfromSOdn almak Heborrowedmoneyfromme. careaboutnemsemek Hecaresaboutwhathischildrenwatch onTV. carefor Sevmek Hedoesn'tcareforfish.
blameSOforSTSulamak
r.
10 DR.HKMETAHNER _____________________________________________________________________________________________
choseSTfromSTSemek
Themagicianchosealadyfromthe audiencetohelphimwiththetrick.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
communicatewithSOIrtibat iindeolmak Manypeopleuseemailtocommunicate withfriendsandfamilyabroad. compareSO/STtoSO/ST Kyaslamak Theanalystcomparedthecompany's currentprofitstolastyear's. compareSO/STwithSO/ST Kyaslamak Heshouldn'tcomparehisyoungerson withhisolderson. competewithRekabetetmek Helovestocompetewithothers.
r.
VOCABULARYFORKPDS&DS 11 ____________________________________________________________________________________
Youshouldn'tconcernherwithour problems.
confesstoItiraftabulunmak Heconfessedtothecrimes.
congratulateSOonST Kutlamak
Shecongratulatedhimonhisvictory.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
convictSOofSTSulubulmak Theyconvictedhimofmurder. copewithBaakmak, altndankalkmak Canhecopewiththelargeamountof work. correspondwithSOYazmak Icorrespondwiththembyemail. countonGvenmek Hecountsontheirsupport. coverwithSarmak, sarmalamak,stnrtmek Shecoveredhersleepingsonwiththe blanket.
r.
12 DR.HKMETAHNER _____________________________________________________________________________________________
crashintoarpmak Hecrashedintothetree.
Hehastodealwithmanyproblems.
Icouldn'tdecidebetweenthechicken dinnerandthesushi.
r.
w
demandSTfromSOTalep etmek,istemek Hedemandedhelpfromhiscoworkers.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
deterSOfromSTVazgeirmek Nothingcoulddeterherfrombecominga policewoman. devoteSTtoSO Adamak Hedevotedthesongtohiswife. differfromFarklolmak Yourresultsdifferlittlefrommine. disagreewithAynfikirde olmamak Hedisagreeswithme. disapproveof Onaylamamak
dealwithBaakmak, halletmek
VOCABULARYFORKPDS&DS 13 ____________________________________________________________________________________
distinguishSO/STfromSO/ST Ayrmak
Theexpertcouldn'tdistinguishthereal paintingfromtheforgery.
distractSOfromST Uzaklatrmak
Theloudmusicdistractedherfromher work.
Idreamabouttravelingaroundtheworld. Heexcludedthemfromthemeeting.
dreamaboutHayalinikurmak
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
elaborateonSTAklama yapmak Heelaboratedonhisearliercomments. emergefromSTkmak Thedragonemergedfromitslair. escapefrom(aplace)Kamak Theyescapedfromjail. exchangeSO/STforSO/ST Deitirmek,deitokuyapmak Theyexchangeddollarsforyen. excludeSOfromSTDar karmak,dardabrakmak
r.
14 DR.HKMETAHNER _____________________________________________________________________________________________
explainSTtoSOAklamak
Theteacherexplainedtheprojecttothe students.
feellikeCanistemek Ifeellikeseeingamovie.
fightaboutTartmak
MartinLutherKingfoughtagainstracism andoppression.
fightagainstKarmcadele etmek
Theyfoughtaboutwhohadtodothe dishes.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
forgetaboutUnutmak Sheforgotaboutthemeeting. forgiveSOforSTAffetmek Sheforgavehimfortheterriblethingshe said. gambleonKumaroynamak, bahsegirmek Iwouldn'tgambleonthathappening. gazeatBakakalmak Shegazedatthesightinwonder. getbackfrom(aplace)Geri dnmek Hegotbackfromworkat6o'clock.
r.
VOCABULARYFORKPDS&DS 15 ____________________________________________________________________________________
I'mnevergoingtogetthroughwiththis work.
Heneedstogetusedtothenewworking conditions.
getusedtoAlmak
glareatBakmak
Sheglaredathimindisbelief.
grieveforYastutmak
Thenationisgrievingforthosewhodied intheaccident.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
hearaboutDuymak Ihaveneverheardaboutthatpolicy before. hearfromSOHaberalmak Haveyouheardfromyoursonrecently? hearofDuymak HaveyoueverheardoftheAnasazi people? helpSOwithSTYardmetmek Hehelpedmewithmyhomework. hideSTfromSOSaklanmak Hehidhisbadreportcardfromhis parents.
getthroughwith Bitirmek
r.
16 DR.HKMETAHNER _____________________________________________________________________________________________
hopeforUmmak,mitetmek
Thecompanyhopesforbettersalesinthe comingquarter.
insistonsraretmek,srarc olmak
Heinsistsondrivingeventhoughheis havingvisionproblems.
insureagainstSigortalolmak
r.
Theinvestmentdoesnotinsureagainst lossofincome.
interfereinSTBurnunu sokmak,karmak
Thecouple'sparentsshouldnotinterfere intheirrelationship.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
inviteSOtoDavetetmek Iinvitedhertotheparty. involveSO/STinST Kartrmak,bulatrmak Weinvolvedtheminthedecisionmaking. jokeaboutakayapmak Welovetositaroundandjokeaboutold times. jokewithSOaboutSO/ST Dalgagemek Hewasjokingwithmeaboutthemistake Imade. jotdownSTNotalmak Shejotteddownnotesashespoke. keepon(doingsomething) Devametmek Shekeptontalking.
VOCABULARYFORKPDS&DS 17 ____________________________________________________________________________________
keepSTforSOSaklamak Hewantstokeepthetoyforhisdaughter.
laughaboutGlmek
Shelaughedaboutwhatthechildrenhad done.
laughat Glmek
Wealwayslaughathisjokes.
Ineedtolearnmoreaboutthattopic.
r.
learnaboutrenmek
Ilentmydictionarytoher.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
lookatBakmak Lookatthisoldpictureofmy grandmother. lookforwardtopleekmek Ilookforwardtomeetingherparents. meetwithSOTanmak, bulumak Wewillmeetwiththeorganizersnext week. mistakeSO/STforSO/ST Kartrmak Imistookhimforhistwinbrother.
18 DR.HKMETAHNER _____________________________________________________________________________________________
participateinSTKatlmak Weparticipatedinthesurvey.
payfordemek
Hepaidforourmeallastnight.
persistinDevametmek
Thediseasepersistsinruralfarms throughouttheregion.
Weplanonattendingthewedding.
r.
planonPlanndaolmak
prayforDuaetmek Thevillagersprayedforrain.
praiseSOforST vmek
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
presentSOwithSTVermek Hewillpresentherwiththeawardfor bestjournalist. preventSO/STfrom(doing something)Engellemek, nlemek Thecampaignisdesignedtoprevent youngpeoplefromdrinking. prohibitSOfrom(doing something)Yasaklamak Theschoolprohibitsstudentsfrom smoking. providefor Bakmak Itisdifficultforthemtoprovidefortheir families.
VOCABULARYFORKPDS&DS 19 ____________________________________________________________________________________
quarrelwithSOaboutST Tartmak
Theyquarreledwiththewaiteraboutthe mistakesonthebill.
quarrelwithSOoverST Tartmak
Hequarreledwithheroverherpolitical beliefs.
reacttoTepkigstermek Hereactedtothenewsnegatively.
recoverfromSTIyilemek
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
remindSOofSO/ST Hatrlatmak Heremindsmeofmygrandfather. replytoCevapvermek Werepliedimmediatelytotheletter. rescueSOfromSO/ST Kurtarmak Herescuedthepuppyfromtheicylake. resignfromSTstifaetmek Heresignedfromthecompany.
r.
20 DR.HKMETAHNER _____________________________________________________________________________________________
showSTtoSOGstermek Heshowedthepicturestohisfriends.
searchforAramak
Thearesearchingforsignsoflifeon Mars.
sentenceSOtoST Cezalandrmak
Thecourtsentencedhimto20yearsin jail.
separateSO/STfromSO/ST Ayrmak
r.
HeseparatedBillyfromtheothers children.
Shesharedhersecretwiththeothers.
shareSTwithSO Paylamak
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Thedirectorspoketotheemployees aboutthechanges. specializeinSTUzmanlamak Hespecializesintechnicaltranslation. spend(money/time)on Harcamak Theyspenttoomuchmoneyontheir newcar. standforAnlamnagelmek NASAstandsforNationalAeronautics andSpaceAdministration. stareatGzndikipbakmak Whyaretheystaringatme?
speaktoSOaboutSO/ST Hakkndakonumak
VOCABULARYFORKPDS&DS 21 ____________________________________________________________________________________
subscribetoAboneolmak Hesubscribedtothatmagazine.
succeedatSTBaarlolmak Hewillsucceedatanythinghedoes.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
suspectSOofST phelenmek Thepolicesuspectthemofsmuggling drugsovertheborder. takeadvantageof Faydalanmak,yararlanmak Hetookadvantageofhisconnectionsat thecompany. takecareofBakmak Hetakescareofhispets. talkaboutBahsetmek Theytalkedabouttherecentproblems. talktoKonumak Ineedtotalktoyouforafewminutes.
r.
22 DR.HKMETAHNER _____________________________________________________________________________________________
tellSOaboutSTAnlatmak Hetoldthemaboutwhathappened.
turntoDnmek,bakmak Theyturnedtopage123.
useSTforSTKullanmak Theyusewoodforfuel.
thinkaboutDnmek
Hethoughtaboutwhatshehadsaid.
toasttoKadehkaldrmak Let'stoasttoalongmarriage.
r.
w
Hetrustedthenewemployeewiththe combinationtothesafe.
trustSOwithSTGvenerek vermek
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Iwaitedforthemattherestaurant. warnaboutUyarmak Theywarnedmeaboutpickpocketsinthe trainstation. waste(money/time)on Harcamak,boasarfetmek Theywastedmoneyonanothernewcar. wishforDilemek Thechildwishedforanewbicyclebefore heblewoutthecandlesonhiscake. workfor almak Ihaveworkedforthemfor20years. workonalmak Theyworkedontheproposalfortwo weeks.
waitforBeklemek
VOCABULARYFORKPDS&DS 23 ____________________________________________________________________________________
worryaboutEndielenmek Sheworriesaboutherchildren.
writeaboutYazmak Hewroteabookabouthislife.
writetoSOYazmak
Youneedtowritetoyourparentsmore often.
yearnforzleminiekmek Heyearnsformoreadventure.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
r.
24 DR.HKMETAHNER _____________________________________________________________________________________________
D w
r.
TESTYOURCOLLOCATIONS FORKPDS&DS
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
VOCABULARYFORKPDS&DS 25 ____________________________________________________________________________________
COLLOCATIONTEST1
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Shehasn'tgotajob.Shedepends herparentsformoney. A)on C)for E)from B)off D)about 3.Idon'tknowwhetherI'llgoout tonight.ItdependshowIfeel. A)in C)for E)on B)off D)about 4.Theyworewarmclothestoprotect themselvesthecold. A)in C)from E)on B)off D)about 5.Theapartmentconsiststhree rooms,akitchenandbathroom. A)in C)for E)on B)of D)about
r.
26 DR.HKMETAHNER _____________________________________________________________________________________________
10.Mypresentjobisn'twonderful,butI preferitwhatIdidbefore.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)off D)about 13.Thecountryisdividedsix regions. A)into C)with E)on B)off D)about 14.Iprefertravellingbytrain driving.It'smuchmorepleasant. A)to C)with E)on B)off D)about B)off D)about 15.IfeltquitecoldbutPeterinsisted havingthewindowopen. A)into C)with E)on B)off D)about B)off D)about
r.
VOCABULARYFORKPDS&DS 27 ____________________________________________________________________________________
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
23.Ican'tthinkofananswerthe problem,I'mafraid. A)to C)for E)on B)of D)from 24.Thecausetheaccidentisstill unknown. A)for C)of E)in B)from D)to 25.Thegovernmenthasintroduceda newtaxluxurygoods. A)to C)of E)towards B)on D)in
r.
28 DR.HKMETAHNER _____________________________________________________________________________________________
COLLOCATIONTEST2
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Therewasaposterwarningyoung peoplethedangersofdrugs. A)about C)to E)at B)of D)by 3.Carlaisveryworriedherexams. A)with C)to E)about B)from D)at 4.Areyouawarethesituationin SierraLeone? A)with C)to E)about B)of D)at 5.She'sveryexcitedhertripto Turkey. A)with C)to E)about B)from D)at
r.
VOCABULARYFORKPDS&DS 29 ____________________________________________________________________________________
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
14.Alotofpeopleturnedupatthe concert,muchmysurprise. A)at C)to E)about B)with D)for 15.IwasamazedseeJohnafterso manyyears. A)at C)to E)about B)with D)for B)from D)at 16.Elizabethinvitedmeher wedding. A)at C)to E)about B)with D)for 17.Takeajacketjustbesureyou don'tgetcold. A)at C)to E)about B)with D)for
r.
30 DR.HKMETAHNER _____________________________________________________________________________________________
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
25.Thebossdiedamassiveheart attack. A)from C)to E)about B)with D)of
r.
VOCABULARYFORKPDS&DS 31 ____________________________________________________________________________________
COLLOCATIONTEST3
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.mypointofview,ChannelTwois thebestone. A)From C)To E)About B)With D)Of 3.ThefamousTVpersonalitywas accusedstealingajarofinstant coffee. A)from C)to E)about B)with D)of 4.Ihadproblemsthatprinter. A)from C)to E)about B)with D)of 5.Hasthisbookbeentranslated TurkishintoEnglish? A)from C)to E)about B)with D)of
r.
32 DR.HKMETAHNER _____________________________________________________________________________________________
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
14.Thelandbelongsarichman. A)to C)at E)for B)about D)from 15.ShethenreferredtheMinisters report. A)about C)at E)for B)to D)from B)about D)from 16.Thebossdisagreed me. A)to C)at E)for B)about D)from B)about D)with 17.Hisfailureresultedlackof attentiontodetails. A)to C)at E)for B)about D)from
r.
VOCABULARYFORKPDS&DS 33 ____________________________________________________________________________________
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)about D)from
r.
34 DR.HKMETAHNER _____________________________________________________________________________________________
COLLOCATIONTEST4
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Ifachildisdeprivedlove,heis likelytohavemanypsychological problemswhenhegrowsup. A)with C)on E)about B)of D)off 3.TheformerSovietUnionemerged theSecondWorldWarasamajorworld power. A)in C)from E)at B)on D)out 4.Herefusedtocommentthe currentdevelopments. A)in C)for E)at B)with D)on 5.Thereasonhisfailureishislack ofinterest. A)of C)about E)in B)for D)on
r.
VOCABULARYFORKPDS&DS 35 ____________________________________________________________________________________
11.Allinstrumentsaresupposedto conformregulations. A)for C)on E)with B)about D)to 17.Therewasafalltenpercentin prices. A)at C)in E)with B)by D)of
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
14.Thejobissimilarmyoldone. A)as C)to E)down B)at D)with B)of D)from 15.Wegetlotsofrequestshelp. A)at C)of E)up B)for D)on 16.What'sthedifferenceaboat and aship? A)between C)under E)to B)from D)with
r.
36 DR.HKMETAHNER _____________________________________________________________________________________________
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
25.Hewassuspectedtreason. A)with C)for E)against B)of D)through
r.
VOCABULARYFORKPDS&DS 37 ____________________________________________________________________________________
COLLOCATIONTEST5
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Ouraimsandinterestsaredifferent yours. A)than C)to E)off B)from D)for 3.Dolphinscommunicateeach othertheyhavealanguagetheir own. A)to/of C)with/of E)of/on B)with/by D)at/ 4.Animalsarebetteradaptedtheir environmentthanus. A)on C)across E)to B)over D)through 5.Theworldissimilaraball. A)to C)at E)from B)of D)in
r.
38 DR.HKMETAHNER _____________________________________________________________________________________________
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
13.Wefought manynationsinour WarofIndependence. A)against C)into E)for B)in D)onto 14.Waterchangesicewhenit freezes. A)to C)under E)for B)in D)into B)of/from D)from/for 15.Wecanprovideyouenough material. A)with C)within E)for B)without D)to B)for D)
r.
VOCABULARYFORKPDS&DS 39 ____________________________________________________________________________________
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
24.Formaleducationendswhenpeople reachacertainage. A)to C)at E)about B)in D) 25.Iwassoimpressedthebook thatIcouldn'tsleep. A)by C)about E)with B)from D)on B)to D)in
r.
40 DR.HKMETAHNER _____________________________________________________________________________________________
COLLOCATIONTEST6
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Ilostconfidencehimbecausehe alwaystellslies. A)on C)for E)in B)at D)into 3.Afterthewarthecountrywasdivided two. A)into C)with E)among B)between D)for 4.Hecan'tbeagoodbusinessmanhe isoutoftouchpeople. A)from C)over E)of B)with D)in 5.Iamafraidlosingdocuments. A)from C)over E)of B)with D)in
r.
VOCABULARYFORKPDS&DS 41 ____________________________________________________________________________________
10.Hehassucceededfindinganew job.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
14.Shedoesnotapprovesmoking. A)of C)for E)in B)at D)into B)about D)for 15.Onlyyoumaypreventhim doingthat. B)with D)in A)on C)from E)in B)at D)into 16.Wecongratulatedhimpassing theexams. A)on C)for E)in B)from D)into B)along D)in 17.Idon'tfeelgoinganywhere. A)on C)for E)like B)at D)to
r.
42 DR.HKMETAHNER _____________________________________________________________________________________________
23.Idisapprovegoingthere.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)at D)into B)at D)to B)at D)into
r.
VOCABULARYFORKPDS&DS 43 ____________________________________________________________________________________
PHRASALVERBS
FORKPDS&DSTESTS
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
r.
44 DR.HKMETAHNER _____________________________________________________________________________________________
Wemustsetaboutreorganisingthe office.
ACROSS
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
putacrosscommunicateideas MERAMINIANLATMAK Harryiscleverbuthecan'tputhisideas across. AFTER askafterinquireabout SORMAK Jimwasaskingafteryou. lookaftersomeoneor somethingtotakecareof someoneorsomething BAKMAK,GZKULAKOLMAK Lookingafterababyisafulltimejob. Youhavetobathit,dressitandfeedit.
r.
VOCABULARYFORKPDS&DS 45 ____________________________________________________________________________________
ALONG
AROUND
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
turnaround(2)movesothat someone/somethingisfacing theoppositedirectionTERS EVRMEK Idon'twantthischairfacingthewindow. Willyouhelpmeturnitaround? turnaround(3)makechanges sothatsomethingthatwas unprofitableisprofitableLER YOLUNAKOYMAK Thecompanywasdoingpoorlyuntilit hiredanewpresident.Heturnedit aroundinaboutsixmonthsandnowit's doingquitewell. getatimplyaboutpersonal mattersMAETMEK Whatareyougettingatexactly?
r.
46 DR.HKMETAHNER _____________________________________________________________________________________________
BACK getawaytoescapeKAMAK
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Yes,youcanborrowmypen,don'tforget tobringitbacktomewhenyou're finished."Thisbookisduetomorrow.I guessIshouldtakeitbacktothelibrary." cutback(on)(oftenwithoutan objectwithanobject,cutback on)uselessofsomething AZALTMAK Youdrinktoomuchcoffee.Youshouldcut back. Youshouldcutbackontheamountof coffeethatyoudrink. fallbackonuseasalastresort GVENCESOLMAK,SON ARESOLMAK Iftheworstcomestotheworst,we'vegot oursavingstofallbackon. gobackonbreakapromise SZNTUTMAMAK Themanagementhasgonebackonits promise.
Theprisonergotawayfromhisguards andranintotheforest.
bring/takebackreturn somethingGERGETRMEK
VOCABULARYFORKPDS&DS 47 ____________________________________________________________________________________
lookbackontorememberand thinkaboutthepastreflecton/ considersomethinginthepast GERYEDNPBAKMAK Whentheylookedbackontheirmany yearstogether,theyrealizedthattheir marriagehadbeenaveryhappyone. TheBlackshavebeenmarriedformany years.Theyliketalkingaboutthepastand lookingbackonoldtimes.
r.
IwonderhowmuchBill'snewcarsethim back?
setback(2)costMALOLMAK
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
dropbyvisitinformally(and usuallywithoutschedulinga specifictime)URAMAK Ifyou'reintownnextmonth,we'dloveto seeyou.Pleasetrytodropbythehouse. getbysurvive,financially,ina difficultsituationGENMEK It'sgoingtobehardtopaytherentnow thatyou'velostyourjob,butsomehow we'llgetby. standbykeeptoanagreement ARKASINDADURMAK Thecompanyagreedtostandbyits originalcommitment. takecareofprovidecarefor watchone'shealthBAKMAK Loishasbeentakingcareofherfather sincehereturnedhomefromthehospital. "You'vebeenworkingtoohardlately. You'dbettertakecareofyourself!"
BY
48 DR.HKMETAHNER _____________________________________________________________________________________________
DOWN
breakdown(ofmachinery)to stopworkingBOZULMAK
r.
Tom'scarbrokedownonthewaytothe airport,andhehadtogetataxi.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Sharonwillbelateforworktoday.Hercar brokedownonthefreeway. burndownbecomedestroyed/ consumedbyfireNote:For uprightthingstrees,buildings, etc.onlyYANIPKLOLMAK LightningstruckMr.Kennedy'sbarnlast night.Itburneddownbeforethefire fightersarrived. Myhouseburneddownlastnight.Inthe morningitwasjustapileofashes. calmdownaperson/adifficult situationetc.becomecalm/less agitatedorupsethelpsomeone becomecalm/lessagitatedor upsetSAKNLEMEK, SAKNLETRMEK Whyareyousoupset?Suziedidn'tintend tospillorangejuiceonyou.Calmdown! "IknowRalphisupset,butcanyoucalm himdown?He'smakingsomuchnoise thathe'sirritatingeveryoneintheoffice." Myfatherwasveryangryandittookhim tenminutestocalmdown.
breakdown(4)stopworking/ functioningBOZULMAK
VOCABULARYFORKPDS&DS 49 ____________________________________________________________________________________
Thiscoldweatherreallygetsmedown.
r.
getdownmaketofeel depressedNKARARTMAK
getdowntobegintoseriously dealwithEBALAMAK
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Thecompanyhaslaiddownstrict proceduresforthiskindofsituation. letdowntodisappointsomeone (oftenbybreakingapromiseor anagreementHAYAL KIRIKLIINAURATMAK, ATLATMAK Sorrytoletyoudown,butIcan'tgiveyou alifttoday. JuliapromisedtomeetRickoutsidethe cinemaateighto'clock,butshelethim down.Hewaitedfortwohoursandthen hewenthomeangrily. lookdownonholdincontempt regardasinferior KMSEMEK It'snotsurprisingthatFredhasfew friends.Heseemstolookdownon anyonewhodoesn'tlikethesamethings thathedoes.
50 DR.HKMETAHNER _____________________________________________________________________________________________
turndown(2)arequest/anoffer /anapplicant/anapplicationetc. torefuseorreject(somethingor someone)REDDETMEK AnothercompanyofferedmeajobbutI turnedthemdown. IthoughtIcouldborrowsomemoneyfrom Joe,butwhenIasked,heturnedme down.Jeffwasinterviewedforthejobat BloggsLtd,buttheyturnedhimdown becausehewastooyoung.
stepdownresignSTFA ATMEK
TheChairmanhassteppeddownafter criticismfromshareholders.
Thepolicetrackeddownkillerand arrestedhim.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
writedownrecordsomethingin writingNOTETMEK Couldyoutellmeyouremailaddress again?Iwanttowriteitdown. FOR bargainfortakeintoacount GZNNEALMAK Wehadn'tbargainedfor therebeingso muchtraffic,andwemissedtheplane. carefor note.usedwith(not) likewantSTEMEK,CANI STEMEK Note:Thisphrasalverbisusuallynegative, thoughitmaybeusedaffirmativelyin questions A:"Wouldyoucareforsomethingto drink?Wehavecoffee,tea,ororange juice." B:"CouldIhavewater,please?Idon't careforcoffee,tea,orjuice."
r.
VOCABULARYFORKPDS&DS 51 ____________________________________________________________________________________
fallfor(1)bedeceivedby KANMAK
lookforsomethingorsomeone totrytofind(somethingor someone),oftenathingorperson thatislostARAMAK Fredwantedtoopenhisfrontdoorbuthe couldn'tfindhiskey.Helookedforit everywhere.It'sinoneofmypockets,'he thought. makeforgotoortoward GTMEK,YNELMEK
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Theselettersseemtobeanabbreviation. Doyouknowwhattheystandfor? standfor(3)tolerate TAHAMMLETMEK, DAYANMAK Iwillnotstandforthiskindofbehaviourin myhouse! waitforwaituntilsomeone/ somethingarrivesorisfinished withsomethingelseBEKLEMEK WhenwillKennybefinishedwithwork? I'vebeenwaitingforhimforalmostan hour! "I'mtiredofwaitingforthebus.IguessI'll takeataxiinstead."
Itwasanunlikelystorybuthefellforit.
standfor(2)represent TEMSLETMEK
r.
52 DR.HKMETAHNER _____________________________________________________________________________________________
FORWARD
lookforwardtoafutureevent anticipatepleasantlytothinkwith pleasureaboutafutureeventthat youexpecttoenjoyPLE EKMEK I'mreallylookingforwardtovacation.I can'twaitforittobegin! BillBloggshasbeeninprisonforthelast tenyears.Nextyearhe'llbereleasedfrom prisonandhe'llbeafreeman.Billis lookingforwardtonextyear.
putforwardaproposal/aplan/ asuggestion/anideaetc.to offer(aproposal/aplanetc.)for considerationNERMEK, ORTAYAATMAK MrSmithputforwardtheideaof introducingtrafficlightsatthecrossroads asawayofpreventingtrafficjams.The planningcommitteethoughthisideawas verygood.
IN
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
IhopeIcanlearnmynewjobquickly.The managerhasn'tscheduledmuchtimefor breakingmein. comeinforreceiveespecially criticism,blameELETR ALMAK Thegovernmenthascomeinforalotof criticismoverthedecision. dropintopayashortvisit, oftenwithoutwarning URAMAK Laurawasshoppingnearherfriend,Lynn, anddecidedtodropinandseeher. dropin(on)visitinformally(and usuallyusuallywithoutscheduling aspecifictime)payavisit URAMAK Ifyou'reintownnextmonth,we'dloveto seeyou.Pleasetrytodropin.
r.
VOCABULARYFORKPDS&DS 53 ____________________________________________________________________________________
fillinaform/aquestionnaireetc. addinformationtoaformto complete(aform) DOLDURMAK Theofficeneedstoknowyourhome addressandphonenumber.Couldyoufill theminonthisform? Ittookmeanhourtofillintheapplication form. fillin(on)(2)supplyinformation thatsomeonedoesn'tknow BLGVERMEK Iwasn'tabletoattendthemeeting yesterday,butIunderstandthatitwas important.Couldyoufillmein?/Could youfillmeinonwhatwasdiscussed?
getinenterasmall,closed vehicleARABAYABNMEK
Idon'tknowwhereCarolewasgoing.She justgotinhercaranddroveaway.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
goinfor(2)enteracompetition YARIAKATILMAK Areyouthinkingofgoinginforthehorse race? handinsubmithomework,an assignment,etc.TESLM ETMEK You'dbettergetstartedonyourreport. Youknowthatyouhavetohanditinat 8:30tomorrowmorning! lookinonvisitinordertocheck something's/someone's conditionZYARETETMEK Myfatherjustcamehomefromthe hospital.Iplantolookinonhimtoday afterIfinishwork. putinforapplyforajob BAVURMAK Suehasputinforateachingjob. setinestablishitselfespecially weatherKKSALMAK,YCE YERLEMEK Ithinkthisrainhassetinfortheday.
r.
54 DR.HKMETAHNER _____________________________________________________________________________________________
INTO
I'vewrittenmyreport,butIhaven'tturned itin.
Twodaysaftertherobbery,thethieves turnedthemselvesin.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
breakintoabuilding/abank/a houseetc.toentersomewhere (e.g.ahouse)illegally,especially byforceKAPIYIKIRARAK ERGRMEK Lastnightaburglarbrokeintomyhouse andstolemytelevisionset. comeintomoney/property/a fortuneetc toreceive something(usuallymoneyor property)aftersomeone'sdeath MRASKALMAK Petercameintoafortunewhenhisfather died. lookintoasituation/acrime/a problem/acomplaintetc. investigate/getmoredetails aboutsomethingtocarefully examineasituationoreventand trytodiscoverthereasonsforit NCELEMEK,ARATIRMAK, SORUTURMAK Thepolicehavepromisedtolookintothe problem.
r.
VOCABULARYFORKPDS&DS 55 ____________________________________________________________________________________
runintosomeonemeetby chanceRASTLAMAK,RAST GELMEK GuesswhoIranintoatthesupermarket! Yesterdayatthesupermarket,Janran intoherformerroommate.Before yesterday,theyhadn'tseeneachotherfor nearlyfiveyears. IwasonmywaytoworkwhenIraninto JeremyThomas.
OFF
backoffnotfollowathreat GERADIMATMAK
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
breakofftalks/negotiations/an engagement/arelationship/an agreementetc. toendto interrupttodiscontinue,stop talkingKESLMEK,SONA ERMEK PeacetalksbetweenIranandtheUShave brokenoffafterthreedaysofserious disagreement. bringoffaccomplishsomething difficultaccomplishsomething peoplehadconsidered impossibleorunlikely NoonethoughtChuckcouldgetanAin thatcourse,buthebroughtitoff.
r.
56 DR.HKMETAHNER _____________________________________________________________________________________________
calloffanevent/an arrangement/anactivityetc. oftenusedinthepassivecancel somethingthathasbeen scheduledtoabandonsomething thathasalreadybegunPTAL ETMEK TheFootballAssociationcalledoff the matchbetweenEnglandandGreece becauseofbadweather.
Daviddrovehiswife,Sue,intotownand droppedheroffinthecinema.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Whenyougetoffthebus,crossthestreet, turnrightonOakStreet,andkeepgoing untilyou'reatthecornerofOakand LincolnBoulevard. getoff(2)beexcused(fora periodoftime)fromwork,class, orotherregularlyscheduled activitiesTATLOLMAK,ZNL OLMAK SomecompaniesgotIndependenceDay offbutoursdidn't.Wehadtoworkas usual. getoff(3)makeitpossiblefor someonetoavoidpunishment CEZADANKURTARMAK Everyoneknewhewasguilty,buthis lawyerwascleverandgothimoff. getoffwithavoidpunishment YIRTMAK,UCUZKURTULMAK Theywereluckytogetoffwithsuchlight sentences.
getoffleavealarge,closed vehicleARATANNMEK
r.
VOCABULARYFORKPDS&DS 57 ____________________________________________________________________________________
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
putoffanevent/doing somethingetc.todelaydoing somethinguntilalatedateto delayaneventorarrangement untilalaterdateERTELEMEK Martinwasveryunhappywhenhesawthe hugepileofdirtydishesinthekitchen.He feltalittlehappierafterdecidingtoputoff thewashingupuntilthenextday. putoff(2)postponedelay avoidKAMAK Ican'tputthisworkoffanylonger.IfI don'tdoitsoon,it'llbeimpossibletofinish itintime. "WhenwillMr.Smithagreetoameeting?I keepaskingforanappointment,buthe keepsputtingmeoff." put(someone)off(3)to discourage,ordistract, (someone)fromdoing,upset DKKATNDAITMAK Thecrowdputthegymnastoff,andbe fell. Ronwastryingtoread,butthenoisefrom thetelevisionputhimoffandhehadto stop.ThenoisefromtheTVputRonoff hisbook.
r.
58 DR.HKMETAHNER _____________________________________________________________________________________________
seesomeoneofftosay goodbyetosomeonewhois goingonajourneyattheplace (e.g.airport,stationetc.)where thejourneybeginsgotostation, airport,etctosaygoodbyeto someoneYOLCUETMEK BillarrangedtogotoScotlandtostaywith hisgrandmotherforafewdays.Hisfather, Frank,drovehimtotherailwaystationand sawhimoff . setofftostartajourney YOLAIKMAK
Pleasetakeyourhatoffwhenyougo insideabuilding.
takeoff(2)remove(something you'rewearing)IKARTMAK
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
tell(someone)off speakto someonebluntlyandnegatively, sayingexactlywhatshe/hedid wrongtospeakangrilyto someonewhohasdone somethingwrongtofindfault withsomeoneAZARLAMAK Ourteachertoldusoffforbeinglate. JuliewasreallyangryatBobshetoldhim offinfrontofallofus. turnoffstopbyturningahandle orswitch KAPATMAK I'mcold.DoyoumindifIturntheair conditioneroff? turnoff(2)borerepel SNRNBOZMAK,GICIK ETMEK Thatmusicturnsmeoff.Pleaseplay somethingelse!
r.
VOCABULARYFORKPDS&DS 59 ____________________________________________________________________________________
ON
bringoncausetheonsetofan illnessNEDENOLMAK
Sittinginthedampbroughtonhis rheumatism.
Youhavebroughtthisonyourself.
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Billhadneverusedacomputeruntilhe tookthisclass,buthecaughtonvery quicklyandisnowoneofthebest student s. countondependonrelyon trustthatsomethingwillhappen orthatsomeonewilldoas expectedGVENMEK I'mcountingonyoutowakemeup tomorrow.IknowIwon'thearthealarm. dragonlastmuchlongerthan expectedorisnecessary UZAMAK Ithoughtthemeetingwouldbeashort one,butitdraggedonformorethanthree hours. getonmakeprogress especiallyinlifeLERLEMEK Sueisgettingonverywellinhernewjob.
60 DR.HKMETAHNER _____________________________________________________________________________________________
I'mnotreadytostopyet.IthinkI'llkeep onworkingforawhile.
lookonconsiderGRMEK
Welookonthistownasourrealhome.
It'salittlebitchillyoutside.You'dbetter putasweateron.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
tryonwearsomethingbrieflyto checkitsfit,howitlooks,etc. DENEMEK I'mnotsurethatjacketislargeenough. MayItryiton? turnonstartbyturningahandle orswitchAMAK It'scoldinhere.I'mgoingtoturnthe heateron. OUT bearout confirmthetruth DORULAMAK Helen'sstorywasborneoutbyhersister.
r.
VOCABULARYFORKPDS&DS 61 ____________________________________________________________________________________
crossoutshowthatsomething writteniswrongorunnecessary bymakinganXacrossit ZERNZMEK Wecan'taffordtobuyeverythingonyour shoppinglist,soI'vecrossedallthe unnecessarythingsout. dieouttodisappearcompletely tobecomeextinctSOYU TKENMEK,YOKOLMAK
Theattackwassuccessfullycarriedout.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Thegreatdinosaursdiedoutmillionsof yearsago. drawoutprolongsomething (usuallyfarbeyondthenormal limits) UZATMAK Ithoughtthatspeechwouldneverend. Thespeakercouldhavesaideverything importantinaboutfiveminutes,buthe drewthespeechoutforoveranhour! dropouttowithdrawfrom,or stoptakingpartin(acompetition, asocialgroup,aschool,a university,ajobetc.) BIRAKMAK Samdroppedoutoftheracebecausehe felttiredandill. figureoutlogicallyfindthe answertoaproblemsolvea problembythinkingaboutit carefullyANLAMAK ForalongtimeIcouldn'tunderstandthe lastproblem,butIfinallyfigureditout.
carryoutcompleteaplan YERNEGETRMEK,FAETMEK
r.
62 DR.HKMETAHNER _____________________________________________________________________________________________
getoutof(2)escapehavingto dosomethingYIRTMAK
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
giveoutbooks/examination papers/pillsetctogive(some thingorthings)toeachpersonin agroupofpeopletodistribute DAITMAK Theteachergaveoutthebooks,sothat thepupilscouldreadthestory. handoutdistribute DAGITMAK Whydon'tyouhaveacoursedescription andlistofassignments?Theteacher handedthemoutonthefirstdayofclass. holdoutofferespeciallywith hopeSAHPOLMAK Wedon'tholdoutmuchhopethatthe pricewillfall.
Lisasaidshehadaterribleheadacheand gotoutofgivingherspeechtoday.
r.
VOCABULARYFORKPDS&DS 63 ____________________________________________________________________________________
Youhavemissedoutawordhere.
makeoutoftenusedinthe negativewithcan'tandcouldn't managetoseeorunderstandto see,hear,orunderstand (somethingorsomeone),often withdifficultysee/hear somethingwellenoughto understandwhatitmeans.(Note: oftennegative.)IKARMAK, ANLAMAK
Icouldn'tquitemakeoutwhatthenotice said.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
missout(2)loseachance ANSINIKAYBETMEK Fivepeoplegotpromoted,butImissed outagain. panoutsucceedhappenas expected(forplans).(Note: almostalwaysnegativewhenin statements.)OLMAMAK, GEREKLEMEMEK I'llbeherenextweekafterall.Mytripto Chicagodidn'tpanout. passoutfaintlose consciousness BAYILMAK WhenEllaheardthatshe'dwonamillion dollars,shewassoshockedthatshe passedout. Whentheairconditioningstopped working,Jamesfounditdifficulttobreathe andpassedout. passout(2)distribute DAITMAK Everyoneintheroomneedsoneofthese informationsheets.Whowillhelpmepass themout ?
r.
64 DR.HKMETAHNER _____________________________________________________________________________________________
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
setout(3)startanaction BALAMAK Suesetouttowriteabiographyhutit becameanovel. sortoutfindasolutionARE BULMAK Don'tworry,Marywillsortoutyour problem. standoutbenoticeablybetter thanothersimilarpeopleorthings DAHAYOLMAK Goodjob,Ann!Yourworkreallystands out ! takeoutinsurancesignan insuranceagreementSGORTA YAPTIRMAK Annhastakenoutlifeinsurance.
I'vesetouttherefreshmentsinthehall.
r.
VOCABULARYFORKPDS&DS 65 ____________________________________________________________________________________
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Heturnedouttobeanoldfriendof Helen's. watchoutforbecarefulof bewareofDKKATETMEK There'saschoolattheendofthisblock. Watchoutforchildrencrossingthestreet. "Ifyoutakethatroad,watchoutforice duringthewinter." wearouttouse(something) untilitbecomesunfitforfurther usetobecomeunusableafter excessiveuseESKTMEK Paulworeouthisfavouritejeansafter wearingthemeverydayfortenyears. wearout(2)wearsomething/ usesomethinguntilitcanno longerbeworn/beused ESKTMEK Ineedanewpencilsharpener.I worethis oneout. "IsupposeIshouldgetsomenewshoes. I'vealmostwornthispairout."
66 DR.HKMETAHNER _____________________________________________________________________________________________
wearout(3)oftenusedinthe passivetotiregreatlyto exhaustYORMAK Carryingtheheavyboxacrossthestreet woreFredout. workoutexercise(usuallyina gym,etc.)tobuildmuscles,body tone,etcEGZERSZYAPMAK InsteadofeatinglunchonMonday, Wednesday,andFriday,Sheilagoesto therecreationcentertoworkout.
OVER
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Whattimedoyourclassesgetover? getover(2)anillness/afailure/a difficulty/ashocketc.recover fromanillnessorpainful experienceYLEMEK, AMAK Katywasreallyupsetwhenshefailedthe test.Shethoughtshewouldneverget overfeelingsostupid. Samhasgotoverhisoperationand expectstoleavehospitaltomorrow.He hasgotoverhisoperation. getoverwithcometotheend ofsomething,usuallyunpleasant HALLETMEK I'llbegladtogetthisawfulbusiness overwith. giveover(1)abandon,devote AYIRMAK Therestofthetimewasgivenoverto playingcards.
r.
VOCABULARYFORKPDS&DS 67 ____________________________________________________________________________________
lookoversomework/acar/a house/adocument/a suggestion/anapplicantetc. checkreviewtoexamine (someoneorsomething)carefully andfullyGZDENGERMEK, NCELEMEK IthinkImayhavesometyposinthis report.Couldyoulookitover? Joewantedtobuyasecondhandcar. 'Thatonelooksgood,'hesaidtothe salesman.'Givemesometimetolookit over.Ifit'singoodcondition,I'llbuyit.'
OF
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
getridofdisposeofgiveaway orthrowawayATMAK,ATIP KURTULMAK Thatshirtisreallyugly.Whydon'tyouget ridofit? getridofdismisssomeonefire someonefromajobcause someonetoleaveTEN ATMAK ThetreasureroftheXYZcompanywas spendingtoomuchmoneysothecompany presidentgotridofhim . ROUND bringroundinfluencesomeone toyourpointofviewKNA ETMEK Aftermuchdiscussion,Ibroughtthe committeeroundtomypointofview.
r.
68 DR.HKMETAHNER _____________________________________________________________________________________________
lookroundahouse/ashop/a town/afactory/anexhibition etc.tovisitandtourrounda place.BAKMAK,GEZMEK, ETRAFAGZATMAK MrandMrsSmithwantedtobuyahouse. Theestateagenttookthemtoseeahouse inthecentreoftownandsaid,'Look roundthehouseandseeifit'swhatyou want.'
Sorry,butIhaven'tgotroundtofixingthe tapyet.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
THROUGH fallthroughfailtocometo completionYATMAK, OLMAMAK,SONUGELMEMEK Theplanfellthroughatthelastminute. fallthrough(2)nothappen. (Note:describessomethingthat wasplannedbutdidn'thappen.) OLMAMAK, GEREKLEMEMEK WehadoriginallyintendedtogotoMexico forourvacation,butourtripfellthrough whenIgotsick. getthroughtocontact someone(usuallybytelephone) RTBATKURMAK Jim(phoninghisfriendRoger):Hello, Roger.I'vebeentryingtogetthroughto youforhours! Roger:Sorry,Jim.Ihadtomakealotof callsthismorning.
r.
VOCABULARYFORKPDS&DS 69 ____________________________________________________________________________________
getthrough(2)somework/at ask/abooketc. tofinishto completeBTRMEK Rogerhadalotofworktodoyesterday, buthegotthroughitallbyfiveo'clock. gothroughtoexamine (something)NCELEMEK, GZDENGERMEK WhenBenenteredthiscountry,acustom's officerwentthroughhissuitcase. putthroughtoconnecta telephonecallertothenumberhe orshewantsBALAMAK, BALANTIKURMAK MrPrattphonedtheofficesofGunnand Company.'Whowouldyouliketospeak to?'askedtheswitchboardoperator.'Put methroughtoMrGuhnplease,'MrPratt replied.
TO
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
UP addupmakesense MANTIKLIOLMAK Hisevidencejustdoesn'taddup. addupfindthetotal TOPLAMAK What'sthetotalofthosebills?Couldyou addthemupandsee? adduptotototalTOPLAMI OLMAK Thebillsaddupto$734.96.That'smore thanIexpected!
r.
70 DR.HKMETAHNER _____________________________________________________________________________________________
You'retooclose!BackyourcarupsoI canopenthegaragedoor.
Ifyoudon'tbelieveme,talktoDave.He'll backmeup.
MrTrenthatedhishouse,soheblewitup withdynamiteandbuiltanewoneinstead.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
breakupdispersescatter cometoanendDAILMAK Whattimedidthepartybreakuplast night?Thepartyfinallybrokeupat3.00 am. breakup(2)(ofamarriage/a family/arelationshipetc.) to endtoseparateSONAERMEK /ERDRMEK TheGreens'marriagebrokeupin1985 afteronlytwoyears.Moneytroublebroke uptheirmarriage. breakup(3)anactivitytostop DURDURMAK,AYIRMAK Theheadmasterbrokeupthefight betweenRogerandClive. breakup(4)usuallybreakup withendapersonalrelationship AYRILMAK TimandJuliearen'tgoingsteadyany more.Theygotreallyangrywitheach otherandbrokeup.
r.
VOCABULARYFORKPDS&DS 71 ____________________________________________________________________________________
bringupmention(asatopicof discussion)BAHSETMEK Weplannedtodiscussovertimepayinthe meeting.Whydidn'tsomeonebringthat topicup? callupmobiliseformilitary service ASKEREAIRMAK Markwascalledupwhenthewarbroke out.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
catchup(with)(oftenwithoutan objectwithanobject)stop beingbehindYETMEK Terrystoppedtorestforafewminutes. He'llcatchupwithuslater. cheeruptobecomehappier helpsomeonefeellessworried/ depressed/sad NEELENMEK,KEYFYERNE GELMEK Jackwasfeelingunhappy,buthecheered upwhenheheardthathehadpassedhis exam. comeupoccurusuallya problemIKMAK,OLMAK Look,somethinghascomeup,andIcan't meetyou.
r.
72 DR.HKMETAHNER _____________________________________________________________________________________________
drawuporganise,especiallya documentcreateaformal documentHAZIRLAMAK, DZENLEMEK Thecontractisbeingdrawnupatthe moment. TheAjaxandTipTopBankshavedecided tomerge.Theirlawyerswilldrawallthe officialdocumentsupsometimethis month.
Westillhaven'tcomeupwithasolutionto theproblem.
doupahouse/aroom/aflat/an oldcaretc.torepairtoimprove theconditionandappearanceof somethingdecorate YENLEMEK Wearehavingourlivingroomdoneup. WhenBobandSallyboughttheirhouseit wasinabadstate,sotheyspentsix monthsdoingitup.Thehouselooked beautifulbythetimetheyfinished.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
endupfinishinacertainway, orplacefinallyarriveatarriveat anunexpectedplaceKENDN BULMAK Wegotlostlastnightandendedupinthe nexttown.Weendedupstayingtherefor lunch. endup(2)arrivesomewhereas aresultorconsequence KENDNSONUNDABULMAK You'reworkingtoohard.Ifyoudon'ttakeit easy,you'llendupinthehospital! faceuptohavecouragetodeal withespeciallyresponsibilities admittotakeresponsibilityfor YZLEMEK Youcan'tpretendthatyou'redoingOKin thiscourse,Joe.Soonerorlater,you'll havetofaceuptothefactthatyou're failingit.
r.
VOCABULARYFORKPDS&DS 73 ____________________________________________________________________________________
Thanksfortheinformationaboutthatbook. I'llfollowitup.
Heknowssmokingisn'tgoodforhis health,buthecan'tgiveitup.
giveupstopdoingsomething (usuallyahabit)BIRAKMAK
w
giveup(4)(ofanhabitual activity,smoking/drinking/ajob etc.)tostopdoingorhaving (something) BIRAKMAK Howarddecidedtogiveupcigarettesafter seeingaposteronthedangersof smoking.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Onedayahungrydogsawabunchof juicygrapeshangingfromavine.Thedog triedveryhardtogetthegrapes,butit couldn'tjumphighenoughtoreachthem. Aftertenfrustratingminutes,thedoggave uptheattemptandwalkedhomeangrily. giveup(3)decidenottotry (unsuccessfully)tosolvea problembelievedtobedeador lostVAZGEMEK,PES ETMEK Aftertendaystheshipwasgivenupfor lost. A:"What'sblackandwhiteandredall over?"B:"Igiveup.What?"A:"An embarrassedzebra!"
followupactuponasuggestion TAVSYEYEUYMAK
r.
74 DR.HKMETAHNER _____________________________________________________________________________________________
I'dliketotalklonger,butI'dbetterhang up.Mysisterneedstomakeacall.
Thewinneroftheraceproudlyheldhis trophyupforalltosee.
Jackwasalwaysheldupasanexample tome.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
I'msorryI'mlate.Therewasanaccident onthefreewayandtrafficheldmeup. SorryI'mlate,Iwasheldupinthetraffic. holdup(4)robthreaten someonewithharmunless he/shegivesher/hismoneyor othervaluablethingsTEHDT ETMEK Sarahisveryupset.Whenshewas walkinghomelastnight,twomenheldher upandtookherpurseandjewelry. keepupcontinueDEVAM ETMEK Welldone!Keepupthegoodwork. letupbecomelessintenseor slowerAZALMAK It'sbeenraininghardforalongtime.Willit everletup?
r.
VOCABULARYFORKPDS&DS 75 ____________________________________________________________________________________
lookupaword/atelephone number/anaddress/atrain time/adateetc.tofind(ortryto find)something(e.g.atelephone number)inabook(e.g.a telephonedirectory)SZLE BAKMAK "I'msorry,butIdon'tknowwhatthatword means.I'llhavetolookitup." WhilePeterwasreading,hefoundaword thathedidn'tunderstand.'Thisisadifficult word,'hethought.I'lllookitupinthe dictionaryandseewhatitmeans.
makeup(3)astory/apoem/an excuse/anexplanationetc.to invent,sometimeswiththe purposeofdeception UYDURMAK Colinoversleptandwaslateforwork.It wasthethirdtimehehadoversleptthat month,sohedecidedtomakeupan excuse.Hetoldhisbossthattheengineof hiscarhadexploded. makeup(4)compensatefor somethingmissedornotdoneby doingextraorequivalentwork TELAFETMEK
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
I'msorryImissedthetest.MayImakeit up? makeup(with)(5)reestablish afriendlyrelationshipby admittingguiltBARIMAK Jackandhisgirlfriendwereveryangry witheachother,butlastnighttheyfinally madeup. makeup(6)foramistake/doing ornotdoingsomethingetc.to compensateforTELAF ETMEK JuneandRonarrangedtomeetoutside thecinemaat7.30p.m.Junewasvery upsetwhenRonarrivedanhourlate.Ron madeupforbeinglatebyapologizingto Juneandgivingherabigbunchofflowers.
r.
76 DR.HKMETAHNER _____________________________________________________________________________________________
pickuplifttakeupYERDEN ALMAK,KALDIRMAK
Thosebooksdon'tbelongonthefloor.Will youhelpmepickthemup?
pickup(3)getbuySATIN ALMAK
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Yourtoysarealloverthefloor,Timmy. Pleaseputthemup. putup(2)offeraccommodation providesomeonewithaplaceto sleepKALACAKYERVERMEK There'snoneedforyoutocheckintoa hotel.I'llbehappytoputyouup. Wecanputyouupforafewdays. putupwithtosuffer(adifficult situationorperson)without complainingTAHAMML ETMEK WhenUncleMikecomestovisitus,the childrenbehaveverybadly.Theyhithim, theyplaytricksonhimandtheymakealot ofnoise.UncleMikemustlovethemvery muchbecauseheputsupwitheverything theydo,andhenevergetsannoyedwith them.
r.
VOCABULARYFORKPDS&DS 77 ____________________________________________________________________________________
putupwith(2)toleratebear DAYANMAK,TAHAMML ETMEK Ican'tputupwithallthisnoise! It'sreallyimportanttocometoworkon time.Thebosswon'tputupwith tardiness. runup(abillletabillget longerwithoutpaying)BOR BRKTRMEK
Iranupahugetelephonebillatthehotel.
We'verunupagainstaslightproblem.
r.
showuparriveappear GELMEK
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
standuptoresist,bearstress DAYANMAK Theenginewon'tstanduptothestrain. stepupincreaseARTIRMAK ProductionattheLeedsplanthasbeen steppedup. stickupfordefendespecially yourself,yourrightsKENDN SAVUNMAK Youmustlearntostickupforyourself. takeuptimeoccupytime ZAMANALMAK Themeetingtookupawholemorning.
78 DR.HKMETAHNER _____________________________________________________________________________________________
takeupbegin(ahobbyor leisuretimeactivity)HOB OLARAKBALAMAK A:"Doyouliketoski?"B:"I'veneverbeen skiing,butIthinkI'dliketotakeitup." takeupahobby/asport/ajob/ ahabitetc.(2)tobegintostudy, practice,ordo(something) HOBEDNMEK Timwantedtotakeuppainting,sohe joinedaneveningclassatthelocal CollegeofArt.
throwupvomit KUSMAK
turnupincreasethevolume SESNAMAK
IcanbarelyheartheTV.Canyouturnit upalittle?
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
wakeup(2)rousesomeone causesomeonetostopsleeping UYANDIRMAK Ihaveanimportantmeetingtomorrowand I'mafraidIwon'thearmyalarm.Willyou wakemeupat6:00AM? wrapup finishsomethingbring somethingtoaconclusion SONLANDIRMAK,SONUNU GETRMEK We'vebeentalkingabouttheproblemfor nearlythreehours.Ihopewe'llbeableto wrapthediscussionupsoon. writeuprecordreportinwriting YAZIYADKMEK You'llneedtomakeareportonyour businessmeetings.Besureyouwrite themupassoonaspossibleafteryou returnfromyourtrip.
r.
VOCABULARYFORKPDS&DS 79 ____________________________________________________________________________________
UPON
holdwithagreewithanidea) PAYLAMAK
D w
r.
Idon'tholdwiththeideaofusingforce.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
WITH
80 DR.HKMETAHNER _____________________________________________________________________________________________
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
r.
VOCABULARYFORKPDS&DS 81 ____________________________________________________________________________________
PHRASALVERBQUIZ FORKPDS&DS1
w w w
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)comeacross B)getintouchwith C)lookforwardto D)makeupto E)lookinto 2.Onlyafteragreatdealofpressure hadbeentheregistrardidheagree togiveuptherecoverywardinfavorof asecondoperatingtheatre. A)weighedup B)takento C)puton D)broughtdown E)turnedover 3.Heclaimshehas acureforthe commoncold,butIdon'tsupposehe has. A)waitedfor B)madesureof C)putthrough D)takencareof E)comeupwith
r.
82 DR.HKMETAHNER _____________________________________________________________________________________________
8.Themainfocusoftheresearchtobe byamultidisciplinaryteamwillbe thestudyofthegenesandproteinsof organismsinthecontextoftheir informationalpathwaysornetworks. A)lookedafter B)carriedout C)madeout D)settleddown E)broughtabout
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
9.Medicalscienceisadvancingatsuch apacethatitisvirtuallyimpossibleto allthelatestdevelopmentseven withinone'sownspecialistfield. A)takeup B)keepupwith C)carryout D)pulloutof E)lookdownon 10.Osteociastsarecellsthatbone inthenormalcourseofbone replenishment. A)showoff B)pullthrough C)breakdown D)putout E)cutoff
r.
VOCABULARYFORKPDS&DS 83 ____________________________________________________________________________________
PHRASALVERBQUIZ FORKPDS&DS2
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Inthefirsthalfofthe20thcentury manyscientistsliquidcrystalsas chemicalimpuritieswithnoscientificor practicalmerit. A)putdown B)wroteoff C)letgoof D)tookcareof E)leftout 3.Ihopepredictionsthatwe'llbeginto oilaroundtheyear2015will convincepeopletousethisprecious resourcemoresparingly. A)runoutof B)bringabout C)slowdown D)makedowith E)sendoutfor
r.
84 DR.HKMETAHNER _____________________________________________________________________________________________
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
9.Thefuelusedbyshipsandaircraftto bringfoodanddrinktoBritain4 milliontonsofCO2emissions. A)speedsup B)bringsout C)getsthrough D)accountsfor E)dealswith 10.Thesuggestionsputforwardbythe researchteamwereimmediatelyby managementandwillshortlygointo effect. A)madeout B)takenup C)ruledout D)putoff E)turnedback
5.Allscienceisthefactthatevery naturaleventhasanaturalcause.
r.
VOCABULARYFORKPDS&DS 85 ____________________________________________________________________________________
PHRASALVERBQUIZ FORKPDS&DS3
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Overtwomillioncornfarmersin Mexicohavebeenbusiness followingtheimportofheavily subsidisedcornfromtheUS. A)putoutof B)broughtupto C)madeupfor D)playeddownto E)shownupto 3.Outoftheworkofthegreatthinkers oftheseventeenthcenturywas developedanewoutlookontheworld, anditwasthisoutlookwhichthe decayofthebeliefinwitchcraftand othersuperstitions. A)gotridof B)droveoff C)madeup D)broughtabout E)keptout
r.
86 DR.HKMETAHNER _____________________________________________________________________________________________
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
9.Theiraimmustbetothebarriers thathinderthefreeflowofinformation betweenemployees,systemsand devices. A)runup B)closeup C)pullthrough D)breakdown E)turndown 10.Theirstateassetswereto foreigncapitalatbargainprices. A)paidoff B)broughtup C)auctionedoff D)puttrough E)closeddown
r.
VOCABULARYFORKPDS&DS 87 ____________________________________________________________________________________
PHRASALVERBQUIZ FORKPDS&DS4
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.AlmostallthevillagesinNewGuinea aresurroundedbyshrubbyzones wherepeoplehavetheoriginalrain forestandplantedgardens. A)keptout B)wrappedup C)madeup D)clearedaway E)sealedoff 3.Couldntweensurethat allcritical networksarekeptsecurelyfromthe restoftheworld? A)takenaway B)leftout C)putdown D)madeover E)cutoff
r.
88 DR.HKMETAHNER _____________________________________________________________________________________________
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
9.Inrecentyears,carbondioxide (CO2),anaturallyoccurring greenhousegas,hasbeenasa resultofactivitiessuchastheburning offossilfuelsanddeforestation. A)settingout B)buildingup C)goingout D)comingin E)reachingup 10.Themovementofelectronswithin electromagneticwavessomeofthe wavesenergy,affectingtheproperties ofthewaveandhowittravels. A)tellsoff B)putsin C)findsout D)usesup E)goesaround
r.
VOCABULARYFORKPDS&DS 89 ____________________________________________________________________________________
PHRASALVERBQUIZ FORKPDS&DS5
w w w
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Asmanagingdirectorheisexpected tohimselfthesoleresponsibility forlaunchingthecampaign. A)makefor B)takeupon C)carefor D)bringabout E)lockinto 3.Hewasratherwhenhelearned thathisproposalhadbeenturned down. A)hurriedon B)sentaway C)foundout D)seento E)putout 4.Iwasastonishedtolearnhowsuch anexperiencedmanasDrFostercould bebyhertricks. A)lockedup B)foundout C)runover D)madeup E)takenin
r.
90 DR.HKMETAHNER _____________________________________________________________________________________________
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)watchout B)lookup C)breakthrough D)takeover E)gothrough
r.
VOCABULARYFORKPDS&DS 91 ____________________________________________________________________________________
PHRASALVERBQUIZ FORKPDS&DS6
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Duetotheindustrialisationand colonisation,thenineteenthcentury thegreatestexpansionofwealththe worldhadeverknown. A)broughtabout B)putoff C)heldup D)gavein E)setoff 3.Thetwoarchaeologistshavetried hardtoreadtheinscriptioninoldLatin, butIdonotthinktheyhavewhatit reallymeans. A)gotawaywith B)writtenoff C)takenafter D)madeout E)broughtup
r.
92 DR.HKMETAHNER _____________________________________________________________________________________________
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)felloff B)wastakenintoaccount C)washeldout D)gotoutofhand E)brokeup 10.Idontknowhowwearegoingto theexpectedsurgeofimmigrantsinto thecountry. A)runthrough B)copewith C)putout D)takedown E)lookover
9.Despitethegustywindtheywere abletoputoutthefirebeforeit.
r.
VOCABULARYFORKPDS&DS 93 ____________________________________________________________________________________
PHRASALVERBQUIZ FORKPDS&DS7
w w
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.TheJewishimmigrants,whothe boatinEngland,formedthebulkofthe ethnicgroupsarrivinginacountry historicallywaryofforeigners. A)tookafter B)gotoff C)turnedup D)madeup E)showedoff 3.Sincemostoftheworldscommercial appleslackgeneticdiversity,theyare unabletoadiseaseorapest. A)putaway B)holdup C)fightoff D)getoff E)breakout 4.Theatmospheretheearthasifit wereahugeroof. A)breaksup B)makesfor C)hangsover D)putsoff E)runsover
r.
94 DR.HKMETAHNER _____________________________________________________________________________________________
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
10.Oncethechildrenhavegrownup,I shallstarttravellingagain,andI'm reallythat. A)passingonto B)waitingupfor C)lookingforwardto D)makingupfor E)goingalongwith
r.
VOCABULARYFORKPDS&DS 95 ____________________________________________________________________________________
PHRASALVERBQUIZ FORKPDS&DS8
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Thetopresearchuniversitiesinthe USAarethefactthatwomen researchersareencountering substantialbarrierstocareer advancement. A)waitingfor B)pullingoutof C)facingupto D)tryingout E)turningup 3.Hisdoctoradvisinghimtotakeit easyforawhileandstopallovertime buthedidn'tlisten. A)madeup B)kepton C)ranthrough D)leftout E)playeddown
r.
96 DR.HKMETAHNER _____________________________________________________________________________________________
5.Intheearlytwentiethcentury,a numberofscientists,whohadbeen trainedasphysicists,wereinterestedin thestudyofbiologicalorganisms,and theireffortsthefieldwenowcall molecularbiology. A)tookleaveof B)madeupfor C)gaveriseto D)showedup E)fellapart
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
9.Ifapartofthecityisresidential use,noonemaybuildafactorythere. A)bornedown B)madefor C)takenout D)zonedfor E)checkedwith 10.Oneofthedisadvantagesof growingolderisthatyouneverseemto havetheopportunitytoallofthe sportsyouwouldliketo. A)catchsightof B)makeroomfor C)losetrackof D)takepartin E)setsailto
r.
VOCABULARYFORKPDS&DS 97 ____________________________________________________________________________________
PHRASALVERBQUIZ FORKPDS&DS9
w w w
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.TheCongresshaveabig problemintheireconomicpolicy:the unionswontcooperate,and managementdoesntapproveofwhat theyaretryingtodo. A)lookeddownupon B)cutdownon C)fitupto D)gotawaywith E)comeupagainst 3.Themanagerwhowassaidtohave revealedtheplanssoastogetfinancial benefitafterthecriticismfromthe shareholders. A)setup B)stoodfor C)steppeddown D)gotover E)brokeup
r.
98 DR.HKMETAHNER _____________________________________________________________________________________________
r. w
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)holdingup B)comingalong C)dealingwith D)payingfor E)takingover 10.Thepopulationofthe underdevelopedcountriesisgrowing sofastthattheagriculturalactivities thereareunabletothe progressivelyrisingdemandforfood. A)keepupwith B)makesureof C)lookoutfor D)bringup E)sortout
VOCABULARYFORKPDS&DS 99 ____________________________________________________________________________________
PHRASALVERBQUIZ FORKPDS&DS10
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Thetwoarchaeologistshavetried hardtoreadtheinscriptioninoldLatin, butIdonotsupposetheyhave whatitliterallymeans. A)gotawaywith B)writtenoff C)takenafter D)madeout E)broughtup 3.Aristotelianismageocentricview oftheuniverseanddealtwithnaturein qualitativeratherthanquantitative terms. A)heldout B)gotabout C)restedon D)sortedout E)wornoff
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
9.Theatmospheretheearthasifit wereahugeroof. A)breaksup B)makesfor C)hangsover D)putsoff E)runsover 10.Popularprotestandextensive mediacoveragefinallyhelped changeinthecountry'senvironmental policies. A)keepoff B)ruleout C)bringabout D)pointout E)breakup
r.
PHRASALVERBQUIZ FORKPDS&DS11
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Thisradiostationisbasedin Chicago,whichis60milesfromhere. Thatiswhythebroadcastdoesn't clearly. A)turndown B)getthrough C)comein D)makeoff E)putdown 3.Fordecades,scientistshave theorizedthatmuchoftheuniverseis nearlyundetectabledarkmatter anddarkenergy. A)madeupof B)takenoverby C)lostin D)heldon E)brokenawayfrom
r.
7.Thoughonlyahandfulofsavants wereevenNewton'sexistence,he hadarrivedatthepointwherehehad becometheleadingmathematicianin Europe. A)exposedto B)awareof C)contentwith D)capableof E)appropriatefor
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)runoutof B)watchout C)standby D)putout E)keepupwith 10.Iwouldliketoopenaprivateold people'shome,butIdon'tknowyet howtoit. A)lookthrough B)setabout C)rushopen D)puton E)turnon
r.
PHRASALVERBQUIZ FORKPDS&DS12
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Thecommitteehasthematter, buttheyhavefoundnoirregularities. A)lookedinto B)takenoff C)playeddown D)stoodfor E)madeup 3.Duetoindustrializationand colonization,thenineteenthcentury thegreatestexpansionofwealththe worldhadeverknown. A)broughtabout B)putoff C)heldup D)gavein E)setoff
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
9.Itisimportantforpeoplewholeadan inactivelifetoasportlike swimming. A)breakdown B)takeup C)calloff D)putout E)makeoff 10.Althoughitcannotbeproven scientifically,presumablythe expansionoftheuniversewillasit approachesacriticalradius. A)slowdown B)cooldown C)buildup D)filterout E)gooff
r.
PHRASALVERBQUIZ FORKPDS&DS13
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Climateshiftscoulddisruptfarming andthousandsofspeciesof animalsandplants. A)makeup B)wearoff C)wipeout D)eataway E)putacross 3.Ourpaediatriciansaidweshould alwaysherifthelittleboys temperaturecontinuedformorethan24 hours. A)comeacross B)getintouchwith C)lookforwardto D)makeupto E)lookinto
r.
9.!There'sacarcoming. 5.Heclaimshehas acureforthe commoncold,butIdontsupposehe has. A)waitedfor B)madesureof C)putthrough D)takencareof E)comeupwith
7.Iwassurprisedthatthefiremen sopromptly.
r.
6.ThelettersUNOtheUnited NationsOrganization.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)Lookout B)Putout C)Takeaway D)Putaway E)Slipaway 10.I'mnotgoingtopunishyounow, butnexttimeIwon'tletyouit. A)lookaway B)getawaywith C)takeaway D)goonwith E)catchupwith
PHRASALVERBQUIZ FORKPDS&DS14
w w w
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Thefingerprintsonthetelephone MintyMiller. A)tookaway B)madeout C)gaveout D)gaveaway E)turnedout 3.WhenIopenedthebottle,it a strongsmell. A)gaveaway B)gaveup C)gaveoff D)gavein E)gaveonto 4.Thetrainwasbyfog. A)seenoff B)setout C)kepton D)calledoff E)heldup
r.
8.Idon'tthinkIcanthisawful weathermuchlonger.
r.
7.Whatexcusewillyouthistime? Speak!
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)caughtupwith B)lookedinto C)seento D)comeacross E)cometo
6.IherquitebychanceasIwas walkingalongthestreet.
10.I'vejustabeautifulpoeminthis book.
PHRASALVERBQUIZ FORKPDS&DS15
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Theprojectswillbeoriginalityof thoughtandpotentialimpactonsociety bydistinguishedspecialists. A)judgedon B)relatedto C)appliedto D)broughtup E)dealtwith 3.At4oclockthatsameafternoon,he gotintohiscarandforBursa. A)putup B)gotoff C)kepton D)setoff E)sentout
r.
7.Ifyourbrotherphones,besuretoask himifhereallyhassmoking.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
9.Hemusthavehadsomesound reasonsforsucharigidtimetable. A)settingout B)drawingup C)runningup D)turningoff E)lookinginto 10.Itsadelightfulnovel,andthereader soongetsinthelivesofthe charactersasthestoryprogresses. A)caughtup B)foundout C)putout D)turnedover E)fedup
r.
PHRASALVERBQUIZ FORKPDS&DS16
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Mycar asIwasonmywaytopick upthechildrenfromschool. A)gotoff B)brokedown C)letdown D)gavein E)tookoff 3.Thepricesofcommoditiessuchas teaandcoffeehavebenefitedfromthe generalboomincommodityprices byincreaseddemandandfairlystatic supply. A)broughtabout B)kepton C)takenup D)pulleddown E)turnedup
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
9.Itreallyisafirstclassproduct,so nowit'suptotheadvertising departmenttoaneffectivewayof launchingitontothemarket. A)putupwith B)keepup C)comeupwith D)takeafter E)pullthrough 10.Accordingtoaleadingarticleinone oftoday'snewspapers,agroupof foreignbusinessmenareplanningto anewprojectintheregion. A)breakinto B)bringup C)setup D)runup E)clearout
r.
PHRASALVERBQUIZ FORKPDS&DS17
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Eveninthefarthestcornersofthe world,firmsmustbeabletotheir peopleandtheirassets. A)lookdownon B)putupwith C)keepintouchwith D)stayclearof E)waitupfor 3.Ofalltheinventionsofthe1800's,the gasolineenginewastheonethat themostfarreachingchangesin transportation. A)calledon B)foundout C)putoff D)broughtabout E)madeout
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
9.SolarheatingneverintheUS becauseofthecostandlimitedwinter sunlightinmostareas. A)caughton B)playedup C)turnedover D)waitedon E)lookedback 10.Therehasbeenincreasingpressure intheUStotheamountoffunding allocatedtoforeignaid,andinstead, usethefundstoimprovethedomestic economy. A)makeupfor B)pointoutto C)keepupwith D)cutdownon E)takeupwith
r.
PHRASALVERBQUIZ FORKPDS&DS18
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.AsEgyptitsbiggestirrigation project,thePharaohs'dreamof spreadingtheirkingdomsintothe desertsiscomingtrue. A)putsoff B)embarkson C)breaksup D)trieson E)showsup 3.Thefirsttwoparagraphsthe particularrequirementsofthedigital environmentasthesourceofdataand asameansofproducingmapsand othervisualisations. A)layemphasison B)runoutof C)breakthrough D)stopshortof E)lookdownon
r.
4.Inrecentyears,carbondioxide (CO2),anaturallyoccurring greenhousegas,hasbeenasa resultofactivitiessuchastheburning offossilfuelsanddeforestation. A)settingout B)buildingup C)goingout D)comingin E)reachingup
7.Animportantaspectofthe applicationofmathematicsisthat differentwaysofmakingmathematical senseofeverydayquestions differentanswers. A)keepup B)bringover C)leadto D)showoff E)findout
w w w
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
8.Theamountoffishcaughtdidnot themassiveincreaseinvesseltonnage andfishingeffort. A)pullthrough B)makedowith C)keeppacewith D)comeacross E)breakoutof 9.Homeheating,whichlessthan7 percentofallenergyconsumedinthe US,hashadacommendableefficiency record. A)accountsfor B)comeswith C)joinsin D)picksup E)bringsout 10.Amysteryvirushasmorethan 90percentofsomebirdspeciesin India. A)foundout B)brokenthrough C)turnedup D)wipedout E)putoff
r.
PHRASALVERBQUIZ FORKPDS&DS19
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Asafamilyweareusedtomoving fromonepartofthecountrytoanother, andweusuallyprettyquicklyin eachnewhome. A)runthrough B)moveround C)turndown D)comethrough E)settledown 3.TheEUrecognizesthatprogresson humanrightsaroundtheworldthe cooperationandcollaborationofmany groupsandindividuals. A)getsinto B)makesup C)takesoff D)dependson E)putsoff
r.
4.ThetermgeographytheEnglish languageinthe16thcenturyfromLatin andultimatelyGreek,atthetimewhen Europeannavigatorswerebeginningto exploreAfricaandtheNewWorld. A)brokeinto B)turnedout C)carriedaway D)wenton E)cameinto
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)setup B)pulledthrough C)setaside D)putup E)madeout 10.Whensomeonechokesonfood,itis becausethefoodhasslippedintothe airpassageandbreathing. A)givenin B)kepton C)setout D)switchedoff E)cutoff
r.
PHRASALVERBQUIZ FORKPDS&DS20
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Ifadenosinetriphosphate(ATP) supplydoesnotdemand,muscle contractionceases. A)makeupfor B)keepupwith C)accountfor D)runoutof E)giveup 3.Awisevegetariandoesnotsolely theproductsmadeoftextured vegetableprotein,butlearnstousea varietyofwholefoodsinstead. A)setout B)takealong C)drawup D)relyon E)makefor
r.
7.Whenatissueisinjured,arapid chainofeventstheproductionof fibrin,astringy,insolublemassof proteinfibersthatformsaclotfrom liquidblood. A)holdsup B)makesup C)breaksdown D)leadsto E)putsout
w w
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
8.Patientswanttobelievethattheir physiciansthemaspeople,notjust aspatients. A)putupwith B)careabout C)takeafter D)lookinto E)pullthrough 9.Ironmustbeinthereducedor ferrousformforabsorptionto. A)comeacross B)makedo C)turnon D)takeplace E)getacross 10.Mostofourexposuretoorganic mercuryeatingoilyfishsuchas tuna. A)playsup B)turnsinto C)comesfrom D)findsout E)putsupwith
5.Thecorrecttimetostartababyon solidfooditsneedsandreadiness.
r.
ACADEMICVOCABULARY FORKPDS&DSTESTS
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
r.
AccompanyEliketmek ACADEMICVOCABULARY FORKPDS&DS1 Thecoursebooksareaccompaniedby fourcassettes. Depressionisalmostalways accompaniedbyinsomnia. Thesalmonwasaccompaniedby( yanndaolmak)afreshgreensalad. Wouldyoulikemetoaccompanyyouto yourroom? "MayIaccompanyyoutotheball?"he askedher. Ihavetwoticketsforthetheatreon Saturdayeveningwouldyoucareto accompanyme?
AbstractSoyut
Truthandbeautyareabstractconcepts.
AcademyAkademi
AccessUlameriim/giri
r.
amilitary/policeacademy theRoyalAcademyofDramaticArt
AccommodateKalacakveya brakacakyerbulmak
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
AccumulateBiriktirmek, birikmek Aspeopleaccumulatemorewealth,they tendtospendagreaterproportionoftheir incomes. Thecompanysaidthedebtwas accumulatedduringitsacquisitionofnine individualbusinesses. Athicklayerofdusthadaccumulatedin theroom. Ifyoudon'tsortoutthepapersonyour deskonaregularbasistheyjustkeepon accumulating. AccurateDoru anaccuratemachine anaccuratedescription Thefigurestheyhaveusedarejustnot accurate. Hernovelisanaccuratereflectionoflife inpostwarSpain. Wehopetobecomemoreaccuratein predictingearthquakes.
AdaptAdapteetmek, uyarlamak,uydurmak Manysoftwarecompanieshaveadapted popularprogramstothenewoperating system. Therecipehereisalambroastadapted fromCarolineO'Neill'sbook'Louisiana Kitchen'. [+toinfinitive]Wehadtoadaptourplans tofitJack'stimetable. Theplayhadbeenadaptedfor( changedtomakeitsuitablefor)children. DaviesisbusyadaptingBrinkworth's latestnovelfortelevision.
[+ingformofverb]Sheacknowledged havingbeenatfault. [+that] Sheacknowledgedthatshehad beenatfault. Youmustacknowledgethetruthofher argument. Historiansgenerallyacknowledgeherasa geniusinherfield. [+object+toinfinitive]Sheisusually acknowledgedtobeoneofourbestartists. Theyrefusedtoacknowledgethenew government. Pleaseacknowledgereceiptofthisletter. Hedidn'tevenacknowledgemypresence. Thegovernmentwon'tevenacknowledge theexistenceoftheproblem.
AcquireAlmak,eldeetmek, kazanmak:
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
AdequateYeterikadar,yeterli Havewegotadequatefoodfortwenty guests? Ididn'thaveadequatetimetoprepare. It'snotbyanymeansabrilliantsalarybut it'sadequateforourneeds. Thecouncil'sprovisionfortheelderlyis barelyadequate(isnotenough). [+toinfinitive]Willfutureoilsuppliesbe adequatetomeetworldneeds? AdjacentYanbanda, yaknnda Theyworkinadjacentbuildings. Theylivedinahouseadjacenttothe railway. AdjustAyarlamak,almak Ifthechairistoohighyoucanadjustitto suityou. Asateacheryouhavetoadjustyour methodstosuittheneedsofslower children. Ican'tadjusttolivingonmyown. Hereyesslowlyadjustedtothedark.
AcknowledgeKabuletmek, tanmak,farkndaolmak
r.
Thelifestyleissoverydifferentittakesa whiletoadjust.
AdultYetikin
Advocate(Birfikri,dnceyi) savunmak
AffectEtkilemek
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Hegetsaboutwiththeaidofawalking stick. Shewenttotheaidofamantrappedin hiscar. Awomaninthestreetsawthathewasin troubleandcametohisaid. teachingaids,suchasbooksandvideos Athesaurusisausefulaidtowriting. Turkeyhasagreedtodonate$80,000in humanitarian/emergencyaidtoIraq affectedbythewar. Aboutafifthofthecountry'sincomeisin theformofforeign/overseasaid. Albeitmasnaramen Theeveningwasverypleasant,albeita littlequiet. Hetried,albeitwithoutsuccess. AllocateAyrmak,denek vermek,maletmek Thegovernmentisallocating$10million forhealtheducation. [+twoobjects]Asprojectleader,youwill havetoallocatepeoplejobs/allocatejobs topeople. Itisnotthejoboftheinvestigating committeetoallocateblameforthe disaster/toallocateblametoindividuals.
AidYardm,vasta,aragere
r.
Analogy Benzerlik AlterDeitirmek,deimek, (elbise)bedeniniayarlamak We'vehadtoaltersomeofourplans. Althoughlongdistancephonecallsare goingup,thechargeforlocalcallswillnot alter. Givingupourcarhasradicallyalteredour lifestyle. Itookthecoatbacktotheshoptohaveit altered. Hedrewananalogybetweenthebrain andavastcomputer. Itissometimeseasiertoillustratean abstractconceptbyanalogywith(by comparingitwith)somethingconcrete.
AlternativeAlternatif,are,yol
Amend(Kanunda,metinde) deiiklikyapmak
r.
AmbiguousKaranlk,kark, anlalmaz
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
AnnualYllk anannualevent/visit/holiday annualincome/salary/profit Companiespublishannualreportsto informthepublicaboutthepreviousyear's activities. AnticipateBeklemek Wedon'tanticipateanytrouble. Wehadoneortwodifficultiesalongthe waythatwedidn'tanticipate. Areyouanticipatingalotofpeopleatthe partytonight? [+ingformofverb]Theyanticipatehaving severalapplicantsforthejob. [+that]Theyanticipatethattheywillhave severalapplicantsforthejob It'salwaysbesttoanticipateaproblem beforeitarises. [+questionword]Atthisstagewecan't reallyanticipatewhatwillhappen. Theanticipatedinflationfigureislower thanlastmonth's. Thearmyanticipated(tookactionin preparationfor)theexplosionby evacuatingthetown.
ApparentApak,belirgin, anlalr,aikar Herunhappinesswasapparentto everyone. [+that]Itwasbecomingincreasingly apparentthathecouldnolongerlookafter himself. Iwasonthemetrothismorningwhenfor noapparentreasonthemanopposite suddenlyscreamed. Thereareoneortwoapparent discrepanciesbetweenthetworeports. Shehasthisapparentinnocencewhich,I suspect,sheusestoheradvantage.
ApproachYaklamak Wecouldjustseethetrainapproaching inthedistance. Ifyoulookoutofthewindowontheleftof thebus,you'llseethatwe'renow approachingtheGalataTower. Iseeit'sapproachinglunchtime,solet's takeabreak. Inmyopinion,noothercomposerseven begintoapproach(comenearinquality to)Mozart. Thetotalamountraisedsofaris approaching(almost)$1000. He'sveryactiveforamanapproaching 80(whoisalmost80yearsold).
There'snopointbuyinghimexpensive wineshedoesn'tappreciatethem. Weappreciatetheneedforimmediate action. [+that]Iappreciatethatit'sadifficult decisionforyoutomake. [+questionword]Idon'tthinkyou appreciatehowmuchtimeIspent preparingthismeal. I/Weappreciate...usedwhenyouare thankingsomeoneorshowingthatyouare grateful: Wereallyappreciateallthehelpyougave uslastweekend. [+ingformofverb]Iappreciateyour makingtheefforttocome. Iwouldappreciateitifyoucouldletme know(Pleaseletmeknow)inadvance whetherornotyouwillbecoming.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
AppropriateUygun,doru appropriatefootwearforthecountry Isthisfilmappropriateforsmallchildren? Ididn'tthinkhiscommentswerevery appropriateatthetime. Isthisanappropriateoccasiontodiscuss finance? Pleasecompletetheappropriatepartsof thisform(thepartsthatarerightor necessaryforyourparticularsituation)and returnitassoonaspossible. NOTE:Theoppositeisinappropriate.
r.
AreaAlan,blge
Allareasofthecountrywillhavesome raintonight. TheareaofNewYorktothesouthof HoustonStreetisknownasSoho. HousesintheLondonarea(inand aroundLondon)areveryexpensive. He'sanareamanager(isresponsiblefor businessinaparticularpartofthecountry orworld)foracomputercompany. Thisisaverypoorarea(partofthe town,countryorworld). Dogsarenotallowedinthechildren'splay area.
AspectYn,taraf,a Whichaspectsofthejobdoyoumost enjoy? Hisillnessaffectsalmosteveryaspectof hislife. That'sthemostworryingaspectofthe situation. Lightingisavitallyimportantaspectof Askforprovokeanegative reaction(aranmak,kanmak) You'reaskingfortrouble.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Accountforexplain(bir konuyuaklamak,hesap vermek) Theyhadtoaccountforallthemoney thathadgonemissing. Actontakeactionbecauseof somethinglikeinformation received(bireylehareketetmek) Thepolicewereactingonatipfroman informerandcaughtthegangredhanded. Aimattarget(hedefalmak) Themagazineisaimedat teenagers.
ArbitraryPlansz,geliigzel, zorba,zorla
r.
Hebackedouttwodaysbeforethe holidaysowegavethetickettohissister.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Bedownbereducedorless (azalmak,dmek) Thefirm'sprofitsaredownbytenpercent thisquarter. Bedownwithbeill(hasta olmak) Gulisdownwithsomebugandisoff worktoday. Beinbeathome(evdeolmak) TheyareneverinIalwaysgettheir answeringmachine. Beinbesubmitted,arrive (verilmek,gelmek) Theapplicationformmustbeinby3pmon Friday. Beoffbebad(offood) (bozulmak) Thisyoghurtmustbeoffitsmellsfoul.
r.
Beoffdepart,leave(gitmek) I'moffhomeit'sfiveo'clock.
Beontakeplace(oynamak)
Theshowisonforthenextthreemonths.
IwastakenabackwhenIsawhim becausehe'slostallhishair.
Betakenabackbeshockedor surprised(okolmak,armak)
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Beuptobegoodenough(bir iiyapacakkadariyiolmak) He'snotuptothejobgetsomeoneelse. Beefup makesomething strongerormoresolid (glendirmek) Thecompanybeefeduptheircasewhen theysawthatthepublicwouldn'taccept theirfirstexplanationoftheaccident. Blowdownwhenthewind forcessomethingtofall(ykmak) Atreewasblowndowninthestorm. Blowoutextinguishcandles, matches,etc.(sndrmek) Sheblewthecandlesoutonherbirthday cake.
Time'sup,pleasefinishyourdrinksand leave.
r.
Blowupexplode(patlamak) Thebombblewupwithoutanywarning.
Bookupreserve(rezerve etmek/olmak)
Theflight'sfullybookedupI'llhavetogo thefollowingday.
TheSDPbrokeawayfromtheLabor Party.
r.
Thetalksbetweenmanagementandthe unionsbrokedownacrimoniously.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Breakthroughpassabarrier orobstacle(yarpgemek) Thecrowdbrokethroughthepolice barriersandattackedthehunters. Breakupbreakintomany pieces(krlmak) Theplatebrokeupwhenhedroppediton thefloor. Breakupcloseaneducational institutionfortheholidays (kapanmak) SchoolsbreakupattheendofJunefor thesummerholidays. Bringaboutmakesomething happen(yapmak) Thechangestothelawwerebrought aboutbythegovernmentbecauseso manypeoplewereignoringtheoldone.
Bringdownmakea governmentfall(ykmak)
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
r.
AcademicVocabularyforKPDS&DS Test1
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Theemergencytothebuildingis attheback. A)attempt C)aid E)adjacent B)available D)access 3.Snowflakesarelooseofice crystals. A)aids C)tools E)means B)sections D)aggregates 4.Thepolicewhentheman threatenedtoshoothiscaptiveinthe head. A)backedaway C)beefedup E)beatup B)backedup D)blaredout
B)alternative D)adaptation
r.
11.Areyouhome?It'sfiveo'clock already. 6.Earthquakevictimswerein temporaryfieldtents. A)accompanied C)accommodated E)barged B)abandoned D)accumulated A)upto C)near E)away B)on D)off
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
12.Shedrewanbetweenthebrain andavastcomputer. A)aid C)access E)alternative B)analogy D)effect 13.Thenewtaxeswilladditional twohundredthousanddollarsamonth intothegovernmentbudget. A)breakin C)beatin E)bargein B)askin D)bringin 14.Thebombinthesuspiciousboxthat wasleftinfrontofthebuilding beforethepolicecouldarriveinthe area. A)bootedup C)broughtup E)brokedown B)blewup D)blazedaway
r.
r.
18.Ithinkthisisaratherplaceto discusspoliticalissues.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)bringup D)bootup A)adequate C)aggregated E)allocated B)accurate D)ambiguous 21.Unlesstheconstitutionis,the powertoappointministerswillremain withtheprimeminister. A)abandoned C)accommodated E)amended B)altered D)allocated B)aidedwith D)brokein 22.Idon'tbelievethebigoilcompanies wantthescientiststodiscovernew toourdependenceonoilforheating andtransportation. A)amendments C)analogies E)aggregates B)alternatives D)aids 23.Theinflationfigureishigher thanlastmonth's. A)advocated C)allocated E)altered B)anticipated D)amended
D)bogdown/branchout E)askfor/breakaway
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)analogous D)appropriate A)blankedout C)beefedup E)backeddown B)aimedat D)backedaway 29.Latelyheavyrainhasmiserable conditionsinmostpartsofIstanbul. A)aimedat C)backedup E)broughton B)apparent D)aggregate B)brokendown D)beefedup 30.Thetalksoverpublicemployee salaryscalesbetweenthegovernment andthepublicemployeeunions acrimoniously. A)broughtround C)bottledout E)blewup B)brokedown D)broughtup
r.
ACADEMICVOCABULARY FORKPDS&DS2
AssumeFarzetmek,kabul etmek [+(that)]Iassumed(that)youkneweach otherbecauseyouwenttothesame school. Let'sassume(that)they'recomingand makeplansonthatbasis. [+toinfinitive]Wecan'tassumethe suspectstobeguiltysimplybecause they'vedecidedtoremainsilent. Wemustn'tassumethesuspects'guilt.
AssessDeerlendirmek,deer bimek Theinsurerswillneedtoassesstheflood damage. Theyassessedthecostoftheflood damageat$1,500,000. Examinationsarenottheonlymeansof assessingastudent'sability. It'stooearlytoassessthelongterm consequencesofthecollapseoftheSoviet Union. [+questionword]Weneedtoassess whethertheprojectisworthdoing.
AssignGrevlendirmek, (zaman,gn)beirlemek
[+twoobjects]UNtroopswereassigned thetaskofrebuildingthehospital. [+toinfinitive]Thecasehasbeen assignedtoourmostseniorofficer. Haveyouassignedadayforthe interviewsyet? Detectiveshavebeenunabletoassigna motiveforthemurder. Thereportassignedtheblameforthe accidenttoinadequatesafetyregulations.
AssistYardmetmek
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
AssureTeminetmek,salamak Theunionsassuredthenewownersof theworkers'loyaltytothecompany. [+speech]"Don'tworry,yourcarwillbe readytomorrow,"themechanicassured him. [+(that)]Sheassuredhim(that)thecar wouldbereadythenextday. ThePrimeMinisterassuredtheelectorate (that)taxeswouldnotbeincreasedafter theelection. Youcanrestassured(feelconfident) thatIshallbethereaspromised. Theplay'spopularityhasbeenassuredby thecritics'ravereviews. AttachEklemek,balamak Iattachedaphototomyapplicationform. Usethiscabletoattachtheprintertothe computer. InTurkey,packetsofcigarettescomewith agovernmenthealthwarningattachedto them(onthem). Iattach(amsending,usuallywitha letter)acopyofourlatestreport.
r.
It'softenverydifficulttochangepeople's attitudes. [+that] Shetakestheattitudethat childrenshouldbeallowedtolearnattheir ownpace. Hehasaverybadattitudeto/towards work. Heseemstohaveundergoneachange in/ofattituderecently,andhasbecome muchmorecooperative. Idon'tlikeyourattitude(thewayyou arebehaving). Thatboyhasarealattitudeproblem( behavesinawaythatmakesitdifficultfor otherpeopletohavearelationshipwith himorworkwithhim).
AttributeYaktrmak, aklamak,atfetmek
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
AuthorityOtorite,yetki,arlk, uzman,yetkili,uzmanlk TheUnitedNationshas used/exerted/exerciseditsauthorityto restorepeaceinthearea. Weneedtogetthesupportofsomeonein authority(animportantorhighranking person). They'vebeenactingillegallyandwithout authority(permission)fromthecouncil. [+toinfinitive]I'llgivemylawyers authority(permission)toactonmy behalf. He'sgotnoauthorityover(abilityto control)hisstudents. Shespokewithauthority(asifshewas incontrolorhadspecialknowledge). thehealthauthority thehousingauthority He'saworldauthorityon19thcentury Ottomanhistory. AutomateOtomatikletirmek Massiveinvestmentisneededto automatetheproductionprocess.
AttitudeTavr,davran, pozisyon
r.
AvailableVar,mevcut,hazr, eldeedilebilir Isthisdressavailableinalargersize? Ourautumncatalogueisnowavailable fromourusualstockists. There'snomoneyavailableforanoffice partythisyear. Itisvitalthatfoodismadeavailabletothe famineareas. [+toinfinitive]I'mafraidI'mnotavailable tohelpwiththeshowonthe19th. Everyavailableofficerwillbeassignedto theinvestigation. Doyouhaveanydoubleroomsavailable thisweekend?
BenefitYarar,fayda,yarar salamak Thediscoveryofoilbroughtmany benefitstothetown. Oneofthemanybenefitsofforeigntravel islearninghowtocopewiththe unexpected. He'shadthebenefitofanexpensive educationandyethecontinuestoworkas awaiter. Ididn'tget/derive(much)benefitfrom school. Withthebenefitofhindsight( Helpedby theknowledgesincelearned)itiseasyfor ustoseewherewewentwrong. Shedrinksalotlessnow,tothebenefitof (resultinginanimprovementin)her healthasawhole.
AwareBilmek,farkndaolmak, farketmek,duyarl
behalfAdna,yerine,yznden
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
BiasTaraftaryapmak/klmak, tersetkilemek Thejudgeruledthattheinformationshould bewithheldonthegroundsthatitwould biasthejuryagainst(influencethem unfairlyagainst)theaccused. Bond Birletirmek,yaknlamak Theaimwastobondthegroupintoa closelyknitteam. Thehospitalgivesmothersnoquietprivate timeinwhichtobondwiththeirbabies. BriefBilgivermek,aklama yapmak Wehadalreadybeenbriefedabout/on whatthejobwouldentail.
r.
inbulk(inlargeamounts)
She'saverycapable woman/worker/judge. Weneedtogetanassistantwho's capableandefficient. OnlytheDemocraticPartyiscapableof runningthecountry. Aforce10windiscapableofblowingthe roofsoffhouses. Whenshe'sdrunkshe'scapableofsaying (likelytosay)awful,rudethings. Ithinkyourplaniscapableofbeing( couldbe)improved.
Thestadiumhasaseatingcapacityof50 000. Thegamewaswatchedbyacapacity crowd/audienceof50,000(theplace wascompletelyfull). Shehasagreatcapacityforhardwork. Thepurchaseof500tanksispartofa strategytoincreasemilitarycapacityby 25%overthenextfiveyears. [+toinfinitive]Itseemstobebeyondhis
CapacityKapasite,says. olan,yetenek,yeterlik,hacimli
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
CategoryKategori,tr,eit Therearethreecategoriesof accommodationstandard,executiveand deluxe. CeaseDurmak,durdurmak, bitmek Whethertheprotestswillceaseremainsto beseen. ThecompanyhasdecidedtoceaseallUS operationsafterthisyear. [+toinfinitive]Workplacenurserieswill ceasetobeliablefortax.
capacityto(Heseemstobeunableto) followsimpleinstructions. Doyouthinkit'swithinhiscapacityto( Doyouthinkhe'llbeableto)dothejob withoutmakingamessofit? Thegeneratorseachhaveacapacityof( canproduce)1000kilowatts. Thelargercarshavebiggercapacity engines(theenginesarebiggerand morepowerful). Allourfactoriesareworkingat(full) capacity(areproducinggoodsasfast aspossible). Wearerunningbelowcapacity(not producingasmanygoodsasweareable to)becauseofcancelledorders. Hesufferedastrokein1988,whichleft himunabletospeak,buthismental capacity(hisabilitytothinkand remember)wasn'taffected.
r.
Circumstancesartlar,durum
r.
ChapterBlm,zamandilimi, sayfa
Chartzlemek,gzlemlemek, planlamak
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Ithinkshecopedverywellunderthe circumstances. Obviouslywecan'tdealwiththeproblem untilweknowallthecircumstances. Shediedinsuspiciouscircumstances. Weopposecapitalpunishmentin/under anycircumstances. Undernocircumstancesshouldyou( Youmustnot)approachtheman. Themeetinghasbeencancelleddueto circumstancesbeyondourcontrol. Theywerevictimsofcircumstance. Wewereobligedtogobyforceof circumstance. Grantsareavailabledependingonyour circumstances. Bynowshewasaloneandlivingin reducedcircumstances(withlittle money) . CiteVermek,duyurmak, gndermeyapmak Shecitedthreereasonswhypeopleget intodebt. Thecompanyciteda12%declineinnew ordersasevidencethatoveralldemandfor itsproductswasfalling. ShecitesbothT.S.EliotandVirginia Woolfinherarticle.
ChannelKanalizeetmek, ynlendirmek,yatrmak
Clause(Kanun,kontrat, anlama)maddesi
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Whenshecalmeddown,shewasmore coherent(abletospeakclearlyandbe understood). CoincideAynzamanda olmak/meydanagelmek,yakn olmak,benzemek Itimedmyholidaytocoincidewiththe children'sschoolholiday. Iftheheavyrainhadcoincidedwithan extremehightide,seriousfloodingwould haveresulted. Ourviewscoincideonarangeof subjects. Ifourschedulescoincide,we'llgoto Spaintogether. Collapse(Yere)yklmak, kmek,katlanmak Thousandsofbuildingscollapsedinthe earthquake. Thechaircollapsedunderherweight. Hethoughthiswholeworldhadcollapsed whenhiswifedied. Hecollapsedanddiedofaheartattack. Allchairscollapseforeasystorage.
ClarifyAklamak,akla kavuturmak
CoherentTutarl,anlalr
r.
IthinkIcancomebutIwon'tcommit myselftillIknowforsure.
CommodityMal CommenceBalamak Wewillcommencebuildingworkin Augustofnextyear. Shallweletthemeetingcommence, gentlemen? [+ingformofverb]Unfortunately,he commencedspeakingbeforeallthe guestshadfinishedeating. Thecountry'smostvaluablecommodities includetinanddiamonds. theinternationalcommoditiesmarket
CommitBalanmak,adamak, szvermek
r.
CommissionGrevlendirmek, ivermek,balatmak
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Communicateletiimkurmak, irtibatkurmak,sylemek,iletmek, (odalar)birbirinealmak/ balanmak) Wecannowcommunicateinstantlywith peopleontheothersideoftheworld. Unabletospeakawordofthelanguage, hecommunicatedwith(using)his hands. Hasthenewsbeencommunicatedtothe staffyet? Asanactorhecouldcommunicatea wholerangeofemotions. IfindIjustcan'tcommunicatewithher. Thebedroomcommunicateswithboth toiletandhall. Community(bellibirgrup) insan,topluluk,toplum He'swellknowninthelocalcommunity. There'salargeblack/white/Jewish communitylivinginthisarea. Herspeechcausedoutrageamongthe community. Drugtraffickingisamatterofconsiderable concernfortheentireinternational community(allthecountriesofthe world). There'sarealsenseofcommunity( caringandfriendlyfeeling)inthis neighborhood.
CompatibleUygun Itwaswhenwestartedlivingtogetherthat wefoundwejustweren'tcompatible. Thissoftwaremaynotbecompatiblewith olderoperatingsystems. Suchpoliciesarenotcompatiblewith democraticgovernment. Aretheirtwobloodgroupscompatible( canbloodfromonepersonbegiventothe otherperson) ?
ComplexKarmak,kark,ok ynl,anlalmaszor,iinden klmaz acomplexmolecule/carbohydrate acomplexnetworkofroads acomplexprocedure Thecompanyhasacomplex organizationalstructure. It'saverycomplexissuetowhichthereis nostraightforwardanswer. Thefilm'splotwassocomplexthatI couldn'tfollowit.
Victimsofthecrashwillbecompensated fortheirinjuries. Nothingwillevercompensateforhislost childhood. Hisenthusiasmmorethancompensates forhislackofexperience. Itookherswimmingtocompensatefor havingmissedoutonthecinema. WewerelateandIwasdrivingfastto compensate.
CompileDerlemek,toplamak
We'recompilingsomefactsandfigures foradocumentaryonthesubject.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
ComponentPara,blm, unsur television/aircraft/computercomponents Thefactorysupplieselectrical componentsforcars. Thecoursehasfourmaincomponents: businesslaw,finance,computingand managementskills. Freshfruitandvegetablesareanessential componentofahealthydiet. Thecontrolofinflationisakey componentofthegovernment'seconomic policy. CompoundKartrmak Mosttiresaremadeofrubber compoundedwithotherchemicalsand materials. ComprehensiveAyrntl, detayl,btnsel,okynl Weofferyouacomprehensivetrainingin allaspectsofthebusiness. Isthislistcomprehensiveorarethere somenamesmissing? Hehaswrittenafullycomprehensive guidetoKPDStest.
r.
Bringinearn(kazandrmak)
Thejobbringsintwothousanddollarsa month.
Gettingwetintherainyesterdaybrought onmycold.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Brushupimproveaskill quickly(gelitirmek) Shetookatwoweekcoursetobrushup herSpanishbeforeshetraveledaround SouthandCentralAmerica. Bumpinto meetbychance (rastlamak) IbumpedintoHelenontheunderground theotherday. Burndownburncompletely (yanpklolmak) Theyhadtocompletelyrebuildthe museumaftertheoldoneburneddown. Burnoutloseenthusiasmand energytocontinueina demandingjob(tkenmek) Jennieburntoutaftertenyearsworking asafuturesbrokerandwenttoliveinthe country.
r.
I'llcallforyouatseven,sobeready becausethefilmstartsathalfpast.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Callonaskforhelp(ar yapmak) ThePresidentcalledonthewealthy countriesforfinancialaidafterthefloods destroyedmuchofthecountry's agriculture. Callupsummonsomeonefor militaryservice(askerearmak) Thearmycalledupthereservesoldiers whenthewarbrokeout. Callupphone(telefonetmek) IcalledhimupassoonasIgottoa phonetotellhimthenews. Calmdownstopbeingangry oremotionallyexcited (sakinlemek) WhenIlosemytemper,ittakesagesfor metocalmdownagain.
r.
Catchupgetwork,etc,upto date.(yetitirmek)
IwasillforafortnightandnowI'vegotto catchupontheworkImissed.
Shewasarrestedincustomslastnightand hasbeenchargedwithsmuggling.
Chargewithaccusesomebody ofacrime(sulamak)
TheycheckedinattheRitzyesterday.
w w
Checkintoregisteronarriving atahotelorattheairport(kayt yaptrmak) TheycheckedintotheRitzyesterday.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Cheerupbelessunhappy (yzglmek) Comeon,cheerupitisn'tallbad,you know. Clearuptheendofaninfection (iyilemek) Itooktheantihistaminesandtherash cleareduprightaway. Clearuptidyup(temizlemek) I'dbetterclearupthemessbeforeleave. Closedowncloseabusiness permanently(tamamen kapatmak) Thefirmcloseddownduringthe recessionbecauseitcouldn'tcompetewith thecutpriceimportspouringin.
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
r.
AcademicVocabularyforKPDS&DS Test2
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Icloselylookedtoseewhetherhis theoriesandargumentswerewithin thegeneralflowofhiswriting. A)considerable C)coherent E)contemporary B)concurrent D)constant 3.Anacceptablelevelofstabilityand securityinIraqamore multinationaleffortthanthedesperate USmoves. A)comesintouse B)bringsup C)catchesup D)callsfor E)comesapart 4.Theconcerthadtobebecause thesingerwentdownwithabadcase offlu. A)comeoff C)burnedout E)cleanedup B)calledoff D)cloudedover
r.
5.Itishardto therepercussionsof thecontinuousUSseignorageonthe worldwidefinancialcrisesand corruption. A)exceed C)facilitate E)evaluate B)export D)fluctuate
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)gooff D)getdown A)focuseson C)getsback E)goesdown B)fitsin D)givesin 12.Thechangestothenational educationsystemwillbebeginning fromthenextschoolyear. A)implicated C)implemented E)founded B)evaluated D)implied B)error D)final 13.Thelatestgeologicalreportsthe urgentneedforthegovernmenttotake immediatemeasurestoprevent enormouslossoflifeandpropertyin caseofaunexpectedearthquakein Istanbul. A)estimate C)exclude E)impose B)highlight D)impact 14.Hehasmanyhardshipsinhis shortlife. A)gonethrough C)gottenroundto E)gonedown B)fleshedout D)givenup
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
22.Inhisresearcharticlehemost wellknownauthorsonthesubject. A)clarifies C)communicates E)comprises B)coincides D)cites 23.Therewasabigovertheuseof drugsinathletics. A)decade C)controversy E)duration B)derivation D)disposal B)component D)challenge 24.Theheavysnowhasblockedmany roadsand anumberofvillages. A)drawnup C)duginto E)cometo B)cutoff D)coppedout B)capacity D)compound
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)countedin D)ekedout B)empirical D)controversial B)channel D)conduct
r.
ACADEMICVOCABULARY FORKPDS&DS3
ConceiveSanmak,alglamak, dnmek,tahayyletmek Ithinkmyunclestillconceivesofmeasa fouryearold. Hecouldn'tconceiveofatimewhenhe wouldhavenojob. [+questionword]Ican'tconceive(Itis tooshockingtoimagine)howanyone couldbehavesocruelly. [+that]Ifindithardtoconceive(Itistoo shockingtoimagine)thatpeoplearestill treatedsobadly.
ConcludeBitirmek, sonulamdrmak,bitmek,sona ermek,sonucavarmak Sheconcludedthespeechbyreminding usofourresponsibility. BeforeIconclude,I'dliketothankyouall forcoming. Theconcertconcludedwitharousing chorus. [+that]Thejuryconcludedfromthe evidencethatthedefendantwasinnocent. Wetalkedlateintothenight,butnothing wasconcluded.
ConcentrateOdaklanmak, kendinivermek,konsantreolmak
Comeon,concentrate!Wedonthaveall daytodothis. Ican'tconcentrateonmyworkwithall thatnoise. Ifindrunningconcentratesthemind( helpsmetothink). I'mgoingtoconcentrateonmywritingfor awhile. Thecompanyisconcentrating(its resources)ondevelopingnewproducts.
ConceptKavram,fikir,dnce
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
ConcurrentEzamanl Thejudgeimposedconcurrentsentences totalling14yearsfortheattacksonthe girls. ConductYapmak,geirmek Weareconductingasurveytofindout whatourcustomersthinkoftheirlocalbus service. Theexperimentswereconductedby scientistsinNewYork. Howyouchoosetoconductyourprivate lifeisyourownbusiness!
r.
ConformUymak ConfineSnrlamak, snrlandrmak,tutsakyapmak Atourschool,youwererequiredto conform,andtherewasnoplacefor originality. Beforebuyingapram,makesurethatit conformstotheofficialsafetystandards. Membersmustconformtoastrictdress code.
Let'sconfineourdiscussiontothematter inquestion,please! Pleaseconfineyouruseofthetelephone tobusinesscalls. Byclosingtheinfectedfarmswe'rehoping toconfinethediseasetothenorthofthe region(stopitfromspreadingtoother areas) . Thehostageshadbeenconfinedforso longthattheycouldn'tcopewiththe outsideworld.
[+that] Sixpeoplehaveconfirmedthat theywillbeattendingandtenhaven't repliedyet. Flightsshouldbeconfirmed48hours beforedeparture. I'veacceptedthejoboverthephone,butI haven'tconfirmedinwritingyet. [+questionword]Thesmellofcigarette smokeconfirmedwhathehadsuspected: therehadbeenapartyinhisabsence. [+(that)]Hisannouncementconfirmed (that)hewouldberesigningasPrime Minister. Theleader'sspeechwasimpressiveand confirmedhisfaithintheparty.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
ConsentRazolmak,izin vermek [+toinfinitive]Veryreluctantly,I've consentedtolendhermycar. Myauntnevermarriedbecauseherfather wouldn'tconsenttohermarriage. ConsequentNihai,sonu olarakortayakan Ouruseofharmfulchemicalsandthe consequentdamagetotheenvironmentis averyseriousmatter. ConsiderableByk,fazla: Thefirecausedconsiderabledamageto thechurch.
r.
ConsistMeydanagelmek, olumak TheteamconsistsoffourEuropeansand twoAmericans. It'sasimpledishtoprepare,consisting mainlyofriceandvegetables. Thebeautyofairtravelconsistsinits speedandease. [+ingformofverb]Forher,happiness consistsinwatchingtelevisionand readingmagazines.
ConsultDanmak,aklalmak Ifthesymptomsgetworse,consultyour doctor. I'mnotquitesurehowtogetthere I'd betterconsultamap. Whydidn'tyouconsultmeaboutthis? ThisafternoonthePrimeMinisterwas consultingwithhisadvisorsandweare expectinganannouncementshortly.
ConstituteOluturmak
Thecountry'sprogresswasconstrained byaleaderwhorefusedtolookforward.
ConstrainKstlamak, snrlamak
Constructnaetmek,yapmak
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
ConsumeTketmek, kullanmak,bitiptkenmek Ourhighlivingstandardscauseour presentpopulationtoconsume25percent oftheworld'soil. Heconsumesvastquantitiesofchipswith everymeal. Hewasconsumedwithjealousy. Asateenager,Iwasconsumedby passionforthegirlnextdoor. Contactrtibatkurmak,iletiim kurmak Itriedtocontacthimathisoffice,buthe wasn'tin. Youcancontactmeat (speaktomeby phoning)3889146. Unlessthemoneyisreturned,weshall shortlybecontactingourlegal department. ContemporaryGnmz, ada,modern,ayndneme ait,dnemindeki,yat contemporarymusic/literature/art/fashion Althoughitwaswrittenhundredsofyears ago,itstillhasacontemporary( modern)feeltoit. Almostallofthecontemporaryaccounts oftheeventhavebeenlost.
r.
ContextKonu,kapsam, kontekst,durum,arkaplan Itisimportanttoseeallthefightingand bloodshedinhisplaysinhistorical context. Thissmallbattleisveryimportantinthe contextofScottishhistory. Inthisexercise,awordisblankedoutand youhavetoguesswhatitisbylookingat thecontext.
Theyhavejustcontractedourcompanyto buildsheltersforthehomeless.
r.
Contradictelimek,kar kmak
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
ContributeKatkdabulunmak, makaleyazmak Smokingcertainlycontributedtohisearly death. Aren'tyougoingtocontributetowards Jack'sleavingpresent? Cometothemeetingifyoufeelyouhave somethingtocontribute. Herfamilyhavecontributed$50,000to thefund. Shecontributestoseveralmagazines. ControversyAnlamazlk, tartma Therewasabigcontroversy surrounding/overtheuseofdrugsin athletics. Thepolicyhascausedfierce/heated controversyeversinceitwasintroduced.
ConvertDeitirmek,dinini deitirmek
Convinceknaetmek
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Weneedsomeonetocoordinatethe wholecampaign. Anumberofcharitiesarecoordinating theireffortstodistributefoodtotheregion. Coreekirdeinikarmak Peelandcorethepearsbeforecooking them. Corporate Bykbirirketeait, irket corporatefinance acorporatemerger corporateexecutives CorrespondTekabletmek, yaklamak,karlkgelmek, uygunolmak ThemoneyI'vesavedcorresponds roughlytotheamountIneedformy course. TheAmericanFBIcorrespondstothe BritishMI5. Hisstoryofwhathappenedthatnight didn'tcorrespondwiththewitness's version.
r.
Currency Para,parabirimi foreigncurrency CreateYapmak,yaratmak CharlesSchulzcreatedthecharacters 'Snoopy'and'CharlieBrown'. Hecreatedawonderfulmealfromvery fewingredients. It'simportanttocreateagoodimpression whenyoumeetanewclient.
Creditnanmak
CriteriaKriterler
TheHealthServiceshouldnotbejudged byfinancialcriteriaalone.
Crucialoknemli,gerekli, elzem
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
CycleDnmek,dndrmek, bisikletsrmek torideabicycle WedidalotofcyclinginFrancelastyear. DataBilgi,veri Thedatawas/werecollectedbyvarious researchers. Nowthedataisbeingtransferredfrom magnetictapetoharddisk. DebateTartmak,karar vermeyealmak InParliamenttoday,MPsdebatedthe Budget. Theyhadbeendebatingforseveralhours withoutreachingaconclusion. [+questionword]Theauthoritiesdebated whethertobuildanewcarpark. [+questionword] Wedebatedwhetherto taketheearliertrain. I'mstilldebatingwhatcolortopaintthe walls. DecadeOnyl,onyllkdnem Thefinaldecadeofthe20 century Overthelastdecade
th
r.
DeclineReddetmek,kabul etmemek,azalmak Iinvitedhimtothemeetingbuthe declined. Hedeclinedmyoffer. [+toinfinitive]Theydeclinedtotellme howtheyhadgotmyaddress. Hisinterestintheprojectdeclinedafter hiswifedied. Theparty'spopularityhasdeclinedinthe opinionpolls.
DemonstrateGstermek, aklamak Thesefiguresclearlydemonstratethe sizeoftheeconomicproblemfacingthe country. [+that]Researchhasdemonstratedthat babiescanrecognizetheirmother'svoice verysoonafterbirth. Theseproblemsdemonstratethe importanceofstrategicplanning. He'sgotajobdemonstratingkitchen equipmentinadepartmentstore. [+questionword]Theteacher demonstratedhowtousetheequipment.
Deducekarmdabulunmak
Inthedictionary'reality'isdefinedas'the stateofthingsastheyare,ratherthanas theyareimaginedtobe'. BeforeIansweryourquestion,couldyou defineyourtermsalittlemore(explain whatyoumeanbythewordsyouhave used)? Yourrightsandresponsibilitiesare definedintheConstitution. Yourroleintheprojectwillbestrictly defined(limitedtoparticularareas). I'dhatetofeelthatIwasdefinedby( thatmylifegotitsmeaningandimportance onlyfrom)myjob.
DefineTanmlamak,aklamak
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
DenoteTemsiletmek Thecolorredisusedtodenotepassionor danger. DenyReddetmek,kabul etmemek,mahrumetmek Herrequestfortimeoffworkwasdenied. Nooneshouldbedeniedagood education./Agoodeducationshouldbe deniedtonoone. [+twoobjects]Thegoalkeeperdeniedhim histhirdgoal. Iwasdeniedtheopportunityoflearning Frenchatschool.
r.
DetectFarketmek,ortaya karmak,bulmak Somesoundscannotbedetectedbythe humanear. Financialexpertshavedetectedsignsthat theeconomyisbeginningtoimprove. Highlevelsofleadweredetectedinthe atmosphere. Radarequipmentisusedtodetect(find thepositionof)enemyaircraft.
Despiteramen
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Takeonemploy(iealmak) Thecouncilhashadtotakeontwenty extraemployeestohandletheirincreased workload. Takeoutborrowalibrarybook (ktphanedenalmak) ItookoutallthebooksIneededformy essayfromthelibrary. Takeoutborrowmoneyfroma bankorotherofficiallender(bor almak) JackieandAniltookoutamortgageto buyabiggerflat. Takeoutextractorremove (karmak) Thedentisttookoutallofmywisdom teethbeforetheystartedcausingany problems.
DeriveAlmak,eldeetmek
r.
Takeupfilloroccupytimeor space(almak)
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Talkoutofpersuadesomeone nottodosomething (vazgeirmek) Hewasgoingtodrivehomeafterdrinking halfabottleofwine,buthisfriendstalked himoutofit. Tearapartdisturborupset greatly(ykmak,iparalamak) Peopleweretornapartwhennewsofthe traincrashcamethrough. Teardowndemolish(ykmak) Theestatewastorndownsothatthey coulddevelopthelandintoluxuryflats.
r.
Thinkoverconsidersomething carefully(dikkatlicednmek)
I'vethoughtitoverandhavemadeupmy mindI'mgoingtotakethejobinLeeds.
Theplanfellthroughbecausetheyhadn't thoughtitthroughproperly.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Tideoverusesomething carefullysoasnottofinishit (yetmek) This$50willhavetotidemeoveruntilI getpaid. Tidyupputthingsinthe correctplaceinaroom (dzeltmek) Itidiedupmybedroombecauseitwasa completemess. Tireofgetboredofsomething (sklmak) Shesoontiredofthecourseanddropped out. Tonedownmakesomething soundmoremoderate(alttan almak) TheMinistertriedtotonedownwhatshe hadsaidwhenthepressstartedattacking her.
r.
Trackdownfindafteralong search(araypbulmak)
Ittookmeagestotrackthemdowninthe crowdatthefootballgame.
Shetradedinheroldcarforthenew model.
Tradeoffbargain,makeadeal orcompromise
Alongerworkingweekwastradedofffor apayrise.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Turnawaynotallowsomeone toenteraplace(gerievirmek) Thedoormanturnedhimawayfromthe nightclubbecausehewaswearing trainers. Turndownreducevolume, temperature,etc.(sesiniksmak) Theroomwastoohot,sosheturnedthe heatingdown. Turndownrejectanoffer, invitation,etc.(reddetmek) Theyofferedherthejob,butsheturnedit down. Turningotobed(yatmak) IturnedinathalfpastelevenbecauseI hadanearlystartthenextmorning.
r.
Turnoutproduce(retmek)
Itlookedasifweweregoingtofail,butit turnedoutwellintheend.
Turnoutstopalight (sndrmek)
Sheturnedoutthelightsandwenttobed.
Shehadnobodytoturntowhenher husbanddied.
Turntotrytogethelp(yardm almak)
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Wakeupstopsleeping (uyanmak) Iwokeupathalfpastsixthismorning. Walkoncontinuewalking (yolunadevametmek) IsawtheaccidentbutjustwalkedonasI didn'twanttohavetogiveastatement. Wantoutwanttoleavea relationshiporarrangement (bitmesiniistemek) Jackiewantedoutofhermarriage. Warmupdoexercisesbeforea sport(snmak) Theteamwarmeduphalfanhourbefore thevolleyballmatch.
r.
Thelecturerwatchedoverthestudentsas theydidtheexperiment.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Wearoutusesomethinguntilit stopsworking(ieyaramazhale getirmek) Sheplayedthevideosomanytimesthat sheworethetapeout. Winddownrelax(dinlenmek) I'mgoingtowinddowninthecountrythis weekendanddonothing. Windupcloseacompany becauseit'sunprofitable(kepenk kapamak) Thecompanywaswoundupwhenthe creditorsdemandedpayment. Wireup makeelectrical connections(kurmak) Shewiredhernewstereosystemupas soonasshegothome.
r.
Thingsweregoingwrongforthembut fortunatelyitallworkedoutintheend.
Theywrappedupthepresentsthenputa ribbonaroundthem.
Wrapupcoverinpaper (sarmak,paketlemek)
Workoutfindtheansweror solution(cevap/zmbulmak)
r.
Workoutendnicely(iyibir ekildebitmek)
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Yieldtosurrender(teslim olmak) Itriedhardtoresist,butintheendI yieldedtotemptationandateitall.
AcademicVocabularyforKPDS&DS Test3
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Smokingcertainlytohisearly death. A)contributed C)credited E)emerged B)created D)declined 3.Mymouthwasnumbafterthe injectionoftheanestheticatthe dentist,butIfeltanexcruciatingpain whenthenumbnessstartedto. A)waterdown C)turnout E)wearoff B)wearout D)turnup 4.Therewasabigovertheuseof drugsinathletics. A)decade C)controversy E)duration B)derivation D)disposal
r.
8.Herworkhasbeentothe project'ssuccess.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
11.Thetwotrainaccidentshave broughtaboutpublicoutrage. A)compatible C)constant E)concurrent B)convenes D)corresponds B)coherent D)contemporary B)triedon D)wornoff 12.DoanMediaGroupistryingto allofthewellknownnewspapersand magazinesinordertoestablisha monopolyoverthemediaoutletsin Turkey. A)takeout C)taketo E)takeover B)takein D)takeup B)empirical D)controversial 13.Byshuttingdownthemainand secondaryaccessroadsthelocal administrationishopingtothe deadlydiseasetothissmallvillage. A)conform C)consist E)constitute B)conclude D)confine
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)committed D)comprised A)contradicts C)commits E)consists B)confirms D)constrains 20.Wehavebeentryingtohiminto runningforapoliticaloffice. A)talk C)take E)wear B)turn D)think 21.Beforepurchasinganyelectrical devicemakesurethatittothe officialsafetystandards. A)confirms C)conceives E)compiles B)conforms D)confers B)confine D)consist 22.Thecolorredisusedtopassion ordanger. A)ensure C)denote E)debate B)erode D)contribute
r.
28.ThedoctorsattheJohnsHopkins Universityare anewmedicinein thefightagainsttheAlzheimers disease. A)takingout C)tryingout E)turningaway B)turningout D)wearingoff
27.Theillegalresidentialslumsand shopsintheareasinwhichpeoplehad notvotedforthepartyinpoweratthe municipallevelwerebythe municipalauthoritieswhoturneda blindeyetosimilarconstructionsinthe areastheirvoteshadcomefrom. A)toldapart C)turneddown E)thrownout
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)convert C)eliminate E)contrast B)couple D)distribute 30.Itriedhardtoresistthelookofthe filledgrapevineleavesmywifehad made,butIcouldnthelpbut temptationandateupthewholepot. ThenIgotsickandhadto. A)yieldto/throwup B)turnin/thrownout C)tryon/throwaway D)turnagainst/yieldto E)waterdown/turnup B)torndown D)takenin
r.
ACADEMICVOCABULARY FORKPDS&DS4
DeviceAra
DevoteAdamak,ayrmak
Heleftgovernmenttodevotemoretimeto hisfamily. Shehasdevotedallherenergies/lifeto thecareofhomelesspeople. Attheageof25,hedecidedtodevote himselftoGod. Overhalfhisspeechwasdevotedtothe issueofunemployment. Thereportrecommendsthatmore resourcesbedevotedtoteachingfour yearolds.
DifferentiateAyrrmak,farkl klmak
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
DiminishAzalmak,azaltmak, kmsemek,kkdrmek Idon'twanttodiminishherachievements, butshedidhavealotofhelp. Thesememorieswillnotbediminishedby time. Whathedidhasseriouslydiminishedhim inmanypeople'seyes. We'veseenourhousediminish greatly/sharply/substantiallyinvalueover thelastsixmonths. Discrete Kendinezg,zel Thesesmallcompaniesnowhavetheir owndiscreteidentity. NOTE:Donotconfusewithdiscreet . DiscriminateAyrmclkyapmak Shefeltshehadbeendiscriminated againstbecauseofherage. Inordertoincreasethenumberoffemale representatives,theselectioncommittee decidedtodiscriminateinfavorofwomen forthreeyears.
r.
DisposeKurtulmak,elden karmak,yenmek
DistinctFarkl,deiik
DistortTahrifetmek,bozmak
DistributeDatmak Thebookswillbedistributedfreetolocal schools. Severalpeoplewerearrestedfor distributingracistleaflets/pamphlets(to thespectators). DominateKontrolelinde tutmak,stnlksalamak Herefusestoletothersspeakand dominateseverymeeting. Theyworkasagroupnoonepersonis allowedtodominate.
Myoriginalstatementhasbeencompletely distortedbythemedia.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
DocumentBelgelemek Hisinterestinbasketballhasbeenwell documented(recordedandwritten about)bythemedia. DomainAlan Shetreatedthebusinessasherprivate domain. Thesedocumentsareinthepublic domain(availabletoeverybody). DomesticAileii,yurtii domesticchores/duties/arrangements domesticairlines/flights Domesticopinionhadturnedagainstthe war.
r.
DurationSre,zaman
Heplannedastayoftwoyears'duration.
DynamicDinamik,artan
EconomyEkonomi
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Amovetowardshealthyeatingcouldhelp eliminateheartdisease. Weeliminatedthepossibilitythatitcould havebeenanaccident. Thepoliceeliminatedhimfromtheir enquiries. Hewaseliminatedinthethirdroundof thecompetition. EmergeOrtayakmak, meydanagelmek,grnmek,su yznekmak Sheemergedfromthesea,bluewithcold. Theministeremergedunscathedfromthe scandal. Thefactsbehindthescandalaresureto emergeeventually. [+that]Ithasemergedthatsecrettalks hadbeengoingonbetweenthetwo companiesbeforethetakeoverwas announced. He'sthemostexcitingTurkishsingerto emergeonthepopsceneforadecade.
EliminateOrtadankaldrmak, karmak,elimineetmek
r.
EnergyEnerji SinceIstartedeatingmorehealthilyI'veso muchmoreenergy. Iwasgoingtogooutthisevening,butI justdonthavetheenergy. [+toinfinitive]Ididn'tevenhavethe energytogetoutofbed. Herwritingisfullofpassionandenergy( enthusiasm). Theenergygeneratedbythewindmill drivesallthedrainagepumps. energyconservation/efficiency. nuclearenergy
EmpiricalEmpirik,gerek, bilimsel
EnableSalamak,yardmc olmak
[+toinfinitive]Computerizationshould enableustocutproductioncostsbyhalf.
EncounterKarlamak
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
EnforceKanunuuygulamak, salamak Itisn'talwayseasyforthepoliceto enforcespeedlimits. Thenewteacherhadfailedtoenforceany sortofdiscipline. Enhanceyiletirmek, dzeltmek Thesescandalswillnotenhancethe organization'sreputation/image. Enormousokbyk,devasa anenormouscar/house Heearnsanenormoussalary. IwasabsolutelyenormouswhenIwas pregnant. You'vebeenanenormoushelp.
r.
Ensure Salamak Theairlineistakingstepstoensuresafety onitsaircraft. [+(that)]Theroleofthepoliceistoensure (that)thelawisobeyed. [+twoobjects]Their20victorytodayhas ensuredtheTurkishteamaplaceinthe CupFinal. EquivalentAyn,eitolmak, karlk She'sdoingtheequivalentjobinthenew companybutformoremoney. Is$50equivalenttoabout30? ThereisnoEnglishequivalentfor'bon appetit'sowehaveadoptedtheFrench expression. Tenthousandpeopleayeardieofthe diseasethat'stheequivalentofthe populationofthistown.
Environmentevre,alan,yer Theofficeisquitebrightandairyit'sa pleasantworkingenvironment. Asaparentyoutrytocreateastable homeenvironmentforyourchildrento growupin. Certainchemicalshavebeenbanned becauseoftheirdamagingeffectonthe environment. We'renotdoingenoughtoprotectthe environmentfrompollution.
EquateEtutmak
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
ErodeZamanlabozmak,eklini deitirmek Windandrainhaveerodedthestatues intoshapelesslumpsofstone. Thecliffsareerodingseveralfeetayear. Hisbehaviouroverthelastfewmonths haserodedmyconfidenceinhis judgement. ErrorHata,yanllk Headmittedthathe'dmadeanerror. Thelettercontainsanumberoftyping errors. Humanerrorhasbeenblamedfortheair crash. Withsomethingasdelicateasbrain surgery,thereislittlemarginforerror( youmustnotmakemistakes).
EntityBirim,nite
r.
EthnicEtnik,yabanc Aquestiononethnicoriginwasincluded inthecensus. Thefactory'sworkforcereflectstheethnic mixfromwhichitdrawsitslabor. Conflictsbetweenthedifferentethnic groupsinthecountryexplodedintocivil war. ethnicfood ethniccostume
EstimateHesaplamak
EthicEtik,ahlakikurallar
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
EvaluateDeerlendirmek, lmek It'simpossibletoevaluatetheseresults withoutknowingmoreabouttheresearch methodsemployed. [+questionword]Wewillneedtoevaluate howthenewmaterialstandsuptowear andtear. EventualSon,nihai Weweretheeventualwinnersofthe competition. Althoughtheoriginalbudgetfortheproject was$1billion,theeventualcostislikelyto be50%higher. EvidentKolaycaanlalr,ak, belli Thefullextentofthedamageonlybecame evidentthefollowingmorning. Fromthesmellitwasevidentthatthe drainshadbeenblockedforseveraldays. Harry'scourageduringhisillnesswas evidenttoeveryone. Herloveforhimwasevidentinallthatshe did.
r.
Womenarestillexcludedfromtheclub. Microbesmust,asfaraspossible,be excludedfromtheroomduringan operation. Tomhasbeenexcludedfromschool( heisnotallowedtogotoschool)forbad behavior. Thepriceexcludeslocaltaxes. Wecan'texcludethepossibilitythatheis dead.
ExhibitGstermek,gsteri yapmak
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
ExplicitTam,ak Igaveherveryexplicitdirectionshowto gethere. Shewasveryexplicitabout(saidvery clearlyandexactly)whatshethoughtwas wrongwiththeplans. Iwasn'tawarethatIwouldbepayingyou certainlydidn'tmakeitexplicit(stateit clearly). ExploitYararlbirekilde kullanmak,smrmek Weneedtomakesurethatweexploitour resourcesasfullyaspossible. Lawsexisttostopcompaniesexploiting theiremployees.
r.
Leaveoutnotinclude(darda brakmak) ExposeAakarmak Theplasteronthewallshasbeen removedtoexposetheoriginalbricks underneath. Hedamagedhislegsobadlyinthe accidentthatthebonewasexposed. Thisphotographwasunder/overexposed (toolittle/toomuchlightwasallowedto reachthefilm). Thereviewexposedwidespread corruptioninthepoliceforce. Thenewspaperstoryexposedhimas ( showedthathewas)aliar. Hewasleftoutofthesidebecausehe hasn'tbeenplayingtoowelllately.
Thehotellaidofftwentystaffbecause touristnumbersweredown.
Layoffmakeanemployee redundant(itenkarmak)
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Letdowndisappoint,failto keepanarrangement(yzst brakmak) ShefailedtoturnupandIfeltbadlylet down. Letinallowsomeonetoenter (ierialmak) Thedoorstaffdidn'tlethiminthe nightclubbecausehewaswearingjeans. Letoffnotpunish(brakmak) Thejudgelethimoffwithafinerather thanaprisonsentencesinceitwashisfirst offence. Letoutallowtoleaveorgoout (brakmak,salmak) Theconvictwasletoutofprisonafter servingfiveyearsofaneightyear sentence.
r.
Liveoffusemoneyearned (geinmek)
Theyfindithardtoliveoffthemoneythey make.
Shelockedupaftereveryonehadleftand wenthome.
Theirauntielookedafterthemwhiletheir motherwasinhospital.
Lookafter takecare(bakmak)
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Lookfortrytofind(aramak) I'vebeenlookingforalltheirhiddenfiles, butIcan'tfindthemanywhere. Lookforwardtowaitforor anticipatesomethingpleasant (ipleekmek) I'mlookingforwardtomeetingyou. Lookin makeaquickvisit (hemenuramak) I'lllookinonthemonmywayhome. Lookinonvisitbrieflytoseeif everything'sallright(uramak) I'mgoingtolookinonGranontheway hometonightasshe'sbeenabitunwell recently.
r.
Welookedroundthehouseanddecided thatwedidn'tlikeitenoughtobuyit.
Lookroundinspectahouse (gzatmak)
Ididn'tknowthecorrectspellingsoIhad tolookitupinthedictionary.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Makeituptotryto compensatefordoingsomething wrong(gnlnalmak) Hetriedtomakeituptoher,butshe wouldn'tspeaktohim. Makeupstopbeingangrywith someone(barmak) Theyarealwaysarguing,buttheymake upagainveryquickly. Makeupforcompensate(telafi etmek) Isentherapresenttotrytomakeupfor myappallingbehaviour. Meetwithhavesomething happentoyou(karlamak) Theymetwithsomeproblemstheyhadn't anticipated.
r.
Optforchoose(semek)
Ioptedforanendowmentmortgageand lostalotofmoney.
Owetobethereasonfor something(borluolmak)
Sheoweshersuccesstohardworkand determination.
Idon'tknowhowthingswillpanoutnow thecompany'sbeentakenover.
r.
Panoutthewayasituation develops(gelimek)
w
Passawaydie(lmek) Sadly,Georgia'sunclepassedaway yesterdayafterashortillness.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Paybackrepaymoney borrowed(geridemek) IpaidbackthetwentypoundsI'd borrowed. Paybacktakerevengeon(c almak) I'mgoingtopayhimbackforthatinsult. Payforpurchase(demek) Ipaidtwentypoundsforthebook. Payintodepositmoney (yatrmak) Ipaidthecashintomyaccount. Payoffcompletelyrepaya debt(deyipbitirmek) Themortgagewillbepaidoffintwenty fiveyears.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
r.
AcademicVocabulary forKPDS&DSTest4
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.I'lljustopenthewindowandlet___ somefreshair. A)off C)out E)around B)in D)down 3.Studentsfromuniversitiesasas METUandBogaziiuseDr.ahiners textbookswhentheylearnEnglish. A)definite C)dynamic E)energetic B)diverse D)enormous 4.Economiststhattheworld economicgrowthwillbereducedby onepercentduetotherecentoilprice hike. A)establish C)evolve E)extract B)estimate D)expand
B)data D)emphasis
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)creative C)enormous E)distinct B)crucial D)environmental 12.Primeministersoriginalstatements havebeencompletelybythemedia. A)distorted C)ensured E)depressed B)equated D)enforced 13.Rosewillyourhousewhile you'reaway. A)lookinto C)lookafter E)makefor B)nagat D)lookforwardto B)discrete D)enormous 14.Itisremindedthatwearingsuch attiresinthepublicisillegal. A)emphasis C)domain E)device B)energy D)culture
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)deduce C)derive E)differentiate B)define D)demonstrate 22.IwillhavetothismatterafterI returnfrommybusinesstrip. A)meetwith C)oweto E)lookinto B)openup D)passout B)enable D)distribute 23.Shefeltshehadbeen against becauseofherethnicbackground. A)contributed C)discriminated E)denoted B)convened D)credited B)detects D)dominates 24.Thesalesmenoftenthemoney fortheirexpensesandarethen reimbursed. A)laydown C)nagat E)payinto B)mixup D)layout
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)funded D)implemented B)estimated D)implicated
r.
ACADEMICVOCABULARY FORKPDS&DS5
External D,harici,dndaki theexternalwallsofthehouse Femalekangarooscarrytheiryoungin pouchesthatareexternal totheirbodies. Thiscreamisforexternaluseonly(it mustnotbeputinsidethebody). Inlateryears,hispaintingsbegantoshow anumberofexternalinfluences ( influencescomingfromotherpeople). Mostnewsmagazineshaveasection devotedtoexternalaffairs(foreign news). Youshouldn'tjudgepeoplebytheir externalappearances(whatthey appeartobelike).
Extractkarmak,zorlaelde etmek
FacilitateKolaylatrmak
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Federal Federal,federal hkmeteait thefederalgovernment Fee cret legalfees universityfees anentrance/registrationfee Wecouldn'taffordtopaythelawyer'sfee. FileResmibavuruyapmak Hehasfiledadivorcecaseagainsthis wife. Thecompanyfiledbankruptcy.
r.
FiniteKstl,snrl
FlexibleEsnek,deiebilir
FluctuateDalgalanmak, deimek
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Hewasunabletoformathisarticleonline duetohisilliteracyinthewordprocessing software. FormulaForml Wehavechangedtheformulaofthe washingpowder. Wehadtolearnchemicalformulaeat school,butIcanonlyrememberH 2Ofor water. There'snomagicformulaforsuccess. ForthcomingYaklaan Wehavejustreceivedtheinformation abouttheforthcomingconference. FoundKurmak,temele dayandrmak: Herlawyeraccusedtheprosecutionof foundingitscaseoninsufficientevidence. I'dliketoseetheresearchthatthese recommendationsarefoundedon. asocietyfoundedonegalitarianprinciples
r.
Functionlemek,almak
FundMasraflarkarlamak, fonlamak
Weneedtomakefundamentalchanges tothewayinwhichwetreatour environment. It'soneofthefundamentaldifferences betweenmenandwomen. Theschoolisbasedonthefundamental principlethateachchildshoulddevelopits fullpotential. Diversityisoffundamentalimportanceto allecosystemsandalleconomies. Someunderstandingofgrammaris fundamentaltolearningalanguage.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
GenerateOluturmak,meydana getirmek,oluturmak,retmek Herlatestfilmhasgeneratedalotof interest/excitement. Thenewdevelopmentwillgenerate1500 newjobs. Thesemeasureswillincreasetheclub's abilitytogeneraterevenue/income. Thewindfarmmaybeabletogenerate enoughelectricity/powerfor2000homes. Generation Nesil,jenerasyon (30yl),seri Theyoungergenerationsmoke/smokes lessthantheirparentsdid. Therewereatleastthreegenerations grandparents,parentsandchildrenatthe wedding. It'sourdutytopreservetheplanetfor futuregenerations. Thispaintinghasbeeninthefamilyfor generations. anewgenerationoflowfatmargarines Scientistsareworkingondevelopingthe nextgenerationofsupercomputers. Agenerationago,homecomputerswere virtuallyunknown.
r.
Goal Hedef,ama GuidelineKurallar Ourgoalisforthecountrytobefully independentwithintwoyears. Theyhavesetthemselvesaseriesof goalstoachievebytheendofthemonth. DoyouthinkI'llbeabletoachievemy goaloflosing5kilosbeforethesummer? TheEUhasissuedguidelineson appropriatelevelsofpayforparttime manualworkers.
GradeSnflamak, snflandrmak,notvermek
GrantVemek,yerinegetirmek
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
HenceBuyzden,onuniin HismotherwasItalian,hencehisname Luca. HierarchyHiyerari Somemonkeyshaveaverycomplex socialhierarchy. Herosequicklythroughthepolitical hierarchytobecomepartyleader. HighlightVurgulamak,altn izmek Thereporthighlightstheneedfor improvedsafety. Thespellingmistakesinthetexthadbeen highlightedingreen. HypothesisHipotez,kuram, bilimseldnce Severalhypothesesforglobalwarming havebeensuggested.
r.
IdentifyTanmak,ortaya karmak,belirlemek
Eventhesmallestbabycanidentifyits motherbyhervoice. ThegunmaninWednesday'sattackhas beenidentifiedasLeeGiggs,an unemployedtruckdriver. Thepoliceofficer identifiedhimself( gavehisnameorprovedwhohewas)and askedforourhelp. Theresearchwillbeusedtoidentify trainingneeds. Youneedtoidentifyyourpriorities.
Ideologydeoloji
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
IhaveanimageinmymindofhowIwant thegardentobe. Hedoesn'tfit(heisdifferentto)my imageofhowanactorshouldlook. Theaimistoimprovethepublicimageof thepolice. Thecompanyhasmadestrenuous attemptstoimproveitsimageinrecent years. televisionimagesofstarvingchildren Theimageyouseeinthemirrorseemsto bereversed. ImmigrateGetmek Heimmigratedwithhisparentsin1895, andgrewupinNewYork. ImpactEtkilemek Fallingexportrateshaveimpacted(on) thecountry'seconomyquiteconsiderably. ImplementUygulamak Thechangestothenationalhealthsystem willbeimplementednextyear.
Imagemaj,tahayyl,resim, grn
r.
Bonuspaymentsprovideanincentiveto workharder.
IncidenceOlay ImplicitDolayl,stkapal Heinterpretedhercommentsasan implicitcriticismofthegovernment. Implicitinthepoem'sclosinglinesarethe poet'sownreligiousdoubts. Therehavebeenquiteafewincidences ofbullyingintheschoolthisyear. anincreasedincidenceofcancernear nuclearpowerstations
Implymaetmek,dolayl sylemek
Impose(Resmiolarakveya zorla)koymak,vermek,yklemek
Veryhightaxeshaverecentlybeen imposedoncigarettes. Judgesareimposingincreasinglyheavy finesforminordrivingoffences. Thecouncilhasimposedabanonalcohol inthecityparks. Idon'twantthemtoimposetheirreligious beliefsonmychildren. Wemustimposesomekindoforderon thewaythisofficeisrun.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
InclineYnelmek,kaymak ThePrimeMinisterisbelievedtobe incliningtowardsanAprilelection. Income Gelir Averageincomeshaverisenby4.5%over thepastyear. Morehelpisneededforpeopleonlow incomes. Ihaven'thadmuchincomefrommy stocksandsharesthisyear. IncorporateBtnletirmek, iinekoymak,birletirmek Suggestionsfromthesurveyhavebeen incorporatedinto/inthefinaldesign. Thisaircraftincorporatesseveralnew safetyfeatures. IndexToplamak,sralamak Ourcomputerindexesseveralthousand newrecordseverysecond. Thebookcontainsalotofinformation,but it'snotverywellindexed.
r.
IndividualAyr,tek,tekbana duran,birey
Induceknaetmek,sebep olmak,dourmak
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Inherentzg,zel Therearedangers/risksinherentinalmost everysport. Ihaveaninherentdistrustoflawyers. InhibitEngellemek Someworkerswereinhibited(from speaking)bythepresenceoftheir managers. Thisdruginhibitsthegrowthoftumors. Initiallk,balang Myinitialsurprisewassoonreplacedby delight. Initialreportssaythatsevenpeoplehave died,thoughthishasnotyetbeen confirmed.
r.
Thefashionindustryisalwaysdesperate toinnovate.
Setoutdisplay,show (gstermek)
Thefiguresaresetoutinthecouncil's annualreport.
Setoutstartajourney(yola kmak)
TheexplorerssetoutfortheSouthPole yesterdaymorning.
Setupprepareequipment, software,etc.,foruse(kurmak)
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Afteryearsofpartyinganddrinking,she finallygotmarriedandsettleddown. Settleingetusedto(almak) Ittookhimawhiletosettleinwhenhe movedtoJapan. Settleonagree(kararklmak) Theycouldn'tagreeatfirstonanamefor theirdaughter,butfinallysettledonAlice. Showintakesomeoneintoan office(ierialmak) Thesecretaryshowedmeintospeakto themanager.
InnovateYenilenmek,yenilik getirmek
r.
Sidewithsupportsomeone (tarafntutmak)
Thelecturersidedwithherstudentsand gotsackedforherpains.
Wehadtosiftthroughthousandsoffiles beforewefoundwhatwewerelookingfor.
Siftthroughexaminealotof thingscarefully(eldengeirmek)
Thetruthfinallysankinaboutherdeath whenitwasbroadcastonTV.
r.
Sinkinslowlycometobe understood(danketmek)
ThestudentssatintheLibraryasa protestagainsttheincreaseintuitionfees.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Sortoutresolveaproblem (zmek) Hasthefirmsortedoutitstaxproblems yet? Sortoutsolveaproblem (zmek) Therewerealotofproblemsatfirst,but they'veallbeensortedoutnow. Speakouttalkopenlyand freely(zgrcekonumak) Peopleareafraidtospeakoutin oppressivepoliticalregimes. SpeakupTalkmoreloudly (yksekseslekonumak) Theycouldn'thearthespeakerandasked himtospeakupabit.
Standbysupportsomeone (yanndaolmak)
Hestoodbyherthroughoutthetrialashe believedhertobeinnocent.
I'mnotgoingtostandfortheirrudeness anylonger.
Standforacceptortolerate behavior(tahammletmek)
'WhatdothelettersBBCstandfor?' 'BritishBroadcastingCorporation.'
Shehadtostandinfortheeditorwhilehe wasonholiday.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Stayinnotgoout(evde kalmak) I'mgoingtostayinandchilltonightIcan't bebotheredtogoout. Stayonremainlongerthan anticipated(kalmak) Shestayedonaftershegraduatedtodoa Master'sdegree. Stayoutnotgohome(darda kalmak,elenmek) Westayedoutallnight. Stayupnotgotobed(ge yatmak) Thechildrenstayedupuntilwaypasttheir bedtime.
r.
Stepupincrease(artrmak)
Thepolicehavesteppedupthepressure onbeggarsworkingtheUnderground.
Sticktonotchange (vazgememek)
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Takeapart takesomethingto pieces(paralamak,skmek) Shetookthephotocopieraparttosee whathadgotstuckinit. Takeasidegetsomeonealone totalktothem(yanaekip konumak) Theteachertookherasideandsaidthat she'dfailedtheexam. Takeback makesomeone nostalgic(gerigtrmek) Thatsongalwaystakesmebacktowhen Iwasatuniversity. Takebackretractastatement, admitthatsomethingwaswrong (gerialmak) IhadtotakebackeverythingbadI'dsaid aboutthemwhenIlearnedhowthey'd helpedout.
r.
Takeinabsorbinformation (anlamak)
ThelecturewasratherboringandIdidn't takeinmuchofwhatthelecturersaid.
Takeindeceive(aldatmak)
Nobodywastakeninbyherunbelievable excuse.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Thesoftwarehousereallytookoffwhen theyproducedthelatestversionoftheir DTPpackage. Takeoffreducethepriceofan item(indirimyapmak) They'vetakentenpercentoffdesigner framesforglasses. Takeoffwhenaplanedeparts orleavestheground (havalanmak) Theflightforstanbultookoffontime. Takeonallowpassengersona shiporairplane(yolcualmak) TheplanestoppedatAnkaratotakeon somepassengers. Takeonassumea responsibility(stlenmek) Shetookonthetaskofindexingthebook.
r.
AcademicVocabularyforKPDS&DS Test5
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Followingtheeconomiccrisisin Turkeyin2001manyexportoriented factories. A)wentunder C)gaveoff E)gotat B)gavein D)firedup 3.DespitethePurchasingPowerParity theorythepriceofaBigMacmenu widelythroughouttheworld. A)focuses C)implies E)fluctuates B)estimates D)indicates 4.Asocietyonsocialistprincipals isnothingbutapipedream. A)funded C)exposed E)founded B)financed D)extracted
r.
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)eventual D)finite A)goby C)giveup E)geton B)fixup D)giveout 11.TheEUCommissionseemstobe towardsstartingaccessiontalkswith Turkeyin2050. A)imposing B)inclining C)establishing D)implementing E)extracting 12.Ifyoudontturnontheoverstove aspirator,thefirealarmwill. A)gooff C)getdown E)glossover B)giveup D)fireaway 13.Recentexplorationslarge reservesofoilbelowtheeasternBlack Sea. A)induce C)exceed E)fluctuate B)found D)indicate
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)exclude D)facilitate 21.Theenvironmentalistscallonthe authoritiestoshutdownthatplant,for italotofdeadlychemicalsmoke intotheair. A)givesoff C)flogsoff E)goesup B)givesback D)firesup B)gotin D)wentwith 22.Duringthe2004OlympicGamesin AthensthesuccessoftheTurkish womanathletestheexpectations. A)excluded C)guaranteed E)exceeded B)estimated D)implicated B)implicit D)final 23.Sheonherboyfriendwhenshe foundoutthathehadbeenseeing anotherwoman.. A)glossedover B)wentdown C)firedaway D)gotback E)gaveup B)getround D)geton
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)fitin C)getby E)gowith B)givein D)godown B)evident D)fundamental
Insertinesokmak/koymak, eklemek
Inspectncelemek,tetkik etmek,incelemeyapmak
Afterthecrashbothdriversgotoutand inspectedtheircarsfordamage. Sheheldthebanknoteuptothelightand inspecteditcarefully. AnofficialfromtheDepartmentofHealth willbei nspectingtherestaurantthis afternoon. ThevisitingPresidentinspectedthe troops.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
InstructEmirvermek,ders vermek Thepolicehavebeeninstructedtopatrol thebuildingandsurroundingarea. Integral Birbtnnparas olmak He'sanintegralpartoftheteamandwe can'tdowithouthim. Barsandterracecafsareintegraltothe sociallifeofthecity. Integrateinekarmak,iine katmak,birletirmek Heseemstofinditdifficulttointegrate socially. It'sverydifficulttointegrateyourselfintoa societywhosecultureissodifferentfrom yourown. Childrenareoftenverygoodat integratingintoanewculture. Theaim,saidtheminister,wasto integrateTurkeybothpoliticallyand economicallyintotheEuropeanUnion. Theideawithyoungchildrenisto integratelearningwithplay.
r.
IntenseYoun,ok,evkli
Interactletiimkurmak
IntermediateOrta seviyede/seviyeli
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
It'sdifficulttointerpretthesestatistics withoutknowinghowtheywereobtained. Ajuryshouldnotinterpretthesilenceofa defendantasasignofguilt. IfShakespeare'splaysaretoreachalarge audiencetheyneedtobeinterpretedina modernstyle. IntervalDnem,ara Weseeeachotheratregular intervals usuallyaboutonceamonth. There'softenalongintervalbetweenan authorcompletingabookanditappearing intheshops. InterveneMdaheleetmek, karmak,arayagirmek TheCentralBankintervenedinthe currencymarketstodaytotrytostabilize theexchangerate. [+toinfinitive]TheMinisterintervened personallytostopthemuseumbeing closed. Twodecadesintervenedbetweenthe completionofthedesignandtheopening ofthetheatre.
r.
InvestigateAratrmak, incelemek
r.
Invokearmak,atfta bulunmak
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Hewasisolatedfromalltheother prisoners. Ahighwallisolatedthehousefromthe restofthevillage. Theytriedtoisolate(find)thecauseof theproblem. Virusparticleswereeventuallyisolated fromthetissue. IssueVermek,yaynlamak Theofficewillbeissuingpermitson TuesdayandThursdaymornings. Theschoolissuedastatementaboutits planstothepress./Theschoolissuedthe presswithastatementaboutitsplans. ItemPara,konu thelastitemonthelist Therestauranthasalongmenuofabout 50items. Severalitemsofclothing(clothes)lay onthefloor. Therearethreeitemsontheagenda.
IsolateAyrmak,izoleetmek
Job atemporary/permanentjob Whensheleftcollege,shegotajobasan editorinapublishingcompany. It'sverydifficulttryingtobringuptwo childrenwhiledoingafulltimejob. He'snevermanagedtoholddown( keep)asteady(permanent)job. She'sappliedforajobwithaninsurance company. Areyougoingtogiveupyourjobwhen youhaveyourbaby? Howlonghaveyoubeenoutofajob( unemployed)? Afteradisastrousfirstmonthinoffice, manypeoplearebeginningtowonderif thenewpresidentisupto(abletodo) thejob. Hundredsofworkerscouldlosetheirjobs.
Laboralmak,yapmaya almak,zerindealmak: HetravelledaroundEuropelaboringto payhisway. [+toinfinitive]Threehoursafterthe explosion,rescueteamswerestill laboringtofreethosetrapped. Helaboredupthehillwithhisheavyload. She'sbeenlaboringoverthesamearticle fordays.
JournalDergi: amedical/tradejournal
JustifyMazaretbulmak,neden bulmak,dorulamak,kantlamak:
Label Etiketlemek: Theparcelwasclearlylabeled'Fragile'. Ifyouspendanytimeinprison,you're labeledasacriminalfortherestofyour life. LegislateKanun/yasayapmak Theypromisedtolegislateagainst cigaretteadvertising. It'shardtolegislatefor (makealawthat willprotect)theownershipofanidea.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
LayerKatkatkoymak,sermek: Layerthepastawithslicesoftomato. potatoeslayeredwithonions LectureDersvermek, eletirmek Fortenyearsshelecturedinlaw. ShetraveledwidelyinNorthAmerica, lecturingonwomen'srights. Hisparentsusedtolecturehimonhis tablemanners. Legal Hukuki,kanuni legaladvice alegalobligation/requirement legalstatus yourlegalrights legalaction/proceedings mylegalrepresentatives(mylawyers)
r.
LicenceLisans/izinvermek
[+toinfinitive]Severalcompanieshave beenlicensedtoselltheseproducts.
LikewiseAynekilde,aynen
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Thearmyhasbeenbroughtintomaintain orderintheregion. Wehavestandardstomaintain. Despitelivingindifferentcountries,thetwo familieshavemaintainedcloselinks. Thefilmhasmaintaineditspositionasthe critics'favouriteforanotheryear. Alargehousecostsalottomaintain. Theroadsaroundthetownhavebeenvery poorlymaintained. Theybarelyearnenoughtomaintain themselvesandtheirfourchildren. ThroughouthisprisonsentenceDunnhas alwaysmaintainedhisinnocence. [+that]Hemaintainsthathehasnever seenthewomanbefore. MajorByk,nemli Allofhermajorplayshavebeen translatedintoEnglish. Sugarisamajorcauseoftoothdecay. Therearetwoproblemswiththissituation, onemajor,oneminor. Citrusfruitsareamajorsourceofvitamin C. Therehasbeenamajorchangein attitudesrecently. TheUnitedStatesisamajorinfluencein theUnitedNations.
r.
ManipulateManipuleetmek, oynamak,tahrifetmek,elle altrmak/iyiletirmek Throughouthercareershehasvery successfullymanipulatedthemedia. Theoppositionleaderaccused governmentministersofmanipulatingthe statisticstosuitthemselves. Thewheelchairisdesignedsothatitis easytomanipulate. Thedoctormanipulatedthebaseofmy spineandthepaindisappeared completely.
Manual Elleyaplan
MarginYan,kenar
w
Matureolgunlamak Humanstakelongertomaturethanmost otheranimals. Girlsaresaidtomaturefasterthanboys. Hematuredalotwhilehewasatcollege. Ittookseveralyearsforherideasto mature.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
MediaMedya thelocal/nationalmedia mediaattention/coverage/hype/reports Theissuehasbeenmuchdiscussedinthe media. MediateAraclkyapmak Negotiatorswerecalledintomediate betweenthetwosides. Thetwoenvoyshavesucceededin mediatinganendtothewar. MedicalMedikal,tbbi medicaladvice medicalbooks amedicalteam medicalworkers
r.
MentalZihinsel
MethodMetot,yntem
MigrateGetmek,yer deitirmek
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
MinimizeAzaltmak, kmsemek,azgstermek Wemustminimizetheriskofinfection. Environmentalistsaredoingeverything withintheirpowertominimizetheimpact oftheoilspill. Sheaccusedthegovernmentof minimizingthesufferingofthousandsof people. It'simportanttofocusonyourstrengths andtominimizeyourweaknesses. NOTE:Theoppositeismaximize. Giveupstopdoingsomething thathadbeenahabit(brakmak) Igaveuptakingsugarinteaandcoffeeto loseweight. Giveuponlosefaithinorstop believinginsomethingor someone(midinikesmek) IgaveuponthemwhenIheardwhatthey weresayingaboutmebehindmyback.
r.
Goafterchase,trytoget (kovalamak)
Thebirdwentafterthepigeon,butitflew away.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Godowndecrease,getsmaller (dmek) Thepriceofscannershasgonedown recently. Godownsink(batmak) TheTitanicwentdownafterithitan icebergonitsmaidenvoyage. Godownsunset(batmak) Thesunwentdownatseveno'clock. Godownwithfallill(yakalanp hastaolmak) Shewentdownwithavirus. Goforattack(saldrmak) Theneighbour'sdogwentforthepostman andbithim.
r.
Gointoenteraprofession (mesleinegirmek)
Shewentintobankingaftershe'dfinished university.
Thefirealarmwentoffbecausesomeone wassmokinginthetoilets.
Gooffgobad(bozulmak)
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Gothroughreadagain (gzdengeirmek) Iwentthroughmynotesbeforetheexam. Goundergobankrupt(iflas etmek) Manysmallshopsaregoingunder becausetheycannotcompetewiththe supermarkets. Gouprise(ykselmek) Thepriceofpetrolhasgoneupsharply becauseoftheincreaseindutyinthe government'sbudget. Gouptoapproach(yanna gitmek,yaklamak)
r.
Growintogrowtofitlarge clothes(iinesmak)
Thejacket'sabitbig,butshe'llgrowinto it.
Growupmature,becomeadult (bymek)
HegrewupinGermany.
Handdownpassontothenext generation(gemek)
Thejeweleryhasbeenhandeddownin myfamilyforgenerations.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Hangonwait(beklemek) Couldyouhangonforamomenttillshe's free. Hangupendaphonecall (telefonukapatmak) Ilostmytemperandhunguponher. Haveonbewearing(giymek) WhatdidJoanhaveonattheparty? Heatup makefoodhot (stmak) Heheatedthesoupupinthemicrowave. Helpoutgiveassistance (yardmcolmak) ShereallyhelpedmeoutwhenIwas goingthroughmydivorce.
r.
Couldyouholdonforaminuteshe'llbe freeinamoment.
Holdonwait(beklemek)
r.
Holdupdelaywhentraveling (gecikmek)
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Keeponcontinue(devam etmek) Hekeptontryingandsucceededinthe end. Keepupnotletsomeonegoto bed(uyutmamak) Myneighborskeptmeuptillafter4am withtheirloudmusiclastnight. Keepupatcontinue,notquit (devametmek) Learningalanguageisdifficult,butifyou keepupatit,you'llsucceedintheend. Keepupwith moveatthe samerate(yetimek) Hewalkstoofastandit'sreallyhardto keepupwithhim.
Kickinwhenadrugstartsto takeeffect(etkisinigstermek)
Knockdowndemolish (ykmak)
Theyknockeddowntheoldchurchand builtablockofflatsinitsplace.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Herhayfeverdidn'tfeelhalfasbadonce theantihistamineshadkickedin.
r.
AcademicVocabularyforKPDS&DS Test6
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)keepupwith C)goafter E)jotdown B)keepon D)holdback 2.Lastnightourpowerwentoffbut afterabrief,thelightscameon again. A)interval C)instance E)integrity B)insight D)input 3.Heorderedtheconvictsto walkinguntilhetoldthemtostop. A)kickin C)keepup E)holdup B)keepon D)goafter 4.Chambershasbroughthis considerabletobearonthis complexproblem. A)interval C)impact E)insight B)issue D)effect
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)so C)legally E)intensely B)likewise D)forinstance 12.Hehisgroundinthefaceof virulentattacks. A)maintained C)intervened E)invoked B)issued D)labeled 13.Afterrumorsofanexplosioninthe IraniannuclearcityofBusherbyDogan NewsAgency,theIstanbulStock ExchangeIndex300points. A)wentdown C)grewup E)handedout B)wentoff D)kepton B)issued D)legislated 14.Atthirtytwo,sheisenoughto makeherowndecisions. A)intense C)legal E)mature B)liberal D)intrinsic
r.
20.Pleasedonotcommentsofyour ownintothebodyofthetext.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)issue D)justify 21.Wemustallthepartsintoa coherentwhole. A)justify C)issue E)mature B)integrate D)maintain 22.Thebombisdesignedtoby dialingacellphonenumbercodedinto theformer. A)gooff C)godown E)handover B)goup D)keepon 23.Asnopaintinghas worth,its valueisarbitrary. A)integral C)intense E)internal B)intelligent D)intrinsic
B)maintain D)mediate
r.
28.Sheaccusedthegovernmentof thepovertyofmillionsofpeopleby makingtheStatisticalInstitutepublish areportclaimingthatalmosteverybody inthecountrywasquitehappy. A)inserting C)intervening E)integrating B)legislating D)minimizing
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)givenup C)handedin E)jotteddown B)heldback D)kepton 30.Afteryearsofworkingasareligious priestatavillagemosque,hedecided toforaprofessionalcareerin politicspaidhiswayintoaparty,and electedtheMP. A)handin C)jotdown E)goby B)keepon D)goin B)handedin D)glossedover
25.Hehasmanytrialsand tribulationsbefore.
29.Ihavehernumberonascrapof paperandIcan'tfinditnow.
r.
ACADEMICVOCABULARY FORKPDS&DS7
MinimumEnaz,asgari Wageincreasesarebeingkepttoa minimumbecauseoftherecession. Shehopedthatherfiftiethbirthdaywould passwiththeminimumoffuss. Weneedaminimumoftenpeopletoplay thisgame. Eighteenistheminimumageforentering mostnightclubs. NOTE:Theoppositeismaximum.
MotiveNeden,sebep Whywouldshehavekilledhim?Shehas nomotive. Doeshehaveamotiveforlyingabout wherehewas? Whatisthemotivebehind(thereason for)thebombing? Ithinkyoushouldexamine/questiontheir motivesinofferingtolendyouthemoney. Shedeniesthatshehashadanulterior( secret)motiveformakingthedonation.
MinorKk,nemsiz
r.
Modeekil,yntem
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
MutualKarlkl Theirswasapartnershipbasedonmutual respect,trustandunderstanding. Bothcountriesareactingtotheirmutual advantage. Theagreementwasterminatedbymutual consent. NegateDeerini/nemini yitirmek Theincreaseinourprofitshasbeen negatedbytherisingcostsofrunningthe business.
NormalNormal,alelade
Ifthere'sanargumentbetweenmy daughterandhermother,it'simportant thatIremainneutral. Thepeaceconferencewouldhavetobe heldinaneutralcountry. I'drathermeetonneutralground/territory (somewherenotcontrolledbyor connectedtoeitherofus)ratherthaninhis apartment. Howardwantsdarkredwalls,butI'drather amoreneutralcolorlikecream. PurewaterisneutralandhasapHof7. Atomsconsistofpositivelycharged protons,negativelychargedelectronsand neutralparticlescalledneutrons.
Iknewalotaboutthesubjectalready,but hertalkwasinteresting,nevertheless.
r.
NeverthelessBunaramen
w
NonethelessBunaramen Thereareseriousproblemsinourcountry. Nonetheless,wefeelthisisagoodtime toreturn.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
NotionFikir,dnce [+that]Theprogrammakersrejectthe notionthatseeingviolenceontelevision hasaharmfuleffectonchildren. Ihaveonlyavaguenotionofwhatshe doesforaliving. NotwithstandingRamen Notwithstandingsomemembers' objections,Ithinkwemustgoaheadwith theplan. Injuriesnotwithstanding,hewonthe semifinalmatch.
NeutralTarafsz,ltsz,mat, dikkatekmeyen
anormalworkingday Livelybehaviorisnormalforafouryear oldchild. It'snormalforcouplestoarguenowand then. Theyweresellingthegoodsathalfthe normalcost. Thetemperaturewasabove/belownormal forthetimeofyear. Thingsarebacktonormalnowthatwe've paidoffallourdebts.
Nuclear Nkleer nuclearenergy/power anuclearpowerplant thenuclearindustry anuclearwar/attack nucleardisarmament Howmanynationshaveanuclear capability(havenuclearweapons)? ObjectiveAma,hedef Hermain/primeobjectivenowissimplyto stayinpower. Canthesalesforceachieve/meetits financialobjectives?
OccupyMeguletmek,igal etmek Thebathroom'soccupiedIthinkJohn's inthere. Therestofthetimewasoccupiedwith writingareport. Thehousehasn'tbeenoccupied(lived in)byanyoneforafewmonths. AlargepictureofthebattleofWaterloo occupiedthespaceabovethefireplace. OnlongcarjourneysIoccupymyselfwith solvingmathspuzzles. Allthenewtoyskeptthekidsoccupiedfor hours. Troopsquicklyoccupiedthecity. Protestingstudentsoccupiedthe universityofficefortwoweeks. theoccupyingforces
ObtainAlmak,eldeetmek
r.
ObviousAk,anlalmas kolay,bilinen,belli
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
OccurMeydanagelmek,olmak, aklnagelmek Anaccidentinvolvingovertenvehicleshas occurredintheeastboundlane. Ifanyofthesesymptomsoccurwhileyou aretakingthemedicine,consultyour doctorimmediately. Violenceofsomesortseemstooccur in everysociety. Mineralsoccurnaturallyintheearth's crust. Thethoughtdidoccurtome. [+that]Itneverevenoccurredtousthat hehadn'tbeeninvited. DoesitneveroccurtoyouthatImightlike tobeonmyownoccasionally?
OddTuhaf Herfatherwasanoddman. Whatanoddthingtosay. Theskirtandjacketlookedabitodd together. That'sodd(surprising)I'msureIput mykeysinthisdrawerandyetthey'renot here. It'soddthatnoone'sseenhim. Itmustbeoddtoliveonthe43rdfloor.
OffsetEtkisizklmak
Theextracostoftravelingtoworkisoffset bythelowerpriceofhouseshere.
OngoingDevameden,sren, devametmek
OptionSeenek,opsiyon
OrientateYneltmek
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
OverallGenel,genelolarak, son Theoverallsituationisgood,despitea fewminorproblems. Overall,ithasbeenagoodyear. Theoverallwinner,aftertengames,will receive$250.000. Overlapststegelmek, akmak Thefenceismadeofpanelswhich overlap(eachother). Mymusicaltastesdon'toverlapwithmy brother'satall. OverseasYurtd,yurtdna, yurtdnda Weneedtoopenupoverseasmarkets. Therearealotofoverseasstudentsin Cyprus. Mybrotherisastudentoverseas. Manymorepeoplego/travel/live/work overseasthesedays.
r.
ParameterParametre,ereve
PartnerOrtak,partner,ortaklk yapmak
Sheneverparticipatesinanyofour discussions,doesshe?
ParticipateKatlmak
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
PercentYzde Yougot20percentoftheanswersright thatmeansoneineveryfive. Only40%ofpeoplebotheredtovoteinthe election. PeriodSre,zaman Herworkmeansthatshespendslong periodsawayfromhome. Unemploymentinthefirsthalfof1993was 2%lowerthaninthesameperiodtheyear before. Fifteenpeoplewerekilledin/overaperiod offourdays. Thestudywillbecarriedoutoverasix monthperiod. Mostteenagersgothrougharebellious period. ThehousewasbuiltduringtheOttoman period.
r.
Theywillphasethenewhealthcare systeminoveraperiodoffiveyears.
r.
PhenomenonOlay
PhaseYavayava yerletirmek
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
physicalexercise/fitness/strength/ disabilities I'mnotaveryphysicalsortofperson(I don'tenjoyphysicalactivities) . Therefereesteppedinbecausethegame hadstartedtogetabitphysical. PlusArt,ve,ayrca Whatissixplusfour? Therentwillbe$75aweek,plus( addedtothecostof)gasandelectricity. Therewillbetwoadultstravelling,plus threechildren. Let'snotgoonholidayinAugustit'llbe toohotplusit'llbemoreexpensive. PolicyPolitika HebelievesthatTurkeyneedsanew foreignandsecuritypolicy. Whatisyourparty'spolicyoneconomic development?
PerspectivePerspektif,bak as
PhysicalFiziksel,krc
PositivePozitif,olumlu Twoisapositivenumber.
NOTE:Theoppositeisnegative.
PotentialPotansiyel,olas
Anumberofpotentialbuyershave expressedinterestinthecompany. Manypotentialcustomersarewaitingfor afallinpricesbeforebuying. TheaccidentintheBosphorusisagrim reminderofthepotentialdangersinvolved inoiltransportationthroughtheStraits. Theregionhasenormouspotentialfor economicdevelopment. Idon'tfeelI'machievingmyfullpotential inmypresentjob. [+toinfinitive]Youhavethepotentialto reachthetopofyourprofession. Ithinkthisroomhasgotalotofpotential (couldbeverygoodifsomechanges weremadetoit).
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
PreciseTam,doru,tam tamna Thebunker'spreciselocationisaclosely guardedsecret. Hecaughtmeattheprecisemomentthat Ifainted. Therewasagoodturnoutforthemeeting twelveofustobeprecise. PredictTahminetmek It'sstillnotpossibletoaccuratelypredict theoccurrenceofearthquakes. [+that]Whocouldhavepredictedthat withintenyearshe'dbeinchargeofthe wholecompany? [+toinfinitive]Thehurricaneispredicted toreachthecoasttomorrowmorning. [+questionword]Noonecanpredict whentheearthquakewillstrikeagain.
r.
Comeoutasecretisrevealed (aklanmak)
Thedetailsofthescandalcameoutinthe pressandshehadtoresign.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Comethrougharrive (messagesandinformation) (gelmek) Newsiscomingthroughofamajor accidentonthehighway,wherefreezing foghasbeenmakingdrivingconditions extremelydangerous. Cometobecomeconscious, wakeupfromanaesthetic (aylmak) Shecametoanhouraftertheoperation. Cometoresultin(gemek) Thetwomenstartedarguingbuttheysoon cametoblowsandstartedfightingin earnest.
r.
Comeupwiththinkofa solution,excuse,etc.(bulmak)
Nobodycouldcomeupwithasatisfactory explanationfortheaccident.
Comeuponfindbychance (rastlamak)
Icameuponthebookinalittlesecond handbookshopinDorset.
Ilefttheteaforaminuteuntilithad cooleddownenoughtodrink.
Cooldown getcooler(lmak)
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Cutbackreduce(azaltmak) Thefirmcutbackproductionbecause salesweresluggish. Cutbackonreduce(azaltmak) Nocountryiswillingtocutbackonthe spendingonitsarmedforces. Cutdownconsumeless (azaltmak) I'mtryingtocutdowntheamountof coffeeIdrinkduringtheday. Cutdownonreduce (azaltmak) Doctorsadvisedhertocutdownonthe amountofsaturatedfatsinherdiet.
r.
Cutoutexclude(karmak) I'mcuttingoutsaltfrommydiet.
Thelastnotesdiedawayandthe audienceburstintoapplause.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Douprepairandrenovate (onarmak) Ittookthemsixmonthstodoupthehouse beforetheycouldactuallymovein. Dragonbeunnecessarilylong (uzamak) Themeetingdraggedonfortwoanda halfhours. Drawupprepareacontract (hazrlamak) Thecontractwasdrawnupbyour solicitor. Dreamofnotthinkorconsider (hayaletmek) Iwouldn'tevendreamoftellingherthat.
r.
Sheslammedthecardoorshutanddrove offwithoutsayingaword.
Driveoffdriveawayfroma place(aralaayrlmak)
IwasintheareasoIdroppedinatthe officetoseeher.
r.
Dropinvisitwithouthaving madearrangements(uramak)
Shedroppedoutofcollegeandwent straightintoagoodjob.
Dropoutquitacourse (brakmak,ayrlmak)
w
Enterforjoinorentera competition(yaragirmek) Theyenteredfor thenational championshipbutweren'tgoodenough.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Embarkonstartaprojector venture(balamak) PiereembarkedonanMBAatInseadlast autumn. Embarkuponstartaprojector venture(balamak) Fernandohasjustembarkedupona completelynewdirectionprofessionally. Endupbecomeordo somethingunplanned(sonunda) Wecouldn'tgetticketsforEgyptsowe endedupgoingtoTurkeyinstead.
AcademicVocabularyforKPDS&DS Test7
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Theheavysnowhasblockedmany roadsand anumberofvillagesin EasternTurkey. A)drawnup C)duginto E)cometo B)cutoff D)coppedout 3.Thisjudgefollowstheletterofthe law. A)physically B)philosophically C)precisely D)potentially E)optionally 4.Ifyou'regoingonthatskiingholiday, youcanmeinI'dlovetogo. A)come C)figure E)end B)count D)find
r.
5.Howisthegovernmentthe budgetlossesresultingfromthelarge amountsofinterestpayments? Easily,byraisingthepricesofoil, cigarettes,andtaxes. A)modifying C)perceiving E)offsetting B)obtaining D)negating
10.Thescandaloushumanrightsreport bythePrimeMinistercontrolled committeewasonthefrontpagesofall thepapersforafewdays,butthe interestgradually. A)cooleddown C)dwelledon E)dieddown B)countedin D)ekedout
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
11.Ihishesitationwhenasolo flightwassuggested. A)orientated C)predicted E)obtained B)fallback D)cutout B)occupied D)perceived 12.Castrosspeechatthepublic meeting forthreehours. A)draggedon C)diedout E)finishedoff B)cooleddown D)foughtoff 13.Theprogrammakersrejectthe thattheirrealityshowsontelevision reflecttherealitiesofthesocial relationsinthecountry. A)norm C)notion E)mode B)network D)motive 14.Thenewsyesterdaylittleother thanthescandalsurroundingthetrain accident. A)cutdownon C)filedaway E)easedup B)dwelledon D)crackeddown
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)output C)motive E)outcome B)notion D)norm B)offset D)perceived 22.Weallbrainstormed,butnoneofus couldagoodplanonhowwe shouldproceedtothenextstageinthe project. A)embarkon B)cutback C)dropin D)comeupwith E)doawaywith B)dwelledon D)crackeddown 23.Ifwecapturetheflagoftheenemy, wewillhavegainedour. A)mode C)objective E)network B)option D)minimum 24.Ittookthegovernment5yearsto thebuildingsthatweredestroyed duringtheearthquake. A)checkin C)cutoff E)comeup B)doup D)cutback
r.
26.Wetheagreementonly yesterday.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)option D)portion
B)endedup D)didup
r.
PrimeEnnemli,esas,eniyi ACADEMICVOCABULARY FORKPDS&DS8 Thisisaprimeexampleof1930s architecture. theprimesuspectinamurder investigation aprimesourceofevidence Thepresidentisaprime(likely)target fortheassassin'sbullet. Thehotelisinaprimelocationinthecity center.
PresumeFarzetmek,sanmak [+(that)]Ipresume(that)they'renot coming,sincetheyhaven'trepliedtothe invitation. [+speech]YouareDrSmith,Ipresume? "Arewewalkingtothehotel?""Ipresume not/so." [+object+adjective]Theboat'scaptainis missing,presumeddead(itisbelieved thatheisdead). Indemocraticlaw,youarepresumed innocentuntilyouareprovedguilty. [+object+toinfinitive]Theuniverseis presumedtocontainmanyotherplanets withsomeformoflife.
PreviousBirnceki,bundan nceki,eski
r.
PrimaryEsas,temel
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
PrincipalEnnemli Iraq'sprincipalexportisoil. HewasprincipaldancerattheDance TheatreofHarlem. Thatwasmyprincipalreasonformoving. PrinciplePrensip,kural theprinciplesofthecriminaljustice system Thecountryisrunonsocialistprinciples. Themachineworksaccordingtothe principleofelectromagneticconduction. Theorganizationworksontheprinciple thatallmembershavethesamerights. Prior n,nceki,nce Thecourserequirednopriorknowledgeof Spanish. Theyhadtorefusethedinnerinvitation becauseofapriorengagement( somethingalreadyplannedforthattime). theweekspriortoherdeath
Priorityncelik Themanagementdidnotseemtoconsider officesafetytobeapriority. Myfirst/toppriorityistofindsomewhere tolive. Youhavetolearntogetyourpriorities right/straight(decidewhicharethemost importantjobsorproblemsanddealwith themfirst). Mendingthelightsisaprioritytask( moreimportantthanotherjobs) . Banksnormallygiveprioritytolarge businesseswhendecidingonloans( Theydealwiththemfirstbecausethey considerthemmostimportant) . Officialbusinessrequirementsobviously take/havepriorityoverpersonalrequests (Officialbusinessmatterswillbedealt withfirst).
ProfessionalProfesyonel, uzman,ileilgili,ciddi Chris,you'reanurse,socanIaskyour professionalopiniononbandaging ankles? Bothdoctorshavebeenchargedwith professionalmisconduct(bador unacceptablebehaviorintheirwork). Itwouldlookmoreprofessionalifthe letterwastyped. Shealwayslooksveryprofessionalinher smartsuits. You'vedoneaveryprofessionaljob strippingthatfloor! She'saprofessional dancer/photographer. He'sarunnerwho'sjustturned professional.(Hisrunningusedtobea hobby,butnowitishisjob.) Roomforrentinsharedhousewouldsuit professionalperson. abarfullofyoungprofessionaltypesin suits healthprofessionals Ithoughtthewholemeetingwasgoingto fallapartbutyourescueditlikeatrue professional! theconsummateprofessional He'sonlybeenplayingfootballasa professionalfortwoyears.
ProceedDevametmek, srdrmek,balamak
Hislawyershavedecidednottoproceed withthecase. Preparationsforthefestivalarenow proceedingsmoothly. Shesatdownandproceededtotellme aboutherskiingholiday. Hetoldmehewasonadietandthen proceededtoeataplatefulofchips! PassengersforAnkarashouldproceedto gate126forboarding.
Processlemdengemek, ilemekoymak
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
ProhibitYasaklamak,imkansz klmak Motorvehiclesareprohibitedfromdriving inthetowncentre. Thegovernmentintroducedalaw prohibitingtobaccoadvertisementson TV. Parkingisstrictlyprohibitedbetween thesegates. Theloudnessofthemusicprohibits seriousconversationinmostnightclubs.
r.
PromoteTeviketmek, arttrmak,pazarlamak Advertisingcompaniesarealwayshaving tothinkupnewwaystopromoteproducts. TheInstituteisintendedtopromotean understandingofthepoliticsandcultureof theArabworld. Greenpeaceworkstopromoteawareness ofthedangersthatthreatenourplanet today. Ithaslongbeenknownthatregular exercisepromotesallroundgoodhealth.
ProspectOlaslk,dnce, aday Isthereanyprospectoftheweather improving? Thereseemslittleprospectofanendto thedispute. [+that]There'snotmuchprospectthat thiswarwillbeoversoon. There'severyprospectofsuccess. Theprospectofspendingthreewhole dayswithherfillsmewithhorror. I'mveryexcitedattheprospectofseeing heragain. Wefacetheprospectofhavingtostartall overagain. We'llbeinterviewingfourmoreprospects forthepoststhisafternoon.
ProportionMiktar,oran,denge
Childrenmakeupalargeproportionof theworld'spopulation. Ahigherproportionofwomennowsmoke thanusedtobethecase. Thereportshowsthatpoorfamiliesspend alargerproportionoftheirincomeon food. Theproportionofwomentomenatmy collegewasaboutfivetoone. Thechartshowshowweightincreasesin proportiontoheight(theincreasein weightdependsontheincreaseinheight). Thelevelofcrimeinanareaisalmost alwaysindirectproportiontothenumber ofunemployed. Yourlegsareverymuchinproportionto (therightsizefor)therestofyourbody. Hisfeetseemverysmallinproportionto hisbody. Myheadwasmuchnearerthecamera thantherestofmesoI'malloutof proportion. You'vegottokeepasenseofproportion (theabilitytounderstandwhatis importantandwhatisnot).
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Protocol Protokol,Resmi Anlama TheGenevaProtocolof1925prohibits theuseofpoisonousgasesinwar. PsychologyPsikoloji ShestudiedpsychologyatHarvard. alecturerinpsychology childpsychology thepsychologyofthesoldier
r.
PublicationYayn Thebrochurewillbereadyforpublication inSeptember. Willyouarrangethepublicationofthe namesofthewinners? Whenisthepublicationdate( Whenwill thebookbeavailabletobuy)? Ourlatestpublicationisamagazinefor healthenthusiasts.
forsometime,butsofarhehasrejected alltheiroffers. Wewillnotbepursuingthismatterany further. Thepolicearecurrentlypursuingseveral linesofinquiryintothecase. Idon'tthinkthisideaisworthpursuing anyfurther. Thepresshaspursuedthisstory relentlessly. He'sbeenpursuingherformonthsand yetshe'ssoclearlynotinterested.
PublishYaynlamak,aklamak
PurchaseSatnalmak
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
QualitativeKalite Isthereanyqualitativedifference betweenthesetwovideorecorders? QuoteAlntyapmak,demek, szlerikullanmak He'salwaysquotingfromhisbook. "Ifthey'reflexible,we'reflexible",the officialwasquotedassaying. Sheworked,toquoteherdaughter,"asif therewasnotomorrow". CanIquoteyouonthat(CanIrepeatto otherpeoplewhatyouhavejustsaid)? Radical Radikal,ar Hewasknownasaradical reformer/thinker/politician. Thesepeoplehaveveryradicalviews. Shewasaradicalallherlife. RandomGeliigzel,plansz randomchecks/tests/attacks Weaskedarandomsample/selectionof peoplewhattheythought.
r.
ReactKarlkvermek,tepki vermek,reaksiyonagirmek
RecoverDzelmek,salna kavumak,iyilemek,gerialmak
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
RefineRafineetmek, gelitirmek Crudeoilisindustriallyrefinedtopurifyit andseparateoutthedifferentelements, suchasbenzene. Engineersspentmanymonthsrefining thesoftware. RegimeRejim,dzen Theoldcorrupt,totalitarianregimewas overthrown. Theregimeinthisofficeishardworkand morehardwork. RegionBlge thesemidesertregionsofAustralia theBirminghamregion Hesaidhehadsharppainsinthestomach region/theregionofthestomach.
Shewentintoacomaanddiedwithout recoveringconsciousness. Shewasastonishedtoseeme,butshe soonrecoveredhercomposure/herself( soongavetheappearanceofbeingcalm). Ittookalongtimefortheeconomyto recover(improve)aftertheslump. Policeonlyrecover(getback)avery smallpercentageofstolengoods. Theinitialoutlayofsettingupacompany isconsiderableandittakesawhileto recoverthosecosts (getbackwhatyou havespent).
r.
RelaxDinlenmek,rahatlamak, rahatbrakmak,gevetmek RegulateDzenlemek,dzene koymak Youcanregulatethetemperatureinthe housebyadjustingthethermostat. Hermotherstrictlyregulateshowmuch TVshecanwatch. Afterworksherelaxedwithacupoftea andthenewspaper. Agoodmassagewillrelaxyourtired muscles. Herelaxedhisgriponmyarm(He begantoholditlesstightly). Twoweeksafterthepolicerelaxed securityattheairports,therewasabomb attack.
ReinforceGlendirmek, takviyeetmek
TheappealwasrejectedbytheHigh Court. CoinoperatedmachinesinEnglandreject Irishmoney. Theprimeministerrejectedthe suggestionthatitwastimeforhimto resign. Iappliedforajobasamechanicinalocal garage,butIwasrejected(Iwasnot offeredthejob). Thefootballcoachrejectedhimforthe
RejectKabuletmemek, reddetmek,gerievirmek
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
ReleaseBrakmak,karmak, kurtarmak,ekmek,(dar) atmak,yaynlamak,piyasaya karmak Hewasreleasedfromprisonafterserving twoyearsofafiveyearsentence. Shewasarrestedforshopliftingbutwas releasedonbail(afterpayingasumof moneytothelawcourt). Theoperationreleasedhimfromyearsof pain. Hereleasedthehandbrakeandthecar jumpedforwards. Theplanereleaseditsbombsat10000 feet. Coalpowerstationsreleasesulphur dioxideintotheatmosphere. Hormonesarereleasedfromglandsinto thebloodstream. Hepunchedthepillowinaneffortto releasehisanger. Policehavereleasedapictureoftheman theywanttoquestion. Theministerhasreleasedastatement explainingthereasonsforhisresignation.
r.
RelevantUygun,gerekli,ilgili, nemli Educationshouldberelevanttothechild's needs. Forfurtherinformation,pleaserefertothe relevantleaflet. Thepointishighlyrelevanttothis discussion. I'msorrybutyourpersonalwishesarenot relevant(important)inthiscase. NOTE:Theoppositeisirrelevant.
Requirestemek,gerekmek, gerektirmek,ihtiyacolmak Pleasetelephonethisnumberifyou requireanyfurtherinformation. Skiingat80milesperhourrequirestotal concentration. [+object+toinfinitive]Bringingupchildren oftenrequiresyoutoputtheirneedsfirst. Youarerequiredbylawtostopyourcar afteranaccident. [+that]Therulesrequirethatyoubring onlyoneguesttothedinner.
Reluctancesteksizlik
RelyGerektirmek,dayanmak, gvenmek
[+ingformofverb]Thesuccessofthis projectreliesoneveryonemakingan effort. Irelyonyouforgoodadvice. [+toinfinitive]I'mrelyingonthegarageto fixthecarbytomorrow. stanbulsweathercanneverbereliedon it'salwayschanging. [+ingformofverb]Don'trelyonfinding meherewhenyougetback(Imight havegone).
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
ResearchAratrmak,aratrma yapmak She'sresearchingintopossiblecuresfor AIDS. Journalistswerefranticallyresearching thenewPrimeMinister'sbackground, familyandinterests. Pickuplearnquickly(hemen renmek) ShepickedupSpanishinsixmonths. Pileupaccumulate(oalmak) WorkjustkeepsonpilingupandIreally can'tmanagetogetitalldone.
r.
Noonethoughtthatshewouldbeableto doit,butshepulleditoffintheend.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Putininstall(koymak) Theyhadtoputinawholenewcentral heatingsystembecausethehousewasso cold. Putoffpostpone(iptaletmek) Theconcert'sbeenputoffuntilnext monthbecausethesinger'sgotathroat infection. Putoffstoplikingsomethingor somebody(tiksindirmek) Iwasreallyputoffbythewayheeatswith hismouthopen. Putongetfat(imanlamak) He'sputonalotofweightsincehegave upsmoking.
r.
Ican'tputupwithmyneighbor'snoise anylongerit'sdrivingmemad.
Putupwithtolerate(tahamml etmek)
r.
Readoutreadaloudrather thansilently(sesliokumak)
Theteacherreadoutthenamesofthe studentswho'dpassed.
w
TheGovernmentquicklyruledoutthe possibilityofarelaxationofthelaw.
Ruleoutexclude(hari brakmak)
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Rundownloseenergyor power(bitmek) Youshouldonlyrechargethebatterywhen ithasfullyrundown. Runintocost(patlamak) Theprojecthasrunintomillionsofdollars withoutanyprospectofareturnonthis investment. Runintomeetbyaccident (rastlamak) IranintoJamesinabarinthecityon Friday. Runonbepoweredby (almak) Thevanrunsondiesel. Runoutofhavenoneleft (kalmamak) We'verunoutofsugarI'mgoingtothe shopsforsome.
Iwenttothestationtoseethemoff.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Sellouthavenomoreof somethingleftbecauseithas beenbought(satlpbitmek) TheticketsfortheconcertattheBrixton Academysoldoutinacoupleofhours. Selloutsellallavailabletickets (satlpbitmek) Theconcertcompletelysoldoutmonths inadvance. Sendbackreturnsomething (gerigndermek) Isentmyfoodbackbecauseitwas overcooked. Sendforasksomeonetocome andhelp(armak) Ihadtosendforaplumberbecausethe radiatorwasleaking.
r.
Setaboutstartdoing something(balamak)
Wesetaboutthecleaningandgotitdone beforelunchtime.
Setasideoverturnacourt verdictordecision(bozmak)
Setbackcost(patlamak)
Thecarrepairssetmebackeight hundredpounds.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Setoffstartajourney(yola kmak) Wesetoffforworkatseventhirty.
r.
AcademicVocabularyforKPDS&DS Test8
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Onceyoustartonsomething,you should. A)seeitthrough B)runitthrough C)putitout D)pickitup E)pileitup 3.Aturnstileentrythroughtheexit doors. A)prohibits C)benefits E)promises B)passes D)pollutes 4.Ifwesuchacourse,weare certaintoachievewhatwewant. A)promise C)proceed E)purchase B)premise D)pursue
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
12.Ayla'ssuggestionisnotstrictly toourplans. A)prime C)relevant E)random B)qualitative D)reluctant 13.Iamonthefactthatinterest ratesarelikelytostayattheirpresent levels. A)relying C)pursuing E)recovering B)presuming D)quoting 14.Hehasalwayshisroleinthe successofourcompany. A)pulledoff C)playeddown E)putin B)setoff D)runon B)pickedup D)pulledaway
r.
16.Itwasthatmembershipfees shouldberaised. A)presumed C)resolved E)refined B)prohibited D)reacted 21.Duetotheterroristincidentin BeslanthevisitoftheRussian PresidenttoTurkeywastill December. A)pointedout C)pushedin E)putdown
19.Theapplicationsforaidwillbe processedinorderof.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)pulledoff D)putback B)registered D)rejected 22.TheprogramcommitteeBilecik asthesiteofnextyear'sconference. A)sawthrough C)putoff E)setoff B)ruledout D)pulledaway B)savedup D)sawthrough 23.TheMinisterofFinanceistryingto broadentheofhisinfluenceinthe Cabinet. A)principle C)priority E)range B)process D)publication B)reference D)scarcity 24.Wearegas,sowedbetterstop bythenextstationandpumpinsome gas? A)sendingfor B)pullingin C)puttingout D)runningoutof E)runninginto
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)pickedup D)ranthrough
r.
ACADEMICVOCABULARY FORKPDS&DS9
Resolvezmek,kararvermek
Haveyouresolvedtheproblemof transportyet? Thecoupleresolvedtheirdifferencesand madeanefforttogetalong. [+that] Sheresolvedthatshewouldnever speaktohimagain. [+adverborpreposition]Afterhoursof argument,theyresolvedagainsttaking legalaction. [+toinfinitive]Thecompanyresolvedto takenofurtheractionagainstthethieves.
w w
RespondYantvermek, cevaplamak [+speech]Toeveryquestion,he responded"Idon'tknow." Iaskedherwhatthetimewas,butshe didn'trespond. Herespondedbymarchingoffand slammingthedoorbehindhim.
r.
ResourceDonatmak
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
RestoreRestoreetmek,eski halinedndrmek/kavuturmak, eskiyerinekoyulmak Thebadlyneglectedpaintingshaveall beencarefullyrestored. Afteraweekinbed,shewasfully restoredtohealth(shefelthealthy again). Theformerleaderwastodayrestoredto powerinthefirstfreeelectionsfortwenty years. Doctorshaverestoredhissight. Thegovernmentistryingtorestorepublic confidenceinitsmanagementofthe economy. Somepeopleareinfavorofrestoring capitalpunishmentformurderers. Thepaintingwasrestoredtoitsrightful owner. RestrainTutmak,kontroletmek, kontrolaltndatutmak Whenhestartedfighting,ittookfourpolice officerstorestrainhim. Shewassoangrythatshecouldhardly restrainherself. Youshouldtrytorestrainyourambitions andbemorerealistic. Growthincarownershipcouldbe restrainedbyincreasingtaxes.
Howdidsherespondtothenews? [+that] Whenthetaxofficewrotetome demandingunpaidincometax,I respondedthatIhadbeenworking abroadsince1998. Thepolicerespondtoemergencies( arriveandarereadytodealwith emergencies)injustafewminutes. Itremainstobeseenwhetherthecancer will respondtotreatment. Forpatientswhodonotrespondtodrug treatment,surgeryisapossibleoption.
Shehaslostherbattletoretaincontrolof thecompany. Hemanagedtoretainhisdignity throughouttheperformance. Shesucceededinretainingherleadinthe secondhalfoftherace. Ihaveagoodmemoryandamableto retain(remember)factseasily. Thesearetainsthesun'swarmthlonger thantheland.
RevealAklamak,ortaya karmak
RevenueGelir
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Hishelpfulnesstodayhasmademerevise myoriginalopinion/impressionofhim. Hispublishersmadehimrevisehis manuscriptthreetimes. RevolutionDevrim atechnologicalrevolution Penicillinproducedarevolutionin medicine. RigidSert,kaskat,kesin, keskin,deimez arigidsteelandconcretestructure Iwasrigidwith(stiffandunabletomove becauseof)fear. Weweredisappointedthattheyinsistedon sucharigidinterpretationoftherules. RoleRol Whatishisroleinthisproject? Schoolsplayanimportantroleinsociety. Sixpeoplehavebeenputontrialfortheir role(involvement)intheanti governmentdemonstrations.
RetainElindetutmak,muhafaza etmek
ReviseDeitirmek,yeniden dzenlemek
r.
RouteYnlendirmek Deliveriesareroutedvia/bywayofUlus.
SectionKsm,blm thesportssectionofthenewspaper thetailsectionofanaircraft Doestherestauranthaveanonsmoking section? Thepoorestsectionsofthecommunity havemuchworsehealth. Hewaschargedundersection17ofthe FirearmsAct(accordingtothatpartof thelaw).
ScheduleProgramlamak
ScopeAlan,boyut
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
SectorSektr Inthefinancialsector,banksand insurancecompanieshavebothlostalot ofmoney. Thenewgovernment'spolicyistotransfer stateindustriesfromthepublicsectorto theprivatesector. SecureGvenliinisalamak, salama/gvenceyealmak,bir eyizorlaeldeetmek Thebuildinghasonlyonemainentrance andwouldbeeasytosecure(against/from intruders). Thisformofinvestmentisanexcellentway ofsecuringyourchildren'sfinancialfuture. Hewasdisappointedbyhisfailureto securethetopjobwiththebank. Thechangeinthelawwillmakeitharder forthepolicetosecureconvictions. SeekAramak,almak
r.
Theydoaseriesonarchitecture throughouttheages.
SexCinsiyet,cins Whatsexisyourcat? Sometestsenableyoutofindoutthesex ofyourbabybeforeit'sborn. It'sillegaltodiscriminateagainstpeopleon thebasisof(their)sex. Sheaccusedheremployerofsex discrimination(oftreatingherunfairly becauseshewasawoman). Sheseemstoregardallmembersofthe malesexasinferior. Membersoftheoppositesexarenot allowedinstudents'roomsovernight.
SelectSemek Therewasachoiceoffourprizes,andthe winnercouldselectoneofthem. Amouseisadevicewhichmakesiteasier toselectdifferentoptionsfromcomputer menus. Howdoyouselectpeopleforpromotion? [+object+toinfinitive]Hewasselectedto playforTurkeyattheageofonly18. Thesupermarket'spolicyistoselectout( choose)thebestfruitanddiscardthe rest.
Sequence Sra,sralama
SeriesSeri,birka
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
ShiftDeitirmek,deimek Sheshifted(herweight)uneasilyfromone foottotheother. Thewindisexpectedtoshift(totheeast) tomorrow. Mediaattentionhasshiftedrecentlyonto environmentalissues. Incarsthatareautomatics,youdon'thave tobotherwithshiftinggears. Significantnemli,farkedilir Therehasbeenasignificantincreasein thenumberofwomenstudentsinrecent years. ThetalksbetweentheUSAandtheUSSR wereverysignificantfortherelationship betweenthetwocountries. SimilarBenzer
r.
SiteYer,alan
socalledSzmona,adna denilen
SoleTek,btn Specificzel,tektr
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
SourceKaynak asourceofheat/energy/light aheat/energy/lightsource OrangesareagoodsourceofvitaminC. Expertsaretryingtotrackdownthe sourceofthecontaminationinthewater supply. Wewalkeduptherivertoitssourceinthe hills. Moneyisoftenasourceoftensionand disagreementsinyoungmarriedcouples. Thejournalistrefusedtorevealher sources(saywhohadgiventhe informationtoher). AccordingtoGovernmentsources( peopleintheGovernment)manyMPsare worriedaboutthisissue. Alwaysacknowledgeyoursources(say whichbooksyouhaveused)attheendof anessay.
r.
StatusStat Theassociationworkstopromotethe statusofretiredpeopleasuseful membersofthecommunity. Therehasbeenanincreaseinapplications forrefugeestatus. Thesuccessofherbookhasgivenher unexpectedcelebritystatus. Applicantsshouldhaveadegreeora qualificationofequalstatus.
Hesaidweshouldmeetbutdidn'tspecify atime. Thepeacetreatyclearlyspecifiesthe termsforthewithdrawaloftroops. [+questionword]Thenewspaperreport didnotspecifyhowthemenwerekilled. [+(that)]Mycontractspecifies(that)I mustgiveamonth'snoticeifIleavemy job. Theloanmustberepaidwithinaspecified period/byaspecifieddate.
SphereAlan
StableDengeli,dzenli
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Straightforward Kolay,basit JustfollowthesignstoBradfordit'svery straightforward. StrategyStrateji Thepresidentheldanemergencymeeting todiscussmilitarystrategywithhis defencecommandersyesterday. Theirmarketingstrategyfortheproduct involvesobtainingasmuchfreepublicity aspossible. [+toinfinitive]We'reworkingonnew strategiestoimproveourshareofthe market. StressStres,bask Peopleunderalotofstressmay experienceheadaches,minorpainsand sleepingdifficulties.
SpecifyAkasylemek,belli etmek,belirlemek
r.
SubsequentSonraki,mteakip StructureYaplandrmak Wemustcarefullystructureandrehearse eachscene. awellstructuredargument Thebookdiscusseshisillnessand subsequentresignationfromthe government. Thoseexplosionsmusthavebeen subsequenttoourdeparture,becausewe didn'thearanything.
StyleStil,metod,yntem, tr
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
SubsidySbvansiyon,maddi yardm Thecompanyreceivedasubstantial governmentsubsidy. Thegovernmentisplanningtoabolish subsidiestofarmers. SubstituteYerinekoymak, yerinegemek Youcansubstituteoilforbutterinthis recipe. DaytonwassubstitutedforWilliamsinthe secondhalfofthematch. Gasfiredpowerstationswillsubstitutefor lessefficientcoalfiredequipment. SuccessorSelef,sonragelen OxfordBrookesUniversityisseekinga successor toitsvicechancellorwho retiresthisEaster. Thisrangeofcomputersisveryfast,but theirsuccessorswillbeevenfaster.
r.
Surveyncelemek,gzatmak, gzgezdirmek Hegotoutofthecartosurveythe damage. Shehaswrittenabookwhichsurveys( describesindetail)thehistoryoffeminism. Beforethenewrailwaywasbuilt,itsroute wascarefullysurveyed. Ifabuildingissurveyed,itisexamined carefullybyaspeciallytrainedperson,in ordertodiscoverwhetherthereisanything wrongwithitsstructure.
SumAnlamnortayakoymak, gstermek
Forme,herpaintingssumuptherestless spiritofAmerica.
Summaryzet,zetlemek
SupplementEk,eklemek, fazladan,ekstra,ekolarak
Thedoctorsaidsheshouldbetaking vitaminsupplements. ThemoneyIgetfromteachingevening classesprovidesasupplementtomy mainincome. Wepaidasupplement(anextra amountofmoney)sothatwecouldhavea cabinonboardtheship. Thenewspaperpublishesasports supplementeveryMonday. Thereisasupplementtothedictionary containingnewwords.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
SurviveHayattakalmak, salamkalmak,canlkalmak, geinmek,geridebrakmak Thebabywasbornwithaheartproblem andonlysurvivedforafewhours. Theseplantscannotsurviveinverycold conditions. NoneofShakespeare'splayssurvivesin itsoriginalmanuscriptform. Thefamilyarestrugglingtosurviveon verylittlemoney. Thefrontpassengerswereluckyto survivetheaccident. Theprimeministersucceededin survivingthechallengetohisauthority. "Howareyou?""Oh,(I'm)surviving(life issatisfactory,butnotverygood)." Heissurvivedbyhiswifeandfour children. Faceuptoacceptan unpleasanttruth(kabuletmek) Manypeoplefindithardtofaceuptothe factthattheyaregettingold.
r.
Falldownhaveaweakpoint (zayflamak)
Theargumentfallsdownwhenyoulook athowmuchit'llcost.
Fallforbelievealieorapiece ofdeception(inanmak)
Fallincollapse(yklmak)
Theceilingfellinhurtingalotofpeople.
Falloffdecrease(dmek)
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Islippedontheiceandfellover. Fallthroughbeunsuccessful (bozulmak) Theplansfellthroughwhenplanning permissionwasrefused. Fathomoutunderstand something(anlamak) Icouldn'tfathomoutwhatshewanted fromme. Feeluptofeelcapableof doingsomething(canistemek) I'msotired.Idon'tthink Ifeeluptogoing outtonight.
Falloverfallontheground (yeredmek)
r.
Filloutcompleteaform (doldurmak)
Ifilledouttheapplicationformandmailed it.
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Fitinhaveenoughtimeor spaceforsomething(zaman olmak) Ididn'thavetimetofitinanother appointment. Fixupmakeanarrangement (randevalmak) Hefixedupanappointmentformetosee aspecialist. Fleshoutaddmoredetailsor information(detaylandrmak) Therecentgovernmentreportfleshedout thedraftproposals.
Italwaystakesmeagestogetaroundto replyingtoletters.
Hisbossisalwaysgettingathimfor arrivinglate.
Getatcriticize(eletirmek)
Getatmean(demekistemek)
Whatdoyouthinkshe'sgettingat?I've noideawhatshewants.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Getbackreturn(dnmek) Thetrainwasheldupsowedidn'tget backhomeuntilmidnight. Getbyhavejustenough moneytoliveon(ktkanaat geinmek) They'refindingitincreasinglydifficultto getbysincetheirdaughterwasborn. Getdownmakesomeone depressed(depresyonasokmak) Themiserableweatherinwinterreally getsmedown. Getdowntostartwork (almayabalamak) Ifinditextremelydifficulttogetdownto doinganyrevisionforexaminations.
r.
Getinarrivehome(eve gelmek)
Thetaxipulledupandwegotin.
Getinenteracarortaxi (binmek)
Getoffescapepunishment (yakaysyrmak)
Hegotoffonatechnicalityandleftthe courtafreeman.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Getonmakeprogress (ilerlemek) HowareyougettingonwithyourSpanish lessons? Getonwithhaveagood relationship(geinmek) Fortunately,Igetonwellwithmyboss. Getoutofavoiddoing somethingyoudislike(yrtmak) IsaidIwasn'tfeelingwellandgotoutof theextrawork. Getoutofleaveacar,van, etc.(inmek) Wegotoutofthetaxiandpaidthedriver.
r.
Getthroughcontact(irtibat kurmak)
Itriedcallinghermobilephone,butI couldn'tgetthrough.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Getuporganize(ayarlamak) Theygotupalistoftwohundredpeople whowereopposedtothelocalcouncil's plans. Getuptodosomethingwrong ornaughty(karmak) Thechildrenarealwaysgettingupto sometroubleorother. Giveawaytellasecret(belli etmemek) Shedidn'tgiveanythingawayaboutthe partysoitcameasacompletesurpriseto me. Givebackreturnsomething you'veborrowed(gerivermek) Igaveherbackthetwentypoundsshe'd lenttome.
r.
Giveinsubmithomework,etc. (teslimetmek)
Thepolicestoppedthevanbecauseitwas givingoffalotofblacksmoke.
Giveoutdistribute(datmak)
Somebodywasgivingleafletsoutinfront oftheundergroundstation.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
r.
AcademicVocabularyforKPDS&DS Test9
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Ineverquitethepurposeofthis device. A)fathomedout C)filteredout E)eyedup B)filledin D)foldedup 3.Itwasthatmembershipfees shouldberaised. A)reflected C)returned E)restrained B)repelled D)resolved 4.Thiscompanywouldbeimprovedif wecouldtheundesirableelements. A)filterout C)getat E)fireaway B)fitin D)faceup
r.
11.Theideaisgood,butitneeds. 6.AtthemeetingIdidn'twanttobring upthebudgetaryproblemswehave beenfacing,butmycoworkers managedtometodoso. A)getin C)findout E)getround B)giveoff D)filterout A)fillingout B)fleshingout C)fallingout D)gettinground E)gettingover
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
12.observanceoftheregulations producedthedesiredresults. A)Ridiculous C)Rigid E)Rhetorical B)Regretful D)Revered 13.Aftertryingforhourstomakehim changehismind,Ifinally andleft themeeting. A)gaveway C)gotat E)gavein B)getat D)fireaway B)filledout D)figuredout 14.Hisnewjobistothatof purchasingdirector. A)sufficient C)sectoral E)rigid B)selective D)subordinate B)givingin D)firingaway
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)gettingat D)gettingto 22.Hisdescriptionconflictswiththe ofeventsasrecordedbythevideo camera. A)sector C)selection E)supplement B)series D)sequence B)selection D)supplement 23.Canyouwhatthisarticleis tryingtosay? A)fireaway C)figureout E)getin B)fallthrough D)getby B)falldown D)fillin 24.AsSusanisthesurvivingheir, shehastherighttosellthehouseifshe wishes. A)socalled C)specific E)sufficient B)sole D)stable
r.
30.The fromtheillegaldrugand armssalesoperationsmustruninto billionsofUSdollarsthroughoutthe world. A)revenues C)references E)restorations B)restrictions D)reasons
26.LatelyIhavebeenworkinglikea dog,soImustforafewdays.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)restricted D)rested
B)fireaway D)filterout
r.
ACADEMICVOCABULARY FORKPDS&DS10
SuspendDurdurmak,askya almak,uzaklatrmacezas vermek Theferryservicehasbeensuspendedfor thedaybecauseofbadweather. ThePresidenthassuspendedthe constitutionandassumedtotalpower. Whenyougotothetheatre,youhaveto bewillingtosuspenddisbelief(toactas ifyoubelievethatwhatyouareseeingis realortrue,althoughyouknowthatitis not). I'msuspendingjudgment(notforming anopinion)onthebookI'mreadinguntil I'vefinishedit. LEGALMrYoungwasgivenasixmonth jailsentencesuspendedfortwoyears( Ifhecommitsanothercrimewithintwo years,hewillhavetogotoprisonforsix monthsforhisoriginalcrime). Shewassuspendedfromschoolfor fighting. Hewassuspendedforfourmatchesafter arguingwiththereferee.
SustainDevamettirmek,kabul etmek,geindirmek
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
TapeBant,film,kaset,kasete almak magnetictape I'vegotthatfilmontape(recorded)if youwanttoborrowit. IfyougivemeablanktapeI'llrecorditfor you. TargetHedef Thegovernment'stargetof3.5%annual growthseemseasilyattainable. Task,vazife,grev, grevlendirmek Weusuallyaskintervieweestoperforma fewsimpletasksonthecomputerjustto testtheiraptitude. Thegovernmentnowfacesthedaunting taskofrestructuringtheentirehealth service. Wehavebeentaskedwithsettingup campsforrefugees.
r.
TerminateBitirmek,sona erdirmek,durmak
TechniqueTeknik,yntem
r.
TechnologyTeknoloji
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
TextMetin,yazlmetin Thebookhas100pagesofcloselyprinted text. Canweseethefulltextofyourspeech beforeTuesday? 'Ulysses'isasettextfortheexam. ThemeTema,birfilmeait Thethemeoflossrunsthroughmostof hisnovels. athemesong/tune TheoryTeori,dnce economictheory scientifictheory Darwin's theoryofevolution Hehasatheorythattheholewascaused byameteorite.
TechnicalTeknik
Thefilmtracestheeventsleadingupto theRussianRevolutionin1917.
TraditionGelenek,rivayet FireworkshavelongbeenanAmerican traditionontheFourthofJuly. Switzerlandhasalongtraditionof neutrality. There'satraditioninourofficethatwhen it'ssomebody'sbirthday,theybringina cakeforusalltoshare. Wedecidedtobreakwithtradition(not behaveasusual)thisyearandgoawayfor Christmas. Accordingtotradition,aheadlessghost walksthroughthecorridorsofthehouseat night.
TopicKonu
Tracezinisrmek,bulmak, kefetmek
Thepolicearetryingtotracethemotherof anewbornbabyfoundabandonedoutside ahospital. Attemptstotracethewhereaboutsofa manseenleavingthesceneofthecrime havesofarbeenunsuccessful. Theirmissingdaughterwasfinallytraced to(foundin)zmir. Thephonecompanywasunabletotrace thecall. Noonehasyetbeenabletotracethe sourceoftherumor. Theoutbreakoffoodpoisoningwas tracedtosomecontaminatedshellfish. ThepracticeofgivingeggsatEastercan betracedbacktofestivalsinancient China. Rivalriesbetweenthegangscanbe tracedbackto(firsthappenedin)the 1950sinsomeblackandHispanic neighborhoods.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
TransferNakletmek,biryerden alpbakabiryerekoymak, gemek,zerinegeirmek Hehasbeentransferredtoapsychiatric hospital. Shetransferredhergunfromitsshoulder holstertoherhandbag. Weweretransferredfromonebusinto another. Policeareinvestigatinghow$20million wasillegallytransferredfrom/outofthe Trust'sbankaccount. Theaimistotransfer power/control/responsibilitytoself governingregionalcouncils. I'llbeupstairs,socouldyoutransfermy phonecalls(arrangethatIcanreceive them)upthereplease? AfterayearhetransferredtoUniversity College. SomeveryhighprofileTurkishplayers havetransferredtoclubsabroad. Hethreatenedtogiveupfootballifhisclub didn'ttransferhim(sellhimtoanother team).
r.
TrendTrend,deiim Surveysshowatrendawayfromhome ownershipandtowardsrented accommodation. There'sbeenadownward/upwardtrendin salesinthelastfewyears. Whateverthelatestfashiontrend,youcan besureNickiwillbewearingit. Thetrendatthemomentistowardsa morenaturalandlessmadeuplook.
TransmitYaynlamak,iletmek, gemek,geirmek
RadioSeventransmitson201medium wave(usesthoseparticularradiowaves tobroadcaston). Theinformationistransmitted electronicallytothecentralcomputer. asexuallytransmitteddisease Choleraistransmittedthrough contaminatedwater. Somediseasesaretransmittedfromone generationtothenext. Somehowyourpanicandfeartransmits itselftothehorsethatyou'reriding.
TransportTamak,nakletmek
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
TriggerTetiklemek Somepeoplefindthatcertainfoods triggertheirheadaches. Theracialkillingsattheweekendhave triggeredoffawaveofprotests throughoutthecountry. Ultimate Son,nihai Ofcoursetheultimateresponsibilityfor thepresentconflictwithoutdoubtlieswith theaggressor. Theultimatedecisionaboutwhoto employlieswithAndrew. Infidelityistheultimatebetrayal. theultimateluxurycruiser UndergoGeirmek Sheunderwentanoperationonatumorin herleftlunglastyear. CinemainBritainisundergoingarevival ofpopularity. UnderlieAltndayatmak Psychologicalproblemsveryoften underlieapparentlyphysicaldisorders.
r.
Unify Birletirmek
UniqueYegane,tek,biricik
w
VersionVersiyon,tr,eit Theofficialversionofeventsisthatthe policewereattackedandwerejusttrying todefendthemselves. Youcanmakeareducedfatversionof thecheesecakebyusingcottagecheese insteadofcreamcheese.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Mytasteinclassicalmusicvaries greatly/widely,butIusuallypreferMozart orBrahms. Somepeoplegivearegularmonthly donationwhileothersvarytheamount theygive. VehicleAra Atruckdriverdiedlastnightwhenhis vehicleoverturned. Roadvehiclesincludecars,busesand trucks. Tractorsarefarmvehicles. Thenumberoftheftsofmotorvehicles rosebyathirdlastyear. Theconferencewasseenasanideal vehicleforincreasedcooperationbetween thememberstates. CorporateAmericahasembracedtheWeb asanewvehicleforadvertising.
r.
Inaveryshortperiodoftime,shehas becomeahighlyvisiblenationalleader.
VisionFikir,rya ViolateKurallar,anlamayihlal etmek,biryerezorlagirmek Theywerechargedwithviolatingfederal law. Itseemsthattheplanesdeliberately violatedtheceasefireagreement. Thedoctorhasbeenaccusedofviolating professionalethics. Thefishermenclaimedthatshipsfrom anothercountryhadviolatedtheir territorialwaters. Questionsofthiskindviolatemyprivacy andIamnotwillingtoanswerthem. Weseeinhisnovelshissinister,almost apocalyptic,visionofthefuture. Johnnywaslatehomeand,asusual,Ihad visionsofhimlyingdeadinsomealley. Shehadvisionsinwhichtheangel Gabrielappearedtoher.
VirtualHemenhementam, sanal
VisibleGrlr,grnr,dikkat ekici
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
VisualGrsel visualstimulus/impact/abilities Guidedogsopenupthelivesoftheblind orvisuallyimpaired. Booksforchildrenhavetobevisuallyvery exciting. VolumeKapasite,say,miktar, kitap Whichofthesebottlesdoyouthinkhasthe greatervolume? It'sthesheervolumeoftrafficinthecity thatiscausingtheproblems. Now'RealmsOfStrife',hissecond volumeofmemoirs,isavailabletoo. Whilestillanundergraduate,hisfirstslim volume'FightingTerms'enjoyeda considerablesuccess. VoluntaryGnll Theychosetotakevoluntaryredundancy. ShedoesvoluntaryworkfortheRed Crosstwodaysaweek.
Bringinearn(kazandrmak) WhereasKyaslafakat,ama
WidespreadYaygn
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Bringoncausesomethingto happenorspeeduptheprocess (sebepolmak) Gettingwetintherainyesterdaybrought onmycold. Bringoutreleaseorpublish (piyasayasrmek,karmak) ThebandarebringingoutanewCDin theautumn. Bringoutincauseahealth problemorreaction(neden olmak) Itwasthelobsterthatbroughtmeoutin thisrashallovermybody. Bringroundmakesomeone wakeupfromunconsciousness orananaesthetic(ayltmak) Thedoctorsbroughthimroundafew hoursaftertheoperation.
Thejobbringsintwothousanddollarsa month.
r.
Brushupimproveaskill quickly(gelitirmek)
Buildupdevelopacompany (iibytmek)
Shebuiltthebusinessupfromnothing intoamarketleaderinlessthanadecade.
Buildupincrease(artmak)
Tensionhasbeenbuildingupeversince thegovernmentpassedtheunpopularlaw.
IbumpedintoHelenontheunderground theotherday.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Burnoutloseenthusiasmand energytocontinueina demandingjob(tkenmek) Jennieburntoutaftertenyearsworking asafuturesbrokerandwenttoliveinthe country. Burstintocatchfirevery quickly(iindekalmak) Thecarburstintoflamesandthedriver diedashedidn'thavetimetogetout. Burstintolaugh,cryorclap loudly(balamak) Sheburstintolaughterwhensheheard thejoke. Buyoutbuysomebody'sshare inacompany(hisselerinisatn almak) Hisbusinesspartnersboughthimoutto getridofhim.
r.
I'llcallforyouatseven,sobeready becausethefilmstartsathalfpast.
Callingetsomeonetocome anddoajob(armak)
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Callonvisit(uramak) Aswewereinthearea,wecalledonmy sisterinlaw. Callupsummonsomeonefor militaryservice(askerearmak) Thearmycalledupthereservesoldiers whenthewarbrokeout. Callupphone(telefonetmek) IcalledhimupassoonasIgottoa phonetotellhimthenews. Calmdownstopbeingangry oremotionallyexcited (sakinlemek) WhenIlosemytemper,ittakesagesfor metocalmdownagain.
r.
Carryoffwin(kazanmak)
ArsenalcarriedoffthefaCuplastseason.
Carryoncontinue(devam etmek)
Carryonquietlywithyourworkuntilthe substituteteacherarrives.
Carryoutperformatask (yapmak)
Thegovernmentiscarryingoutteston growinggeneticallymodifiedcrops.
Catchonbecomepopular (poplerhalegelmek)
Manycriticswereshockedwhentechno caughtonintheclubs.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Chargewithaccusesomebody ofacrime(sulamak) Shewasarrestedincustomslastnightand hasbeenchargedwithsmuggling. Chaseupensurethat someonerememberstodo something(hatrlatmak) Thelibrarianischasingmeupaboutmy overduebooks. Checkinregisteronarrivingat ahotelorattheairport(giri yapmak) TheycheckedinattheRitzyesterday. Checkintoregisteronarriving atahotelorattheairport(kayt yaptrmak) TheycheckedintotheRitzyesterday.
r.
Cheerupbelessunhappy (yzglmek)
Comeon,cheerupitisn'tallbad,you know.
Ichickenedoutofthebungeejumping whenIsawhowhighitwas.
Chickenoutbetooafraidtodo something(korkmak)
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Clearuptidyup(temizlemek) I'dbetterclearupthemessbeforeleave. Climbdownacceptthatyou arewrongandchangeyour position(geriadmatmak) ThePrimeMinisterhadtoclimbdown overhistaxproposalsbecausetherewas somuchoppositionfromthemembersof hisownparty. Closedowncloseabusiness permanently(tamamen kapatmak) Thefirmcloseddownduringthe recessionbecauseitcouldn'tcompetewith thecutpriceimportspouringin.
r.
Comedownrain(yamak)
Justlookattheraincomingdown!I'mnot goingoutinthat.
Comedowntravel(gelmek)
Whenyou'renextinLondon,comedown andseeus.
Themanagementreallycamedownon himforlosingthecontract.
Comedownoncriticize heavily(serteeletirmek)
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
Comeinplaceorrankingina competition,etc.(gelmek,olmak) Ididmybestbutcameininlastbutonein therace. Comeinreceivenews(haber gelmek) Reportsarejustcominginofan assassinationattemptonthePresident. Comeintobeimportantor relevant(nemliolmak) Moneydoesn'tcomeintoitIsimplywill notdoitunderanycircumstances. Comeintoinherit(mirasolarak almak) Shecameintoalotofmoneywhenher grandmotherdied.
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
r.
AcademicVocabulary forKPDS&DSTest10
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
2.Mr.Petersisoutoftheoffice, andwillcontactyouonhisreturn. A)visibly C)ultimately E)temporarily B)thereby D)virtually 3.TheUSgovernmentiswillingto multipletestsonitsantimissileshield project. A)comeout C)carryout D)burnout B)callup D)chasedown 4.Theysaidtheywantedtothe contract. A)transform C)trace E)violate B)transmit D)terminate
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)calmdown C)burndown E)carryoff B)comeoff D)bringup 12.Mywayofthinkingmightbe differentfromyours,butit'sequally. A)ultimate C)valid E)widespread B)tense D)temporary 13.Hehabituallythelawby carryingagun. A)violated C)suspended E)transformed B)transformed D)undertaken B)utilized D)terminated 14.Themeetinghasbeentothis Fridayinsteadofnextweekbecause somepeoplecouldn'tmakeitthen. A)broughtforward B)caughtup C)carriedout D)broughtup E)chaseddown B)calledoff D)cloudedover
r.
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)widespread D)uniform 22.Anacceptablelevelofstabilityand securityinIraqamore multinationaleffortthanthedesperate USmoves. A)catchesup C)comesintouse E)comesapart B)bringsup D)callsfor B)estimates D)identifies 23.Thedevicethelightthroughthis filter. A)transmits C)terminates E)varies B)transforms D)violates 24.Thepolicecalledonhimtofreeze, buthejustuntilhefinallywasshot down. A)carriedon C)caughton E)cleanedout B)carriedaway D)chilledout B)thereby D)whereas
26.Naturalforcesconspiredtocreate thissituation.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)undergoing D)unifying B)cleanedup D)builtup
B)unique D)technical
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
r.
VocabularyforKPDS&DSTest1
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)replaced C)expanded E)become B)remained D)distributed B)fact D)demonstration 7.Nosinglecountrycanmeasure andreportonconditionsineverypart oftheatmosphere,sotheworld's nationsmustcooperatetomonitorthe weathereffectively. A)mentally C)reluctantly E)constantly B)indifferently D)formerly B)unimportant D)inappropriate 8.Becauseanimalsadapttotheir surroundingsinmanyways,thereisa wideofanimalsinany environment. A)requirement C)approval E)prevention B)diversity D)reduction B)abundantly D)obscurely
6.Themobilephonebusinesshas rapidlysince1990.
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)makeup D)providefor A)profitable C)amusing E)costly B)necessary D)useful 16.Thesedaysweareconstantly hearingandreadingaboutecological studiesconcernedwithfactorsthat ourenvironment. A)produce C)affect E)balance B)permit D)filter B)promptly D)innocently 17.BecauseTurkey'seconomyhas becomeindustrializedsincethe mid1940's,manufacturingnow contributesmoretothenationalincome thandoesagriculture. A)inefficiently C)responsibly E)willingly B)increasingly D)scarcely
r.
B)foundout D)broughtabout
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)careful D)harmful A)competentB)benevolent C)resistantD)crucial E)rigid 24.Taxationinthatcountryis indirectforexample,tobacco,excise andcustomsdutiesaccountforavery greatamount. A)conceivably C)efficiently E)predominantly B)provisionally D)abundantly 25.Wewillgiveallthestaffcopiesof theguidelinesonthesecurity proceduresthatwerebythe administration. A)givenbackB)drawnup C)broughtupD)foundout E)shownout B)estimate D)propose
r.
VocabularyforKPDS&DSTest2
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)takeoff C)putup E)letout B)workout D)pullout 7.Oneofthegreatestrolesof photographyistorecordimagesofthe worldaroundusworthytobeasa heritageforallgenerations. A)broughtback C)handeddown E)sentdown B)givenback D)thrownout B)disturbing D)unpredictable 8.IusedtoseequitealotofJane,but nowwemanagetomeet. A)just C)rarely E)mainly B)fairly D)usually B)afforded D)allowed 9.YoucanttrustAmyshecanteven asecret. A)remember C)prevent E)leave B)win D)keep
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)efficient D)impressive A)giveoff C)turnon E)takeoff B)leaveoff D)putaway 17.ThecountrysMinisterfor Developmentcouldntgetmuchwork donetodaybecausetherewereso manyvisitorsto. A)comeacross C)leadon E)showaround B)findout D)leaveout B)approval D)explanation B)rigid D)pleasant 18.Whileitispossiblethatthedeathof elderlycoupleswithinashorttimeof eachothercouldoccurbychance, thereiscompellingsuggestinga causallink. A)predictor C)conflict E)consideration B)evidence D)definition B)suddenly D)currently 19.EgyptianactorOmarSharifs roleisinaFrenchfilmcalledMonsieur Ibrahim. A)latest C)furthest E)clearest B)rarest D)fastest
r.
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)attract D)confirm A)claim C)include E)object B)regard D)prefer B)kepton D)pulleddown B)makeup D)taketo
VocabularyforKPDS&DSTest3
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)nervous C)extravagant E)selfish B)sensitive D)reliable 7.Asshegrewolder,itbecame difficultforhertodotheshopping. A)eventually C)doubtfully E)reluctantly B)increasingly D)adequately 8.Thesurvivorsoftheshipwreckwho wereabletoreachtheland,decidedto afireandwaittoberescued. A)make C)show E)put B)do D)set 9.Themeltingofalltheicemassinthe Arcticwouldthesealevelbyseveral metres. A)establish C)raise E)spoil B)preserve D)restore
r.
B)comprehensive D)indifferent
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)complain D)inform A)hardly C)extremely E)simultaneously B)enormously D)immensely 17.WilliamWordsworthwasapoetof nature,andhadthespecial tothrow charmoverordinarythings. A)ability C)topic E)illusion B)verse D)admiration B)expanding D)exceeding 18.Nooneknowsforcertainwhenthe firstAngloSaxonsettlementswere madeinBritain,butitisthatsome ofthematanyratewerefoundedabout themiddleofthefifthcenturyA.D. A)temporary C)probable E)urgent B)vital D)contemporary
16.Imetyourfatheronceyearsago, butIcanrememberhim.
r.
22.Muchofeveryteacherstimeis markingpapers.
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)fluently D)widely A)established C)placed E)separated B)occupied D)inhabited B)influenced D)encouraged B)takenupwith D)madeout
25.IrelandisintheAtlanticOceanand fromGreatBritainbytheIrishSea.
VocabularyforKPDS&DSTest4
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)settingout C)runningup E)lookinginto B)drawingup D)turningoff 7.Itsadelightfulnovel,andthereader soongetsinthelivesofthe charactersasthestoryprogresses. A)caughtup C)putout E)fedup B)foundout D)turnedover B)preventive D)accurate 8.ThereligionoftheHittiteswasbased uponofasungoddessandastorm god. A)wonder C)survival E)display B)invention D)worship B)suitably D)notably 9.Thesuccessoftheclassicalrecord industryislargelyduetothehigh qualityofthe. A)descriptions C)sales E)products B)audiences D)articles
6.Hemusthavehadsomesound reasonsforsucharigidtimetable.
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)truly D)partially A)involve C)demonstrate E)relieve B)attend D)consist 16.Ifyourbrotherphones,besureto askhimifhereallyhassmoking. A)givenup C)madeout E)turnedoff B)putaway D)openedup 17.TheFrenchexplorerM.Peiselwas touringTibetwhenhefirstaseries oftall,mysterious,starshapedstone towersalongtheChineseborder. A)gotthrough C)feltfor E)ranover B)suddenly D)reasonably B)cameacross D)madeup
r.
B)property D)neighbourhood
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)previously B)plainly C)partly D) courageouslyE)extremely 24.Filmsquiteoftenfocuson journalism,andfromtimetotimethey havecriticallyexaminedandthis profession. A)succeeded C)denied E)suspected B)deserved D)influenced 25.Marathontrainingschedulesrange fromfourtosixmonthsandtheyall considerablediscipline. A)require C)imply E)improve B)reduce D)combine B)favourite D)sensitive
r.
VocabularyforKPDS&DSTest5
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)reluctant C)selfish E)delicate B)hardworking D)loyal 7.Hisnovelshavebeenpraisedfor thesuperbuseofcolloquiallanguage. A)rapidly C)suddenly E)widely B)strangely D)safely 8.Anestimated$4billionoverthenext fiveyearswillcoverthecostof immunizingchildrenindeveloping countries. A)undeniably C)fully E)actively B)abruptly D)currently B)journey D)discovery
6.Sheseemstotakepartinthequiz programme.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)respect D)perceive A)responsible C)cautious E)reasonable B)stable D)particular 16.Inordertostudythepastitisnot alwaystoknowpreciselyhowlong agoinyearsaparticularperiodorevent occurred. A)recurrent C)capable E)essential B)annual D)absolute B)takeup D)keepon 17.Consumersknowthatfoodlabels suchasorganicandnaturaldonot guaranteegoodconditionsforthe animalsthatproducedthemeat,milkor eggsfoundinsidethepackaging. A)respectively C)necessarily E)falsely B)relatively D)severely 18.Theacceptedlawsofphysics arethesameeverywhereintheworld. A)continually C)simply E)commonly B)rapidly D)equally B)desire D)impression
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)relatedto D)broughtup
r.
VocabularyforKPDS&DSTest6
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)distribute C)contain E)employ B)publish D)depart 8.Doyouthinkwecantrusthimtofind aplaceforustostayinLondon? A)thorough C)steady E)suitable B)sufficient D)considerate B)persuade D)engage 9.Everyoneknowsthatthesetwofirms havebeeninfiercetogetthejobof runningthehotel. A)involvement C)management E)competition B)approval D)expression B)reference D)arrangement 10.Idontknowthescheduledtimeof ,butIdoknowthattheplaneto Istanbulhasalreadyleft. A)purchase C)accommodation E)departure B)customs D)reference
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)respected D)challenged A)avidity C)prediction E)intention B)impression D)disposition 18.Tobealeaderitisnotenoughtobe hardworkingandknowledgeableone mustalsobeabletoinspire. A)denial C)discretion E)reservation B)restraint D)confidence B)satisfactorily D)rapidly 19.Peoplewhoareconstantlyinthe publiceyemustlearntoremainin thefaceofcriticism. A)composed C)appreciated E)restored B)persuade D)agree B)resultant D)outrageous 20.Astheconditionsoftheexpedition arelikelytobesevere,youhadbetter takenecessary. A)trials C)efforts E)attempts B)precautions D)objections B)relieved D)specified
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)illuminated D)varied B)established D)determined
r.
VocabularyforKPDS&DSTest7
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)ridiculous C)restricted E)progressive B)considerate D)fragile 7.Thedevelopmentoftheexperimental methodtoverifythetheorieshadthe effectandtherewasarapid increaseinscientificknowledge. A)adverse C)appropriate E)partial B)reluctant D)erroneous 8.Wewillhavetohiremoreworkers soonwecantputitoff. A)plainly C)emphatically E)indefinitely B)supremely D)intensely B)sentaway D)seento 9.Awellorganisedcompanythat knowsitsproductsareofahigh standarddoesnotfear. A)conversion C)competition E)pretension B)concentration D)departure
r.
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)cure D)undermine A)relyon C)takeover E)sendfor B)runthrough D)watchoutfor 17.Manyofthecriticsclearlyregarded severalofthepaintingsonasof poorquality. A)discovery C)occasion E)account B)display D)approval B)exposed D)disposed 18.ThereportissuedbytheNational HealthCouncildrawsattentiontothe hazardsoftoXrays. A)resistance C)confinement E)implication B)involvement D)exposure 19.Hesclever,heseemstoknowby instinctwheresomeoneisand strikesthere. A)conceited C)vulnerable E)critical B)sufficient D)informative
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)recklessly D)restrictively A)redundancy C)consumption E)conformity B)efficiency D)suitability B)lookup D)takeover
r.
VocabularyforKPDS&DSTest8
1.Wemustfindsomewaytogivethem fairlycompleteandrealisticpictureof thesituation,butwithout themtoo much. A)depressing B)intimidating C)restricting D)complementing E)embittering
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)makeout C)getover E)fallthrough B)putthrough D)lookup 7.Whateverthepressuresputupon him,Ithinkitishighlyunlikelythat Jameswouldeveranyone. A)walkawaywith B)giveinto C)makeupfor D)getawaywith E)fallthrough B)repressive D)exclusive 8.Thewasnotahappyoneatthe time,butlookingbackonitIsuppose Imgladitoccurred. A)improvement C)encounter E)compromise B)regression D)intention B)randomly D)tightly
r.
9.Locke,HobbesandRousseauwere concernedintheirwritingswiththe questionofaproperbetweenthe publicgoodandtherightofindividuals toexercisefreewill. A)balance B)demonstration C)responsibility D)interest E)solidarity
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)cast C)constituted E)followed B)explored D)relaxed B)perennial D)naughty 15.Theassassinationbyterroristsof SignorAldoMoro,fivetimesPrime MinisterofItaly,inMay1978wasby everyoneasanactofbarbarism. A)applauded C)reiterated E)restrained B)appealed D)condemned 16.Asthmaisacommoninwhich theairwaysliningthelungbecome inflamed. A)diagnosis C)fury E)recovery B)disease D)patient B)likely D)profoundly 17.Fromthereportreleasedtodayit appearsthatoiltankerssuffertheir majorontheirreturnjourneys. A)spills C)repairs E)crews B)costs D)drills
r.
18.Peoplecurioustogetsomeideaof whatitisliketobeblackinacountry bywhitesneedlooknofurther thanDennisWilliamssnewnovel Crossover. A)tempted C)perpetrated E)deemed B)undermined D)run
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)elaborates D)resumes A)tookafter C)turnedup E)showedoff B)gotoff D)madeup 24.The1990shavebeenageneral inaidtopoorcountries,largely becauseoffiscalpressuresinmany richcountries. A)consumption C)contingency E)expenditure B)decline D)conviction 25.Thewholebusinessofhavingmeals atfixedisnothingbutasocial conventionand,inmodernlife,a matterofconvenience. A)approaches B)substances C)intervals D)requirements E)proportions B)adequately D)notoriously
r.
VocabularyforKPDS&DSTest9
5.Itisabookrichinideasandbeauty, abookthatandtriestoanswer greatfundamentalquestionsand demandsthemostactivereadingoneis capableof. A)raises C)casts E)accomplishes B)attains D)alludes
2.Thecurrentsocialsecuritysystemis popular,partlybecauseits universalandpartlybecauseretirement benefitsarerelatedtocontributions,so mostpeoplethinkthesystemisfair. A)extremely B)likely C)eventually D)indispensably E)favourably
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)lookthrough C)takeback E)makeout B)bringup D)breakout 7.Ifyouwantthatpostyou'dbetter applyquicklythelastdayfor applicationsisFriday. A)reversing C)enforcing E)committing B)withholding D)submitting B)faithful D)futile 8.InthispaperIshouldliketoreport someoftheresultsofanstudyof twohundredLondonfamilies. A)extreme C)intensive E)apparent B)intrinsic D)emphatic B)consult D)provide 9.Recentstudieshaveshownthat smokersaremoretocommon coldsandfluthannonsmokers. A)feasible C)applicable E)responsible B)susceptible D)reliable
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)scarcely D)abundantly A)socially C)suitably E)reputedly B)primarily D)firmly 17.Abasicofamphibiouswarfare isundoubtedlycommandofthesea. A)withdrawal C)determination E)requirement B)explanation D)complication B)involvement D)concession B)winover D)putoff 18.Evenquitelateinthetwentieth centurymanymenassumedthatentry intocertainprofessionswastheir right. A)independent C)adequate E)unaccountable B)exclusive D)excessive 19.Bacteriahaveremarkablecapacity fortolerancetopreviouslylethal drugs. A)acquiring C)deceiving E)recovering B)denouncing D)repudiating
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)madeupfor D)showedup A)regulations C)provisions E)admissions B)methods D)laws B)holdsout D)putson B)deceitful D)destructive
r.
VocabularyforKPDS&DSTest10
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)dowith C)gowithout E)providefor B)makeup D)putupwith B)overcome D)improve 7.Ifitrains,thefootballmatchwillbe untilnextweek. A)givenout C)turnedoff E)takenon B)putoff D)runthrough 8.Forthechemistsofthe18thand19th centuries,anunderstandingofthe chemicalnatureoffoodwasamajor. A)objective C)submission E)estimation B)agreement D)significance B)fortunately D)precisely 9.Thegreenbuttononthefarleftofthe machinethevolume. A)interferes C)regulates E)arises B)discloses D)allows
r.
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)effortlessly D)surprisingly A)treatment C)admission E)expansion B)recovery D)diagnosis 17.Somewomenaretroubledwith backacheastheygetolder. A)relevantly B)consecutively C)continually D)sufficiently E)reluctantly 18.Apoorlyplannedvegetariandiet willtypicallybeiniron,zincand calcium. A)unhealthy C)varied E)essential B)keepupwith D)turnupon B)deficient D)nutritious 19.Idon'tknowhowthenursethe constantdemandsofthatelderly patient. A)thinksover B)changesover C)turnson D)wakesup E)putsupwith B)ledfrom D)containedin
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)turndown D)geton B)withholding D)submitting B)intrinsic D)emphatic B)susceptible D)reliable
r.
VocabularyforKPDS&DSTest11
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)involve C)promise E)deny B)resume D)disdain B)explanation D)complication 7.No authorityhastherightto dictatewhetherastateshalladopta socialistoracapitalisteconomic policy. A)comprehensive C)reputable E)compulsive B)outside D)irresponsible 8.Russiahasafleetof250nuclear submarines,170ofwhichareoutof service. A)currently C)conventionally E)consequently B)vehemently D)adequately 9.Theirstateassetsweretoforeign capitalatbargainprices. A)paidoff C)auctionedoff E)closeddown B)broughtup D)putthrough
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)resistant C)convenient E)indifferent B)reliable D)reluctant 16.Whenshereferredinherpaperto biocomplexity,manyintheaudience scratchedtheirheadsandwhatthat wordmeant. A)expected C)wondered E)rejected B)suspected D)improved B)takenup D)putoff 17.Pollutioncouldonedayendanger theworldsofoxygen. A)expectation C)extinction E)decline B)supply D)recovery B)putupwith D)filledin 18.Nomodeliseverperfect,and scientistsaretryingtorefinetheir models. A)uniformly C)mentally E)equally B)formerly D)constantly
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)comfortably C)successfully E)nearly B)apparently D)carefully B)carriedout D)settleddown B)reserve D)separation
r.
VocabularyforKPDS&DSTest12
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)keepdown C)putout E)breakthrough B)ruleagainst D)pointout 7.Naturaldisastershavebeendefined asecologicaldisruptionsexceedingthe adjustmentcapacityofacommunity andoutsideassistance. A)steppingup B)puttingupwith C)lookafter D)callingfor E)dealingwith 8.Itishardforatiger,especiallyan inexperiencedone,tohowtoattack ananimalthatisfacingit. A)figureout C)ruleout E)runover B)keepaway D)fallback B)process D)duration 9.InhisfictionWilliamFaulknerusesa complexliterarystylethatseemsto hisintricatethemesofgoodandevil. A)fitinwith C)clearout E)takeafter B)putupwith D)makeout
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)madeup D)putoff A)preservative C)absorption E)process B)decay D)solution 17.Atomsareofelectronsanda nucleuscontainingprotonsand neutrons. A)joined C)composed E)completed B)linked D)kept 18.Visibilitydependsuponthe concentrationofwaterordustparticles intheair. A)rapidly C)instantly E)chiefly B)obstinately D)suitably B)immediately D)fairly 19.Thismagazineisdesignedtohelp satelliteequipmentbuyersmakemore purchasingdecisionsandkeep aheadofnewdevelopments. A)representative C)foreseen E)indifferent B)obscure D)informed
11.TheJudgequicklyhisnotes beforesentencingtheaccused.
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)turnedup D)givenriseto A)getridof B)sortout C)takeback D)getalongwith E)foldover B)keepupwith D)pulloutof
r.
VocabularyforKPDS&DSTest13
1.Therelationshipbetweensmoking andlungcancerhasbeenheatedly discussedformanyyears,butuntil recentlytheevidenceaboutithasbeen bothandconflicting. A)exemplary C)compatible E)confident B)susceptible D)fragmentary
4.Thefindingsindicatethatthereisa lowerofcanceramongvegetarians.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)socially C)suitably E)reputedly B)primarily D)firmly B)similarly D)nevertheless 7.Abasicofamphibiouswarfareis undoubtedlycommandofthesea. A)withdrawal C)determination E)requirement B)involvement D)concession B)justifying D)retaining 8.Evenquitelateinthetwentieth centurymanymenassumedthatentry intocertainprofessionswastheir right. A)independent C)adequate E)unaccountable B)exclusive D)excessive B)disturbance D)reversal 9.Bacteriahaveremarkablecapacity fortolerancetopreviouslylethal drugs. A)acquiring C)deceiving E)recovering B)denouncing D)repudiating
r.
10.Becausecriticalperiodsoccur throughoutpregnancy,awomanshould continuouslyherhealth. A)keepinwith B)putupwith C)findout D)takegoodcareof E)lookupto 11.Intheearlytwentiethcentury,a numberofscientists,whohadbeen trainedasphysicists,wereinterestedin thestudyofbiologicalorganisms,and theireffortsthefieldwenowcall molecularbiology. A)tookleaveof C)gaveriseto E)fellapart B)madeupfor D)showedup
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)increasingly C)repeatedly E)selectively B)constantly D)reluctantly 16.TherespectabilitythatBritainon America'sactionsisworthmoreto Americathantheprovisionofany amountofmilitaryaid. A)transmits B)proclaims C)distributes D)commissions E)confers B)contest D)distinction 17.Outoftheworkofthegreatthinkers oftheseventeenthcenturywas developedanewoutlookontheworld, anditwasthisoutlookwhichthe decayofthebeliefinwitchcraft andothersuperstitions. A)gotridof B)droveoff C)madeup D)broughtabout E)keptout
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)participate C)incorporate E)demonstrate B)reproduce D)reinstate 24.Itwasthroughtheresearchof SabineatHarvardattheendofthe19th centurythatthesubjectofacoustics wasputonascientificfooting. A)random C)constructive E)competitive B)quantitative D)selective 25.Theprobableresourcesof petroleumcannotbeestimatedas ascanthoseofcoal. A)considerably C)essentially E)accurately B)ultimately D)suitably
r.
VocabularyforKPDS&DSTest14
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)nutritional C)collective E)complacent B)conditional D)deceptive 7.Studiesofthesurvivorsoftheatomic bombblastsandradiationaccidents havedemonstratedthe leukemogeniceffectofradiation. A)reluctantly C)sensitively E)understandably B)properly D)unmistakably 8.Inablizzard,theofverylow temperatures,strongwindand suffocatingsnowoftenprovesfatal. A)expectation C)engagement E)combination B)endurance D)consistence 9.I'mafraidIcan'tthesignatureon thispaintingbutithasbeensigned. A)makeout C)findout E)putdown B)takeout D)turnback
r.
10.Thetopresearchuniversitiesinthe U.S.A.arethefactthatwomen researchersareencountering substantialbarrierstocareer advancement. A)waitingfor C)facingupto E)turningup B)pullingoutof D)tryingout
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)kepton D)leftout A)components C)reliably E)scarcity B)immunity D)cavity 16.Everycommunityintheworld recognizescertainactivitiesascrimes, andhasdevelopeditsownwayof them. A)dependingon C)lookingafter E)dealingwith B)breakinginto D)makingfor 17.Thevisitorsweretakentothe airport,andtheretheywerebythe assistantmanager. A)madeoff C)putthrough E)lookedover B)available D)considerable B)seenoff D)turnedout
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)difference D)insurance A)putdown C)letgoof E)leftout B)wroteoff D)tookcareof B)rely D)react 25.Ihopepredictionsthatwe'llbeginto oil aroundtheyear2015will convincepeopletousethisprecious resourcemoresparingly. A)runoutof B)bringabout C)slowdown D)makedowith E)sendoutfor B)competitive D)conceivable B)previously D)respectfully
r.
VocabularyforKPDS&DSTest15
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)remotely C)quite E)proportionally B)physically D)increasingly 7.Allpatientswithchronicbronchitis shouldbetogiveupsmokingsoas tohaveabetterprognosis. A)urged C)discouraged E)established B)limited D)distressed B)permanently D)sensibly 8.Withtheincreasinglyageing populationintheUK"hometelecare" nowonthelistofpriorities. A)lightsup C)makesdo E)rankshigh B)looksup D)pointsout B)remedies D)devices
r.
9.Thefindingscouldalsohelp researchersto waystoimprovethe brain'srecoveryafterotherkindsof damage. A)workout B)putout C)turnin D)bringthrough E)takeover
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)discovered C)persuaded E)displayed B)complained D)designed 15.Theforemanhasawayofmaking mostpeopledowhathewants,but somehowIdon'tthinkhe'llmanageto thenewdirector. A)getaround C)turnover E)ruleout B)makeupfor D)keepupwith B)betray D)convert 16.Themanwhocreatedthefirst computervirushasbeensentencedto 20monthsinanAmericanfederal prison,anditisgenerallyagreedthat hehasbeenverylightly. A)shownup C)takendown E)broughtin B)letoff D)givenup B)methods D)laws
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)fallthrough C)getawaywith E)getoff B)endup D)makeup 23.TheAbelPrizeinmathematicsis intendedtofinallythegapleftby AlfredNobel,whochosetoignore mathematicswhenheestablishedthe Nobelprizes. A)fill C)avoid E)exceed B)link D)refuse B)inadequately D)inevitably 24.Reefscientistshavecompiled,what couldbethemostcompellingyet, thatfarmingisharmingtheGreat BarrierReef. A)circumstance C)evidence E)controversy B)proposal D)discussion B)allocated D)ranged 25.Inmanypartsoftheworldmains electricityisstilloreven nonexistent. A)convenient C)deliberate E)impressive B)aggressive D)unreliable
r.
VocabularyforKPDS&DSTest16
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)plausibly D)adversely A)lookover C)lookforward E)keepup B)makedo D)bringforth 6.Therearecertainsignsof improvementinhisgeneralcondition sothedoctorsfeelheisgoingto. A)breakdown C)makeup E)clearout B)pullthrough D)bringoff 7.Theliverreceivesaquarterofits bloodfromthehepaticartery. A)substance C)supply E)sample B)condition D)connection B)hadonhand D)kepton 8.Ithaslongbeenknownthatvarious microorganismsexistinthe atmosphere,butformerlyscientists werenotabletoidentifythem. A)indirectly C)potentially E)perpetually B)occasionally D)accurately
r.
9.Thereactionbetweenaminoacids andsugarsis forthecolourand flavourofcookedfoodandoccurs whenotherplantbasedfoodsarefried, baked,roastedortoasted. A)responsible C)convertible E)measurable B)dependent D)avoidable
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)deduced C)deceived E)cited B)delayed D)withdrawn 15.Thegeneralfeelinginthecourtwas thatseveralofthewitnesseswere informationthatcouldhaveadirect bearinguponthecase. A)expressing C)avoiding E)declining B)withholding D)disrupting B)hazardous D)susceptible 16.Thepopulationofthe underdevelopedcountriesisgrowing sofastthattheagriculturalactivities thereareunabletothe progressivelyrisingdemandfor food. A)keepupwith B)makesureof E)sortout B)rejections D)denials C)lookoutfor D)bringup
r.
17.AmongtheMaoriofNewZealand, eachcommunityhasdevelopeditsown wayofcrimesandhaschosena numberofdifferentpunishmentsto matchthem. A)holdingup B)comingalong C)dealingwith D)payingfor E)takingover
22.Apparentlyasmuchas20percent ofLondonfiresarestarted.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)reputably C)preferably E)compulsively B)appropriately D)deliberately 23.Smallchildrenoftenbecome unsettlediftheyareforcedtospend longstretchesoftimeinaspace. A)considerable C)restricted E)rejected B)selected D)potential B)turneddown D)playeddown 24.TheofbromineintheDeadSea wateris100timesthatintheocean. A)extraction B)concentration C)composition D)complexity E)sufficiency B)closeup D)breakdown 25.Withagestationperiodofsix months,batsaretheslowest reproducingmammalfortheirsizeand thereforeespeciallytoextinction. A)applicable C)variable E)vulnerable B)reliable D)sizeable
r.
VocabularyforKPDS&DSTest17
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)dowellby B)lookdownon C)feelupto D)makeupfor E)findoutabout 7.Thearticlegivesalucidaccountof themeasuresbeingtakentodealwith SARSanditisusefulgraphsand maps. A)takenupwith B)backedupwith C)setdownto D)madeoutto E)broughtupwith B)dealswith D)getsthrough B)broughtup D)carriedon 8.Dietsrichinwholegrains,legumes, vegetablesandfruitsseemtobe protectiveagainstcancer,but identifyingthespecificfoodsorof foodsthatareresponsibleisdifficult. A)levels C)rates E)components B)benefits D)agencies
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
14.Ifhewantsthecontract,hemustlet usknowbyTuesdaywecan'tkeepthe offeropen. A)infinitely C)conclusively E)indefinitely B)decisively D)reluctantly B)discreetly D)scarcely 15.Thisnewanthologyofpoetry,edited byBrianJohnson,isnotonlya judiciousselectionofthebestpoems butalsoamajorworkofserious. A)decision C)disturbance E)scholarship B)edition D)enthusiasm B)expression D)relapse 16.Therichercountriesmakeit possiblefordrugcompaniestoprovide productsthatareinthepoorer regions. A)exceptional C)decent E)patient B)sensible D)affordable
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)exceeded D)restrained A)runoutof B)bringabout C)slowdown D)makedowith E)sendoutfor B)capableof D)replacedby 24.Itisnowrealizedthatforestsizes haveainfluenceontheclimate. A)reliable C)significant E)sensitive B)compulsive D)controversial B)showedup D)turnedout 25.Animalthatliveinlarge communitiesaremuchmoredependent oneachotherthanwaspreviously believed. A)instincts C)relatives E)habitats B)patterns D)species B)complete D)establish
r.
VocabularyforKPDS&DSTest18
5.Therelationshipbetweensmoking andlungcancerhasbeenheatedly discussedformanyyears,butuntil recentlytheevidenceaboutithasbeen bothandconflicting. A)exemplary C)compatible E)confident B)susceptible D)fragmentary
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)otherwise C)ontheotherhand E)however B)similarly D)nevertheless B)keepupwith D)pulloutof 7.Scientistsarebiotechnologyto develophighlyeffectivedrugsinthe fightagainstcurrentlyincurable diseases. A)invading C)exerting E)utilizing B)justifying D)retaining 8.Thefindingsindicatethatthereisa lowerofcanceramongvegetarians. A)incident C)decline E)replacement B)disturbance D)reversal 9.Asthenewfieldworkerwillbe workinginclose withseveral others,makesureyouselectsomeone withanagreeablepersonality. A)uniformity C)collaboration E)productivity B)suspicion D)discretion
r.
14.Thequestionofwhetherheredityor environmentismoreimportantin determiningthecourseofhuman developmenthasbeenconstantly throughthecenturies. A)conditioned C)debated E)regulated B)prevailed D)confirmed
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)remarkably D)memorably A)natives C)colleagues E)captives B)prisoners D)suspects 16.Asamatteroffact,water infrastructureissothatmost governmentsinunderdeveloped countriesfinditextremelydifficultto investforsafewaterorsewerage. A)offensive C)obsessive E)expensive B)conclusive D)exclusive 17.Thewordsengravedonagladiator's tombarealmost"Isharethe commondestiny". A)reputedly C)decisively E)discretely B)successively D)invariably B)runoutof D)stopshortof
r.
18.MuammarGadaffi,theLibyan leader,hasdecidedtothe22 memberArabLeagueinresponsetoits inefficiencyindealingwiththecrisesin theMiddleEast. A)putupwith B)pulloutof C)beconcernedabout D)getawaywith E)fallinwith
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)avoided C)abused E)released B)deterred D)negotiated 24.Couldntweensurethatallcritical networksarekeptsecurelyfromthe restoftheworld? A)takenaway C)putdown E)cutoff B)leftout D)madeover B)intentions D)responses 25.Agreatmanysocalleduseful gadgetssoundgreatintheorybutin practice,dontyouagree? A)makedo C)turnover E)keepup B)pulldown D)fallshort
r.
VocabularyforKPDS&DSTest19
1.Biochemicalengineersarekey playersinthegreatbiomedical that lieaheadincludingthepreparationof anHIVvaccine. A)challenges B)consultancies C)components D)ingredients E)options
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)putupwith B)cutofffrom C)makeupto D)comeupwith E)runoutof 7.Thesenovelsillustratetheauthor's forthestrugglesofyoungpeople andtheproperhelpthatshouldbe given. A)deceit C)alteration E)concern B)obligation D)disturbance B)sensitively D)repeatedly 8.Thequartet'srenderingofMozartis good,butlhavemixedfeelings abouttheSchubertcollection. A)exceptionally C)preferably E)impartially B)sensitively D)impulsively
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)provide D)Inflict A)increasingly C)repeatedly E)selectively B)constantly D)reluctantly 15.TherespectabilitythatBritainon America'sactionsisworthmoreto Americathantheprovisionofany amountofmilitaryaid. A)transmits B)proclaims C)distributes D)commissions E)confers B)embarkson D)trieson B)contest D)distinction 16.Outoftheworkofthegreatthinkers oftheseventeenthcenturywas developedanewoutlookontheworld, anditwasthisoutlookwhichthe decayofthebeliefinwitchcraftand othersuperstitions. A)gotridof B)droveoff C)madeup D)broughtabout E)keptout
r.
21.ResearchersattendingtheWorld WaterForuminKyotolastyearargued thatcollectingandusingwatermore wouldlessentheneedformore dams. A)efficiently C)wastefully E)speedily B)plentifully D)remarkably
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)closedown C)sortout E)dowith B)makeout D)forceout 23.Mostofourexposuretoorganic mercuryeatingoilyfishsuchas tuna. A)playsup C)comesfrom E)putsupwith B)turnsinto D)findsout B)inflated D)destroyed 24.Inthefuture,surgeonsmayperform operationsthatwecanonlydreamof today,suchasinsertinggenesinto singlecellsorcorrectingbeforea childisborn. A)incisions C)defects E)forces B)remedies D)devices B)stable D)predominant
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
r.
VocabularyforKPDS&DSTest20
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)turnsback C)takesto E)relieson B)waitsfor D)pullsup 7.Theaurorasarecausedbytheof solarwindswithgasesintheEarths atmosphere. A)intersection C)interaction E)distraction B)completion D)perception 8.Itseemsstrangetousnowthat minersandothersemployedin dangerousworkshouldnothave demandedtheprovisionof headgear. A)forceful C)relentless E)intensive B)obstructive D)protective
r.
9.Inthepast30years,ourknowledge oftheancientMayacivilizationhas increasedasaresultofthe deciphermentofanewlydiscovered script. A)significantly C)suspiciously E)conditionally B)alternatively D)persuasively
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)attribute D)preservation A)takingon C)copingwith E)holdingout B)doingwell D)pilingup 15.Ican'tbelievethatthetreasurer reallyhaswithalltheclub'sfunds. A)turnedover C)madeout E)putup B)cutoff D)runoff 16.Fossilizedbonesarefragileandcan easilybedamagedbytotheair. A)exposure C)resistance E)restoration B)compression D)appearance B)Inevitably D)Conclusively 17.Highenergycosmicrays,whichare moreinspacethanonMarsor Earth,coulddeliverdangerouslyhigh radiationdoses. A)impressive C)fragile E)prevalent B)compulsive D)innovative
r.
18.Thepointandclickactionsofthe computer mousehavemadeitan popularalternativetokeyboardand textbasedcommands. A)increasingly C)effortlessly E)objectively B)assertively D)exactly
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)reach D)reserve A)reluctant C)excessive E)transient B)compulsive D)predominant 24.Bysepticshockismeanta disseminatedbacterialinfection. A)consequently C)widely E)sufficiently B)superficially D)selectively 25.Mostexamplesofhormone deficiencystatescanbeto glandulardestruction,caused,among otherthings,bysurgeryorinfection. A)attributed C)increased E)located B)stimulated D)induced B)fillin D)putover
r.
VocabularyforKPDS&DSTest21
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)compensate C)request E)exchange B)account D)ensure B)makedo D)takeplace 7.Recentfindingsanswerkey questionsabouthowtumourcells residenceinotherpartsofthebody. A)cutdown C)slowdown E)takeup B)pullup D)waitfor 8.Whenatissueisinjured,arapid chainofeventstheproductionof fibrin,astringy,insolublemassof proteinfibersthatformsaclotfrom liquidblood. A)holdsup C)breaksdown E)putsout B)makesup D)leadsto B)significant D)previous 9.Inanaircraft,thecabinlightsare dimmedduringtakeoffandlandingto helppassengerstothemselvesto darknessintheeventofanemergency. A)modify C)resume E)relate B)accustom D)associate
r.
14. Inthe1990stheBelgian governmentwasinvolvedinnumerous scandalsthatcontaminateditwitha reputationforincompetenceand. A)participation C)corruption E)certainty B)despair D)dislike
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)internal C)stable E)versatile B)reasonable D)arrogant 16.Inspiteofthewidespreadeffectsof ChristianityontheAngloSaxons,they clungtomanyofthesuperstitions andcustomsfromtheirpaganpast. A)hardly C)rapidly E)urgently B)firmly D)fairly 17.In1968,Bermuda,whichusedtobe aBritishcolony,wasanew constitutionandautonomyexceptfor foreignrelations,defenceandinternal security. A)leased C)appropriated E)abolished B)exploited D)granted
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)repeated C)deceived E)inferred B)discredited D)implied 24.Byoneaccount,theteamthe desiredcompoundinjustthreedays. A)drovethrough C)cameupwith E)madeupfor B)turnedover D)putupwith B)contribution D)distinction 25.Thegovernment'snuclearadviser thatsofarnoradioactive contaminationhasbeenfoundoutside thetestsite. A)pointsout C)setsup E)getsin B)putsout D)takesover B)eager D)susceptible
r.
VocabularyforKPDS&DSTest22
1.InEngland,thegeneralpublicsof medicaladvicefromthegovernment stemsfromthefactthat,inthepast, suchinformationhasoftenproved vastlyinaccurate. A)approval C)mistrust E)preference B)inadequacy D)distraction
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
7.Unlessyouuseyourcomputer, youcan'texpectittofunctionwell. A)surely C)recently E)soundly B)intense D)occasional B)particularly D)properly 8.InChina'slargestpsychiatricfacility thereisaseriouslackofresourcesbut thestafftryhardtothisintheir treatmentofthepatients. A)comeupwith C)putupwith E)makeupfor B)goinfor D)setoatfor B)confirmed D)regretted 9.It'sworthrememberingthathisof thedownwardtrendsinoutputover recentyearsisnottheonlyone. A)interpretation C)compliance E)intention B)departure D)discretion
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)defiantly C)extremely E)lately B)suitably D)sensitively 16.Therewereplentyofpeoplewilling totheexperimentasthesubject, controllingemotions,attractedthem. A)fillout B)takepartin C)watchoutfor D)makedowith E)openup B)restrictions D)allocations 17.Finally,thecommissionerssettled onashort,simple,constitutional amendmentgrantingCongressthe authoritytoguidelinesforselecting temporarymembersinanemergency. A)holdup C)callout E)setup B)bringdown D)serveup B)emotional D)crucial
r.
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)excessive D)regrettable A)consideration C)attentiveness E)regulation B)conclusion D)examination B)seriously D)ingeniously 25.Healthrisksfrompesticide exposureareprobablysmallforhealthy adults,butchildren,theelderly,and peoplewithcompromisedimmune systemsmaybetosometypesof pesticidepoisoning. A)hostile C)severe E)vulnerable B)substantial D)reversible
VocabularyforKPDS&DSTest23
1.Theamountofalcoholicdrinksa personcanconsumesafelyis individual,dependingongenetics, healthcondition,sex,body composition,age,andfamilyhistory. A)violently C)offensively E)loudly B)worthily D)highly
2.Forpeoplewhohaveafamilyhistory ofageneticdisorderbutnosymptoms, apredictivetestcanhelpapersons riskfordevelopingthedisorderinthe future. A)sustain C)determine E)represent B)remove D)arouse
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)worldwide B)substantial C)aware D)commonplace E)liable 7.LatinAmericancountriesonaverage exportonlyabout10percentoftheir productstootherLatinAmerican countriesbut20percentofthemto theUS. A)almost C)respectively E)extensively B)fairly D)initially B)keepupwith D)runoutof 8.Untilthesixteenthcentury,whenthe firstinternationalpostalagreementwas ,therewasnopostalsystemaswe knowittoday. A)assigned C)enacted E)conducted B)maintained D)seized B)takealong D)relyon
r.
9.Therehasbeenincreasingpressure intheUStotheamountoffunding allocatedtoforeignaid,andinstead, usethefundstoimprovethedomestic economy. A)makeupfor C)keepupwith E)takeupwith B)pointoutto D)cutdownon
13.Thesearchfortruthrational guidelines,and,thoughsomeofour subjectsmaylieontheouterlimitsof scientificresearch,weexaminethem throughscienceslens. A)demands C)reaches E)establishes B)relates D)orders
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)indication D)deception A)brokeinto C)carriedaway E)cameinto B)turnedout D)wenton 15.Ifthisbusinessgoesoninsuchan awfulway,itwillhundredsof unemployed. A)dowithout B)hangaroundwith C)endupwith D)goupagainst E)makeoutfor B)rich D)elective 16.Inthelifesciences,biologistsneed tobemoreawareofthebetween scienceandtechnology. A)approach C)complexity E)gap B)departure D)extremity B)effectively D)extremely 17.Thetheoryisinterestingenough, butisit ? A)solvable C)intensive E)resistant B)expressive D)coherent
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)counter D)uphold A)tentative C)factual E)protective B)irrelevant D)effective 24.Thearmypsychologists___ initiatedtreatment,andsohesoon regainedhisconfidenceasasoldier. A)promptly C)obviously E)imminently B)vaguely D)relunctantly 25.Redbloodcellscontain haemoglobin,whichenablesthemto carryoxygenfromthelungsand___it toallpartsofthebody. A)contribute C)deliver E)guide B)organize D)transform B)comeswith D)picksup
r.
VocabularyforKPDS&DSTest24
B)uneasy D)comprehensive
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)pursue C)recreate E)reinstate B)recognize D)determine 7.SolarheatingneverintheUS becauseofthecostandlimitedwinter sunlightinmostareas. A)caughton C)turnedover E)lookedback B)playedup D)waitedon 8.Intheirtoovercometheanti socialeffectsofmodernarchitecture, architectshavedirectedtheirattention tomoreinformalsettlements. A)avoidance C)attempt E)development B)condition D)involvement 9.Muchofourknowledgeofthe livesoftheancientRomanshasbeen derivedfromtheexcavationsat PompeiiandnearbyHerculaneum. A)pretentious C)complete E)extensive B)daily D)convenient
r.
14.Thegreatesttothespreadof nucleartechnologyandnuclearpower reactorstodevelopingcountriesisthat itwillincreasetherisksofnuclear weaponsproliferation. A)obligation C)solution E)objection B)contribution D)condition
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)distract D)tend A)crucial C)vulnerable E)permanent B)inevitable D)bearable 16.Intheopinionofmostscientists, engineeringdoesnotoffer universallyacceptablesolutions. A)randomly C)necessarily E)extremely B)moveround D)come B)previously D)excessively 17.Scientistssuggestthathuge amountsofgreenhousegaseswillbe intotheatmosphereifrising temperaturescausetheArctic permafrosttomelt. A)produced C)disrupted E)joined B)makesup D)dependson B)accelerated D)released
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)bringover D)showoff A)rank C)implicate E)interact B)relate D)increase B)exposure D)advice 24.Thebodyresistsstarvationby itsowntissuesandusingthemasa sourceofcaloriesmuchlikeburning thefurnituretokeepthehousewarm. A)gettingoff B)breakingdown C)carryingout D)followingup E)makingfor B)available D)expansive 25.Billionsofusefulbacteriacolonize ourguts,butbecauseantibioticsare lethaltoawholerangeofmicrobes, drugstakenforachestinfection,for example, friendlybacteriatoo. A)wipeout C)buildup E)movein B)sortout D)takeback
r.
VocabularyforKPDS&DSTest25
5.Kosraeisthesmallestofthefour islandstatesthattheFederated StatesofMicronesia(FSM),thelargest andmostpopulouspoliticalentitythat emergedafterWorldWarII. A)keepaway C)makeup E)takeon B)tieupwith D)setdown
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)dismissal C)impact E)distrust B)recovery D)recognition 7.Eversincetheremainsofancient statesandcitieswerefirstdiscovered, thecollapseoftheircivilizationshas beenafocusofdebateandinquiry. A)consistent C)vulnerable E)impressive B)implicit D)competent B)solely D)inadequately 8.TheArawakIndianswerethefirstto inhabitGrenada,buttheywereall massacredbythebelligerentCarib Indians. A)fairly C)eventually E)rarely B)previously D)principally
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)standfor D)carryout A)denounce C)empower E)speculate B)pressurize D)evade B)giveup D)tryout 16.Inrecentyears,carbondioxide (CO2),anaturallyoccurringgreenhouse gas,hasbeenasaresultof activitiessuchastheburningoffossil fuelsanddeforestation. A)settingout C)goingout E)reachingup B)buildingup D)comingin B)hesitation D)dedication 17.Themovementofelectronswithin electromagneticwavessomeofthe wavesenergy,affectingtheproperties ofthewaveandhowittravels. A)tellsoff C)findsout E)goesaround B)putsin D)usesup
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)persuasive D)irregular A)applications C)representations E)amplifications B)resolutions D)innovations 24.Becauseofthetimeneededto developexpertise,scientiststendto continueworkinginasingleareafora lengthoftime,perhapseven throughouttheirlives. A)substantial C)moderate E)comprehensive B)thorough D)qualitative 25.Althoughtheredflamesoflithium andstrontiumappearsimilar,thelight fromeachcanbeseparatedbymeans ofaprismintodifferentcolours. A)excessively C)conventionally E)familiarly B)distinctly D)properly B)outlawed D)sustained
r.
VocabularyforKPDS&DSTest26
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
8.Weshouldadvisechildrentokeep drugs. A)out C)away E)into B)off D)in 9.Shecouldn'tkeepthesecret fromherparents. A)out C)back E)across B)away D)apart 10.Look!Thesignsays:"Keepthe grass". A)out C)away E)from B)off D)in
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
18.Heisreallylucky!Hegotaroom thatlooksonthesea. A)up C)out E)above B)over D)into 19.I'msureyouhavewrittenthatdown. Lookyournotesandyouwillfindit. A)round C)together E)across B)at D)into 20.Studentsusuallylookthe counselortohelpthemchoosea career. A)at C)into E)down B)up D)aside B)to D)above
r.
22.Theroomwasbig,sotheymadeit aconferenceroom.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)of D)down
r.
VocabularyforKPDS&DSTest27
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)acts D)scenes 8.Whenteenagersfirstgettheir driver'slicense,itiscommonfortheir parentstofeelanxiousand. A)happy C)outrageous E)involved B)proud D)concerned B)defect D)reflect 9.Acopyofthelatestfinancial statementfiledbythisorganizationmay beobtainedcallingour headquarters. A)by C)from E)to B)for D)so B)losing D)dropping 10.Atrampmayhunt,begorsteal occasionallytokeephimselfalivehe mayeven,intimesofrealneed,doa littlework, buthewillneverhis eversopreciousfreedom. A)sufferfrom C)surround E)derivefrom B)holdon D)giveup
17.Wouldyouacceptmy? 12.I'mnottogoingoutafterdark. A)adapted C)adopted E)accustomed B)adored D)afforded A)apologize C)devise E)advise B)advice D)practice
15.Sheonthebeachwhileherson splashedatthewater'sedge.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
18.Sofar,somefiftypeoplehave forthetwovacancieswehave. A)applied B)beenappointed C)approved D)advertised E)addressed 19.Theysayawomanmightforgivean insultbutshewouldneverforgive being. A)sacrificed C)ignored E)prohibited B)resented D)repented B)erupt D)stimulate 20.Yourwordswouldseemtothat Fadimeistryingtostealyourhusband fromyou! A)gossip C)despair E)insult B)imply D)infer B)lay D)lied
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)refuse D)accuse B)applicants D)cars B)donation D)flight
r.
Vocabularyfor KPDS&DSTest28
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
8.Thereisnoscopeadvancement inthiscareer. A)up C)at E)from B)with D)for B)intriguing D)obvious 9.Sherefusedtoeatmeatunderany . A)opportunities B)occasions C)reasons D)circumstances E)prices 10.Newmineralresourcesmaybe discoveredduringtheforthcoming totheAntarctic. A)excursion C)expedition E)assault B)voyage D)migration
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)Considering C)Hoping E)Defining B)Assuming D)Speculating 19.Itwouldbehelpfulifyoucould thereportintothreeorfourpages. A)resume C)reduce E)separate B)decrease D)condense 20.Thebestsoilwasawaybya torrentialrainstorm. A)gushed C)flooded E)cleaned B)flowed D)washed B)idea D)notion 21.I'dliketothisoldcarforanew modelbutIcan'taffordit. A)interchange C)replace E)exchange B)transform D)convert
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)misguiding D)good B)wet D)sunny
r.
VocabularyforKPDS&DSTest29
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
7.Ahighschooldiplomaisfor entranceintocollege. A)required B)abandoned C)achieved D)accomplished E)issued 8.Thehorizonisanimaginaryline.It doesn'treally. A)happen C)live E)exist B)takeplace D)seem 9.Thequalitystandardsprevailing muchAmericanindustryarenotgood enough. A)in C)out E)off B)for D)with
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
17.Janewantedtobuysomeshoesto hernewdress. A)match C)suit E)reflect B)fit D)resemble 18.Iadviseyoutotaketoensure thatallyourpropertyisadequately coveredbyinsurance. A)means C)steps E)care B)actions D)dealings B)means D)methods 19.Youshouldacceptthejoboffer.A likethatwon'tcomeagain. A)charge C)chance E)charity B)chase D)check
r.
21.Theillegalfactorieswereshut.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)into D)from
B)for D)about
r.
VocabularyforKPDS&DSTest30
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
7.I'msurewewouldbenefitfrom betweenourcompanies. A)coexistence C)cheating E)fighting B)claim D)collaboration 8.Thedownturninthemarketbrought abouttheofthecompany. A)clash C)circulation E)collapse B)idea D)clich 9.Cellularphonesaresoldhalf price. A)at C)until E)into B)over D)on B)disregarded D)refused
r.
14.I'mnotbyaparticularly ambitiousman.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)defect C)tendency E)deficiency B)deficit D)scarcity 17.Ihavenodoubthishonesty. A)in C)about E)with B)on D)up 18.Watchingtoomuchtelevisionhas someharmfuleffectschildren. A)in C)about E)on B)with D)off B)down D)against 19.Despitemountingpressureforhis resignation,hehasnointention steppingdown. A)of C)on E)for B)in D)with B)accident C)default
16.She'ssufferingfromaofiron andneedstotakeacourseoftablets.
r.
24.We'regoingtophasethe2005 modelsnextyear.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)disabled D)invalidated B)to D)for B)on D)out
r.
VocabularyforKPDS&DSTest31
6.Peoplewhosmoketheriskof damagingtheirhealth.
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)take C)run E)pull B)get D)put 7.Ofcourse,itmayrain,andinthat we'llorganizeindoorevents. A)case C)condition E)way B)weather D)occasion B)notime D)when 8.Aprimeministercannotexpectto havemuchtimetotopurely personalmatters. A)deserve C)concentrate E)spare B)devote D)reserve 9.Hewasbarredfromtheclubfor refusingto withtherules. A)conform C)adhere E)comply B)abide D)compile
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
17.Istillitisamistaketoinsiston constanteconomicgrowth. A)find C)conform E)maintain B)regard D)judge 18.Thetwostatementseachother. A)invade C)abstract E)correspond B)emit D)contradict 19.Thetankofpetrolwasbya carelesslydiscardedcigaretteend. A)litup C)exploded E)imported B)ignited D)inflamed B)mean D)develop 20.Expiredpassportsaresothat theycannotbeused. A)endorsed C)nullified E)recycled B)invalidated D)adopted
r.
25.Thereisnoforhardworkand perseveranceifyouwanttosucceed.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)relief D)escape B)cognizance D)hold B)persistence D)indifference B)substitute D)imitation
r.
VocabularyforKPDS&DSTest32
4.Therewereover30,000atthe match.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)anticipations D)calculations 8.He'sthesortofboringspeakerthat useslotsofwellworn. A)clashes C)publications E)conundrums B)citizens D)clichs B)printing D)transmission 9.Hespentthewinterinthenorthof Norwayandhadproblemscopingwith theinhospitable. A)choice C)climate E)coincidence B)coercion D)collection B)witnesses D)watchers 10.Ifyoucarryonlikethis,it'sgoingto endinaheadon withSarah.I'd adviseyoutobackoffabit. A)clash C)circulation E)collapse B)love D)coincidence
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)hesitant C)urgent E)wary B)cautious D)considerate 18.Iimaginehewillbequitetostop us. A)capable C)potent E)good B)feasible D)keen 19.Hisspeechwascarefuland,but hiswordsseemedtomakenosense. A)disappointing C)pointless E)various B)distinct D)suspicious B)to D)into 20.Thechoirstoodinfourrows accordingtotheirheights. A)respectable C)respective E)disrespectful B)respectful D)respected
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)studious D)spying B)able D)necessary B)pickout D)pullup
r.
VocabularyforKPDS&DSTest33
2.Deepinsidetheearth,twothousand milesbeneathitssurface,pocketsof moltenrockcanbefoundinaregion manyscientistsdidnotexpectto findanythingbutsolidrock. A)when C)where E)whereas B)which D)while
3.Justastemperaturevariesat differentpartsoftheearth'ssurface, therealsoseemtobelargetemperature differences2,000milesbeneaththe earth. A)slightly B)nearly C)hardly D)tremendously E)negligibly
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)converts C)directs E)occupies B)encloses D)covers 7.Thetoycarwasdestroyeda naughtyboy. A)with C)of E)by B)out D)on 8.Shewantstosetagoodexample herson. A)about C)on E)for B)in D)from 9.Thenewspaperisveryinterested thatphotograph. A)by C)down E)to B)for D)in B)fathomout D)bringabout
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
17.Alargenumberofpeoplewhoare antiabortionaremostadamantly thedeathpenalty. A)towards C)against E)with B)into D)from B)incongruous D)incorporated 18.Thereisastrongcontingentofpro deathjurorssittingthejurypool. A)at C)into E)along B)in D)after B)consider D)believe 19.EdinburghisknowntheAthens oftheNorth. A)for C)as E)in B)by D)with
r.
r.
23.Thesesuggestionsaretobe acceptedbythemajorityofmembers.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)thesame D)alike
21.Religionandpoliticsinteresthim almost.
VocabularyforKPDS&DSTest34
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
7.Ifyouinbehavinginthisway you,willbringyourselfnothingbut trouble. A)persist C)decide E)insist B)continue D)react 8.Hisparents'hostileattitudehim toleavehome. A)drove C)made E)resulted B)urged D)suggested 9.You'vebeenoverworkingrecently, andwouldfindaholiday. A)benevolent C)expensive E)beneficial B)essential D)profitable
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
17.I'mworriedabouttheStockMarket andI'vedecidedtobuildupmyliquid . A)articles B)aspects C)assertions D)assessments E)assets B)denied D)agreed 18.Ithinkwehavecommitteda monumentalhere.Howcanweput itright? A)belief C)blunder E)blame B)bill D)bias B)indication D)inducement 19.Hispoetrymovedusitsquiet dignity. A)in C)out E)down B)for D)with
r.
21.Hegotoutofbedandtookafew butcouldn'tgoanyfarther.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)situated D)surrounded B)made D)took
B)starts D)actions
r.
Vocabularyfor KPDS&DSTest35
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)in C)of E)off B)from D)by 8.Atthebeginningoftheschoolyear, everyteacherisaclassroom. A)allocated C)sorted E)compensated B)distributed D)registered B)with D)by 9.Publicworksprojectshavenot significantlytheunemployment situation. A)facilitated C)appeased E)deteriorated B)for D)from B)softened D)alleviated 10.Buyinganewcarmuch planning. A)presumes C)values E)entails B)endorses D)infers
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
18.Heencounteredmanyproblems,but thankstohishewasableto achievehisgoal. A)intervention C)insistence E)suggestion B)persistence D)reverence 19.Hegetsagreatsenseof from hisworkwiththementally handicapped. A)fulfillment C)protection E)disgust B)arranged D)delayed B)affection D)prosperity 20.Themostimportantthathewas responsibleforwastheuseofInternet inteaching. A)novelty C)reformation E)innovation B)reason D)introduction B)attained D)absorbed
r.
25.IfyouMary,couldyoutellher I'dliketoseeher?
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)tastes D)likes B)carryout D)makeout B)lookafter D)lookinto
r.
VocabularyforKPDS&DSTest36
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
7.Thecurrentsocialsecuritysystemis popular,partlybecauseitis universalandpartlybecauseretirement benefitsarerelatedtocontributions,so mostpeoplethinkthesystemisfair. A)extremely B)likely C)suitably D)indispensably E)favorably B)deprivedof D)lookedinto 8.Sheistheoldestpersoninthe village,92yearsoldtobeprecise,and hasa wordofadviceforeveryone. A)fanciful C)eventful E)kindly B)faithful D)futile
r.
9.Ourchallengeistoourclients withthebestpossibleadviceand supportenablingthemtotaketheright decisionatbothstrategicand operationallevels. A)suspend C)improve E)respect B)consult D)provide
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)insured D)scattered A)annual C)essential E)intimate B)minimal D)ultimate 16.TheGovernmentishopingtoclamp onthoseworkingintheblack economy. A)up C)at E)down B)on D)back B)sparsely D)abundantly 17.Shehasadeeprootedinher ownability. A)belief C)blunder E)blame B)bill D)bias B)on D)down 18.Hepreferstodealthecomputer mattershimself. A)in C)at E)down B)for D)with
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)brought D)shouted
r.
VocabularyforKPDS&DSTest37
7.Thedeskwassowithpapersthat itwashardtofindanything.
A)having C)havingbeen
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)outfit D)outline A)burdened C)overrun E)messed B)cluttered D)muddled 8.Englishfoodisantohuman decency. A)affluence C)affront E)assault B)essence D)anachronism B)is D)being 9.Practicallyallthepopulation votedno. A)ineligible C)rural E)sinister B)riveting D)rigid 10.Isthereanyoftheirgetting tickets? A)perspective C)opportunity E)reason B)outlook D)likelihood 11.Theyareexcitedtheirtripto RomenextJune. A)about C)by E)from B)at D)for
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
19.Thesepeoplelive,agreat extent,byfishing. A)to C)than E)at B)by D)of B)foundation D)ground 20.Despiteallhiseffortsinthe stagesoftherace,therewasn'tinfact muchlefthecoulddotochangethe inevitable. A)forward C)farewell E)fatal B)fading D)final B)competitor D)coward 21.Itwasveryofhimtoleaveyou thereallunprotected. A)noble C)admirable E)inconsiderate B)kind D)polite B)mere D)extreme
r.
23.Ididn'tsayIdidn'tlikeit.Itjust doesn'tmywaistproperly.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)misguiding D)misleading
r.
VocabularyforKPDS&DSTest38
4.Oneshouldnotevenmention competitorsname.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
8.Thepolicehavebeenorderednotto ifthestudentsattackthem. A)combat C)challenge E)kill B)retaliate D)rebuff B)disturbance D)grievance 9.Frankwouldbemorepopularinthe officeifhedidn'ttrysohardto himselfwiththeboss. A)regard C)congratulate E)attach B)sympathize D)ingratiate B)by D)of 10.Thepoliticiantriedtoarousethe crowd,butmostofthemweretohis arguments. A)closed C)careless E)indifferent B)dead D)enthusiastic
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
18.Owingtothefog,hisflightfrom Karachiwas. A)belated C)unscheduled E)momentous B)overdue D)unpunctual 19.She'stotallysheneverdoes anythingshepromisestodo. A)unenthusiastic C)unreliable E)indifferent B)disloyal D)illogical B)inform D)talk 20.Acatwithtwoheadswasa(n) additiontotheshow. A)literate C)attractive E)negative B)unique D)common
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)stupid D)unwise
r.
VocabularyforKPDS&DSTest39
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)denies C)criticizes E)reveals B)avoids D)forms 7.ItisunlikelythattheQueenwill agreetoopenthenewTownHall. A)mainly C)largely E)finally B)highly D)greatly B)hard D)promptly 8.Becausethehousewas,the childrenenjoyedplayinghideandseek intheemptyrooms. A)adapted C)abandoned E)painted B)maintained D)proceeded B)conclusions D)schedules 9.Someschoolshaveveryrulesof behaviorwhichmustbeobeyed. A)strong C)solid E)lax B)strict D)straight
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)bill D)bias 17.Theinspectorreportedthatoffice staffwereratherintheirattentionto security. A)lenient C)loose E)easy B)lax D)limp 18.Banksusuallychargeasmallfeeto onecurrencytoanother. A)acquire C)segregate E)convert B)alter D)divide B)anxiety D)bond 19.Thelatestresearchoffersthemost significantbodyofexperimental evidenceansweringthetheoretical questionsaboutchangesinFermi volumeinquantumcriticalmatters. A)aimedat C)reflectedin E)criticalof B)interestedin D)focusedon
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)keen D)interested B)customary D)ordinary
r.
VocabularyforKPDS&DSTest40
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
8.Thewatersoonintheheat. A)melted C)evaporated E)flowed B)dissolved D)froze 9.I youthatIhadnointentionof offendingyou. A)convince C)guarantee E)ensure B)persuade D)assure 10.I'llhavetoaskmymothersome money. A)by C)off E)of B)for D)in B)becauseof D)insteadof 11.Theyshowadeeprooted againstbuyingforeignproducts. A)belief C)blunder E)blame B)bill D)bias
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
19.I'maccustomedbeingtreated withrespect. A)in C)by E)about B)at D)to 20.TheWorldBankhascriticized Britainfornotgivingenoughfinancial todevelopingcountries. A)allowance C)loan E)tip B)aid D)provision 21.Hislatestnovelhashisalready considerablereputation. A)enhanced C)heightened E)embarked B)enlarged D)expanded
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)superficial D)superfluous B)from D)about
r.
VocabularyforKPDS&DSTest41
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)concession D)comparison 8.Ishouldbemostgratefulifyou wouldgivemeaofthisnew typewriter. A)demonstration B)display C)showing D)manifestation E)scene B)concept D)computer 9.Hissevenchildrenandtwoexwives areprovingtobeafinancialtohim. A)burden C)charge E)freedom B)load D)debt B)bitterness D)beauty 10.Thesecontinualintemperature makeitimpossibletodecidewhatto wear. A)fluctuations B)transformations C)exchanges D)agitations E)amendments
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
18.Twootherinhisargumentfor hiscountry'sindependencearewortha mention. A)notices C)effects E)claims B)points D)reports 19.Ihavehadaofmisfortunes. A)continuation C)omissio E)succession B)repetition D)continuity 20.Themusicarousedanfeelingof homesicknessinhim. A)intense C)intensive E)immature B)intentional D)intended
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)spread D)completed B)sweat D)transpire
r.
VocabularyforKPDS&DSTest42
4.Pleaseacceptthischampagnewith theofthehouse.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)awful D)serious 8.Wearemeetingstiffinthis market. A)complaints B)competition C)complaint D)compensation E)company 9.Two,foursix,eightandtenare numbers. A)pair C)even E)odd B)dual D)double B)company D)comparison 10.Farmoreshouldbedonetothe sufferingsofunwanteddomesticpets. A)alleviate C)remove E)deteriorate B)improve D)remedy
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)constant D)continual A)in C)to E)for B)from D)of 18.IconfidedmysisterwhenIwent tocollege. A)from C)for E)to B)of D)in 19.Yourcompanyhashadalongand fruitfulwithmine. A)assignment C)association E)aid B)assistance D)assessment B)During D)By 20.Iamsurethatithaseffectivelycut offmanyprisonerstheirfriendsand families. A)towards C)against E)with B)into D)from
17.Johnaccountedallthemissing materials.
r.
22.Itisnotunusualvisitorstowait foranhourorlonger.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)frightened D)afraid B)constructed D)excluded
B)with D)along
r.
VocabularyforKPDS&DSTest43
4.He'salwaysofhissuccess.I'm tiredofhearingaboutit.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
8.Davidthe'Nosmoking'noticeon thecarriagewindowandproceededto lighthispipe. A)disbelieved C)ignored E)obeyed B)rejected D)avoided 9.Numbersintheeveningdancing classhaveratherbadly.Wemay havetocloseit. A)dwindled C)reduced E)risen B)deteriorated D)lessened B)proclaiming D)exulting 10.Itstheresponsibilityofthepoliceto thelaw. A)compel C)enact E)urge B)enforce D)force
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
18.Intheallotmentofthenewlab equipment,wasgiventoschools withbelowaveragebudgets. A)conformity C)priority E)acceptability B)selection D)access 19.EverythingtheBritishRoyalfamily hasisduetoa(n)ofbirth. A)opportunity C)chance E)accident B)privilege D)coincident B)suppressed D)abolished 20.Erwardalwayswantstobethebest atanything,butIdon'thavesuchhigh . A)superstitions C)restrictions E)aspirations B)inspirations D)visions B)in D)on
r.
25.Theborderincidentledtoain therelationsbetweenthetwocountries.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)settleup D)carryon B)distraction D)disruption
r.
VocabularyforKPDS&DSTest44
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
7.Becauseofanunfortunate,your orderwasnotdispatchedbythedate requested. A)hindrance B)oversight C)negligence D)transgression E)denial 8.Theyhaveaonefiftychanceof success. A)to C)on E)for B)in D)from B)safeguard D)distraction 9.Theycouldfindnoofthemissing cardespiteanextensivesearch. A)clue C)indication E)ruin B)remnant D)trace
r.
14.Thisbookwillyoutolearn Englishbetter.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
17.Iamprofoundlyconvincedthat power,notanyparticulareconomic system,isattheofhuman unhappiness. A)source C)root E)roof B)foundation D)ground B)subsequent D)successive 18.Itisanoffencetoshowagainst peopleofdifferentraces. A)distinction B)differentiation C)separation D)discrimination E)sympathy B)make D)design 19.Theyoungexplorerssetupan expeditiontothedangersinvolved insuchatask. A)indifferent C)unaware E)despite B)opposed D)contrary
r.
21.Hedidn'tdoitvoluntarily.Hegave wayto.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)confidence D)confession B)conference D)conversation
B)coercion D)collection
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
7.Hecontinuestoclingtothethat hecandoeverything.Buthereally needstodelegate. A)belief C)blunder E)blame B)bill D)bias 8.I'mhappytosaythatwehavederived considerablefromworkingwith yourcompany. A)benefit C)blow E)betrayal B)behavior D)battle 9.DidyouseeJackchance? A)at C)on E)in B)for D)by B)audience D)bank 10.Ifyoureleaseusfromthiscontract, wewillofferyoufull,fairandgenerous . A)complaint B)compensation C)company D)compassion E)compass
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)Becauseof B)Incommonwith C)Insteadof D)Apartfrom E)Accordingto 18.Thefilmoffersarareglimpsean uncommonromance. A)in C)at E)of B)for D)away 19.Hewassodesperatethathe resortedviolence. A)behind C)away E)to B)from D)about 20.Hecouldn'tfindthewordhewas lookingfor,soheconsultedhis. A)timetable C)thesaurus E)president B)state D)atlas
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)defaced D)deformable B)emissions D)exhortations
r.
VocabularyforKPDS&DSTest46
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
8.Heisnotagoodleader:heisnot enough. A)deciding C)decisive E)divisive B)decision D)decided B)cajolery D)gleaning 9.Hehasaveryserioustowards hiswork. A)attitude C)opinion E)nuance B)view D)respect 10.Willyouacceptacheckordoyou prefer? A)money C)payment E)bank B)cash D)balance
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)proclaim C)state E)suggest B)announce D)expect 18.Thetrainthebayandthen turnedinlandfortwentymiles. A)coasted C)edged E)bypassed B)skirted D)sided 19.Iheardthesoundoftheblindman withhisstick. A)creaking C)pattering E)squeezing B)ticking D)tapping B)defeat D)delay 20.Thismanissoarrogantthatheis completelytoallcriticism. A)impervious C)regardless E)sensible B)unaware D)unconscious
r.
25.Wheneverweplantogoforapicnic, itrains.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)prove D)intend B)phrased D)remarked B)invariably D)interminably
r.
VocabularyforKPDS&DSTest47
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
7.Thestudentsvisitedthemuseumand spentseveralhourswiththe,who wasveryhelpful. A)commissioner C)steward E)minister B)bursar D)curator 8.Socalledeconomiclawsmaybe tooursociety,buttheyaren'ttoall societies. A)valid C)sound E)radical B)applicable D)apt B)overdrawn D)outstanding 9.Thewholeplaceneedsa(n) cleaning. A)full C)thorough E)inevitable B)utter D)entire
r.
14.Wegotothecinemaaboutthreeor fourtimesayear:inotherwords,just .
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)stingy D)versatile A)possibly C)certainly E)almost B)likely D)potentially 17.AuntBerthaistryingtoher husbandtobuyherafurcoat. A)persuade C)talk E)have B)influence D)make 18.Hedoesn'ttakemuchexercise, fromwalkingthedog. A)alone C)except E)but B)besides D)apart B)fertile D)volatile 19.Fightinghasinseveralpartsof thecountry. A)gonein C)brokenout E)reasoned B)setup D)comeon B)normally D)occasionally
r.
24.IdoubtifIwillbeenoughto playtomorrow.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)serious D)determined B)prime D)rough B)healthy D)sound
r.
VocabularyforKPDS&DSTest48
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
7.Doyouthinktherecouldbeanyother ofdoingit? A)reason C)justification E)way B)cause D)mean 8.Gostraightdownthisroadandtake thesecondontheleft. A)point C)angle E)aspect B)corner D)turning B)occasion D)benefit 9.Somegovernmentsareconsidering imposingonoilproduction. A)peaks C)summits E)zeniths B)ceilings D)roofs
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
17.Theyshowedgreatinsolving theproblem. A)ingenuity C)awe E)attempt B)incredulity D)proximity 18.Thepartywillbeginimmediately aftertheofthenewbuilding. A)mitigation C)inauguration E)foundation B)derisively D)scantily B)imposition D)precipitation 19.SomeexpertsclaimthatAmerica willprobablytoJapanthe technologyrequiredtoproduce micromachines. A)cite C)etch E)cede B)tug D)inherit
r.
24.Iwrotetomybankmanagerabout gettinga.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)consensus D)stake B)about D)by B)mortgage D)money
21.Theylookedimpressedattheof brandnewcomputersandprinters.
r.
VocabularyforKPDS&DSTest49
4.Weshouldtrytocutdownsomeof thiscumbersome.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)conclusion C)conduct E)committee B)conference D)conversation 8.IfyoucontinuetofailtodowhatIask youtodo,Iwillbedrawntothethat younolongerwishtoworkhere! A)conclusion C)conduct E)committee B)conference D)conversation 9.Heshouldstillhavetheopportunity toappealevensuchalongdelay. A)at C)into E)along B)in D)after B)bureaucracy D)boom 10.Ithinkthereisanirrefutable for closingdowntheplant. A)cash C)case E)addition B)catalogue D)caution
7.ThenegotiationsaregoingwellandI anticipateaspeedy.
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)audience D)bank 18.Weproducedaseriesofhard hitting,awardwinning.Theyranfor severalmonthsintheStates. A)communications C)singers E)commercials B)stars D)athletes 19.I'mnotsureIcanfindthewordsof necessarytohelpyouatthis difficultmoment. A)comfort C)sufficiency E)disgust B)insult D)competence B)basics D)bans 20.Potentialcandidateswillappear beforea andwillhavetomakea shortpresentation. A)company C)stadium E)court B)school D)committee
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)factor D)source B)Also D)Since B)towards D)at
r.
VocabularyforKPDS&DSTest50
3.Shesuffers alackofconfidence.
C D w w
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
8.John,theywon'tfinishthe projectuntiltheendofnextweek. A)Accordingto B)Becauseof C)Incommonwith D)Insteadof E)Apartfrom B)on D)against 9.I'mallhelpingoutthepoorwhen inneed. A)bymeansof B)infavorof C)onbehalfof D)asfor E)incaseof 10.Please,don'tinterrupttheteacher heisspeaking. A)by C)during E)since B)for D)while
r.
15.Fightinghasinseveralpartsof thecountry.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
19.Pauline meverymuchofagirlI usedtoknowatuniversity. A)remembers C)recalls E)resembles B)reminds D)recollects 20.Veronicabroketheschoolrulesso manytimesthattheheadmistress finallyhadnoalternativebuttoher. A)expel C)eject E)import B)deport D)export B)setup D)comeon 21.Isuddenlythatitwaspastten o'clock. A)understood C)realized E)predicted B)recognized D)resolved
r.
23.Taxdeprivesthestateofseveral milliondollarsayear.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)condensed D)compressed
B)desertion D)depression
r.
VocabularyforKPDS&DSTest51
r.
4.Thejuryreturneda(n)of'not guilty'.
B)apprehension D)despair
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
8.Manycountriesstillrelyonriceas thefood. A)capital C)superior E)staple B)junk D)winning B)onsight D)fromsight 9.UntiltheJohnsonsmovedin,the househadbeenforseveralyears. A)innovative C)gusty E)ghostly B)vacant D)indifferent B)charge D)evidence 10.YoushouldeasilyrecognizeMs. Sanchezifyouseeher.Shehasavery markonherleftcheek. A)alternative C)redundant E)distinctive B)coincidental D)deniable
13.Theargumentsinfavorofthe compulsorywearingofseatbeltsseem enough,buttheyarereallyonly furtherexcusesfordeprivingusofour liberty. A)apt C)sound E)false B)proper D)thorough
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
18.Thebook,whichisdesignedto appealtothelayman,isacondensed ofthewriter'searlierwork. A)production B)representative C)product D)subscription E)version 19.Economistsareforecastingan economic. A)analysis C)budget E)burden B)skill D)ability B)bureaucracy D)boom 20.Wehaveachievedasignificant scientific. A)books C)board E)breakthrough B)boredom D)breakdown B)account D)ambition
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)foresight D)prospect B)while D)since B)flow D)stream
r.
VocabularyforKPDS&DSTest52
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
8.Oneoftheessentialsoffreedomis freetoaccurateinformation. A)entry C)access E)attempt B)entrance D)approach B)testament D)wish 9.Hersalarywasincreasedwhen shewaspromoted. A)consistently B)predominantly C)efficiently D)substantially E)consecutively 10.Aneclipseofthesunormoonisa fascinatingnatural towatch. A)environment B)phenomenon C)magnitude D)similarity E)cause
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)await C)anticipate E)seem B)hope D)wait 18.Shetheletterandputitinthe envelope. A)bent C)twisted E)licked B)folded D)wrinkled B)proceed D)testify 19.Smithinsistedonarguingwiththe referee,althoughtheotherplayerstried tohim. A)inhibit C)restrain E)beat B)refrain D)hinder 20.IhaveYTL100frommybank account. A)withdrawn C)subtracted E)borrowed B)extracted D)detached
17.Wedon'tanydifficulty,butit's besttobeonthesafeside.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)on D)to
r.
VocabularyforKPDS&DSTest53
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
8.EmilyDickinson'spoem"ANarrow Fellow"tellsaboutherreactionto snakes,acommon. A)reptile C)amphibian E)fish B)mammal D)insect B)in D)from 9.Hewillbefromprisoninsix months'time. A)sentoff C)letgo E)released B)expelled D)discharged 10.Heapologizedtohisgrandmother havingtoaskherformoremoney. A)to C)on E)for B)in D)from
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
19.Heplayedanactiveinpolitics untilhewaswellover80. A)scene C)position E)part B)job D)game B)condense D)assist 20.Itwasverydifficultfortheinspector towhatrecommendationshe shouldmake. A)realize C)solve E)search B)settle D)decide B)won D)gained 21.Thisisnottherighttoaskfor myhelpIamfartoobusyevento listen! A)situation B)circumstance C)opportunity D)moment E)point
r.
23.Couldyougivemearoughof whatthejobmightcost?
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)estimate D)correlation
r.
VocabularyforKPDS&DSTest54
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)confidence D)confession 7.Hewasovertiredbynow.,he didn'thesitatetoacceptthenew challenge. A)Inaddition B)Moreover C)Nevertheless D)Consequently E)Ontheotherhand 8.Theycanincreasesales advertising. A)in C)out E)off B)for D)with B)concept D)computer 9.Technologyisgivingway organizationintermsofimproving manufacturing. A)with C)of E)on B)up D)to
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
17.Don'tbetoohastyanddrawthe wrong. A)outcome C)conclusion E)decision B)judgment D)opinion B)aspect D)arrangement 18.Thesoupwouldbemoreifyou hadputmoremeatinit. A)tasty C)tasted E)tasting B)tasteful D)tasteless B)attacks D)assortments 19.Myeffortstogetthetruthoutofhim havesofar withnosatisfaction. A)found C)shown E)met B)resolved D)given B)cost D)charge
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)usual D)everyday B)gone D)used B)grow D)extend
r.
VocabularyforKPDS&DSTest55
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)capable C)potent E)disqualified B)feasible D)keen 7.Touristsflockfromtheplacesto seethecapital'ssights. A)remotest B)mostoutward C)uttermost D)mostaloof E)kindest B)diligent D)compatible 8.Seeminglycrowdsoftourists invadeourcitiesinthesummer. A)innumerable C)countless E)infinite B)endless D)unbound 9.Thegovernment'snewsafety pamphletagainstsmokinginbed. A)declares C)emphasizes E)advises B)punishes D)stresses
6.Iimaginehewillbequitetostop us.
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)count D)value A)but C)only E)not B)very D)far 17.Fortheexperimentstosucceed,the measurementsmustbeaccurateto fivecentimeters. A)about C)within E)totally B)under D)exactly B)recourse D)resort 18.Whenwegottotheboxoffice,the questionofwhoshouldpay. A)raised C)came E)arrived B)arose D)appeared B)talented D)ingenious 19.Peoplelivingabroadarenotto enterforthiscompetition. A)enabled C)capable E)subject B)permissible D)eligible B)responding D)thrashing
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)asked D)forced B)charging D)allotting B)relationship D)result
r.
VocabularyforKPDS&DSTest56
1.Inaspeechhemadetoday,the PresidentofPassagoniaadvocatedthe ofnucleararmsandsaidthathis countrywasreadyfor"urgentand effectivemeasurestothearms race." A)expansion/hinder B)propulsion/end C)escalation/curtail D)acceleration/stop E)elimination/curb
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
5.NaimSleymanolu,bornofTurkish descentandoneoftheworld'stop weightliftersthen, toTurkeysome twentyyearsagowhilehewas competinginAustralia. A)immigrated C)defended E)emigrated B)interrogated D)conspired B)compensate D)constitute 6.Ifyoucandowithoutthefew pleasuresofthecountry,youwillfind thecitycanprovideyouwiththebest thatlifehastooffer. A)rational C)humorous E)satiric B)pastoral D)scornful B)assess D)endorse 7.Modernoceanlinersofferyouagreat varietyofcomforts. A)vulgar C)ludicrous E)hospitable B)infamous D)civilized
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)forbid D)fortify A)credulous B)religious C)supernatural D)surreptitious E)superstitious 14.Don'tforgettowishyourelders manyhappyontheirbirthdays. A)returns B)celebrations C)anniversaries D)jubilees E)congratulations 15.Inthemedicalprofession,men womenbytwotoone. A)outlive B)outdo C)outshine D)outnumber E)outclass 16.Aggressiveness,theviolent expressionofselfishness,isrelatively simpletoexplaininevolutionary. A)texts C)words E)terms B)books D)lectures
13.Sheisveryyoujustcouldn't makeherwalkpassunderaladder.
r.
17.Onlyoverthepastfewdecades havewecometounderstandhow surprisinglymuchofwhatwedomay bebythekindofcreaturesweare andespeciallybytheinformation storedinourgenes. A)enlarged C)avoided E)influenced B)swollen D)gestured
18.Scientistshavebecome increasinglywiththefactthat genesnotonlygovernphysical characteristicsbuttheyalsoplaya largeroleinbehavior. A)critical B)impressed C)indistinct D)intensified E)stimulated
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)reluctant B)obstinate C)straight D)remarkable E)objectionable 23.Iyouamillionlirasthatthey'll managetogethereanyway. A)offer B)riskto C)receivefrom D)handoverto E)bet B)deviated D)appointed 24.Hisiscertainlyastoryofragsto. A)riddles C)ridges E)rituals B)riches D)riots 25.Hetoldhisaudiencethe and fantasticstoryofhisnarrowescapes. A)indecent B)incredible C)inexperienced D)indispensable E)individual
r.
VocabularyforKPDS&DSTest57
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
7.I'velistenedtoyourargument.It's neitherherenorthere.Inotherwords, it'squite. A)irrelevant C)rebellious E)humorous B)resentful D)scornful 8.Iresentyourlastremarksand certainlydemandanapology.Sir,we're runningabusinesshere! A)remarkable B)reciprocal C)reluctant D)respectable E)representative 9.Whatweneedhereisamanwho knowswhatit'sallabout.Inother words,whatweneedisafullyman. A)competent B)potential C)irresponsible D)incompetent E)impotent
r.
14.Shelikesclassicalmusicandis particularlyonMozart.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)observed D)confirmed 17."Haveyouanythingto?"said theyoungcustomsofficer,looking straightatmeintheeye. A)declare C)compensate E)hide B)identify D)confirm B)massacred D)confessed 18."Wouldyoumindthissuitcase, please?"saidthecustomsofficertothe youngwomaninjeans. A)loosening C)donating E)screwing B)unlocking D)disordering B)dawned D)presented 19.Thehardenedprofessional smuggler,ontheotherhand,isnever bysuchfeelingsofguilt. A)investigated B)inclined C)retreated D)compensated E)troubled B)keen D)enthusiastic
r.
24.ThoughVerrazanois consideredtohavebeenagreat explorer,hisnamewillprobablyremain immortal,foronNov.21,1964the greatestbridgeintheworldwasnamed afterhim. A)byallmeans B)byeveryone C)byfate D)bynomeans E)bycommonconsent
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)prosperously D)orderly B)vividly D)explicitly
r.
VocabularyforKPDS&DSTest58
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
5.Onlyaverychildwouldever managetofillupamoneybox,i.e.,his orherpiggybank. A)extravagant C)wasteful E)excited B)spendthrift D)thrifty B)swift D)focal 6.Therewasatimewhentheownersof shopsandbusinessesinChicagohad topaylargesumsofmoneyto gangstersinreturnfor"". A)protection C)inclusion E)exploitation B)existence D)confirmation B)repulsively D)ambiguously 7.Inthosedays,boxingasasport wasvery,fortherewerenorules andaprizefightercouldbeseriously injuredorevenkilledduringamatch. A)rude C)ripe E)vulgar B)raw D)crude
r.
12.Weoftenreadinnovelshowa(an) respectablepersonorfamilyhas someterriblesecretwhichhasbeen concealedfromstrangersforyears:itis oftencalled"askeletoninthe cupboard". A)seemingly C)improbably E)suspiciously B)improperly D)instinctively
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)anomalous D)anonymous 13.Thereader'shairstandonendwhen hereadsinthefinalpagesofthenovel thattheheroine,adearoldladywho hadalwaysbeensokindtoeveryone, had,inheryouth,everyoneofher fivehusbands. A)retaliated C)twisted E)poisoned B)exhausted D)despised 14.Itisnoinjusticetosaythatthe senseofapersonhasisclosely boundupwithhisculturalupbringing. A)harbor C)tumor E)labor B)rumor D)humor B)represented D)reproduced 15.Agreatculturaltruthisthatweall havebeenbroughtuptoeatcertain foodsandtoatthesightofcertain others. A)regret C)feelsick E)horrify B)repent D)abominate
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)rational D)regional A)Inspiteof C)However E)Nevertheless B)Accordingly D)While 22.Ashehatedeveryminuteofhislife inthearmy,itisnowonderthathe decidedonedaytohisunit. A)dessert C)deserve E)descend B)assert D)desert 23.Atrampmayhunt,beg,orsteal occasionallytokeephimselfalivehe mayeven,intimesofrealneed,doa littlework,buthewillneverhis freedom. A)suffer C)surround E)produce B)despair D)giveup B)capture D)defeat
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)deliberately D)unknowingly
r.
VocabularyforKPDS&DSTest59
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
6.Invitingthefirebrigadetoputoutan imaginary,nonexistentfireisacrude formofdeceptionwhichnoperson wouldeverindulgein. A)selfconscious B)selfrespecting C)selfindulgent D)selfsacrificing E)selfgoverning 7.Citybornandcitybred,Ihavealways thecountryassomethingyoulook atthroughatrainwindow,as somewhereyouoccasionallyvisit duringaweekend. A)derivedfrom B)dominated C)evacuated D)regarded E)concerned B)retreated D)humiliated B)replace D)declare 8.Somepeoplekeeptalkingaboutthe friendlyvillagers,theunpolluted atmosphere,thetonaturethatone feelsandthegentlepaceoflivingout thereinthecountry. A)homesickness C)replacement E)nostalgia B)rhythm D)closeness
r.
9.Buttheyfailtomentionthelongand friendlesswinterevenings,whichare onlyinterruptedbya(an)visitto thelocalcinemavirtuallythesole formofentertainment. A)occasional B)sophisticated C)steady D)retrospective E)apathetic
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)struggle C)blunder E)slander B)hostility D)exhaustion 15.Newspapersandmagazinesoffered hugesumsofmoneytotheproud parentsfortherightstopublish theirstory. A)exclusive C)fascinating E)impulsive B)entertaining D)humiliating B)forget D)forbid 16.Itwouldneveragainbepossiblefor themtoleadnormallives.Theyhad becomevictimsofcommercialization, fortheirnameshad amarketvalue. A)required B)acknowledged C)inquired D)acquainted E)acquired B)scaled D)weighed
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)obstructed D)preparatory A)perceptible B)justified C)ornamental D)commonplace E)comprehensible B)supporting D)innocuous 23.Hislawyerthatacertainpolice officerhadindeeddealtroughlywith foreignersonseveraloccasions. A)ascertained C)condescended E)repealed B)persecuted D)persuaded 24.Indemocraticcountries,anyefforts torestrictthefreedomofthePressare rightly. A)relegated C)published E)retreated B)withdrawn D)condemned B)demand D)extract 25.Theguestwhoarriveshalfanhour toosoonisthegreatest.Some peopleneverseemtobeabletocure themselvesofthatirritatinghabitall throughtheirlives. A)proximity C)nutrition E)lottery B)pretence D)nuisance
r.
VocabularyforKPDS&DSTest60
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)interrupt C)interfere E)intervene B)interview D)interpret 8."Howmuchisthe?"sheasked thebusconductor. A)fare C)cost E)fee B)price D)prize 9.Whatwasallthat about? A)speak C)tell E)inform B)say D)talk 10.Ihavesomewonderfulnewsto you. A)speak C)tell E)communicate B)inform D)talk
7.Willyoukindlynotmeagaintill I'vefinished!
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)borne D)boring A)reminds C)memorizes E)repeats B)remembers D)remains 18.Thisoneisoutof.You'llhaveto usetheotherone. A)order C)work E)job B)business D)employment 19.Myobjectiontoneuroticsisthat theyaredifficulttolivewith. A)primarily C)privileged E)priority B)principle D)principal B)benefit D)profit B)lifelong D)lifelike 20.Ofthetwobooksyou'vejust mentioned,Icertainlypreferthe. Theformerisn'tmycupofteaatall. A)later C)late E)latter B)latest D)last
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
r.
VocabularyforKPDS&DSTest61
r.
5.Hisgirlfriendwasinanairplane .
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)deal C)much E)less B)many D)lot 8.Youdon'tthinkyoucanthese factsfromthepeopleforever,doyou? A)cover C)hide E)escape B)secret D)blanket B)frightened D)suspected 9.Ican'ttohaveaholidayabroad onmypresentsalary. A)spend C)waste E)afford B)purchase D)spare 10.Thechargedbythelawyerfor hisserviceswasunusuallyhigh. A)price C)receipt E)prize B)fare D)fee
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)receive D)reward A)retreat C)deviate E)withdraw B)detour D)defeat 18.Itisnoinjusticetosaythatthe senseofapersonhasisclosely boundupwithhisculturalbackground. A)harbor C)tumor E)humor B)rumor D)labor 19.Peoplebecomequitewhenit comestodiscussingthedifferences betweenthesexes. A)illogical C)illegible E)illegitimate B)illiterate D)illegal B)messages D)information 20.Hewasfromserviceforhis insistentdisobedience. A)distorted C)dismissed E)participated B)investigated D)exploded
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)effect D)part
r.
VocabularyforKPDS&DSTest62
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)acts D)scenes 8.Itwasagoodpieceofland.Theygot quitebyusingittocultivatethe muchneededindustrialplants. A)tranquil C)responsible E)prosperous B)peaceful D)hostile B)defect D)reflect 9.Idon'tthinkthatwasavery decision.Thepeopleareboundtorise upagainstitinarms. A)enormous C)intellectual E)wise B)tremendous D)malignant 10.Atrampmayhunt,begorsteal occasionallytokeephimselfalivehe mayeven,intimesofrealneed,doa littlework, buthewillneverhis eversopreciousfreedom. A)sufferfrom C)surround E)derivefrom B)holdon D)giveup
17.Wouldyouacceptmy? 12.I'mnottogoingoutafterdark. A)adapted C)adopted E)accustomed B)adored D)afforded A)apologize C)devise E)advise B)advice D)practice
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
18.Sofarsomefiftypeoplehave forthetwovacancieswehave. A)applied C)approved E)addressed B)beenappointed D)advertised 19.Theysayawomanmightforgivean insultbutshewouldneverforgive being. A)sacrificed C)ignored E)prohibited B)resented D)repented B)erupt D)stimulate 20.Yourwordswouldseemtothat Tracyistryingtostealyourhusband fromyou! A)gossip C)despair E)insult B)imply D)infer B)lay D)lied
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)hostile D)prosperous
r.
VocabularyforKPDS&DSTest63
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)partition D)separation 7.Thesebigbooksshouldn'tbetaken fromthelibrary. A)after C)away E)aside B)in D)inside B)indications D)suggestions 8.Takeaccounteverythinghe's doneforus. A)into C)after E)above B)for D)up B)mean D)develop 9.Don'tletyourselfbetakenby anyone. A)into C)on E)opposite B)in D)over
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
17.Beforeleavingthehouse,don't forgettoturnthelights. A)down C)over E)with B)up D)off 18.Heturnedthemanagementof thecompanytohisoldestson. A)away C)onto E)over B)beside D)above B)aside D)up 19.Theconcertwasbecauseofthe rain. A)calledoff C)turnedoff E)showedoff B)blackedout D)gatheredin B)over D)into
r.
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)woreout D)camedown
6.I'vejustdroppedinforafriendly. VocabularyforKPDS&DSTest64 A)chaos C)charm E)chat 1.Ithinkhehasalegitimatetobe theinventorofthisprocess. A)coexistence C)clock E)circumstance B)claim D)collaboration 7.Dowhatyouwant.Youhaveablank onthisproject. A)charge C)chance E)charity B)chase D)check B)chasm D)change
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
8.Isapersontobemorehighlyfor hiscourageorforhisselfsacrifice? A)estimated C)esteemed E)criticized B)assessed D)reckoned B)authenticity D)ballot 9.There'sacockroachtheceiling. A)about C)on E)for B)in D)from 10.Hemetamysteriousfigurewho knewthetruththecrime. A)behind C)away E)to B)from D)about 11.Sheiswillingtohelpothersand showsconcernthem. A)about C)on E)for B)in D)from
r.
B)on D)down
16.Heistheonewhobattles justice.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
19.TheshipHoodsdidnotstartto untiltwodaysaftertherainhad stopped. A)recede C)depart E)blink B)retreat D)sink 20.Hewentaheadwithunpopular changestohostilecriticism. A)opposed C)unaware E)similar B)indifferent D)contrary 21.Manystudentshavethebelief thatBritishEnglishissomehowmore pureandperfectthanAmerican English. A)communistic C)godly E)erroneous B)alternate D)indistinct
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)down D)over B)putupwith D)putup
23.Hisapplicationforavisawasturned bytheconsulate.
r.
VocabularyforKPDS&DSTest65
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
7.Thecompanydirectorsaskedthe governmenttointhedisputeand preventastrike. A)intervene C)intercept E)internationalize B)interact D)interpose 8.I'mafraidtheresultwasaforegone . A)conclusion C)conduct E)committee B)conference D)conversation B)up D)down 9.I'mafraidourexpenditurehasgone overtheannual. A)cliff C)budget E)burden B)bureaucracy D)boom
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)Without C)On E)At B)About D)Over B)concession D)comparison 17.China'seconomicgrowthlaggedfar muchoftherestoftheworldupto the1970's. A)behind C)along E)in B)during D)by 18.Michaelisveryselfishandhasno forthefeelingsofotherpeople. A)attention C)feeling E)idea B)interest D)regard B)after D)from 19.Weshouldbecomeawareofthese importantoftheproblem. A)aspects C)considerations E)words B)points D)faces
r.
21.He'sanamusingtohavelunch with.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)deal D)committee B)intervals D)memos
B)companion D)thief
r.
VocabularyforKPDS&DSTest66
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)compassion C)compliment E)comparison B)compass D)conclusion 8.Shelongedtovisitthehousein Ankara,whereshewasasachild. A)broughtin B)broughtabout C)broughtout D)broughtdown E)broughtup 9.Didyoucomemypassportwhile youwereclearingoutthedesk,byany chance? A)round C)across E)towards B)upagainst D)to 10.Althoughnoneofuswantedtogo onthepicnic,ittobequite enjoyable. A)turnedup C)showedup E)turnedin B)turnedout D)showedoff
7.Ithinkitwasintendedasaback handed.
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
18.Hecouldn'thisfatherthathe wastellingthetruth. A)admit C)trust E)convince B)confide D)contradict 19.IwasrelievedanxietywhenI heardthatyouweresafe. A)in C)down E)with B)of D)up 20.InWorldWarII,theAlliessuffereda longofdefeatsbeforetheyfinally achievedvictory. A)succession C)publicity E)alliance B)prosperity D)unity B)authority D)ball
r.
22.Thestormdidconsiderableto thetreesinthepark.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)destruction D)injury
r.
VocabularyforKPDS&DSTest67
r.
4.Negotiationsaredeadlocked.Ithink weneedtomakeaortwo.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
8.Ericparticipatestheschool's athleticsteam. A)about C)on E)for B)in D)from B)from D)with 9.Onhisbirthday,hedrankwine thefirsttime. A)for C)up E)in B)in D)down B)concession D)comparison 10.Thereisnoevidencethatany memberofthegovernmentisinthe currentscandals. A)connected C)participated E)interested B)corrupted D)implicated
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
19.I'mlonging aholiday. A)for C)up E)in B)on D)off 20.Theboywascharged alonglist ofjuvenilecrimes. A)with C)of E)on B)up D)to 21.Jackspecializeddrawing animatedpictures. A)to C)on E)for B)in D)from B)compete D)acquiesce 22.ThomasPaine'swereextremely influential. A)pamphlets C)notebooks E)lives B)letters D)dictations
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)notion D)motion B)dissipates D)trims
r.
VocabularyforKPDS&DSTest68
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)agony D)scrutiny 8.Dancerswereasifinafrenzy. A)gyrating C)snoozing E)skipping B)snoring D)drifting B)tearful D)secretive 9.Formybirthday,Iwasgivenawriting settwopens,envelopesand notepaper. A)involving C)making E)comprising B)forming D)taking 10.Iwrotetomybankmanagerto gettingaloan. A)inthehope B)onthequestion C)withtheaim D)withaview E)forthepurpose
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
18.Atfirstthechildrenenjoyedthe gamebutquitesoonthenovelty. A)wentoff C)dieddown E)brokeoff B)diedout D)woreoff 19.Thepolice agooddealof criticismovertheirhandlingofthe demonstration. A)cameinfor B)broughtabout C)wentdownwith D)openedup E)closeddown 20.Theincreasefrom5millionto350 millionspeakersofEnglishhasnot becauseofanyspecialmeritsinthe languageitself. A)cometo B)comeup C)comeabout D)comeforward E)comein
r.
22.Thereisnodifferenceweekdays andtheweekendsandholidays.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)topple D)huddle
B)between D)without
r.
VocabularyforKPDS&DSTest69
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)apparent C)literate E)efficient B)evitable D)eligible 8.Bankmanagersshouldbecompletely people. A)trusting C)trustful E)trustworthy B)trust D)trusty B)basics D)bans 9.Heseemsunawareofthe sufferingthereisoutsidehisown comfortablelittleworld. A)infinitely C)acutely E)totally B)fadeout D)fallthrough B)fully D)thoroughly 10.Thechildren'sagesare10,12,and 14,. A)respectively C)respectable E)respected B)respective D)respectfully
15.Ashemadenotoourquarrel,I assumedhehadforgivenme.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)suspension D)inference A)benefit C)blow E)betrayal B)behavior D)battle 18.I'mappalledbyyourcallous. Thatisnowayforaresponsible companytoact. A)benefit C)blow E)betrayal B)behavior D)battle B)potent D)urban 19.Thefactoryverywellwiththe suddenincreaseindemand. A)competed C)succeeded E)inferred B)coped D)raced B)Primary D)Proportional 20.Themajorityofnursesarewomen, butinthehigherranksofthemedical professionwomenareina. A)rarity C)scarcity E)sum B)minimum D)minority B)mention D)comment
r.
25.Thatoldvasewillanattractive lampholder.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)attention D)attack B)extra D)altogether B)form D)assemble
r.
VocabularyforKPDS&DSTest70
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
8.PleasecontributetotheHungerSite. It'sallinagood. A)challenge C)celebration E)cooperation B)catastrophe D)cause B)waste D)reduction 9.Itwasthathehappenedtowalkin justaswewerediscussinghim. A)contemptible C)wretched E)necessary B)unfortunate D)miserable B)discussing D)shouting 10.Theauthorcleverlykeptthereader guessing.Thesolutiontothecrimewas notuntiltheverylastpage. A)excluded C)estimated E)suspended B)revealed D)retained
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
18.Hisimportanceasapolitical novelistinhissensitivitytothe politicalworldaroundhim. A)rests C)stems E)rises B)bases D)lies 19.Icannotbearthenoiseofmy brother'sradioitmefrommywork. A)disturbs C)interrupts E)distances B)perturbs D)distracts B)catastrophe D)cause 20.Membershiptotheclubisrestricted peopleover30. A)up C)in E)to B)by D)on
r.
22.Sheaffectionfromherchildren buttheyneglectedhershamefully.
25.Theywereawaitingofficialof thenewstheyhadheardfromafriend.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)opening D)scope
B)craved D)desired
r.
FORKPDS&DS
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
SYNONYMS
r.
affect(v.)toinfluence
Eatingtoomuchcandywillaffectyour weight.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
apply(v.),application(n.)put on,apply,rubon,spreadover Applythecreamalloveryourskin. area(n.)region,part Hewassufferingfrompaininthearea nearhisheart. assemble(v.) puttogether, construct Theworkerassembledthenewmachine. aspect(n.)quality HIVcanbedefinedaccordingtothree aspects:cause,symptoms,andtreatment. attach(v.),attachment(n.) fasten,append,connect Attachyourphotographtoyour application.
r.
blistering(n.),blister(v.)
Theacidresultedinanareaofblistering onhishand.
Ittakeslessthan10secondsforthetwo paperstobond.
branchoff(v.phrase) separate
Thebronchibranchoffintobronchioles.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
chief(adj.)principal,foremost, leading Thechiefreasonforattendingschoolisto acquireknowledge. chokeup(v.)fillwithtears Hechokedupwhenheheardthebad news. chronic(adj.)unabletobe cured Hesuffersfromchronicarthritis. circular(adj.) Hemovedhisarmsinacircularmotion.
r.
ProfessorsAndrewsandSamuelson collaboratedontheproject.
collaboratively(adv.)jointly
Dr.JohnsonandDr.Fearsonworkedon theprojectcollaboratively.
Thedoctorusedanewdrugtocombatthe effectsofthecommoncold.
combat(v.)trytostop,tryto reduce,trytodefeat
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
complex(adj.)complicated, intricate Brainsurgeryisaverycomplex procedure. complicated(adj.)complex Thisisacomplicatedquestion. complication(n.)anadded difficultyonedisease superimposedonanotherdisease withoutbeingspecificallyrelated yetaffectingormodifyingthe prognosisoftheoriginaldisease Onecomplicationofthemeaslescanbe pneumonia. confer(v.)give,bestow HisfatherconferredthenameBaderon him.
communicable(adj. Measlesisacommunicabledisease.
r.
contain(v.)hold,befullof Theglasscontainedwater.
contract(v.)becomeinfected with,catch
Hecontractedleprosywhilehewasliving inIndia.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
crucial(adj.),crucially(adv.) vital,critical,key Receivingprompttreatmentiscrucialif thepatientistolive. culminate(v.),culmination(n.) endin Hodgkinsdiseaseeventuallyculminates indeath. debilitating(adj.),debilitation (n.),debilitate(v.) incapacitating,weakening AIDSisadebilitatingdisease. defective(adj.),defect(n.) faulty,imperfect,flawed Adefectiveheartvalvecanleadtohealth problems.
r.
Hesufferedfromdepressionbecauseof thedeathofhischild.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
detect(v.),detection(n.) identify,discover Researchershavenotdetectedthecause ofautism. devastate(v.),devastation(n.), devastated(adj.)crush, desolate Thebadnewsdevastatedhismother. dimension(n.)measurement (e.g.,length,height) Whatarethedimensionsofthenew building? discover(v.),discovery(n.) learn,determine,detect Scientistshavediscoveredthatamutant genecausesthedisease.
r.
r.
Thechemicaldistortedthenaturalshape oftheobject.
distribution(n.),distribute(v.) location,dispersal
ThemapshowsthedistributionofAIDS casesthroughouttheworld.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
dome(n.),domed(adj.)a shapelikeaballcutinhalf Theobjectwasshapedlikeadome. donor(n.),donate(v.)giver, supplier Ihopetherewillbeakidneydonor. droplet(n.)drop,bead, globule,drip Thetechnicianplacedadropletofblood ontheglassslide. early(adj.) initial Earlysignsofmeaslesarefeverand runnynose.
enable(v.)allow,facilitate, permit,makepossible
Studyingthevocabularywordsenables studentstopassthevocabularytest.
Iaskedthemantoenlargethephotograph toabiggersize.
w w
entire(adj.),entirely(adv.) whole,complete,total Icompletedtheentiretaskinlessthan onehour.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
essential(adj.)vital,crucial, critical Treatmentisessentialifapatientisto recoverfrombubonicplague. evaporate(v.),evaporation(n.), evaporated(adj.)ifaliquid evaporatesorifsomething evaporates,itchangesinto steamifafeelingevaporates,it slowlydisappears Thewaterevaporatedintohotsteam. Hopeofreachinganagreementis evaporating. exaggerated(adj.)largerthan normal,overlylarge Thehematomawasexaggeratedinsize.
r.
extraordinary(adj.) unexpected,unusual
Winning$1millionwasextraordinary.
extraordinary(adj.)strange, odd
Itwasextraordinarythathedidntknow hisownbrothersname.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
feature(n.)characteristic,trait, aspect,symptom Onefeatureofthediseaseistrembling. filtered(adj.),filtration(n.), filter (v.) Thefilteredwaterdidnotcontainforeign matter. flake(n)averysmallflatthin piecethatbreaksawayeasilyor hasbeenbrokenawayfrom somethingelse Themaidusedsoapflakestowashthe sweater.
r.
Hegavefreereintohisimagination.
glance(n.),glance(v.)quick look
Thedentistglancedatherwatch.
gradually(adv.)progressively Thediseasegraduallyworsened.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
humanity(n.)allthepeoplein theworldthoughtofasagroup thehumanrace Itwasacrimeagainsthumanity. humanity(n.)thequalityof beingkindandunderstanding Theprisonersweretreatedwithhumanity. hypothesize(v.),hypothesis (n.),hypothetical(adj.), hypothetically(adv.) speculate,theorize Scientistshypothesizethatamutantgene causesthedisease.
r.
individual(adj.)single
Thescientistexaminedeachindividual sampleunderamicroscope.
inflammation(n.)redness, irritation
Thedoctorprescribedasoothinglotionfor myinflammation.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
initial(adj.)first,early Initialsymptomsarewheezingand coughing. instantaneously(adv.) immediately,directly Becomingapharmacistdoesnotoccur instantaneouslyyoumuststudyformany yearsbeforeyougraduate. intake(n.)ingestion Anintakeofjunkfoodwillresultinobesity. intended(adj.),intend(v.), intention(n.),intentionally (adv.)plannedfor,meantfor Theintendedpurposeofthedrugisto relievepain.
r.
invade(v.),invasion(n.) attack,assault
Whendiseasecausinggermsinvadea person'sbody,heorshemaybecomeill.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
map(v.), map(n.)chart Newtechnologymadeitpossiblefor scientiststomapthepartofthehuman brainresponsibleforperception. merge(v.)jointogether,come together,unite Thetwoveinsmerge. moist(adj.),moisture(n.) slightlywet,damp Keepthesoilmoist,ortheplantwilldie. momentum(n.)speed, strength Theballgainedmomentumasitrolled downhill.
r.
numbness(n.),numb(adj.) lackofsensation
Hewasanordinaryperson.
ordinary(adj.)common, normal,commonplace
overdose(n.),overdose(v.) O.D.
Thewomantookanoverdoseofsleeping pills.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
peculiar(adj.)odd,strange Heisapeculiarperson. perception(n.),perceive(v.) awareness Thereissomethingwrongwithhis perceptionoftheproblem. perception(n.),perceive(v.) opinion Myperceptionisdifferentthanyours.
r.
preyon(v.)feedon,liveoffof persist(v.),persistence(n.) continue Youshouldseeadoctorifyour feverpersists. private(adj.)personal population(n.),populate(v.), populated(adj.)inhabitants, residents Goodhealthcareresultsinahealthy population. Hislifeasamoviestarisdifferentfromhis privatelife. Somebacteriapreyonotherbacteria.
Thatspecimenisinthewrongposition.
position(n.)opinion
Hispositionisthatweshouldstartagain.
Ageneticpredispositionmaycause autism.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
professional(n.)someonewho worksinajobthatrequires specialeducationandtraining Dentistsandpharmacistsare professionals. progress(v.),progression(n.) advance,grow Asthediseaseprogresses,thesymptoms increase. progressively gradually Hisconditionprogressivelyworsened.
r.
pulse(n.)heartbeat
Thenursetookthepatientspulse.
Shehadarashonherarms.
rash(n.)irritation,inflammation
TheirTOEFLscoresrangedfrom200to 300.
r.
range(v.),range(n.)vary, extend
w
Thediseaseravagestheimmunesystem.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
recurrence(n.),recur(v.) reappearance,return Therecurrenceofplagueisapossibility. refer(v.),reference(n.)tobe associatedwithtosendto someoneforinformation,help, etc. Thetermneoplasiareferstocancer. ThemanwasreferredtoDr.Dicksonfor treatment. regard(v.)consider Macyregardsthisissueasbeingvery important.
relatedkinned Sheisrelatedtomyfamily.
residue(n.)deposit
Therewasabrownresidueintheempty beaker.
resistant(adj.),resist(v.), resistance(n.)opposedto
Sheisresistanttochange.
Thepatientwillrestorehishealthby followinganewdiet.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
scary(adj.),scarily (adv.), scare(v.),scare(n.) frightening Ifindinjectionstobescary. segregate(v.),segregation(n.), segregated(adj.)separate, isolate OnemansaidthattheEnglishfootballfans shouldbesegregatedsothattheywould notcausetroubleatthefootballmatch. sensation(n.),sense(v.) feeling Ifeltaburningsensationonmyskin.
r.
show(v.)prove,confirm
Histestresultsshowthatheisagood student.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
soothing(adj.),soothe(v.) Thelotionhadasoothingeffectonthe patientssunburnedskin. speculate(v.),speculation(n.) guess,conjecture,hypothesize Scientistsspeculatethatamutatedgene causesthedisorder. spread(v.)transmit Lymediseaseisspreadbydeerticks. sterile(adj.)uncontaminated Placetheliquidinasterilebeaker.
r.
symptom(n.)indication,sign
OnesymptomofLymediseaseisswelling ofthelymphglandsnearthetickbite.
task(n.)chore
Hertaskistorecordchangesin temperature.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
trace(n.)markorsign(that showsthatsomethinghappened orexisted) Themandisappearedwithoutatrace. trace(n.)averysmallamount ofsomething Tracesofbloodwerefoundunderher fingernails. tranquilizing(adj.)sedating calming,soothing Thedrugisusedforitstranquilizing effect.
r.
transmit(v.)spread
Lymediseaseistransmittedbythedeer tick.
Thehormonetriggersgrowth.
typically(adv.)normally, usually,habitually
Thediseasetypicallytakesseveralweeks toappear.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
verbal(adj.)spoken,oral Sometimesnonverbalcommunicationis asimportantasverbalcommunication. via(prep.)bywayof Thebloodreturnstotheheartviathe arteries. vigorous(adj.),vigorously (adv.)energetic,forceful, strong,brisk Heclosedhishandinavigorous movement. violent(adj.)verystrong, powerful,intense,uncontrolled Thepatientsshakingwasviolent.
r.
vital(adj.)crucial,essential Oxygenisvitalforhumansurvival.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
r.
SynonymsforKPDS&DSTest1
3.Itwasaminutecrackinthemotor blockthatruinedthecar.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)endure D)surpass A)range C)aim E)reservoir B)view D)need 7.Mailservicewillbesuspendedduring thepostalworkers'strike. A)inspected C)uninterrupted E)curtailed B)delayed D)speeded B)verysmall D)multiple 8.Thereisagreatdiversityofopinion onthisissue. A)similarity C)commonness E)difference B)unity D)collection 9.Rainlessensinthefallthroughout thenorthernpartofthecountry. A)accumulates C)abates E)hikes B)pours D)evaporates
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
17.TheChinesewereprobablythefirst teadrinkersintheworld. A)apparently C)believably E)hardly B)mostlikely D)seemingly B)onesided D)wise 18.Mosttoothpasteisbasicallychalk. A)possibly C)necessarily E)essentially B)eventually D)probably B)ratified D)signed 19.Aftermuchthought,heagreed reluctantly. A)eagerly C)unwillingly E)resolutely B)willingly D)finally B)thrive D)vegetate 20.Today'sclasshasalreadybeen calledoff. A)revised C)cancelled E)changed B)completed D)announced
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)predict D)test
r.
SynonymsforKPDS&DSTest2
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)built C)originated E)funded B)authorized D)founded 7.Whentheelectionresultsweremade known,theprimeminister acknowledgeddefeat. A)admitted C)rejected E)realized B)deserved D)defended B)determined D)distributed 8.HehasalteredagreatdealsinceI lastsawhim. A)grown C)improved E)changed B)deteriorated D)slimmed B)directed D)criticized 9.Astudentwilloftenshifthisinterest fromonefieldtoanother. A)translate C)change E)distinguish B)define D)confine
r.
16.Hewasoftentoldthathelookedlike hisfather.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)remember D)obtain 17.Jasonwasassignedtoanewpost. A)appointed C)called E)funded B)encouraged D)allocated B)arrested D)praised 18.Theproblemarosewhenthe studentsrefusedtodotheirhomework. A)deteriorated B)grew C)enticed D)wasresolved E)emerged B)abandon D)board 19.Ican'tputupwithhisbehaviorany more. A)encourage C)approveof E)mock B)criticize D)tolerate
B)restrained D)reconciled
r.
24.Parentsshouldestablishcertain rulesfortheirchildrentofollow.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)sent D)recognized B)destroy D)improve B)distribute D)suggest
r.
SynonymsforKPDS&DSTest3
3.Surplussuppliesofcoalshouldbe storedforfutureemergencies.
A)available C)considerable
A)accumulation C)achievement
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)subject C)book B)article D)event B)affection D)depth 8.Bothheredityandenvironmenthelp toshapeaperson'scharacter. A)relatives C)surroundings B)education D)upbringing B)poorquality D)excess 9.Manydoctorsarestillgeneral practitioners,butthetendencyis towardspecializationinmedicine. A)rumor C)trend B)prejudice D)security B)desirability D)undeniability 10.WinninganOlympicmedalwasa greatachievementonhispart. A)prize B)accomplishment C)reward D)award B)defeat D)job
7.Theissuewearediscussing concernseveryonewhohaschildren.
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
19.Manyreptilesareoftenclassifiedas beneficialtohumans. A)harmful C)relevant B)useful D)undesirable 20.Hehasmadesignificant contributionstoscience. A)interesting C)useful B)important D)exciting B)retreating D)decreasing 21.Thereisn'tadequatefoodtofeedso manypeople.Weshouldgetsome morefood. A)abundant C)necessary B)scarce D)sufficient 22.Efficientairservicehasbeenmade availablethroughmoderntechnology. A)affluent C)modern B)inexpensive D)effective
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)hazardous C)important
B)effective D)suitable
r.
SynonymsforKPDS&DSTest4
3.Herhusbandisverycompetent:he willrepairtheroofhimself.
A)capable C)industrious
A)hopeful C)certain
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)fragile C)vanished B)related D)active B)fragmentary D)complete 8.Theballet'svisualmessageis comprehensibletoalmosteveryone. A)acceptable C)understandable B)interesting D)pleasing B)thrifty D)careful 9.CharleswasquiteupsetbyJerry's remarks. A)amused C)irritated B)disappointed D)angered B)difficult D)tiring 10.Extensiveuseismadeofcomputer basedtechnologyinfactoriesand offices. A)spacious C)progressive B)plentiful D)widespread B)doubtful D)surprised 11.Whenaskedifhehadbrokenthe vase,Paulgaveanambiguousreply. A)unmistakable C)uncertain B)clear D)astonishing
7.Scientistsfoundtheprintsofseveral extinctspeciesinthecave.
r.
A)originally C)basically
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
20.Thereisnoresolutiontothis conflict. A)decision B)action C)condition D)disagreement B)subjectively D)mainly 21.Throughouttheyear1989,therewas asharprisingrateofinflationinTurkey. A)grimly C)steeply B)constantly D)roughly 22.Wegoouttothecountrychieflyon hot,sunnydaysinthesummer. A)scarcely C)occasionally B)mainly D)rarely B)clearly D)gradually 23.Therelativitytheoryisbasically madeupoftwoparts:therestrictedand thegeneralrelativitytheory. A)necessarily B)fundamentally C)approximately D)usually
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
r.
SynonymsforKPDS&DSTest5
A)Bytheway C)Personally
B)Forourinformation D)Actually
A)advanced C)decorative
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
8.Doitnow!Otherwise,it'llbetoolate. A)Orelse C)Essentially B)Principally D)Aside 9.Webookedourseatswellinadvance ofthedatewewantedtotravel. A)aheadof C)during B)after D)for B)significantly D)slightly 10.Steadyeconomicgrowthcanonly beachievedbycurbinginflationand maintainingproductiontargets. A)Constant C)Safe B)Rapid D)Desirable B)metallic D)simple 11.Theplaysucceededthankstofine actingbyallthecast. A)becauseof B)notwithstanding C)despite D)regarding
2.Incidentally,doyouknowwhere Johnlivesnow?
r.
16.Theprobabilityofthestrikeending beforethetouristseasonisnothigh.
A)likelihood C)idea
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
20.Onweekendswewearcasual clothesunlessweexpectcompanyor goout. A)formal C)loose B)informal D)tight B)wish D)superiority 21.Aliwascautiousinthewayhe approachedNilwhenshewasinabad mood. A)careful C)careless B)foolish D)clever B)result D)controversy 22.Myfatherisamanofmoderate views. A)modern C)stern B)predictable D)reasonable B)fightwith D)resemble 23.Sootstickstoanythingittouches. A)pointsto C)blackens B)clingsto D)streaks
r.
25.Wehiredacarforaweekwhenwe wereinItaly.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)purchased C)bought
B)rented D)reserved
r.
SynonymsforKPDS&DSTest6
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
8.Theflowersonthetablewerea manifestationofthechild'sloveforhis mother. A)demonstration C)combination B)satisfaction D)need B)anaccurate D)aquick 9.Wemustdoallwecantoalleviatethe sufferingofthesepoorpeople. A)stop C)compensatefor B)getridof D)lessen 10.Thesoldierrashlyagreedtoleadthe dangerousexpedition. A)dutifully C)recklessly B)heroically D)reluctantly 11.Thedroughtwasverysevere.Ithad notrainedfornearlythirtydays.Asa result,foodwouldbescarceinthefall. A)plentiful C)abundant B)insufficient D)enough
r.
A)prolific C)gifted
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
19.Therehadbeendisagreements betweenthem,triggeredbyhiswork. A)sparkedoff C)excited B)developed D)ended 20.Thegovernmentplacedrestrictions onsalesofweapons. A)limitations C)opportunities B)reductions D)increases 21.Themomentuminthedirectionof servicesissuchthatfurtherincreases inbenefitsandthereforeintaxesseem almostinevitable. A)unavoidable C)untrue B)obligatory D)redundant B)industrious D)famous 22.Annisacapablepianistbutshe's notyetquitereadytoplayinconcerts. A)competent C)hardworking B)famous D)determined
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)reliable D)clear
r.
SynonymsforKPDS&DSTest7
A)described C)praised
r.
A)burden C)hazard
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
8.Supportersofnofaultautomobile insurancebelieveitcorrectsflawsin theoldersystem,whichrequiresthat blamebedeterminedbeforeclaimsare settled. A)vestiges C)discrepancies B)defects D)contentions B)killed D)inaugurated 9.Hestoppedhiscarsuddenlywhen thelightturnedred. A)abruptly C)dangerously B)ambiguously D)carelessly B)constituted D)inaugurated 10.Youmusttakeintoaccountthe student'slongillness. A)disregard C)examine B)ignore D)consider 11.Thechildhasbeenrelativelysilent mostofthisevening. A)sadly C)comparatively B)remarkably D)strangely
r.
A)valuable C)remarkable
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
20.Thesignrequestedthatwe extinguishallfiresbeforeleavingthe campground. A)putout C)putoff B)putup D)putupwith 21.HelenlistenedtoFrank's explanationsinutteramazement. A)unspoken C)angry B)complete D)unique B)expensive D)smart 22.Icannotaccommodateallthese people.Idon'thaveenoughbedsfor them. A)putup C)putout B)putoff D)putupwith B)adherence D)sickness 23.Iwasstunnedbyhissuggestionfor changingthesystem. A)pleased C)shocked B)infuriated D)amused
25.Thestormcausedirreparable damagetotheFinikecitruscrop.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)irresponsible C)irrecoverable
B)irresistible D)irregular
r.
SynonymsforKPDS&DSTest8
7.Mostteenagersthinktheiractions aremature.
A)smell C)flavor
3.Theseedsofthisplanthavea licoricetaste.
A)subsidiary C)social
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)grownup C)intelligent B)serious D)childlike 8.Thenewteachingaidswillfacilitate learninginashorttime. A)makedifficult B)makeprofitable C)makeeffective D)makeeasier B)core D)crust 9.Thereisanacuteshortageofpetrol. A)inadequate C)inevitable B)severe D)drastic 10.Fishaboundinthissmallstream. A)arescarce C)areplentiful B)aredead D)arerare B)connected D)member 11.Itisawellknownfactthatthe hencuckoolayshereggsinthenestsof otherbirdsandpracticallynever broodsherself. A)substantially C)essentially B)relatively D)virtually
r.
A)abundant C)distant
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
19.Incidentally,doyouknowwhere Johnlivesnow? A)Bytheway B)Forourinformation C)Personally D)Actually 20.Violatorswhoareignorantofthe parkinglawsmuststillpaytheirfines. A)aretiredof B)wanttoknow C)arerespectfulto D)knownothingabout 21.Aftermanyattemptsheeventually managedtogetpromotion. A)finally C)probably B)obviously D)fortunately
r.
23.Thehotelherecommendedproved tobetooexpensive.
25.Theaccidentoccurredbecausethe taxidriverwascareless.
D w
r.
A)alert C)ignorant
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)negligent D)intolerant
SynonymsforKPDS&DSTest9
1.Thetaxidriverwasblamedfor causingtheaccident. A)rewarded C)reproached B)honored D)chosen 7.Thismachinehasamajordrawback fromthetechnologicalpointofview. A)advantage B)disadvantage C)improvement D)potential
A)available C)approachable
4.Byherclothesonecouldseethatshe wasquiteprosperous.
r.
A)peaceful C)poor
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)innovation D)obligation 8.Currently,therearemoreyoung peopleinTurkeythanatanyothertime inourhistory. A)Atpresent C)Beforelong B)Atonce D)Uptonow B)visible D)usable 9.CoffeeconsumptionbyAmerican coffeedrinkershasdiminishedto2.06 cupsperday. A)amounted C)improved B)dropped D)increased B)welltodo D)calm 10.Thebarometerisusedbyweather forecasterstodetectchangesinair pressure. A)announce C)reduce B)bringabout D)determine 11.Shededicatedherlifetohelpingthe poor. A)prepared C)assigned B)devoted D)adjusted
18.Dustaccumulatedontheengine, impairingitsfunction. 13.Hehopestofulfillhisdesireto becomeadoctor. A)realize C)maintain B)perceive D)visualize A)gathered C)rose B)grew D)existed
A)deny C)allow
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
19.Themonkeyswereconfinedtoa smallcage. A)closedin B)releasedfrom C)takento D)fedin 20.Travelagentswillconfirmyour reservationsforyoufreeofcharge. A)purchase C)verify B)exchange D)obtain B)encouraged D)expected 21.In1981,theworldrecessionand conservationmeasurescombinedto curbdemandforoil. A)restrict C)involve B)spread D)affect 22.Thespaceshuttleprogramentails theuseofsophisticatedtechnology. A)enhances C)creates B)develops D)involves
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
r.
SynonymsforKPDS&DSTest10
A)endless C)measurable
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
8.Theindustryshouldusethemost practicablemethodstoabatepollution. A)lessen B)putanendto C)cease D)curb B)interruptive D)additional 9.Thejudgeassertedthatthesuspect hadbeeninjailatthetimeofthe murder. A)argued C)assumed B)stated D)knew 10.Thisbookisratherdifficult,butthat oneisrelativelyeasy. A)remarkably B)comparatively C)unusually D)mostly 11.We'dbetterhurryotherwise,we'll belate. A)orelse C)essentially B)principally D)aside
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
20.Heresolvedtoactmorewiselyin thefuture. A)promised C)consented B)hoped D)decided B)ascribed D)dedicated 21.GeorgeW.BushsucceededBill Clintonasthenewpresidentofthe USA. A)overruled C)preceded B)followed D)assisted 22.Hisextremenervousnessimpeded hisabilitytospeakinfrontoflarge groupsofpeople. A)hindered C)accelerated B)halted D)fostered B)appropriately D)precisely
r.
A)expected C)craved
D w
r.
A)desires C)cooks
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)merited D)demanded B)reminds D)visualizes
SynonymsforKPDS&DSTest11
A)stimulus C)improvement
r.
5.Theconverseofevaporationis condensation.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
8.AccordingtoFreud,dreamscanbe interpretedasthefulfillmentofwishes. A)performance C)completion B)satisfaction D)conclusion B)enlarge D)shine 9.Themanlistenedtoreportsofthe approachinghurricanewithmounting anxiety. A)depression C)gratification B)uneasiness D)absorption. 10.Thedoctorcouldn'tseemuch prospectofthepatient'srecovery. A)vision C)chance B)expectation D)outlook
17.Thegovernmentreachedanaccord regardingoffshorefishingrights. 12.Thiskindofworkwouldhavebeen inconceivablebeforetheadventof microprocessors. A)invention C)discovery B)production D)arrival A)disagreement C)agreement B)indecision D)apology
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
18.Expertsseetheextremelyvolatile situationinthisregionasathreatto worldpeace. A)anincentive C)amenace B)anuisance D)apromoter 19.Hehadimpresseduswithhis versatilityasajournalist. A)enthusiasm B)varietyofskills C)version D)verse B)Rudeness D)Action 20.Becausehehadinvitedtwogirlsto thedance,hefoundhimselfinaterrible dilemma. A)predicament C)argument B)romance D)discussion 21.Theepochofspacetravelhas alreadybegun. A)fear C)event B)moment D)age
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)zealousness D)end
A)debate C)dismissal
B)argument D)compromise
r.
SynonymsforKPDS&DSTest12
A)perfect C)imitations
r.
4.Thejewelerreportedthatthe diamondsweregenuine.
A)considerable C)unimportant
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
8.Cornisthemostprevalentcropin theBlacksearegion. A)common C)frequent B)traditional D)routine B)only D)unequalled 9.Influenzaisanacuteviraldiseaseof therespiratorytractthatisextremely contagiousandoftenreachesepidemic proportions. A)scarce C)widespread B)common D)infectious B)real D)valuable 10.Sincehiswoundwassuperficial, onlyaBandAidwasrequired. A)frivolous B)onthesurface C)deep D)supercilious
18.Theyhavestatedunequivocally whattheystandfor. 12.Pakistanisoneofthemostdensely populatedcountriesintheworld. A)heavily B)homogeneously C)sparsely D)thinly A)ambiguously C)astonishingly B)clearly D)doubtfully
15.Georgedancedquiteawkwardly withMary.
A)energetically C)clumsily
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
19.Heworkedquitezealouslyafterhe gothispromotion. A)unwillingly B)enthusiastically C)ambitiously D)reluctantly 20.Whennewmathwasintroducedinto schools,manyparentswereperplexed bytheapproachitinvolved. A)puzzled C)shocked B)frightened D)annoyed B)clearly D)doubtfully 21.Herespondedtoheradvances ardently. A)expertly C)entirely B)vigorously D)gracefully B)zealously D)arduously 22.Beforethecollapseoftheformer SovietUnion,Mr.Gorbachevtriedto preservetheunion. A)unify C)maintain B)prepare D)predispose
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)trace C)tempt
B)enervate D)thrice
r.
SynonymsforKPDS&DSTest13
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
8.That'sabsolutenonsense.Nobody willbelieveit. A)profound C)true B)complete D)unique B)convicted D)convinced 9.Johnisoptimistic.Bill,ontheother hand,ispessimistic. A)inaddition C)consequently B)regularly D)however B)rescued D)dismissed 10.Lifeexpectancyisthemeasureof theaveragelifespanofaparticular groupofpeople. A)age C)condition B)range D)mortality 11.Theschoolbusdriveradmonished thenoisychildren. A)admitted C)rebuked B)drove D)struck
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
19.Whetherthedeathpenaltyshould beabolishedisacontroversialissue. Whilesomepeopleinsistthatitshould bemaintainedasadeterrenttocrime, othersareinfavorofitsabolition. A)ancient C)unanimous B)disputable D)unique 20.Hecriedoutinpainwhentheytried tomovehimfromthesceneofthe accident. A)ailment C)anguish B)crutch D)despair 21.Theageofatreecanbedetermined accuratelybycountingthenumberof treeringsithasdeveloped. A)decided C)predicted B)measured D)resolved
r.
A)decided C)increased
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)decreased D)measured B)customary D)regular B)putup D)putupwith
r.
SynonymsforKPDS&DSTest14
A)anger C)doubt
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)correct D)prepare A)unsuited B)confined C)adjusted D)unaccustomed 8.Hehasgivenuptheideaofopening anotherfactoryinIstanbul. A)rejected C)abandoned B)approved D)originated B)eliminate D)challenge 9.Hewas accusedofrobberyand murder. A)executedfor B)declaredinnocentof C)chargedwith D)askedabout B)articulate D)doubtful 10.Higherenergycostsseemcertainto haveanadverseeffectontheeconomy. A)afavorable B)acontroversial C)apermanent D)abad
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
19.Baldness,theabnormalor prematurelossofhair,isaninherited traittransmittedbyasexinfluenced gene. A)quality B)characteristic C)disease D)mark 20.Aninnocentmanwasaccusedof thecrime. A)chargedwith B)interferedwith C)copedwith D)dealtwith B)ancient D)reliable 21.Themostrecentevidenceindicates thatdinosaurswerewarmblooded animals. A)admits C)suggests B)insists D)concludes
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)satisfactory D)remarkable
A)hoped C)promised
B)failed D)refused
r.
SynonymsforKPDS&DSTest15
3.Theconversationbetweenthetwo womenwasintelligible.
A)disagreeable C)understandable
r.
4.Theiraggressivenessstemmedfrom fear.
A)grew C)vanished
A)reduced C)rejected
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
8.Governmenthealthcampaignshave fosteredanawarenessofthedangers incertainsocialhabits. A)perfected C)discouraged B)encouraged D)initiated B)rapid D)clever 9.Authenticstainedglassiscolored duringtheglassmakingprocess. A)priceless C)genuine B)antique D)unpainted B)arose D)increased 10.Organicmaterialconsistsofplant andanimalmatterinvariousstatesof decay. A)disuse C)life B)deterioration D)development B)revised D)reviewed 11.Computingremainsagrowtharea andoneinwhich,notwithstanding economicrecessions,theoutlooklooks bright. A)despite C)considering B)becauseof D)inadditionto
A)view C)range
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
20.Hehadreachedthezenithofhis careerwhenhebecamepresidentofthe university. A)ambition B)happiestmoment C)summit D)zeal B)masculine D)redeeming 21.Manispronetoerror,eventhough he'dliketothinkhe'sinfallible. A)apathetic C)disposed B)averse D)indifferent 22.Ionlyhavetimetotellyouthemain ideaofit,notthedetails. A)twist C)list B)gist D)part B)aim D)intention 23.HasMarygivenyouanyclueof whatshewouldlikeforherbirthday? A)hinge C)hoax B)hoe D)hint
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)arduous D)ambiguous
r.
SynonymsforKPDS&DSTest16
1.Ashorterhaircutwouldmakeher appearancebetter. A)entice C)enhance B)induce D)intrude 7.Ifyoucontinuetobeabsentfrom classes,wewillhavetoinformyour sponsor. A)modify C)horrify B)notify D)solidify
A)penalized C)enhanced
r.
A)clever C)mechanical
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
8.Hedevisedafoldingtoothbrushfor travelers. A)sold C)invented B)bought D)described B)repel D)discard 9.Hereadsperiodicalsthatare pertinenttohisprofession. A)appropriate B)apparent C)perceptive D)discriminating B)rejuvenated D)endangered 10.Sodiumplaysapartintissue formationandinmusclecontraction. A)compression C)rigidity B)maturation D)constriction B)minor D)intricate 11.Education,principallyforboys flourishedalmostfromtheoutset. A)foremost C)start B)mainstream D)extreme
r.
A)aneffort C)afantasy
16.Alaserbeamisusedtopenetrate eventhehardestsubstances.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
19.Achancesamplecanoftenprovide informationaboutalargerpopulation. A)genuine C)modified B)prudent D)random 20.Mygrandparentsalwaystalkabout theirailmentswheneverIgotovisit them. A)pleasures C)achievements B)illnesses D)hobbies B)aquest D)achallenge 21.Theproposalisgainingmoreand moreadherents. A)opponents C)admirers B)practitioners D)supporters 22.Hereadsperiodicalsthatare pertinenttohisprofession. A)appropriate B)apparent C)perceptive D)discriminating
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)exceeds C)augments
B)equals D)predicts
r.
SynonymsforKPDS&DSTest17
A)activity C)bother
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)associating C)advanced B)related D)new 7.Hehadanedgeonthecompetition. A)border B)aslightadvantage C)aslightmargin D)success 8.TheapplicantsoftheProposal Competitionareinvitedtoprovidethe FrontierScienceResearchCityProject withvisionsforcreatinga21stcentury stylecity. A)performance B)plan C)business D)communication B)importance D)assistance 9.ThedollarfellagainsttheEurofor thefourthdayinfiveanddropped againsttheyenonconcernarecovery intheUSeconomyisfaltering. A)evidence C)worry B)interest D)relief
r.
A)new C)practical
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)surveying C)development B)dimension D)budget 17.Hehasauniquetalenttoinspire andcompeleachpersontorecognize hisorherownpersonaluniqueness andvalue. A)force C)command B)cheer D)lead 18.Surveyshowthatthesilence majorityagreewithmeandnotyou. A)minority C)senior B)major D)bulk 19.Theloweringofthethreatlevelis notasignaltogovernment,law enforcementorcitizensthatthedanger ofaterroristattackispassed. A)throat C)territory B)thread D)terror
r.
A)strip C)mission
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)journey D)research B)test D)investigate
21.Thisisashortreportonourtripto Colorado.
r.
SynonymsforKPDS&DSTest18
A)scenario C)shot
r.
A)replaced C)shifted
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)fortify D)change 8.So,yourfocusisnotinwardonyour ownprocesses,butoutward,onsupply chainprocesses. A)based C)inside B)dependent D)inbound B)compile D)conduct 9.Oursisafieldincreasinglydrivenby bothrapidlyevolvingsolutionsto existingproblemsandbynew interpretationsofthenatureofthe problemsweface. A)method C)lotion B)mixture D)problem 10.Howdidshekeepitsecretfornine years? A)secretary C)hidden B)mystery D)information
A)copy C)freedom
A)roof C)power
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)permission D)software A)bodyoflawmakers C)congress B)lecturer D)army 18.Nowonder,manycompaniesare findingdifficulttosustainthegrowth. B)subdue D)reverse A)expand C)maintain 19.They'resupposedtobepreparing usforthemeeting. A)scheduled C)forced B)believed D)replaced B)protection D)guidance 20.Particularattentionispaidtothe repertoireandqualityofperformance presentedontheaudition. A)originality C)uniqueness B)acollectionofworks D)depth
r.
A)strip C)area
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)dramatic D)drastic
r.
SynonymsforKPDS&DSTest19
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)deserved C)expected E)denied B)needed D)demanded B)peels D)hardens 7.Thetendencyofthehumanbodyto rejectforeignmatteristhemain obstacletosuccessfultissue transplantation. A)occurrencein B)phenomenonof C)impedimentto D)factorin E)attemptto B)obviously D)finally 8.Thisquestiondoesnotpertaintothe heartofmyinterests:understanding thenatureofhumanbehaviorand relationshipofmindtothebody. A)conform C)pursue E)adhere B)lead D)relate B)alleviate D)curb 9.Birdsexhibitunusualadaptationsto theirenvironment. A)require C)develop E)leave B)attempt D)display
r.
11.Heisaleadingadvocateoffree enterprise.
14.Thecandidatedeclinedtocomment ontheproposedtaxincrease.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)object C)attribute E)refer B)ascribe D)prefer 17.Nooneknewthereasonforthe enmitybetweenthetwofamilies. A)relationship C)closeness E)toughness B)hatred D)friendship 18.Thegovernmentprovidesaidto farmersbysubsidizingpricesthey receivefortheircrops. A)advice C)help E)vote B)treatment D)charity 19.Wehopetherewillbesufficientfood tonight. A)varied C)perfect E)adequate B)delicious D)tasty
B)opponent D)reformer
16.Inyourremarksyoualludeto certainsinisterdevelopments.
r.
25.Manyadvertisementsboastthat theirproductsdonotcontainany additives.Theyhavenoartificial ingredients.Theadvertisementsstress thisbecausethepublichascometo valueproductsmadefromonlynatural ingredients. A)natural C)unnatural E)fatty B)blended D)fattening
24.TheIrishsetteriswellknownforits keensenseofsmell.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)warily D)occasionally B)dull D)sharp
r.
SynonymsforKPDS&DSTest20
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
A)surpass C)prolong E)energize B)equip D)preserve 7.Sandracameacrossanimportant letteryesterdaywhilegoingthroughher drawers. A)mentioned C)read E)posted B)discovered D)toreup B)ambiguous D)irregular 8.MithatPashawilllongbe rememberedforhisroleinfoundingthe AgriculturalBank. A)promoting C)assisting E)establishing B)embezzling D)financing 9.Electronicfirmscontinuetoseek waysofcrammingmorebitsof informationontotinysiliconchips. A)find C)lookfor E)dig B)reveal D)discover
r.
16.Theintricatedirectionswere difficulttounderstand.
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
17.$1000willsufficetobuyagood homecomputer. A)besaved C)beavailable E)begranted B)becharged D)beenough B)lie D)develop 18.Anaffluentsocietysuchasthe UnitedStatesmustdowhatitcanto preventhungerandmisery. A)divided C)determined E)healthy B)willing D)wealthy 19.Doubleagentsliveinaperpetual stateoffear. A)perfect C)constant E)tense B)perpetrated D)ceasing
11.Maryfounditdifficulttocopewith thelossofherjob.
B)routine D)unusual
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
B)preliminary D)prior
r.
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
ANSWERKEYS
r.
CollocationTest1
2.A
7.D
12.E
17.C
22.A
7.A
1.D
2.A
12.D
17.D
22.E
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
CollocationTest2 3.E 4.B 5.E 8.D 9.D 10.A 13.A 14.C 19.A 24.A 15.C 20.D 25.D 18.D 23.D CollocationTest3 3.D 8.E 13.E 18.B 23.E 4.B 5.A 9.A 14.A 19.A 24.A 10.E 15.B 20.A 25.C
r.
CollocationTest4
2.B
7.A
12.C
17.C
22.B
7.A
1.E
2.E
12.D
17.E
22.D
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
CollocationTest5 3.C 8.A 4.E 9.E 5.A 10.A 15.A 20.B 13.A 18.A 23.B 14.D 19.D 24.C 25.A CollocationTest6 3.A 8.B 13.A 18.A 23.C 4.B 9.B 14.A 19.D 24.D 5.E 10.D 15.C 20.C 25.A
r.
AcademicVocabularyforKPDS&DSTest1
AcademicVocabularyforKPDS&DSTest2
2.C 7.C
12.C 17.E
22.D 27.A
AcademicVocabularyforKPDS&DSTest3
1.A
2.A
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
24.C 29.E 28.C 30.B 3.D 8.D 4.B 5.E 9.A 10.B 13.B 14.A 19.A 24.B 29.E 15.A 20.E 18.C 23.C 28.B 25.D 30.B 3.E 8.A 13.D 18.B 23.C 4.C 9.B 14.E 19.E 24.E 5.A 10.C 15.C 20.A 25.B
r.
26.C
27.B
28.C
29.E
30.A
AcademicVocabularyforKPDS&DSTest4
AcademicVocabularyforKPDS&DSTest5
1.E
2.A 7.B
AcademicVocabularyforKPDS&DSTest6
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
24.D 29.E 30.A 3.E 8.A 4.E 5.D 9.C 10.C 15.D 20.B 13.D 18.D 23.E 28.E 14.A 19.E 24.C 29.B 25.D 30.C 3.B 8.B 13.A 18.C 23.D 4.E 9.C 14.E 19.E 24.E 5.D 10.D 15.B 20.C 25.B
r.
26.E
27.B
28.D
29.E
30.D
AcademicVocabularyforKPDS&DSTest7
22.D 27.E
AcademicVocabularyforKPDS&DSTest8
1.A
2.A 7.B
AcademicVocabularyforKPDS&DSTest9
r.
27.C
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
23.C 28.A 29.D 30.E 3.A 4.D 9.C 5.A 8.D 10.C 15.A 20.A 25.B 13.A 18.E 23.E 14.C 19.C 24.D 29.E 28.C 30.C 3.D 8.A 13.E 18.A 23.C 4.A 9.A 14.D 19.C 24.B 5.C 10.C 15.D 20.E 25.B
26.E
27.B
28.D
29.C
30.A
AcademicVocabularyforKPDS&DSTest10
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
23.A 28.E 24.A 29.E
r.
PHRASALVERBQUIZFORKPDS&DS1
1.B
2.C
3.E
4.E
5.A
6.D
7.E
8.B
9.B
10.D
1.A
2.E
3.A
1.E
2.A
3.D
1.B
2.E
3.E
1.E
2.B
3.E
1.C
2.A
3.D
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
4.B 5.C 6.E 7.C 8.D 9.D 10.B PHRASALVERBQUIZFORKPDS&DS3 4.A 5.E 6.B 7.C 8.E 9.D 10.C PHRASALVERBQUIZFORKPDS&DS4 4.D 5.C 6.E 7.E 8.D 9.B 10.D PHRASALVERBQUIZFORKPDS&DS5 4.E 5.C 6.B 7.D 8.E 9.C 10.E PHRASALVERBQUIZFORKPDS&DS6 4.E 5.C 6.B 7.D 8.E 9.D 10.B
PHRASALVERBQUIZFORKPDS&DS2
r.
PHRASALVERBQUIZFORKPDS&DS7
1.E
2.B
3.C
4.C
5.C
6.B
7.D
8.A
9.E
10.C
1.A
2.C
3.B
1.A
2.E
3.C
PHRASALVERBQUIZFORKPDS&DS10
1.A
2.D
3.C
1.A
2.B
3.
PHRASALVERBQUIZFORKPDS&DS11
PHRASALVERBQUIZFORKPDS&DS12
1.C
2.A
3.A
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
4.D 5.C 6.A 7.B 8.E 9.D 10.D PHRASALVERBQUIZFORKPDS&DS9 4.D 5.C 6.B 7.C 8.C 9.C 10.A 4.D 5.D 6.B 7.E 8.D 9.C 10.C 4.B 5.C 6.B 7.B 8.C 9.E 10.B 4.A 5.D 6.A 7.B 8.C 9.B 10.A
PHRASALVERBQUIZFORKPDS&DS8
r.
PHRASALVERBQUIZFORKPDS&DS13
1.D
2.C
3.B
4.C
5.E
6.B
7.D
8.C
9.A
10.B
PHRASALVERBQUIZFORKPDS&DS14
1.B
2.C
3.C
PHRASALVERBQUIZFORKPDS&DS15
1.B
2.A
3.D
PHRASALVERBQUIZFORKPDS&DS16
1.B
2.B
3.A
PHRASALVERBQUIZFORKPDS&DS17
1.E
2.B
1.B
2.C
3.D
PHRASALVERBQUIZFORKPDS&DS18
3.A
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
4.E 5.A 6.B 7.A 8.A 9.C 10.D 4.B 5.C 6.D 7.A 8.B 9.B 10.A 4.B 5.A 6.E 7.B 8.C 9.C 10.C 4.B 5.D 6.A 7.C 8.D 9.A 10.D 4.B 5.D 6.A 7.C 8.C 9.A 10.D
r.
PHRASALVERBQUIZFORKPDS&DS19
1.A
2.E
3.D
4.E
5.C
6.B
7.E
8.E
9.A
10.E
1.D
2.B
3.D
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
4.D 5.B 6.E 7.D 8.B 9.D 10.C
PHRASALVERBQUIZFORKPDS&DS20
r.
VocabularyforKPDS&DSTest1
6.C 16.C
7.B 17.B
8.A 18.A
9.E 19.E
10.D 20.D
3.A
13.C 23.B
3.C
13.A
23.C
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
VocabularyforKPDS&DSTest2 4.D 5.E 6.B 7.C 8.C 9.D 10.E 14.D 15.B 16.A 17.E 18.B 19.A 20.C 24.D 25.A VocabularyforKPDS&DSTest3 4.B 5.C 6.E 7.B 8.A 9.C 10.D 20.D 14.D 24.E 15.B 16.A 17.A 18.C 19.B 25.E VocabularyforKPDS&DSTest4 4.A 14.E 24.D 5.C 15.B 25.A 6.B 16.A 7.A 17.B 8.D 18.C 9.E 19.D 10.A 20.E
r.
VocabularyforKPDS&DSTest5
6.A 16.E
7.E 17.C
8.C 18.E
9.E 19.D
10.C 20.E
3.E
13.C 23.A
3.B
13.E 23.E
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
VocabularyforKPDS&DSTest6 4.C 5.A 6.C 7.A 8.E 9.E 10.E 14.B 15.C 16.A 17.E 18.D 19.C 20.B 24.B 25.B VocabularyforKPDS&DSTest7 4.E 5.D 6.B 7.C 8.E 9.C 10.A 14.C 24.C 15.B 16.D 17.B 18.D 19.C 20.A 25.B VocabularyforKPDS&DSTest8 4.E 14.E 24.B 5.E 15.D 25.C 6.C 16.B 7.B 17.A 8.C 18.D 9.E 19.C 10.B 20.A
r.
VocabularyforKPDS&DSTest9
6.B 16.B
7.D 17.E
8.C 18.B
9.B 19.A
10.A 20.D
3.E
13.B
23.C
3.E
13.E
23.C
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
VocabularyforKPDS&DSTest10 4.D 5.C 6.E 7.B 8.A 9.C 10.B 14.A 15.D 25.A 16.A 17.C 18.B 19.E 20.D 24.B VocabularyforKPDS&DSTest11 4.C 5.C 6.E 7.B 8.A 9.C 10.B 20.E 14.A 24.E 15.A 25.B 16.C 17.B 18.D 19.D VocabularyforKPDS&DSTest12 4.E 14.D 24.C 5.C 15.E 25.A 6.B 16.A 7.D 17.C 8.A 18.E 9.A 19.D 10.E 20.B
r.
VocabularyforKPDS&DSTest13
6.B 16.E
7.E 17.D
8.B 18.A
9.A 19.D
10.D 20.C
3.B
13.B
23.C
3.A
13.D 23.A
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
VocabularyforKPDS&DSTest14 4.C 5.E 6.A 7.D 8.E 9.A 10.C 14.A 15.E 16.E 17.B 18.C 19.C 20.D 24.E 25.A VocabularyforKPDS&DSTest15 4.C 5.E 6.B 7.A 8.E 9.A 10.E 14.D 15.A 16.B 17.A 18.E 19.D 20.B 24.C 25.D VocabularyforKPDS&DSTest16 4.B 14.E 24.B 5.E 15.B 25.E 6.B 16.A 7.C 17.C 8.D 18.A 9.A 19.E 10.C 20.D
r.
VocabularyforKPDS&DSTest17
6.C 16.A
7.B 17.A
8.E 18.C
9.D 19.B
10.A 20.D
3.C
13.A 23.A
3.D
13.B
23.C
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
VocabularyforKPDS&DSTest18 4.A 5.D 6.B 7.E 8.A 9.C 10.D 14.C 15.D 16.E 17.D 18.B 19.A 20.C 24.E 25.D VocabularyforKPDS&DSTest19 4.B 5.C 6.B 7.E 8.A 9.C 10.D 14.A 15.E 16.D 17.A 18.C 19.D 20.C 24.C 25.E VocabularyforKPDS&DSTest20 4.A 14.B 24.C 5.D 15.D 25.A 6.E 16.A 7.C 17.E 8.D 18.A 9.A 19.C 10.E 20.D
r.
VocabularyforKPDS&DSTest21
6.A 16.B
7.E 17.D
8.D 18.E
9.B 19.A
10.A 20.D
3.A
13.D 23.A
3.B
13.A
23.D
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
VocabularyforKPDS&DSTest22 4.B 5.D 6.B 7.D 8.E 9.A 10.E 20.B 14.B 15.C 16.B 17.E 18.D 19.C 24.A 25.E VocabularyforKPDS&DSTest23 4.D 5.B 6.D 7.A 8.C 9.D 10.C 20.C 14.E 15.C 25.C 16.E 17.D 18.A 19.B 24.A VocabularyforKPDS&DSTest24 4.E 14.E 24.B 5.C 15.B 25.A 6.D 16.C 7.A 17.D 8.C 18.A 9.B 19.C 10.E 20.E
r.
VocabularyforKPDS&DSTest25
6.C 16.B
7.E 17.D
8.C 18.A
9.A 19.E
10.B 20.C
3.A
13.C 23.C
3.C
13.A 23.A
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
VocabularyforKPDS&DSTest26 4.C 5.C 6.B 7.A 8.B 9.B 10.B 14.B 15.C 25.E 16.A 17.B 18.C 19.B 20.B 24.C VocabularyforKPDS&DSTest27 4.E 5.B 6.A 7.C 8.D 9.A 10.D 20.B 14.B 15.B 16.E 17.E 18.A 19.C 24.C 25.D VocabularyforKPDS&DSTest28 4.B 14.C 24.B 5.A 15.E 25.E 6.A 16.E 7.E 17.B 8.D 18.B 9.D 19.E 10.C 20.D
r.
VocabularyforKPDS&DSTest29
6.E 16.A
7.A 17.A
8.E 18.C
9.A 19.C
10.A 20.E
3.C
13.A
23.C
3.A
13.E
23.A
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
VocabularyforKPDS&DSTest30 4.C 5.A 6.D 7.D 8.E 9.A 10.A 14.E 15.C 25.E 16.E 17.C 18.E 19.A 20.D 24.D VocabularyforKPDS&DSTest31 4.C 5.E 6.C 7.A 8.B 9.E 10.B 14.C 15.C 16.A 17.E 18.D 19.B 20.B 24.A 25.A VocabularyforKPDS&DSTest32 4.C 14.E 24.A 5.B 15.B 25.D 6.B 16.A 7.A 17.E 8.D 18.C 9.C 19.B 10.A 20.C
r.
VocabularyforKPDS&DSTest33
6.D 16.D
7.E 17.C
8.E 18.B
9.D 19.C
10.D 20.D
3.C
13.C 23.B
3.B
13.D 23.E
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
VocabularyforKPDS&DSTest34 4.A 5.D 6.B 7.A 8.A 9.E 10.D 14.B 24.B 15.E 16.B 17.E 18.C 19.D 20.E 25.A VocabularyforKPDS&DSTest35 4.E 5.B 6.D 7.C 8.A 9.D 10.E 14.E 15.B 16.B 17.E 18.B 19.A 20.A 24.A 25.C VocabularyforKPDS&DSTest36 4.C 14.C 24.D 5.E 15.A 25.E 6.A 16.E 7.A 17.A 8.E 18.D 9.D 19.D 10.D 20.E
r.
VocabularyforKPDS&DSTest37
6.A 16.A
7.B 17.C
8.E 18.C
9.C 19.A
10.D 20.D
3.D
13.C 23.E
3.E
13.D
23.B
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
VocabularyforKPDS&DSTest38 4.B 5.E 6.B 7.A 8.B 9.D 10.E 14.D 24.C 15.C 25.E 16.B 17.D 18.A 19.C 20.B VocabularyforKPDS&DSTest39 4.B 5.C 6.E 7.B 8.C 9.B 10.E 14.E 15.A 16.E 17.B 18.E 19.A 20.A 24.C 25.C VocabularyforKPDS&DSTest40 4.E 14.B 24.E 5.A 15.A 25.E 6.B 16.D 7.E 17.A 8.C 18.A 9.D 19.D 10.B 20.B
r.
VocabularyforKPDS&DSTest41
6.B 16.B
7.A 17.A
8.A 18.B
9.A 19.E
10.A 20.C
3.E
13.C 23.D
3.D
13.E
23.C
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
VocabularyforKPDS&DSTest42 4.C 5.C 6.C 7.C 8.B 9.C 10.A 14.B 15.D 25.B 16.C 17.E 18.D 19.C 20.D 24.A VocabularyforKPDS&DSTest43 4.A 5.A 6.A 7.C 8.C 9.A 10.B 14.D 15.D 25.E 16.B 17.A 18.C 19.B 20.E 24.A VocabularyforKPDS&DSTest44 4.A 14.C 24.A 5.D 15.B 25.C 6.C 16.B 7.C 17.C 8.B 18.D 9.D 19.A 10.E 20.C
r.
VocabularyforKPDS&DSTest45
6.B 16.A
7.A 17.D
8.A 18.C
9.D 19.E
10.B 20.C
3.B
13.D 23.A
3.A
13.B
23.C
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
VocabularyforKPDS&DSTest46 4.D 5.C 6.C 7.D 8.C 9.A 10.B 14.B 15.D 16.D 17.A 18.E 19.D 20.A 24.B 25.B VocabularyforKPDS&DSTest47 4.C 5.C 6.D 7.D 8.B 9.C 10.D 14.D 15.D 25.A 16.A 17.A 18.D 19.C 20.B 24.A VocabularyforKPDS&DSTest48 4.E 14.A 24.B 5.D 15.E 25.C 6.E 16.D 7.E 17.A 8.B 18.C 9.B 19.E 10.A 20.A
r.
VocabularyforKPDS&DSTest49
6.B 16.A
7.A 17.E
8.A 18.E
9.D 19.A
10.C 20.D
3.E
13.E 23.E
3.E
13.C
23.D
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
VocabularyforKPDS&DSTest50 4.C 5.C 6.B 7.B 8.A 9.B 10.D 20.A 14.B 15.C 16.E 17.D 18.A 19.B 24.B 25.A VocabularyforKPDS&DSTest51 4.C 5.B 6.B 7.B 8.E 9.B 10.E 14.A 15.E 16.A 17.B 18.E 19.D 20.E 24.A 25.B VocabularyforKPDS&DSTest52 4.C 14.A 24.B 5.C 15.C 25.C 6.C 16.E 7.E 17.C 8.C 18.B 9.D 19.C 10.B 20.A
r.
VocabularyforKPDS&DSTest53
6.E 16.A
7.A 17.E
8.A 18.A
9.E 19.E
10.E 20.D
3.D
13.C 23.E
21.E
22.C
11.C
12.D
r.
1.B
2.B
3.E
13.D
23.C
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
VocabularyforKPDS&DSTest54 4.A 5.E 6.E 7.C 8.D 9.D 10.B 14.B 15.B 16.E 17.C 18.A 19.E 20.C 24.C 25.A VocabularyforKPDS&DSTest55 4.A 5.B 6.D 7.A 8.C 9.E 10.C 14.E 15.D 25.A 16.E 17.C 18.B 19.D 20.C 24.E VocabularyforKPDS&DSTest56 4.B 14.C 24.B 5.A 15.D 25.B 6.B 16.E 7.C 17.E 8.E 18.B 9.E 19.A 10.E 20.B
VocabularyforKPDS&DSTest57
6.D 16.C
7.A 17.A
8.D 18.B
9.A 19.E
10.A 20.B
3.E
13.E
23.D
3.E
13.B
23.A
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
VocabularyforKPDS&DSTest58 4.D 5.D 6.A 7.D 8.E 9.D 10.A 14.D 15.C 16.A 17.E 18.A 19.B 20.B 24.E 25.B VocabularyforKPDS&DSTest59 4.A 5.C 6.A 7.D 8.D 9.A 10.B 14.A 15.A 16.E 17.E 18.A 19.C 20.A 24.D 25.D VocabularyforKPDS&DSTest60 4.E 14.E 24.D 5.A 15.C 25.B 6.A 16.C 7.A 17.A 8.A 18.A 9.D 19.D 10.C 20.E
r.
VocabularyforKPDS&DSTest61
6.C 16.D
7.A 17.E
8.C 18.E
9.E 19.A
10.D 20.C
3.C
13.A 23.E
3.E
13.C 23.B
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
VocabularyforKPDS&DSTest62 4.E 5.B 6.A 7.C 8.E 9.E 10.D 14.B 15.B 16.E 17.B 18.A 19.C 20.B 24.C 25.C VocabularyforKPDS&DSTest63 4.C 5.E 6.C 7.C 8.A 9.B 10.D 14.D 24.C 15.B 16.A 17.D 18.E 19.A 20.B 25.B VocabularyforKPDS&DSTest64 4.E 14.A 24.E 5.E 15.B 25.B 6.E 16.A 7.D 17.E 8.C 18.A 9.C 19.D 10.D 20.B
r.
VocabularyforKPDS&DSTest65
6.A 16.D
7.A 17.A
8.A 18.D
9.C 19.A
10.E 20.A
3.D
13.E 23.E
3.A
13.C
23.D
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
VocabularyforKPDS&DSTest66 4.B 5.E 6.A 7.E 8.E 9.C 10.B 14.E 15.B 16.B 17.B 18.E 19.B 20.A 24.D 25.A VocabularyforKPDS&DSTest67 4.B 5.B 6.E 7.A 8.B 9.A 10.D 14.E 15.E 16.A 17.B 18.C 19.A 20.A 24.B 25.B VocabularyforKPDS&DSTest68 4.E 14.A 24.D 5.C 15.B 25.B 6.D 16.C 7.E 17.E 8.E 18.D 9.E 19.A 10.D 20.C
r.
VocabularyforKPDS&DSTest69
6.C 16.A
7.E 17.D
8.E 18.B
9.E 19.B
10.A 20.D
3.E
13.C 23.B
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
VocabularyforKPDS&DSTest70 4.C 5.E 6.C 7.C 8.D 9.B 10.B 14.D 15.D 25.E 16.E 17.D 18.D 19.D 20.E 24.D
r.
SynonymsforKPDS&DSTest1
6.A 16.A
7.E 17.B
8.E 18.E
9.C 19.C
10.D 20.C
3.E
13.B
23.A
21.D
22.D
11.D
12.B
r.
1.C
2.A
3.D
13.B
23.D
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
SynonymsforKPDS&DSTest2 4.E 5.E 6.D 7.A 8.E 9.C 10.C 20.B 14.E 24.E 15.B 16.C 17.A 18.E 19.D 25.C SynonymsforKPDS&DSTest3 4.A 5.C 6.B 7.A 8.C 9.C 10.B 20.B 14.D 24.C 15.A 16.B 17.D 18.A 19.B 25.D SynonymsforKPDS&DSTest4 4.C 14.D 24.B 5.A 15.B 25.C 6.A 16.C 7.C 17.A 8.C 18.D 9.D 19.A 10.D 20.D
SynonymsforKPDS&DSTest5
6.A 16.A
7.A 17.D
8.A 18.A
9.A 19.A
10.A 20.B
3.C
13.C 23.B
3.B
13.B
23.C
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
SynonymsforKPDS&DSTest6 4.A 5.A 6.B 7.B 8.A 9.D 10.C 20.A 14.C 24.A 15.A 25.A 16.A 17.D 18.C 19.A SynonymsforKPDS&DSTest7 4.D 5.C 6.B 7.B 8.B 9.A 10.D 20.A 14.B 15.C 25.C 16.C 17.B 18.A 19.D 24.A SynonymsforKPDS&DSTest8 4.B 14.B 24.C 5.B 15.A 25.B 6.B 16.A 7.A 17.C 8.D 18.D 9.B 19.A 10.C 20.D
r.
SynonymsforKPDS&DSTest9
6.B 16.A
7.B 17.C
8.A 18.A
9.B 19.A
10.D 20.C
3.D
13.C 23.C
3.A
13.C 23.D
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
SynonymsforKPDS&DSTest10 4.C 5.B 6.A 7.C 8.A 9.B 10.B 14.B 24.B 15.A 25.A 16.C 17.D 18.D 19.B 20.D SynonymsforKPDS&DSTest11 4.A 5.A 6.B 7.B 8.B 9.B 10.C 14.C 24.C 15.B 16.A 17.C 18.C 19.B 20.A 25.C SynonymsforKPDS&DSTest12 4.B 14.B 24.C 5.A 15.C 25.B 6.C 16.B 7.C 17.A 8.A 18.B 9.C 19.B 10.B 20.A
r.
SynonymsforKPDS&DSTest13
6.A 16.B
7.B 17.C
8.B 18.C
9.D 19.B
10.B 20.C
3.A
13.D 23.B
3.C
r.
13.B
23.D
2.D
3.A
12.C 22.A
13.C 23.B
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
SynonymsforKPDS&DSTest14 4.D 5.C 6.C 7.C 8.C 9.C 10.D 14.B 15.A 16.C 17.A 18.A 19.B 20.A 24.C 25.C SynonymsforKPDS&DSTest15 4.B 5.C 6.A 7.C 8.A 9.C 10.B 14.C 15.C 16.C 17.A 18.B 19.C 20.C 24.B 25.B SynonymsforKPDS&DSTest16 4.D 14.B 24.A 5.D 15.B 25.C 6.C 16.D 7.B 17.A 8.C 18.C 9.A 19.D 10.D 20.B
SynonymsforKPDS&DSTest17
6.B 16.B
7.A 17.A
8.B 18.D
9.C 19.D
10.A 20.D
3.A
13.D
23.C
3.D
r.
13.E 23.B
2.B
12.E 22.B
o H .h ik py ik m ri m e gh et t t sa a hi hin ne e r.c r om
SynonymsforKPDS&DSTest18 4.B 5.C 6.C 7.A 8.D 9.A 10.C 14.D 15.A 16.B 17.A 18.C 19.B 20.B 24.C 25.A SynonymsforKPDS&DSTest19 4.A 5.B 6.C 7.C 8.D 9.D 10.E 14.C 24.C 15.E 16.E 17.B 18.C 19.E 20.B 25.C SynonymsforKPDS&DSTest20 4.A 14.E 24.C 5.D 15.D 25.C 6.D 16.C 7.B 17.D 8.E 18.D 9.C 19.C 10.A 20.A
VOCABULARY
KPDS & DS
KPDSveDSsnavlarnagirenkiilerinngilizcekelime haznesininzenginliibusnavlardakibaarlarnartrmadanemli birroloynamaktadr. Elinizdebulunanbukitaptangilizcekelimehaznenizin gelimesineoknemlikatkdabulunacakKPDSDSkelimeleri, Trkekarlklar,ngilizceeanlamlar,vekelimeleriniinde kullanldrnekcmlelerbulunmaktadr. Yenikelimerenmeninolmazsaolmazartyenikelimeleribir balamiinderenmenizdir.Kelimehaznenizingeliip gelimediinikontroletmekvepratiinizipekitirmekiinkitapta yaklak10.000taneoktansemelisorubulunmaktadr.