Professional Documents
Culture Documents
Lecture Notes For Methods in Cell Biology - Wiser PDF
Lecture Notes For Methods in Cell Biology - Wiser PDF
95% confidence interval
counts 1.96(counts)
40
upon total number of disintegrations observed (Box). The proportional error at a 95%
confidence level is defined by 1.96(counts)
2
r and F
f
= -fv
where m
o
= the mass of the displaced solution, f = frictional coefficient and v = velocity of the
particle. The particle will move at a velocity such that the total force equals 0, thus:
F
c
+ F
b
+ F
f
= 0, or m
2
r - m
o
2
r - fv = 0
substituting m
s
= m
o
, where = partial specific volume of the particle and
s
= density of the
solvent, and solving for v results in:
v =
2
rm(1 -
s
)/f =
2
rm(
p
-
s
)/f
This equation (expressed in the two different forms) tells us several things about sedimentation:
1. The more massive a particle, the faster it moves in a centrifugal field
2. The denser a particle (i.e., the smaller its ) the faster in moves in a centrifugal field.
Ultracentrifuge
Analytical
Preparative
High Speed
Table Top
Clinical
Microfuges
Centrifugal Force
54
3. The denser the solution, the slower the particle will move in a centrifugal field.
4. The greater the frictional coefficient (factors such as viscosity, particle shape, etc.
influence this parameter), the slower the particle will move.
5. The particle velocity is 0 when the solution density is greater than the particle density.
6. The greater the centrifugal force (
2
r) the faster the particle sediments.
The velocity per unit force will be defined as the sedimentation coefficient (s), or:
s = v/
2
r = m(1 -
s
)/f
When mass is expressed in g and f in g/sec s ranges from 10
-13
to 10
-11
sec. This is normally
expressed in Svedberg (S) units where 1 S = 10
-13
sec. The higher the S value, the faster that
particle will sediment. For example, subcellular compartments and macromolecules have
sedimentation coefficients which reflect their size, shape and density (Figure).
The sedimentation coefficient is determined by measure the velocity of a particle in a
known centrifugal field. S units need to be normalized according to the composition of the
medium. Sedimentation coefficients are usually determined with an analytical ultracen-
trifugation, also referred to as a model E ultracentrifuge. The rotor in the model E centrifuge
allows the sample to be monitored spectrophotometrically as the sample is centrifuging. As
the sample migrates in the centrifugal field the absorbance across the chamber will change.
The sedimentation rate can be calculated from this change in absorbance. In addition,
physical characteristics (such as size, density and shape) of a particle, or molecule, can be
55
determined from the sedimentation rate of a particle in a
medium of known composition.
PREPARATIVE CENTRIFUGATION
The centrifuge is used most often in the biological
sciences to collect material or to separate particles based upon
their sedimentation properties. Preparative centrifugation
takes advantage of the fact that more massive particles will
sediment faster than less massive particles. For example,
organelles and other subcellular components can be isolated
by differential centrifugation (Figure). Differential centrifuga-
tion is carried out by centrifuging a sample at low speed and
separating the supernatant and pellet. The supernatant is then
recentrifuged at higher speed and the supernatant and pellet
separated again.
Sedimentation of a particular particle is dependent
upon the RCF (see box) and how long the centrifugal force is applied. Samples must be
centrifuged long enough for the particles at the top of the tube to reach the bottom. The size and
shape of the centrifuge tube will also affect the centrifugation time. In addition, there is a
difference in the RCF between the top and bottom of the tube. These factors need to be taken
into consideration when scaling up from small pilot experiments carried out in small centrifuge
tubes into large scale experiments. The term gmin refers to the product of the minutes a sample
is centrifuged and the g-force. In general, assuming that the sizes and dimensions of the
centrifuge tubes are similar, the product of the g-force and the time of centrifugation can be
used to determine the conditions needed to to completely sediment a particle. For example, if it
takes 60 min to completely sediment a particle at 1000 x g, then it should only take 10 min to
sediment the same particle at 6000 x g.
Relative centrifugal force (RCF) is defined as the
ratio of the centrifugal force to the force of gravity:
RCF = F
c
/F
g
=
2
r/980
(expressed in radians/sec) is converted to
revolutions per minute (rpm) by substituting =
(rpm)/30, resulting in:
RCF = 1.119 x 10
-5
(rpm)
2
r
where r is expressed in cm. RCF units are expressed
as "x g". (See appendix for nonograph.)
56
Centrifugation Through Density Gradients
Fast sedimenting particles will be contaminated with slow
sedimenting particles. The reason for this is that by the time large particles
near the top of the tube are pelleted, some of the small particles near the
bottom of the tube have also pelleted. In addition, mechanical vibrations,
thermal gradients and convection currents can also affect the sedimentation
properties. Centrifugation through a dense medium, or density gradient centrifugation, can
partially alleviate these problems. In addition, density gradient centrifugation will allow for
better separation of particles with similar properties. Several different media are commonly
used in density gradient centrifugation depending upon the exact application (Box).
The two types of density gradient centrifugation are rate zonal and isopycnic (or
equilibrium). In rate zonal centrifugation the density of the particles being separated are greater
than the density of the solvent. Separation is based primarily upon size (i.e., larger particles will
sediment faster). It is important to determine the optimal length of centrifugation for separating
the particle of interest. If the centrifuge is not turned off soon enough all of particles will pellet.
In isopycnic centrifugation the solvent density encompasses density of particles. The separation
is based upon particle density. Centrifugation is carried out until equilibrium is reached (i.e., all
particles have banded at densities corresponding to their own).
Density gradients can be preformed or formed during centrifugation. In the case of
isopycnic density gradients it is possible to mix the sample with the desity gradient medium and
carry out the centrifugation until the density gradient forms. The various components in the
sample will then be found at a position which corresponds to their density. This is especially
useful in the case of Percoll which rapidly forms density gradients when subjected to
centrifugation. Another common example in which self-forming gradients are commonly used
is the separation of nucleic acids on CsCl gradients (see Nucleic Acid Struction and Isolation).
Preforming the gradients before centrifugation decreases the amont of time and centri-
fugal force needed to reach equilibrium. In the case of rate zonal density gradients it is
necessary to use preformed gradients. Gradient makers are used to produce continuous
gradients, or step-wise gradients can be prepared by layering successive solutions of lesser
density. Samples are layered onto the gradients and subjected to centrifugation. In the case of
isopycnic gradients the sample can also be underlaid at the bottom of the tube and the various
particles will 'float' to their correct densities during centrifugation. Following centrifugation the
gradient is divided into fractions corresponding to different densities and analyzed.
Sucrose
CsCl
Ficoll
Hypaque
Percoll
57
The fractions are analyzed for the
component(s) of interest and if needed the
densities of the various frations can be
determined. One method of determining
the density is to measure the refractive
index of the fractions and to then calculate
the densities based on a standard curve
prepared from solutions of known density
made with the same medium of the desity
gradients (eg., sucrose, etc.). Another
method of determining the density is to
prepare an identical gradient with 'marker
beads' of known density. These marker beads are different colors and the position in the
gradient is determined by measuring the distance from the top of the tube or determining
which fraction they are associated with. This can then be use to estimate the range of
densities in the other tubes containing sample. In subcellular fractionation experiments the
various organelles can be evaluated by measuring components (eg., enzymes) known to be
exclusively associated with the various subcellular compartments. This will identify the
fraction(s) containing the organelle of interest as well as provide information about
contamination with other organelles.
Subcellular Fractionation
and Marker Enzymes
Organelle Marker
nuclei DNA
mitochondria cytochrome oxidase
lysosome hydrolases
peroxisome catalase
Golgi -mannosidase
plasma membrane adenylate cyclase
cytosol lactate dehydrogenase
58
CENTRIFUGATION APPENDIX 1. RCF CALCULATION
The relative centrifugal force (RCF) can be calculated from the following equation:
RCF = (1.119 x 10
-5
)(rpm)
2
(r)
where rpm is the speed of rotation expressed in revolutions per minute and r (radius) is the
distance from the axis expressed in cm. The RCF units are "x g" where g represents the force of
gravity. RCF can also be determined from the nomograph below. Place a straight edge to
intersect the radius and the desired RCF to calculate the needed rpm. Alternatively place the
straight edge on the radius and the rpm to calculate the g-force. For example, spinning a sample
at 2500 rpm in a rotor with a 7.7 cm radius results in a RCF of 550 x g.
59
PART II
Analysis and Characterization of
Proteins
Topics covered:
Protein Structure and Assays
Differential Solubility
Chromatography
Membranes and Detergents
Electrophoresis
Overview on Protein Purification
61
CHAPTER 7--INTRODUCTION TO PROTEINS
Proteins typically make up more than half the dry weight of cells. They contribute to the
structure of a cell and are responsible for cellular functions such as catalysis and molecular
recognition.
PROTEIN STRUCTURE
Proteins are polymers of L--amino acids. The refers
to a carbon with a primary amine, a carboxylic acid, a hydrogen
and a variable side-chain group, usually designated as 'R'.
Carbon atoms with four different groups are asymmetric and
can exhibit two different arrangements in space due to the
tetrahedral nature of the bonds. The L refers to one of these two
possible configurations the four different groups on the -
carbon can exhibit. Amino acids of the D-configuration are not
found in proteins and do not participate in biological reactions.
Twenty different amino acids, distinguished by their side-chain
groups, are found in proteins (Box). The side-chain groups vary
in terms of their chemical properties such as polarity, charge and size. These various side-chain
groups will influence the chemical properties of proteins as well as determine the overall
structure of the protein (see Appendix). For example, the polar amino acids tend to be on the
outside of the protein where they interact with water and the nonpolar amino acids are on the
inside forming a hydrophobic core.
The covalent linkage between two amino acids
is known as a peptide bond. A peptide bond is formed
when the amino group of one amino acid condenses
with the carboxyl group of another amino acid to form
an amide (Figure). This arrangement gives the
polypeptide chain a polarity in that one end will have a
free amino group, called the N-terminus, and the other
end will have a free carboxyl group, called the C-
terminus.
Peptide bonds tend to be planar which gives
the polypeptide backbone some rigidity. However,
rotation can occur around both of the -carbon bonds
resulting in a polypeptide backbone with different potential conformations in regards to the
relative positions of the R-groups. (Conceptually this can be viewed as the R-groups projection
into or out from the page in the figure.) Although many conformations are theoretically
possible, interactions between the R-groups will limit the number of potential conformations
and proteins tend to only fold into a single functional conformation. In other words, the confor-
mation or shape of the protein is due to the interactions of the side-chain groups with one
another and with the polypeptide backbone. The interactions can be between amino acids that
L--AMINO ACIDS
Nonpolar Polar
Alanine Arginine
Glycine Asparagine
Isoleucine Aspartic a.
Leucine Cysteine
Methionine Glutamic a.
Phenylalanine Glutamine
Proline Histidine
Tryptophan Lysine
Valine Serine
Threonine
Tyrosine
62
are close together in a polypeptide or between amino acids that are far apart or even on
different polypeptides. These different types of interactions are often discussed in terms of
primary, secondary, tertiary and quaternary protein structure (Table).
Levels of Protein Structure
Primary
Refers to the amino acid sequence and the location of disulfide
bonds between cysteine residues (i.e., covalent bonds).
Secondary
Refers to interactions between amino acids that are close
together (eg., -helix, -sheet, -turn, random coil).
Tertiary
Refers to interactions between amino acids that are far apart
(eg., motifs, domains).
Quaternary
Refers to interactions between two or more polypeptide chains
(i.e., protein subunits).
The primary amino acid sequence and positions of disulfide bonds strongly influence
the overall structure of protein. In regarads to the primary amino acid sequence, certain side-
chains will permit, or promote, hydrogen-bonding between neighboring amino acids of the
polypeptide backbone resulting in secondary structures such as -sheets or -helices. Alterna-
tively, certain R-groups may interfere with each other and prevent certain conformations.
In the -helix conformation the peptide backbone takes on a 'sprial staircase' shape
which is stabilized by H-bonds between carbonyl and amide groups of every fourth amino acid
residue. This restricts the rotation of the bonds in the peptide backbone resulting in a rigid
structure. -sheets are also rigid structures in which the polypeptide chain is nearly fully
extended with the R-groups alternating between pointing up and down. -sheets interact either
in parallel (both with same orientation in regards to N- and C-termini) or anti-parallel fashion.
Certain amino acids promote the formation of either -helices or -sheets due to the nature of
the side-chain groups. Some side-chain groups may prevent the formation of secondary
structures and result in a more flexible polypeptide backbone, which is often called random coil
conformation.
The other aspect of primary protein
structure is the position of disulfide bonds. The
amino acid cysteine has a free thiol group that
can be oxidized to form a covalent bond with
another cysteine (Figure). These disulfide bonds
can form between cysteine residues that are relatively close or far apart within a single polypep-
tide chain, or even between separate polypeptide subunits with a protein. In this regard,
disulfide bonds can contribute to secondary, tertiary and quaternary aspects of protein structure.
Proteins containing disulfide bonds will be sensitive to reducing agents (such as -mercapto-
ethanol) which can break the disulfide bond.
The various secondary structures can interact with other secondary structures within the
same polypeptide to form motifs or domains (i.e., tertiary structure). A motif is a common
combination of secondary structures and a domain is a portion of a protein that folds
independently. The tertiary structure will represent the overall three dimensional shape of a
63
polypeptide. A typical protein structure is a compact entity composed of the various secondary
structural elements with protruding loops of
flexible (ie, random coil) sequence. This is often
depicted in a ribbon diagram (Figure) in which -
sheets are drawn as flat arrows with the arrowhead
representing the N-terminal side and -helices are
drawn as flat spirals. The flexible loops are repre-
sented by the strings connecting the secondary
structural elements.
Many proteins are composed of multiple subunits,
or distinct polypeptide chain that interact with one
another. This is referred to as quaternary structure.
PROTEIN STABILITY
Proteins are often fragile molecules
that need to be protected during purifi-
cation and characterization. Protein dena-
turation refers the loss of protein structure
due to unfolding. Maintaining biological
activity is often important and protein
denaturation should be avoided in those
situations. Elevated temperatures, extremes in pH, and changes in chemical or physical
environment can all lead to protein denaturation (Table). In general, things that destabilize H-
bonding and other forces that contribute to secondary and tertiary protein structure will promote
protein denaturation. Different proteins exhibit different degrees of sensitivity to denaturing
agents and some proteins can be re-folded to their correct conformations following
denaturation.
Factors Affecting Protein Stability
Factor Possible Remedies
temperature Avoid high temperatures. Keep solutions on ice.
freeze-thaw
Determine effects of freezing. Include glycerol in buffers. Store in
aliquots.
physical
denaturation
Do not shake, vortex or stir vigorously. (Protein solutions should
not foam.)
solution effects Mimic cellular environment: neutral pH, ionic composition, etc.
dilution effects Maintain protein concentrations > 1 mg/ml as much as possible.
oxidation Include 0.1-1 mM DTT (or -ME) in buffers.
heavy metals Include 1-10 mM EDTA in buffers.
microbial growth Use sterile solutions, include anti-microbials, and/or freeze.
proteases Include protease inhibitors. Keep on ice.
The optimal conditions for maintaining the stability of each individual protein need to
64
be determined empirically. In general, though, protein solutions should be kept cold (< 4
o
C)
except during assays and other procedures requiring specific temperatures. Many proteins are
especially labile and need to be stored at -20
o
or -80
o
. However, repeated freezing and thawing
of protein solutions is often deleterious. Adding 50% glycerol to storage buffers will lower the
freezing point and allow storage at -20
o
. Solutions for working with proteins will often contain
heavy-metal chelators and/or antioxidants as protectants.. In addition, proteases may be released
during cell disruption and it may therefore be necessary to include protease inhibitors.
PROTEIN ASSAYS
Numerous spectrophotometric methods have been developed to estimate the amount of
protein in a sample. Proteins are chromophores with absorption maximum in the UV range.
Some proteins, such as cytochromes and hemoglobin, will have distinct spectral characteristics
due to prosthetic groups. In addition, several indirect ways to measure protein concentrations
spectrophotometrically have been developed.
UV Absorption
A simple method to measure protein concentration is to determine the absorption at 280
nm. Tyrosine and tryptophan residues which have A
max
at 275 and 280, respectively, are
responsible for this absorption. The distribution of tyrosine and tryptophan is fairly constant
among proteins so it is not absolutely necessary to determine an extinction coefficient for each
individual protein. Typically, a 1 mg/ml protein solution will result in an A
280
of approximately
one (1). In the case of purified proteins the exact extinction coefficient will depend on the exact
amount of tyrosine and tryptophan in that particular protein. For example, a 1 mg/ml IgG
solution has an A
280
of approximately 1.5. The simplicity and ability to completely recover the
sample are the major advantages of this method. The lower limit of sensitivity for UV
absorption is 5-10 g/ml.
A potential problem with using A
280
values to calculate protein concentration is the
absorption due to contaminating substances, and in particular, nucleic acids which have an A
max
at 260 nm. It is possible to use correction factors that permit the determination of protein
concentrations. A particularly convenient formula is:
(A
235
- A
280
)/2.51 = mg/ml protein.
Indirect spectrophometric assays (eg., Lowry, Bradford) for the determination of protein
concentrations overcome some of the problems associated with interfering substances in protein
samples. However, the measured protein cannot be recovered in such assays and they take
longer to perform.
Folin-Ciocalteu or Lowry
Historically, one of the most widely used protein assays was the Lowry assay. This
assay is a modification of a previous assay known as the Biuret. In the Lowry assay proteins
65
react with alkaline Cu
2+
reducing it to Cu
+
. The reduced Cu
+
and the side-chain (R) groups of
tryptophan, tyrosine and cysteine react with the Folin-Ciocalteu reagent (complex of inorganic
salts) to form a blue color that is proportional to the amount of protein. The A
600-750
is
determined and protein concentration is calculated from a standard curve. The assay is linear 1-
300 g and the lower limit of sensitivity is 1-5 g/ml. Substances in the sample such as
detergents can interfere with the results and therefore appropriate controls and blanks need to be
carried out.
Bradford or Coomassie Blue G-250
The Bradford assay has replaced the Lowry as the standard protein assay. The major
advantage is that it is carried out in a single step and that there are very few interfering
substances. The principle of the assay is based on a shift of the A
max
of the Coomassie-blue (G-
250) dye from 465 nm to 595 nm in the presence of protein due to a stabilization of the anionic
form of the dye. The dye reacts primarily with arginine residues and to lesser extent with his,
lysine, tyrosine, tryptophan and phenylalanine. Protein concentrations are determined by
developing a standard curve with known amounts of proteins and extrapolating the absorbance
values of the samples. The standard curves are not linear over a wide range of protein
concentrations. This assay can also carried out in 96-well plates and read on automated ELISA
readers. Programs are available that will automatically calculate the protein concentrations
based upon a standard curve.
Assay Of Specific Proteins
In addition to measuring the total amount of protein, it is
often necessary to estimate the amount of a specific protein in a
mixture of proteins. Measuring a specific protein will depend upon
the availability of an assay that is specific for the protein of interest.
Protein assays should be practical in addition to being specific and accurate (Box). Typically
protein assays are based upon the biological activity of the protein of interest. For example,
enzyme assays will detect the conversion of a substrate to a product. Enzymes assays can be
based upon colorimetric, fluorescent or radioactive substrates (or products). Many proteins bind
to ligands or other substances and this binding activity is measured. Bioassays measure a
change in some biological property (eg., stimulation of cell division). In cases where the protein
of interest has no measurable activity or the activity is unknown it may be possible to generate
antibodies against the protein and develop an immunoassay (to be discussed later). If antibodies
against such a protein are not available, the assay may simply be the amount of a protein band
on a Commassie blue-stained gel following electrophoresis (to be discussed later).
Specificity
Sensitivity
Accuracy
(Quantification)
Rapid
Easy to Perform
66
APPENDIX. AMINO ACIDS: PROPERTIES AND STRUCTURE
Proteins are composed of 20 different amino acids which are
distinguished by their side-chain groups, designated as R (see figure at
right). The amino acids are grouped below according to the chemical
nature of their side-chain groups.
Name/Abbreviations R-group Comments
Glycine Gly G -H
The lack of a side chain provides for the
greatest possible conformational
flexibility.
Proline Pro P
The aliphatic side-chain forms a cyclic
imino compound (entire amino acid is
shown). This imposes rigid constraints on
the rotation around the backbone and has
significant affects on protein conformation.
Amino Acids with Aliphatic Side Chains
Alanine Ala A -CH
3
Valine Val V
Leucine Leu L
Isoleucine Ile I
These alkyl side-chain groups are
important for hydrophobic interactions and
provide for a variety of surfaces and
shapes.
Amino Acids with Aromatic Side Chains
Phenylalanine Phe F
Tyrosine Tyr Y
Tryptophan Trp W
The aromatic groups are important for
hydrophobic interactions and may be
especially important for interacting with
other flat molecules.
Amino Acid Alcohols
Serine Ser S -CH
2
OH
Threonine Thr T
The hydroxyl groups are weakly ionizable
(pK
a
~13) and participate as active groups
in some enyzmes.
Acidic Amino Acids
Aspartatic acid Asp D
Glutamatic
acid
Glu E -CH
2
CH
2
CO
2
H
These side-chain groups are generally
negatively charged at neutral pH (pK
a
=
4.3-4.7).
67
Amides of the Acidic Amino Acids
Asparagine Asn N
Glutamine Gln Q -CH
2
CH
2
CONH
2
These side-chain groups do not ionize, but
are relatively polar.
Basic Amino Acids
Histidine His H
The imidazole group participates in the
active site of many enzymes, as well as
binding metal ions.
Lysine Lys K -CH
2
CH
2
CH
2
CH
2
NH
2
Arginine Arg R
These side-chain groups are generally
positively charged at neutal pH (pK
a
>10).
Sulfur Containing Amino Acids
Cysteine Cys C
-CH
2
SH
-CH
2
S-
SCH
2
-
Cysteines participate in redox reactions
and can form disulfide links between two
residues (i.e., oxidized state).
Methionine Met M -CH
2
CH
2
SCH
3
Met is rather hydrophobic, but the
thioether group is a potent nucleophile.
Other Abbreviations
Asp or Asn Asx B
Glu or Gln Glx Z
The amides are converted to the acids by the procedures used to
identify and quantify amino acid residues. Therefore they are
designated as either in such situations..
Any amino
acid
Xaa X Used when the amino acid is unknown or does not matter.
69
CHAPTER 8--DIFFERENTIAL PRECIPITATION OF PROTEINS
Proteins are responsible for many aspects of cell function and structure. To learn more
about their precise roles in cellular biology it is often necessary to analyze purified proteins. A
protein of interest can be separated from other proteins based upon its unique physical and
chemical properties. The first step in protein isolation is to extract the protein from the tissue or
cell in a soluble form. In some cases it is desirable to first disrupt the cell and to isolate the
appropriate subcellular compartment before solubilizing the protein. Generally, cytosolic
proteins are found in the supernatant following cell disruption and centrifugation at 100,000 xg
for 30-60 min. Membrane proteins or proteins associated with organelles will require additional
solubilization techniques such as detergents or chaotropic agents (see Chapter 10).
Proteins are soluble in aqueous solutions because the charged and polar side-chain
groups of the amino acids interact with water. In other words, proteins become hydrated. If the
protein-solvent interaction is prevented, proteins will interact with one another and form
aggregates that precipitate out of solution. Different proteins will behave differently in terms of
interacting with either the solvent or other protein molecules. Therefore it is possible to separate
different proteins based upon different solubility properties. For example, as the salt
concentration of a solution is increased the amount of water that is available to interact with
proteins is decreased. This will result in the more hydrophobic domains of proteins interacting
with hydrophobic domains of other proteins. The interacting proteins will form large masses, or
a precipitate, that can be collected by centrifugation. Proteins with a larger proportion of
hydrophobic amino acid residues exposed on their surface will be more sensitive to effects of
salts than highly charged proteins. Therefore, it is possible to selectively precipitate some
proteins under conditions where other proteins remain soluble. One of the most common salts
used for this differential precipitation of proteins is (NH
4
)
2
SO
4
.
PROCEDURE FOR (NH
4
)
2
SO
4
PRECIPITATION.
A common method for differentially precipitating proteins is by 'salting-out' with
(NH
4
)
2
SO
4
. As the (NH
4
)
2
SO
4
is added, H
2
O molecules interact with the salt ions, thus
decreasing the amount of water available to bind to protein. Proteins are differentially precipi-
tated by (NH
4
)
2
SO
4
due to their differences in hydrophobicity. A more hydrophobic protein will
precipitate at a lower salt concentration than a more hydrophilic protein.
1. The (NH
4
)
2
SO
4
is slowly added to a protein solution while gently stirring. The amount to
add to precipitate the protein of interest will have to be initially determined empirically. The
concentration of (NH
4
)
2
SO
4
needed to precipitate a particular protein in usually expressed
as a percent of saturated (NH
4
)
2
SO
4
. Either solid or a saturated solution can be added. For
large volumes, adding solid is more convenient.
2. Once dissolved, the (NH
4
)
2
SO
4
/protein suspension is allowed to slowly stir (usually while
kept cold) until equilibrium is reached. This is typically for one hour, however, some
proteins require overnight incubations. The precipitated protein are collected by centri-
fugation. Typically 10,000 xg for 10 minutes is sufficient to pellet precipitated proteins.
70
3. The protein pellet is dissolved in the buffer of interest and the remaining (NH
4
)
2
SO
4
is
removed by either dialysis or desalting column. Dialysis tubing has defined pore size which
allows small molecules to pass through freely while retaining larger molecules. Multiple
buffer changes accelerates the process.
(NH
4
)
2
SO
4
precipitation can also be
carried out as a two-step procedure. The maxi-
mum amount of (NH
4
)
2
SO
4
that does not precip-
itate the protein of interest is added and this
pellet is discarded. (NH
4
)
2
SO
4
is then added to
the supernatant to bring the concentration to the
minimal % saturation that completely precipi-
tates the protein of interest. Nomograms for
calculating the amounts of (NH
4
)
2
SO
4
needed to
achieve the desired percent saturation are avail-
able (see appendix). The pellet is retained and
the supernatant discarded at this step.
Another variation of (NH
4
)
2
SO
4
precipitation is 'back extraction'. In this case the
total protein is precipitated with 80-90% saturated (NH
4
)
2
SO
4
and the pellet is extracted
with the appropriate (NH
4
)
2
SO
4
concentration to solubilize the protein of interest.
OTHER PROTEIN PRECIPITATION METHODS
Organic solvents can also be used to differentially
precipitate proteins. Water miscible solvents (eg., acetone,
ethanol, methanol) are mixed with an aqueous solution. As the water molecules interact with
the organic solvent molecules less water is available for hydration and proteins will
differentially precipitate as in the case of added salts.
Proteins also tend to precipitate out at high temperatures or at extreme pH values.
Proteins will differentially denature under conditions of high temperature or extreme pH. The
unfolded, or denatured, proteins will have hydrophobic residues exposed and will aggregate.
Most of the time precipitation with high temperatures or acidic pH results in precipitated
protein which can not be resolubilized. However, it is possible to remove unwanted proteins in
cases where the protein of interest is acid or heat stable.
salt (eg, (NH
4
)
2
SO
4
solvents
acidic pH
high temperature
71
APPENDIX. AMMONIUM SULFATE NOMOGRAM
Final Concentration of Ammonium Sulfate (% saturation)
20 25 30 35 40 45 50 55 60 65 70 75 80 90
Grams of solid (NH
4
)
2
SO
4
to be added to 1 liter of solution.
0 114 144 176 209 243 277 313 351 390 430 472 516 561 662
20 29 59 91 123 155 189 225 262 300 340 382 424 520
25 30 61 93 125 158 193 230 267 307 348 390 485
30 30 62 94 127 162 198 235 273 314 356 449
35 31 63 94 129 164 200 238 278 319 411
40 31 63 97 132 168 205 245 285 375
45 32 65 99 134 171 210 250 339
50 33 66 101 137 176 214 302
55 33 67 103 141 179 264
60 34 69 105 143 227
65 34 70 107 190
70 35 72 153
75 36 115
I
n
i
t
i
a
l
C
o
n
c
e
n
t
r
a
t
i
o
n
o
f
A
m
m
o
n
i
u
m
S
u
l
f
a
t
e
(
%
s
a
t
u
r
a
t
i
o
n
)
80 77
Nomogram for determining the amount of ammonium sulfate which will yield the desired %
saturation of (NH
4
)
2
SO
4
. A saturated (NH
4
)
2
SO
4
solution is 4.1 M and 3.9 M at 25
o
and 0
o
,
respectively. Find the appropriate initial and desired final concentrations of (NH
4
)
2
SO
4
on
the vertical and horizontal scales, respectively. The point of intersection is the number of
grams needed per liter of solution. Multiply this number by the number of liters and add that
amount of (NH
4
)
2
SO
4
to the solution. (Modified from Methods of Enzymology 1:76).
Example: you have 100 ml of protein solution and would like to remove the proteins
precipitate at 35% saturation (NH
4
)
2
SO
4
and collect the remaining proteins precipitated at
60%. Add 20.9 grams of (NH
4
)
2
SO
4
to the 100 ml. Centrifuge at 10,000 x g for 10-20
minutes, discard the pellet and determine the volume of the supernatant. Multiply 164 by the
volume in liters and add that number of grams of (NH
4
)
2
SO
4
to the solution. Centrifuge as
above, discard the supernatant and dissolve the pellet in appropriate volume of buffer.
73
CHAPTER 9--CHROMATOGRAPHY
Grossly dissimilar molecules are relatively easy to separated. For example, lipids,
proteins and DNA can usually be separated from one another based on differences in solubility
in various solvents. Separation of substances with similar chemical and physical properties is
more complex and subtle. Although individual proteins are unique in terms of their structures,
the overall chemical and physical properties are somewhat similar in that they are all polymers
of amino acids. Therefore differential solubility has a limited ability to separate proteins.
Chromatography provides a means to refine the separation of substances.
BASIC PRINCIPALS
The basis of chromatography is to place substances to be separated into a system with
two phases: a mobile phase and a stationary phase. Substances are then separated based upon
their differential interaction with these two phases as the mobile phase moves across the
stationary phase. In the case of liquid chromatography the mobile phase is a solvent. Molecules
of interest (called the solute) are dissolved in the solvent and the solvent then flows across a
solid matrix (i.e., the stationary phase). Solutes interact with the stationary phase by reversibly
binding to the stationary phase. The strength of the binding between the solute and the
stationary phase will determine how fast the solute is carried by the mobile phase. For example,
substances which do not bind or interact with the solid phase will be carried unimpeded by the
solvent. Whereas substances that interact with the solid phase will be temporarily retained.
Therefore two substances that interact with the solid phase to different degrees can be separated
from one another.
In most applications the mobile phase is liquid. The major exception is gas-liquid
chromatography in which the mobile phase is a gas and the stationary phase is a liquid absorbed
to a solid support. In liquid chromatography, the stationary phase can be in a column
configuration or in a thin layer. The column is probably the most common way to hold the solid
support and is especially convenient for preparative work such as the isolation of the solute. In
particular, proteins are generally isolated by column chromatography. The column is a cylinder
or tube which holds the solid phase matrix and the liquid phase is passed through this column.
There are several distinct types of solid phases used in the isolation and analysis of
proteins (see Table). These various types of solid supports will separated proteins based upon
different chemical and physical properties (discussed below).
CHROMATOGRAPHY DISCRIMINATION
Ion Exchange Charge
Gel Filtration Size and Shape
Hydrophobic Surface Hydrophobicity
Reverse Phase Total Hydrophobicity
Affinity Specific Amino Acids
Adsorption Amino Groups?
74
EQUIPMENT
The equipment needed for column chromatography can range from expensive
workstations to pasteur pipettes. The central component is the column. A pump may be needed
to control the flow rate of buffers through the column. However, gravity can also be used. The
solvent used in the mobile phase will often need to gradually change. This gradual change is
accomplished by a gradient maker. The elution of substances can be monitored during
chromatography with an in line spectrophotometer which measures the absorbance of material
coming off the column. In the case of protein chromatography the detector/recorder monitors
the A
280
. Detectors to record radioactivity or fluorescence during chromatography are also
available.
If chromatography is used as part of a protein purification scheme a fraction collector
is needed. A fraction collector is a device that will automatically collect the liquid flowing from
the column in separate tubes. Most fraction collectors will allow fractions to be collected per
unit time or per unit volume (i.e., number of drops). In either case, the end result is a series of
tubes containing approximately equal volumes. The tubes can then be evaluated for the
substances of interest. The amounts of the substances being measured are often plotted against
either the fraction number, volume or time. These three variables can be easily inconverted from
the flow rate and volume of the individual fractions. Some fraction collectors can also be
interfaced with the detector/recorder and programmed to collect only the peaks.
High Performance (Pressure) Liquid Chromatography. HPLC is not a distinct
chromatographic technique, but an advancement of technology. The flow rates in
conventional chromatography is limited because of the compression of the support matrices
used in the columns. These low flow rates result in diffusion and loss of resolution. New
resins that can withstand packing and high flow rates allow for higher resolution have been
developed. This allows for separations to be carried out under higher pressures (i.e., high
flow rates) resulting in increased resolution. All of the same types of chromatographic media
75
are available for HPLC as in conventional chromatography. HPLC is more widely used for
the separation of small molecules but can be applied to the separation of proteins in some
applications.
Fast protein liquid chromatography (FPLC) is a similar concept as HPLC, but
specificially designed for protein separations. FPLC also uses special columns and pumps to
achieve high flow rates and therefore faster separations. In general the flow rates obtained
with FPLC are not as great as those achieved with HPLC.
ADSORPTION CHROMATOGRAPHY
The basic principal of chromatography discussed above refers specifically to adsorption
chromatography. Thin-layer chromatography (TLC) and paper chromatography are examples of
adsorption chromatography. These techniques are usually used to separate small molecules,
such as nucleotides, amino acids, lipids, simple carbohydrates, for analytical work. However, in
many applications HPLC in a column format is used. Adsorption chromatography is not widely
used in protein purification. Hydroxyapatite, a crystalline form of calcium phosphate, is an
example of a stationary phase medium that is sometimes used to analyze either proteins or
nucleic acids. The basis of protein separation on hydroxyapatite columns is not understood and
is difficult to predict based upon a protein's chemical and physical properties. It may involve
non-specific interations between the positive calcium and negative carboxyl groups on the
protein and the negative phosphate and positive amino groups on the protein. Chromatography
on hydroxyapatite columns has been used successfully in some cases to separate proteins that
were not readily separable by other techniques.
ION EXCHANGE CHROMATOGRAPHY
Ion exchange chromatography (IEC) is a specific type of adsorption chromatography
based upon charge-charge interactions. The stationary phase consists of fixed charges on a solid
support. The fixed charges on the stationary phase can be either negative or positive and are
respectively referred to as cation exchange or anion exchange chromatography. Counter ions
will interact with the fixed charged groups and can 'exchange' with solute molecules. In other
words, substances to be separated will replace the counter ions associated with the chroma-
tography medium and stably bind to the exchanger via electrostactic interactions. Conditions in
which some solute molecules are electrostatically bound to the exchanger and other solute
molecules are not bound can be used to separate solutes (Figure).
76
Basic Principal of IEC. A solution containing the solutes of interest (
+
YH & Z
+
) is
applied to the ion exchanger. The solutes bind to the exchanger and displace the
counter-ions (X
+
) already bound to the column. The solute is removed from the
stationary phase by increasing the concentration of counter-ions or by changing
the pH to affect the charge of the solute. Weakly charged solutes (
+
YH) will be
displaced from the stationary phase with lower concentrations of counter-ions than
more highly charged solutes (Z
+
). This results in separation of solutes based upon
their net charges
For example, mixtures of adenine nucleotides (i.e., adenosine, AMP, ADP and ATP)
can be separated by IEC. Adenosine, which is uncharged does not bind to the anion exchanger.
As an increasing concentration of formate is applied to the column, AMP is the first to elute
followed by ADP and then ATP. The order of elution corresponds to the overall negative charge
of the nucleotides (i.e., number of phosphate groups).
Proteins are complex ampholytes (have both - and +
charges). Negative charges are due to aspartic acid and glutamic
Amino a. pK
a
Asp, Glu 4.3-4.7
His 7
Lys, Arg > 10
77
acid residues and positive charges are due arginine, lysine and histidine residues. (See Appendix
of Introduction to Proteins for structure of side-chain groups.) Each of these side-chains
functions as either a weak acid or weak base and has a pK
a
value (see Table). The exact pK
a
for
the side-chain groups will depend on the position of the residue within the protein. The side-
chains of aspartate and glutamate have a carboxylic acid group that will either be negatively
charged or uncharged depending upon the pH. At pH values greater than the pK
a
the carboxylic
acid group will be deprotonated, or negatively charged, whereas below the pK
a
the carboxylic
acid will be protonated and thus have no charge. Similarly, the side-chains of the basic amino
acids have an amine group that will be positively charged (i.e., protonated) at pH values below
the pK
a
or uncharged (i.e. deprotonated) at pH values above the pK
a
.
The combination of all of the charged side chains will give the protein a net charge
which depends on the pH. The isoelectric point (Figure) of a protein is the pH at which the net
charge is zero (i.e., the number of positive and negative charges are equal). Therefore, proteins
will have either a net negative charge or net positive charge depending upon the isoelectric
point of the protein and the pH of the solution, and thus, it is possible to use either anion
exchange or cation exchange chromatography. Anion exchange chromatography is generally
carried out above the isoelectric point of the
protein of interest and cation exchange
chromatography is carried out below the
isoelectric point.
The functional groups in IEC can be
either strong or weak acids for cation
exchange or strong or weak bases for anion
exchange. A strong exchanger is used for the
separation of weakly ionizable groups and a
weak exchanger is usually used for more
highly charged solutes. In addition, weak exchangers result in better resolution when the charge
differences between solutes is small. IEC of proteins is most often carried out with weak
exchangers. The matrix should not have ionizable groups or bind proteins. Common matrices
used in IEC are dextran (trade name Sephadex), agarose (trade name Sepharose), and cellulose
are common matrices used in protein chromatography.
The basic steps in column chromatography are to prepare the column, apply the sample
to the column, and to elute the solute from the column. Prepared IEC columns can be purchased
or alternatively the ion exchange media is purchased and prepared. The amount of preparation
necessary will depend upon the form of the media and the manufacturer's instructions should be
followed. In general, short wide columns work best for IEC and that the total column volume
should be such that all of the protein binds in the top 1-2 cm of the column. The sample should
be loaded under conditions (i.e., appropriate pH and low ionic strength) which promote the
binding of the protein of interest. Proteins that do not bind to the column are washed away using
the same buffer.
Proteins are eluted by increasing the ionic strength or changing the pH. Increasing the
ionic strength can be done batchwise by sequentially washing with buffers containing higher
78
concentrations of salt or gradually using a gradient maker. Eluting in a 'steps' is generally
simpler, but of lower resolution. A gradient maker will mix two buffers of different ionic
strengths resulting in controlled
increase in the ionic strength of the
elution buffer. The slope and shape of
the gradient will determine the
resolution in regards to separating
solutes. For example, decreasing the
slope of the gradient will lead to a
greater separation of the solutes (see
Figure). However, as the slope
decreases the proteins will be more dilute.
Chromatofocusing is a specialized form of ion-exchange chromatography which
separates proteins according to their isoelectric points. This method takes advantage of the
buffering capacity of the exchanger and generates a pH gradient across the column. The column
is developed with a mixture of buffers called the 'polybuffer'. As these migrate down the
column, the most acidic components will bind to the basic groups of the exchanger and lead to
an increase in the local [H
+
]. As elution progresses the pH as each point in the column is
gradually lowered due to the addition of more buffer components. The more acidic components
will elute, migrate further down the column and bind to again to the basic exchanger groups.
This will result in a pH gradient across the length of the column. The sample is loaded onto the
column at a pH > than the pI of the solute of interest. As the pH drops the protein elutes and
migrates down the column until the pH is greater than the isoelectric point and then reabsorbs.
This will continue until the proteins elute at their isoelectric points.
79
HYDROPHOBIC CHROMATOGRAPHY
Proteins can be separated according to
differences in their hydrophobicities. Hydropho-
bicity is a chemical property which promotes the
aggregation of nonpolar compounds with each
other in an aqueous environment. These hydro-
phobic interactions are not an attractive force per
se, but are forced upon nonpolar compounds in a
polar environment. The media for hydrophobic chromatography is a support matrix such as
agarose with long chain hydrocarbons covalently bound. Two common examples are octyl-
agarose (8 contiguous methyl groups) and phenyl-agarose (Figure). This will provide a hydro-
phobic surface for proteins to interact with instead of aggregating with each other. Highly
hydrophobic resins like octyl-agarose are best for weakly hydrophobic proteins, whereas less
hydrophobic resins like phenyl-agarose are better for proteins of intermediate hydrophobicity.
Proteins bind to hydrophobic columns under conditions that promote hydrophobic
interactions and these conditions will determine the extent of binding. For example, raising the
ionic strength increases hydrophobic interactions, or the 'salting out' effect (see chapter on
Differential Solubility). Both anions and cations can be listed in a series in terms of either
promoting hydrophobic interactions or increasing the chaotropic effect. Chaotropic agents
disrupt the structure of H
2
O by decreasing H-bonding and therefore decrease hydrophobic
interactions. The most common salt used in hydrophobic chromatography is (NH
4
)
2
SO
4
. The
(NH
4
)
2
SO
4
concentration should not promote protein precipitation (eg., 20% saturated or
approximately 1 M). Other salts can be substituted, but higher concentrations may be required
(eg., 4 M NaCl).
Conditions which decrease hydrophobic interactions
are used to elute proteins from hydrophobic columns (Box).
Decreasing the ionic strength is generally the preferred
method since the other methods introduce substances which
may be difficult to remove and/or denature the protein.
Decreasing the ionic strength can be done in a step-wise fashion or with gradients as discussed
for ion exchange chromatography. Substances which affect the polarity of the solvent (i.e.,
water) will also affect hydrophobic interactions. For example, a gradient of ethylene glycol will
lead to the differential elution of proteins. Similarly, chaotropic agents can be use to elute
proteins from hydrophobic columns. Detergents are more hydrophobic than proteins and will
complete with the proteins for binding to the hydrophobic matrix.
decrease ionic strength
decrease solvent polarity
chaotropic agents
detergents
increasing salting-out effect
anions: PO
4
, SO
4
, Cl, Br, NO
3
, ClO
4
, I, SCN
cations: NH
4
, Rb, K, Na, Li, Mg, Ca, B
increasing chaotropic effect
80
Reverse phase chromatography (RPC)
also separates compounds based upon differences
in hydrophobicities. RPC differs from hydrophobic
interaction chromatography (HIC) in that the
mobile phase is a nonpolar solvent such as hexane
instead of an aqueous salt solution. HIC is usually
performed under non-denaturing conditions and
separates proteins according to differences in sur-
face hydrophobicity. RPC is carried out under denaturing conditions and separates according to
differences in the total hydrophobicity, since all of the amino acid residues are available for
interaction with the stationary phase. The separation of small polypeptides and proteolytic
fragments is a common application of RPC.
GEL FILTRATION CHROMATOGRAPHY
Gel filtration, also called molecular sieve
chromatography or size exclusion chromatography,
separates proteins on the basis of molecular size. A
protein solution is passed over a column made up of
small beads composed of cross-linked polymers.
The degree of cross-linking will defined a pore size.
Solutes larger than this pore size are excluded from
the matrix and pass through the column unimpeded.
In other words they do not enter the beads but flow
around them. Smaller solutes will enter the gel matrix and are retained on the column longer.
The retention time is inversely proportional to the size of the solute.
Several different polymers have been used as support
matrices for gel filtration chromatography (Box). Different
grades of gel filtration media with different pore sizes are avail-
able. The different pore sizes allow for separation of macromole-
cules with different size ranges. Gel filtration chromatography is generally carried out in buffers
containing 0.15-1.0 M salt to prevent interactions of proteins with the support matrix. Unlike
the other chromatographic methods the solute (eg., protein) does not bind to the stationary
phase during chromatography. Therefore, gel filtration is a gentle technique and fragile proteins
are not damaged by adsorption to the chromatographic support. Since proteins do not bind to
the stationary phase, the resolution is dependent upon loading the smallest possible volume of
sample.
HIC vs. RPC
Hydrophobic
Reverse
Phase
Mobile
Phase
Polar Solvent
Nonpolar
Solvent
Conditions Native Denatured
Solute
Properties
Surface
Residues
Total
Residues
Dextran (=Sephadex)
Agarose (=Sepharose)
Polyacrylamide
81
Gel filtration can also be used to determine the molecular
weight of a protein if the columns are calibrated by using
molecular weight standards. Proteins of known size are passed
over the column and the K
av
is determined for each protein
according to the following equation:
K
av
= V
e
- V
o
/V
t
- V
o
.
The void volume (V
o
), also called the excluded
volume, is the elution volume of a substance which
is two large to enter the matrix of the support
medium. This is experimentally determined with a
standand known to be completely excluded and
represents the solvent between the beads. The total
volume is calculated from the volume of the
column bed (r
2
x length) and represents the elution
volume of molecules completely included in the
matrix. All substances, assuming there are no
interactions with the matrix, will elute in this
volume. The K
av
values are plotted against the log
of the molecular weight for each protein standard. The molecular weight of the unknown
protein can then be determined from its K
av
and the standard curve.
Shape also affects the retention of macromolecules. For example, long rod shaped
proteins elute from gel filtration columns at apparent molecular weights greater than their actual
molecular weights.
Desalting. Gel filtration is often employed to remove salts or other small molecular
weight solutes from protein solutions or to carry out buffer exchanges. The sample is loaded
onto a gel filtration column that will exclude proteins (eg., G-10 or G-25) and the void volume
collected. Desalting columns are much faster than dialysis. However, the sample is usually
diluted 2-4 fold. Spin columns, widely used in DNA isolations, are another example of desalting
columns.
AFFINITY CHROMATOGRAPHY
The biological function of proteins often involves binding to
or interacting with specific ligands, substrates, co-factors, inhibitors,
other proteins, etc. Affinity chromatography takes advantage of these
specific interactions between proteins and ligands. A protein mixture
is passed over the column with an appropriate moiety covalently
attached to a solid support. Only the protein which recognizes the
ligand of interest will bind to the column and the other proteins will
be washed away. Affinity chromatography can be very specific and
may allow the isolation of a protein in a single step.
V
o
= void volume
V
t
= total volume
V
e
= elution volume
82
Affinity columns are usually prepared from cyanogen bromide (CNBr)-activated
agarose. The CNBr group reacts with primary amines and covalently attaches the ligand to the
solid support. In some cases, the ligand already bound to the matrix is commercially available.
In addition, linker arms are often used to extend the ligand away from the matrix of the solid
support. The matrix should not adsorb contaminating proteins and covalent attachment of ligand
to matrix should not alter its binding to protein of interest. Binding of the protein to the ligand
should be relatively tight (i.e., high affinity), but at the same time the binding should not
preclude the ability to elute the solute from the column.
Conditions which promote the dissociation of the protein and
ligand are used to elute proteins from affinity columns (box). For
example, high concentrations of the free ligand can compete with the
bound ligand resulting in elution. In cases where affinity elution is not
possible or does not work, it may be possible to change the pH or
increase the ionic strength resulting in a destabilization of the protein-ligand interactions.
Another possibility is to use denaturing or chaotropic agents to elute the protein which will
result in the protein unfolding. However, these later methods can only be used if it is not
important to recover protein in the native state.
http://www.science.uts.edu.au/subjects/91326/Section3/section3.html (good summary of
chromatography)
affinity elution
pH changes
ionic strength
chaotropic salts
denaturing agents
83
CHAPTER 10--MEMBRANES AND DETERGENTS
Membranes are composed of a lipid bilayer and associated proteins. Lipids are
amphipathic molecules in that they contain a polar head group and hydrophobic tails. In
aqueous solutions lipids will aggregate such that the hydrophobic tails interact with other
hydrophobic tails and the polar head groups are exposed to water. The two possible
configurations are: 1) a spherical micelles with the hydrophobic tails pointed inward, or 2) a
bilayer with the hydrophobic tails sandwiched between the polar head groups. The shape of the
lipid and its amphipathic nature cause them to spontaneously form bilayers in aqueous solutions
and accounts for the stability of membranes.
Proteins interact with this layer bilayer in several different fashions. Transmembrane
proteins pass through the bilayer. A hydrophobic domain, typically an -helix composed of
amino acids with hydrophobic side-chains, interacts with the hydrophobic tails of the lipids and
anchors the protein to the bilayer. Some transmembrane proteins will have multiple membrane
spanning domains. Other membrane proteins are anchored to the lipid bilayer via fatty acids or
lipids that are covalently attached to the protein. Other membrane are attached to the membrane
by non-covalent association with other membrane proteins.
Many cellular processes occur on membranes or in membrane-bound subcellular
compartments. Approximately half of a cell's total protein is associated with membranes or
found in membrane-bound compartments. The study of these membrane associated processes
may require the isolation of membranes or membrane proteins. The choice of tissue and
membrane fraction (i.e., organelles) will depend in part on the phenomenon being studied.
Some cell types are better sources for certain types of membranes. The cells need to be
disrupted by procedures which preserved the activity
of interest (see Appendix). Disruption of cells or
subcellular compartments will usually result in the
membranes forming vesicles. The different types of
membranes will have different sizes and densities
based upon their lipid and protein composition and
can be prepared by differential centrifugation, density
gradient centrifugation or a combination of the two.
choice of cells or tissue
choice of membrane fraction
homogenization conditions
preparation of membranes
differential centrifugation
density gradient centrifugation
solubilization of membranes
isolation of proteins
84
The exact isolation technique will depend upon the source and type of membrane being isolated
as well as the desired purity.
TYPES OF MEMBRANE PROTEINS
It is possible to remove proteins from the lipid bilayer and subject membrane proteins to
further analysis. The method for solubilization will depend on the nature of the proteins
association with the lipid bilayer. In this regard, membrane proteins can be viewed as either
integral or peripheral. Integral membrane proteins include the transmembrane proteins and
lipid anchored proteins. Such proteins are solubilized under conditions which disrupt the lipid
bilayer. Peripheral membrane proteins are non-covalently associated with other membrane
proteins and can be differentially extracted under conditions which disrupt protein-protein
interactions, but leave the bilayer intact (eg. high salt, low salt, alkaline pH, urea).
Differential Solubility of Erythrocyte Membrane Proteins
Erythrocyte membranes were suspended in 0.1 mM EDTA (pH 9.2) and centrifuged. The pellet was
resuspended in 0.1 mM EDTA (pH 11) and centrifuged again. The total extract (t), the first supernatant
(s), and the first (p1) and second (p2) pellets were examined by SDS gel electrophoresis (see chapter on
Electrophoresis). Integral membrane proteins such as band 3 and glycophorins are not extracted from
the lipid bilayer under either condition. Ankyrin and band 4.1, which bind directly to band 3 and
glycophorin respectively, are extracted at pH 11 but not pH 9.2. Spectrin and actin, which form a two-
dimensional network connected to the membrane via interactions with ankyrin and band 4.1, are
extracted at pH 9.2.
Membrane proteins can be selectively extracted from the membrane depending on the
nature of their association with the lipid bilayer. For example, some peripheral membrane
proteins can be extracted from the membrane by treating with high salt (0.5-1.0 M) solutions.
This will remove proteins that interact weakly with the bilayer via electrostatic interactions. The
integral membrane proteins and other peripheral membrane proteins remain associated with the
lipid bilayer and are removed by centrifugation. Most peripheral proteins will require low ionic
strength and alkali pH (< 9) for solubilization. The exact pH will depend on the particular
protein (see figure for example). Chaotropic agents, such as urea, can also be used to solubilize
peripheral membrane proteins. However, such agents will not exhibit selectivity and many will
disrupt the bilayer and extract integral membrane proteins. Integral membrane proteins can be
selectively extracted through the use of detergents (see below).
85
The optimal conditions for solubilization will need to be determined for each individual
protein. Isolated membranes are mixed with the extraction buffer. The temperature and time can
also be varied. Following the incubation, the particulate (i.e., pellet) and soluble (i.e,
supernatant) fractions are separated by centrifugation and the two fractions analyzed for the
protein of interest. In general, extraction with detergents will disrupt the bilayer resulting in a
particulate fraction that represents cytoskeletal elements and associated proteins. However,
some detergents, especially ionic detergents, will also disrupt protein-protein interactions
involved in formation of cytoskeletons. Extraction with low ionic strength buffers at alkaline pH
will result in a pellet consisting of the bilayer still containing the integral membrane proteins.
Sequential extractions can be used to remove proteins that are not of interest before solubilizing
the protein(s) of interest.
The extraction conditions may preclude the analysis of enzyme or other functional
activities. It may be possible to restore the functional activity by restoring the samples to
appropriate conditions or removing the detergents.
DETERGENTS
Detergents are amphiphilic compounds, meaning that they contain both hydrophilic and
hydrophobic moieties. A wide variety of chemicals can be classified as detergents. These can be
subgrouped based upon the natures of their hydrophobic and hydrophilic regions. Two types of
hydrophobic regions found in biologically important detergents are alkyl chains and steroid
skeletons (eg., deoxycholate). The alkyl chains can be straight or branched and some also
contain phenyl (eg., NP-40) or cyclohexyl groups. The polar groups can be classified as anionic,
cationic, amphoteric (i.e., zwitterionic), and non-ionic. Common non-ionic polar groups are
glucosides and polyoxyethyl groups. In general, the non-ionic detergents are less denaturing
than the ionic detergents.
Detergents have surface activity and readily
form micelles that are soluble in H
2
0 (unlike
lipids). Micelles are aggregates of detergent
molecules in which the polar groups are exposed to
the aqueous environment and the hydrophobic
groups form an inner core.
Terms defining the properties of detergents are: critical micellar concentration, micellar
molecular weight, critical micellar temperature, and cloud point. The critical micellar
concentration (CMC) is defined as the minimum concentration at which the detergent forms
micelles. The micellar molecular weight is the average micelle size of a pure detergent and
represents the number of detergent monomers within a micelle. The micellar M
r
usually
expressed as an aggregation number (N) which is the average number of monomers in one
micelle. In general, detergents with a low CMC have a high micellar M
r
. The CMC and micellar
M
r
are affected by temperature, pH and ionic strength. Increasing the ionic strength tends to
lower the CMC and raise the micelle size. The critical micellar temperature is the minimum
temperature at which a detergent will form micelles. The cloud point is the temperature above
86
which detergent micelles will form super aggregates. Detergents should be used under
conditions which are optimal for micelle formation since micelles are critical for detergent
function.
Examples of Detergents and Their Properties
Name Structure CMC N (MW)
Nonidet
(N) P-40
0.3 mM
100-155
(647)
sodium dodecyl
sulfate (SDS)
8.3 mM 62 (288)
sulfobetaine
(SB12)
3.6 mM 55 (336)
n-octylglucoside
14.5
mM
20-25
(292)
deoxycholate
20 mM
3-12
(417)
A few examples of detergents illustrating the different types of hydrophillic and hydrophobic groups.
Critical micellar concentrations (CMC) and aggregation numbers (N) are also shown. MW is the
average molecular weight of the monomer in daltons.
Detergents interact with both membrane lipids and proteins. At low detergent to lipid
ratios, detergent monomers incorporate into the lipid bilayer without disrupting the membrane.
As the detergent:lipid ratio increases, lipids, because of their similar properties as detergents,
will form mixed micelles with the detergent. Therefore, the detergent concentration needs to be
above the CMC. Detergent molecules also interact with the hydrophobic portions of the proteins
and in effect replace the lipids. This will lead to the proteins being coated with detergents and
prevent protein-protein interactions that would normally result in protein precipitation. Protein
solubilization occurs at or near the CMC for most detergents.
There are no general rules for choosing among the
various types of detergents. It is not possible to predict which
detergent will be most useful for any particular application.
Pilot experiments to determine the optimal detergent as well as
the optimal conditions for maximal protein solubilization are
carried out. Membrane samples are incubated with various
Possible Detergent Effects
protein structure
protein activity
interference with assays
separation techniques
87
concentrations of detergents for appropriate times and detergent insoluble material is removed
by centrifugation. The soluble and particulate fractions are analyzed for the protein of interest.
Ideally, detergents should not affect the native structures or activities of the protein(s) being
characterized. In addition the detergent should not affect the measurement of that protein (eg.,
assay) or chromatography systems that will be utilized in the isolation
of that protein.
DETERGENT REMOVAL
It is often necessary to use a detergent to solubilize the protein of interest. However,
later it may be necessary to remove the detergent. In general, detergents are difficult to remove.
Therefore, the ease at which a detergent can be removed is also an important criteria to consider
when choosing a detergent.
Various methods for detergent removal have been described (Box). The choice of
method will depend somewhat on the class of detergent being removed. Dialysis or desalting
columns can be used for ionic detergents with a small micelle size and high CMC. However,
detergents with a low CMC tend to have a large micelles size and will not pass through the
dialysis membranes. Dialysis would require substantial dilution for the removal of the detergent
monomers. Gel filtration can be used to remove the large micelles from the smaller proteins.
The proteins will still be coated with detergent though.
Hydrophobic chromatography can be also used to remove detergent. Similarly, in the
case of ionic detergents, urea can be added and ion exchange chromatography can be carried
out. In the presence of urea proteins will not bind to the column. Conversely, ion exchange
chromatography or affinity chromatography can be used to bind proteins of interest. The
column is washed extensively and the proteins are eluted in detergent free buffers.
In many cases complete removal of the detergent will result in protein precipitation and
is undesirable. Detergent replacement can be used in situations where a detergent which is
optimal for solubilization interferes with the analysis or further purification of the protein. The
sample is subjected to dialysis or chromatography in the presence of the second detergent.
Another possibility is to replace the detergent with urea.
Dialysis
Chromatography
Replacement
88
APPENDIX 1. CELL DISRUPTION TECHNIQUES
Organisms can be studied on many
levels. The whole organism can be studied
(eg., behavior, toxicity, etc.). Tissues or
organs can be removed by dissection. Tissues
can be broken down to single cells by grinding
or enzymatic digestions. In addition, single
cells can be obtained through in vitro cell
culture or from single-celled organisms. The
choice of organism, tissue, or cell type will
depend on the research topic or the protein of
interest. A particular organism, tissue or cell
type is often the subject of the research. In
other cases, though, a particular phenomenon
is the object of research. Therefore, the choice
of organism, tissue, etc. will depend upon the biological phenomenon being studied. Different
tissues and cells will express different amounts of macromolecules or organelles. For example,
liver is good source of mitochondria and erythrocytes are a good source of purified plasma
membrane.
To study biology at the subcellular and molecular levels it is necessary to disrupt or lyse
the cells. Many different methods can be used to disrupt cells (Table). The various techniques
all have advantages and disadvantages and the method used will depend on the type of cell and
the application. Cell disruption/lysis may destroy the organelle or denature the protein of
interest. Therefore, it is important to have an assay to evaluate the disruption techniques in
terms of preserving the structures or activities of interest. In general, one needs to empirically
determine the optimal conditions for cell disruption.
Subcellular organelles are isolated after cell lysis by differential and/or density gradient
centrifugation. Generally homogenation, presses or nitrogen cavitation are the appropriate
methods for cell lysis if intact organelles need to be isolated. The other methods are most
appropriate in cases were macromolecules are being evaluated without prior isolation of
organelles.
89
Cellular Disruption Methods
TECHNIQUE COMMENTS
homogenation
Cells are placed in homogenizer or blender and disrupted by shear forces or
grinding. Many different types of homogenizers are available depending on the
application. Most consist of a pestle with a defined clearance and can be hand
or motor driven. Homogenation can be combined with osmotic methods.
Heating can be a problem.
presses
Cells are placed under high pressure in a stainless steel chamber. After
reaching a defined pressure the chamber is opened and the cells exit through
a small orifice at a controlled rate. The rapid exposure to atmospheric
pressure causes the cells to lyse. Optimal pressure for cell disruption needs to
be determined empirically for each type of cell and experimental condition.
N
2
-cavitation
Cells are placed under high pressure in a N
2
atmosphere. The pressure is
suddenly released, causing the N
2
dissolved within cells to boil off and rupture
the cells. Both the pressure and rate of pressure release can be controlled.
osmotic,
hypotonic
Cells are placed in an isomolar solution of a permeable solute or a hypotonic
solution. Water will enter cell which results in swelling until the membrane
ruptures. The technique is gentle, but may not lyse cells with walls or rigid
cytoskeletons (eg., bacteria, plants, etc.).
sonication
Ultrasonic waves are used to disrupt cells. Heating is a problem and the
process tends to vesiculate membranes and subcellular compartments.
freeze-thaw
Ice-crystals formed during freezing will rupture cell membranes. It will
generally take multiple cycles of freeze-thaw to disrupt all of the cells.
detergents
Detergents will disrupt the lipid bilayer allowing the contents to be released
and will solubilize membrane proteins. Many detergents denature proteins and
they are often difficult to remove.
chaotropic
agents
Chaotropic agents solubilize proteins by disrupting the structure of water and
minimizing hydrophobic interactions. Protein denaturation is a problem.
enzymatic
Bacteria, yeasts and plant cells are often treated with enzymes to remove the
cell wall. Enzymatic treatment is often combined with other disruption
methods.
91
CHAPTER 11--ELECTROPHORESIS
Electrophoresis, like centrifugation, is a hydrodynamic technique. A charged particle
(i.e., molecule) in an electric field experiences a force that is proportional to the potential
difference (E), or voltage, of the electric field and inversely proportional to the distance (d)
between the electrodes. (The potential difference divided by the distance (E/d) is referred to as
the field strength.) The force will also be proportional to the net charge of the molecule (q).
Therefore, the force experienced by the molecule can be expressed by the following equation:
F = Eq/d
This force will by opposed by a
frictional force (= fv) where f is a frictional
coefficient and v is the velocity of the particle.
The frictional coefficient depends on the size
(eg., r = radius) and shape of the molecule and
the viscosity () of the medium. For example, in the case of a sphere the frictional force is:
F
f
= 6rv
A particle will move at a velocity (v) so that these two forces are equal, therefore:
6rv = Eq/d or solving for v
v = Eq/d6r
This equation indicates that the mobility (i.e., velocity) of a molecule in an electric field
is proportional to the electric field (E/d), or more simply the applied voltage, and the net charge
of the molecule. The mobility is inversely proportional to a frictional coefficient (i.e., size and
shape of the molecule and the viscosity of the medium), as indicated by the following equation:
mobility = (applied voltage)(net charge)/(friction coefficient)
Therefore, it is possible to derive information about the charge, size and shape of a molecule by
its mobility in an electric field.
GEL ELECTROPHORESIS
Electrophoresis of macromolecules can be carried out in solution. However, the ability
to separate molecules is compromised by their diffusion. Greater resolution is achieved if
electrophoresis is carried out on semi-solid supports such as polyacrylamide or agarose gels.
Gels are formed by cross-linking polymers in aqueous medium. This will form a 3-dimensional
meshwork which the molecules must pass through. Polyacrylamide is a common gel for protein
electrophoresis whereas agarose is more commonly used for nucleic acids (see Chapter 18).
Agarose gels have a larger pore size than acrylamide gels and are better suited for larger
macromolecules. However, either type of gel can be applied to either nucleic acids or proteins
92
depending on the application.
Gels are formed from long polymers in a cross-linked lattice (Figure). The space
between the polymers are the pores. Higher concentrations of the polymer will result in smaller
average pore sizes. Polyacrylamide gels are formed by covalently cross-linking acrylamide
monomers with bis-acrylamide with a free radical like persulfate (SO
4
). The cross-linking of
the acrylamide polymers results in 'pores' of a defined size. The total acrylamide concentration
and the ratio of bis-acrylamide to acrylamide will determine the average pore size. The
polyacrylamide solution is poured into a mold and polymerized. This mold can be a cylindrical
tube, but is usually a 'slab' poured between two glass plates (see below).
Diagramatic representation of gels. Gels are form by cross-linking polymers into a 3-dimensional mesh-
work or lattice (left). This results in a pourous semisolid material that solutions can pass through. In other
words the open spaces are filled with solvent. Increasing the concentration of the polymer will resulting in
smaller 'pores'. Agarose gels are formed by heating the desired concentration of agarose in an aqueous
buffer. After the agarose dissolves, the solution is cooled and the gel forms. Polyacrylamide gels are
formed by chemically crossing acrylamide and bis-acrylamide using a free-radical such as persulfate
(right).
Since the gel is solid with respect to the mold, all molecules are forced through the gel.
Smaller molecules will be able to pass through this lattice more easily resulting in larger mole-
cules having a lower mobility than smaller molecules. In other words, the gel acts like a mole-
cular sieve and retains the larger molecules while letting the smaller ones pass through. (This is
opposite of gel filtration where the larger molecules have a higher mobility because they to not
enter the gel.) Therefore, the frictional coefficient is related to how easily a protein passes
through the pores of the gel and size will be the major determinant of the mobility of molecules
in a gel matrix. Protein shape and other factors will still affect mobility, but to a lesser extent.
Substituting size for the frictional coefficient results in:
mobility (voltage)(charge)/(size)
In other words, the mobility of a protein during gel electrophoresis is primarily a function of its
charge/mass ratio.
93
EQUIPMENT
Equipment to conduct gel electrophoresis is relatively simple. They consist of a mold to
form the gels, an apparatus to hold the gel and contain buffers, and a power supply capable of
delivering the required voltage or current. There are many types of apparati for carrying out
electrophoresis depending on the application. Gels can be either in a vertical or horizontal
configuration. Polyacrylamide gels are run in a vertical fashion and agarose gels tend to be run
in a horizontal position.
Gels can either be formed as cylinders by using glass tubing as a mold (often called tube
gels) or formed as rectangular slabs. These slab gels are formed by polymerizing the acryamide
solution between glass plates separated by spacers (Figure). Typically the gel is 0.75-1.5 mm
thick. At the top a 'comb' is used to form sample wells. Slab gels allow multiple samples to be
compared on the same gel, thus eliminating gel-to-gel variations.
The formed gel is placed into the apparatus to that the top and bottom of the gel are in
contact with chambers containing buffer (Figure). These chambers contain electrodes which are
connected to a power supply. Thus an electric field is generated across the gel when a voltage is
applied. The buffer in the chambers is generally different that the buffer making up the gel for
protein electrophoresis and in some applications the buffers in the lower and upper chambers
may be different. In most applications the buffers are such that the protein has a negative charge
and therefore the anode (positve pole) will be in the lower chamber and the cathode (negative
pole) will be in the upper chamber. However, there are applications in which the proteins of
interest may be positively charged and therefore the electrodes will be reversed.
Discontinuous or "disc" electrophoresis. The Laemmli discontinuous buffers are exten-
sively used in gel electrophoresis. Discontinuous gels consist of two distinct gel regions referred
to as stacking gel and separating gel (see Table) and a Tris-glycine tank buffer. The stacking gel
94
has a lower acrylamide concentration, a lower pH and a lower ionic strength than the separating
gel.
The lower ionic strength of the
stacking gel results in a greater local elec-
tric field strength than in the separating gel.
The field strength difference combined with the lower acrylamide concentration results in
proteins having a higher mobility in the stacking gel than in the separating gel. In addition, the
glycine in the tank buffer has a higher mobility in the separating gel than in the stacking gel
because of the pH differences. Therefore, proteins will migrate faster than the glycine in the
stacking gel. When proteins reach the separating gel their mobility is decreased because of the
increased acrylamide concentration and decreased field strength, whereas the increase in pH
results in glycine having a higher mobility. All of these factors result in the proteins becoming
compressed at the interface between the two gels and thus increasing resolution (Figure).
Resolution in non-discontinuous electrophoresis depends partially on the volume of the sample.
However, stacking also occurs at the interface of the sample and gel, especially if a high voltage
is applied.
SDS-PAGE
Polyacrylamide gel electrophoresis in the presence of SDS (sodium dodecyl sulfate) is
the most common form of protein gel electrophoresis. SDS completely disrupts protein-protein
interactions and denatures almost all proteins resulting in a complete unfolding of proteins. In
addition, -mercaptoethanol (or other reducing agents) is often used to break disulfide bonds.
The SDS binds to the unfolded proteins giving all proteins a similar shape (i.e., random coil or
extend conformation) and an uniform charge-to-mass ratio. In other words, coating proteins
with a negatively charged detergent minimizes the effects of a protein's net charge. Therefore,
during electrophoresis in the presence of SDS the mobility of a protein now depends primarily
upon its size (i.e., mobility is inversely proportional to protein mass).
Mobility in SDS gel electrophoresis is expressed as a relative mobility (R
f
). The
distance the protein migrated is compared to the length of the gel, or:
R
f
= distance protein migrated gel length
The length of the gel is often defined by the migration of a substance which is not impeded by
the matrix such a small molecular weight tracking dye (eg., bromophenol blue). This mobility
can then be used to calculate the size of proteins. Protein standards of known size are used to
Composition of Laemmli Gels
Stacking
Gel
Separating
Gel
Acrylamide 3-4.5% 6-20%
pH 6.8 8.8
Ionic
Strength
0.125 M
Tris
0.375 M
Tris
95
generate a standard curve by plotting the log of the
molecular weight against the R
f
values. The molecular
weight of an unknown protein can be extrapolated from
its R
f
value (see Appendix 1). Such a calculated
molecular weight is designated as M
r
to indicate that it
is a relative molecular weight based on comparisons to
other proteins. For some proteins, though, this estimated
molecular weight can differ from the actual molecular
weight. In particular, highly charged proteins behave
anomalously during SDS gel electrophoresis. In
addition, some proteins are not completely denatured by
SDS and this retention of some structure will lower the
mobility.
Practical considerations. The first step in
electrophoresis is to pour the separating gel (Box). Pre-
poured gels are also commercially available. Separating
gels will typically contain 6-20% acrylamide. The size
range of the proteins being separated, the desired
resolution and the amount of sample being applied are
factors to consider when choosing an acrylamide con-
centration. Gradient gels can be used in situations
where it is necessary to examine both high and low
molecular weight proteins on the same gel. The stack-
ing gel is poured after the separating gel polymerizes
and just before electrophoresis to minimize diffusion
between the two gels.
Proteins to be analyzed by SDS-PAGE are solubilized in a
sample buffer that typically contains 2% SDS and 5% -mercapto-
ethanol and then boiled. The reducing agent is omitted in situations
where disulfide bonds need to be preserved. In situations where an
enzyme activity will be measure following electrophoresis (see
below) a lower SDS concentration is used and the sample is not boiled. The amount of protein
that can be loaded onto a gel is limited. Overloading the gels results in the pores becoming
plugged and has an adverse effect on the electrophoresis.
After loading the samples into the wells of the gel an electric field is applied across the
gel. The mobility of proteins in an electric field is proportional to field strength (E/d), or simply
the voltage (E) since the distance (d) is determined by the electrophoresis apparatus. Electro-
phoresis will proceed faster, and therefore finish sooner, at higher voltages. However,
electrophoresis generates heat in proportional to the amount of power, which is the product of
voltage and current (P = EI). Excessive heating may result in proteins precipitating within the
gel or have other deleterious effects on proteins depending on the nature of the protein sample
and total protein concentration. These electrical parameters change during electrophoresis
because the ions migrate to the anode and cathode buffers, and therefore lead to an increase in
1. Pour separating gel.
2. Pour stacking gel.
3. Load samples.
4. Apply electric field.
5. Stain or process gel.
96
resistance (R). Resistance affects the voltage and current (E = IR) depending upon which
variable is held constant. Most power supplies are capable of delivering constant voltage (E),
constant current (I), or constant power (P). Electrophoresis is usually carried out under constant
voltage or constant power to minimize the resulting increase in heating that occurs during
electrophoresis.
A tracking dye (bromophenol blue) is included in the sample. When this dye reaches the
bottom of the gel or some predetermined time afterwards the power is turned off and the
proteins detected. A common way to detect proteins after electrophoresis is to stain the gel with
Coomassie blue, a dye that binds proteins. Gels are usually 'fixed' before staining with an acetic
acid and methanol solution which precipitates proteins into the acrylamide matrix.
ISOELECTRIC FOCUSING
Isoelectric focusing (IEF) separates proteins
based on their isoelectric points. The isoelectric
point is defined as the pH at which a protein has no
net charge (i.e., the number of negative and positive
charges are equal) and is a measure of the protein's
net charge. Separating proteins according to their net
charge is accomplished by generating a pH gradient
in an electric field. The effect of protein size on
mobility is minimized by carrying out the electro-
phoresis gels with large pore sizes such as low
acrylamide concentrations (eg., 3.5%) or agarose.
This large pore size minimizes the molecular
sieving.
A pH gradient is generated with carrier
ampholytes. These ampholytes are a mixture of
aliphatic amines and either carboxylic or sulfonic
acid. They have a high buffering capacity, low
molecular weight (300-600 Da) and a range of pK
a
values. Initially the pH of an ampholyte
solution will be the average of the pK
a
values of the mixture. Application of an electric current
will cause the ampholytes to migrate toward the electrodes according to their charges.
Ampholytes that have pK
a
values above the pH will be positively charged and those with pK
a
values below the pH will be negatively charged. As the ampholytes migrate this will result in
changes in the local pH due to the buffering action of the ampholytes. This change in the local
pH will affect the charge on the ampholytes depending upon the pK
a
. The ampholytes will
continue to migrate until they reach a position in which the local pH equals their pK
a
(i.e., no
net charge). The end result is a pH gradient in which the most basic ampholytes are found at the
cathode, a dilute alkali solution (eg., NaOH), and the most acidic ampholytes are at the anode, a
dilute acid solution (eg., H
3
PO
4
). Carrier ampholytes with defined pH ranges can be purchased
or prepared by isoelectric focusing.
Proteins are also ampholytes and will migrate within the pH gradient until they reach a
97
pH equal to their isoelectric point. The carrier ampholytes are needed since the protein concen-
tration is generally not high enough to establish a stable pH gradient and the isoelectric points of
the proteins may not be uniformly distributed along a pH gradient.
Sample preparation is important for IEF in that many rea-
gents can adversely affect isoelectric focusing. In particular, the
ionic strength should be as low as possible. Precipitation of pro-
teins with acetone is a method for removal of excess salts, as well
as concentrating the protein. Separations can be performed under
either native or denaturing conditions. Urea is the preferred denaturing agent since it is
uncharged. Similarly, non-ionic detergents, such as Triton X-100 or NP-40, are less likely to
interfere with the formation of pH gradients. Protein precipitation is sometimes a problem in
that proteins tend to be less soluble at their isoelectric points and their local concentrations can
be quite high. In addition, the high voltages and high resistance (see below) associated with IEF
generates substantial heat which increases protein precipitation. Many apparatuses for IEF will
have a cooling mechanism to disperse the excess heat. Inclusion of urea and NP-40 in the gels
will also minimize protein precipitation.
IEF is an equilibrium phenomenon since the components of the system migrate until
they have no net charge. As the system approaches equilibrium the resistance approaches
infinity since there are no ions to conduct the current. However, the pH gradient will start to
break down before true equilibrium is reached and the ampholytes will migrate into the anode
and cathode buffers. This gradient breakdown is accompanied by a lowering of the resistance.
Therefore, the progress of IEF can be followed by performing the electrophoresis under
constant voltage and monitoring the current. Initially the current will rapidly drop in concor-
dance with the rapid migration of the ampholytes. As the ampholytes lose their net charge, the
resistance increases and the current decreases (E = IR). The rate at which the current decreases
levels off as the system approaches equilibrium. The current will start to rise again when the pH
gradient starts to break down. IEF needs to be discontinued before this point.
The pH gradient can be determined with marker proteins with known isoelectric points
or by measuring the pH along the gel. This is accomplished by slicing the gel into pieces,
eluting the ampholytes into distilled water and measuring the pH.
TWO-DIMENSIONAL GEL ELECTROPHORESIS
Conventional electrophoresis separates proteins according to their charge/mass ratios.
SDS-PAGE separates proteins according to subunit, or polypeptide, mass. IEF separates
proteins according to isoelectric point (or charge). It is possible to sequentially combine the
different types of electrophoresis and run two-dimensional (2-D) gels. A common form of 2-D
gel electrophoresis is to first separate proteins by IEF in 'tube' gels. These gels are then equili-
brated in SDS gel electrophoresis sample buffer and subjected to SDS-PAGE in a 'slab' gel. (It
is necessary to carry out the IEF first since SDS interfere with the isoelectric focusing.) The 2-
D separation results in higher resolution since proteins are being separated according to two
distinct properties (i.e., charge and size).
Practical Considerations
low ionic strength
protein precipitation
heating
gradient breakdown
98
PROTEIN DETECTION FOLLOWING ELECTROPHORESIS
Total protein stains. Coomassie-blue staining is a
popular method for the detection of proteins following
electrophoresis. The procedure is to 'fix' the proteins into
the gel, usually in methanol and acetic acid, and then to
incubate the gel in a solution containing the dye (see
Appendix 2). Excess dye is removed by destaining in the
acetic acid and methanol solution. The method is cheap and easy to carry out, but of limited
sensitivity.
Silver staining is generally 10-100X more sensitive that Coomassie-blue staining. Three
basic types of silver staining methods have been described. All three methods are based upon
binding silver ions to proteins and reducing the Ag
2+
to metallic silver. The silver interacts with
primary amines or sulfhydryls. In the diamine method, silver diamine complexes are stabilized
with ammonium ions and the free amine groups of proteins. The silver bound to protein is then
reduced to metallic silver with formaldehyde. In the non-diamine method, AgNO
3
reacts with
protein under acidic conditions, followed by reduction to metallic silver with formaldehyde
under alkaline conditions. Photodevelopment relies on light
(photons) to reduce silver ions to metallic silver. Some silver
stain protocols result in certain types of proteins being stained
particular colors, thus aiding in the identification of proteins.
Fluorescence. Fluorescent dyes that bind non-covalently to proteins are also used for
protein detection following electrophoresis. Following incubation with the dye and destaining
the gels are examined under ultraviolet illumination. Polyacrylamide exhibits some background
fluorescence. Proteins can also be convalently labeled with fluorescent probes prior to
Coomassie Blue Stain
Silver Stain
Fluorescence
Autoradiography/Fluorograph
y
Enzymatic
diamine (or ammonical)
non-diamine
photodevelopment
99
electrophoresis. However, attaching fluorescent groups to proteins will change their charges.
Autoradiography and Fluorography. Radioactive proteins can be detected by exposing
X-ray film to the gel. Radioactivity emitted from the proteins will activate silver grains in the
film emulsion which will be converted into metallic silver during development. The reduction
to metallic Ag will result in a dark spot or 'band' appearing on the film in positions which
correspond to proteins. Fluorography refers to the exposure of film to secondary light emitted
by either intensifying screens or fluors upon their exposure to radiation.
Proteins can be made radioactive by incubating cells in the presence of radioactive
amino acids or other compounds that are naturally incorporated into proteins (eg., phosphate,
fatty acids, glycosyl groups, etc.). Non-physiological means can also be used to incorporate
radioisotopes into proteins. Iodination involves the reaction of radioactive iodine (
125
I or
131
I)
with proteins by one of several methods. The iodine in incorporated primarily into tyrosine
residues and to a lesser extent into cysteine and histidine residues. Several reagents are available
that will react with either free sulfhydryls (eg., cysteine) or primary amines (eg., lysine). Such
alkylating agents can be used for the incorporation of either
3
H or
14
C. In most applications the
proteins are radiolabeled before electrophoresis. It should be noted though that alkylating
primary amines will affect the charge of the protein.
Gels are dried before carrying out autoradio-
graphy or fluorography. A gel dryer removes all of
the water and solvent from the acrylamide matrix by
heating the gel while under vacuum. This results in
the matrix collapsing into a thin layer. The dried gel
is placed next to a sheet of X-ray film in a light tight
cassette and exposed for an appropriate amount of
time depending on the isotope and the amount of radioactivity. The exposed film is developed.
Some emissions of high energy isotopes (eg.,
32
P and
125
I) will pass through film
without exposing it. An intensifying screen is placed on the opposite side of the X-ray film
from the dried gel. Emissions passing through the film will then interact with the intensifying
screen which will fluoresce. The light from this fluorescence will then expose the X-ray film.
Using an intensifying screen will usually decrease the exposure time by a factor of 7-10X. The
efficiency of the intensifying screen is highest at -70
o
.
Emissions from low energy isotopes (eg.,
3
H) and some medium energy emissions (eg.,
14
C and
35
S) are not energetic enough to escape the dried gel matrix. In this case a scintillation
fluor is impregnated into the gel before drying. The radioactive emissions then interact with the
fluors resulting in fluorescence. The fluorescence will then expose the X-ray film. Inclusion of
fluors in the gel will not enhance the detection of high energy isotopes, and likewise,
intensifying screens will not enhance the detection of low and medium level isotopes.
Phosphor-imager machines use screens containing storage-phosphors as a replacement
for the use of film. These phosphor-imager screens trap the energy of radioactive emissions and
are sensitive to both beta particles and gamma rays, but insensitive to visible light. The storage-
Autoradiography and Fluorography
Isotope
Energy
Detection
Method
Sensitivity
(dpm/mm
2
)
Screens 2-5 High
(
32
P,
125
I)
Direct 0.5
Fluor 15-25 Medium (
14
C,
35
S)
Direct 2
Low (
3
H) Fluor only 10-20
100
phosphor captures energy with an efficiency around 100% for any particle that strikes the
screen. Subsequent scanning the screen with a laser beam releases the stored energy as blue
light. This blue light is then converted into an image file for display and quantitation by the
phosophor-imager's computer. Such high efficiency makes it possible to detect low levels of
radioactivity after short exposure times. The phosphor screens can be used repeatedly by
'erasing' the screen following scanning.
Enzyme. It is possible to detect enzyme activity following gel electrophoresis of some
proteins. Generally it is necessary to carry out non-denaturing gel electrophoresis or IEF since
proteins will need to be in a native configuration for the expression of activity. However, some
enzyme activities can still be detected following SDS-PAGE. This will require that activity is
located in a single polypeptide chain (i.e., no multi-subunit enzymes) and that the protein is able
to refold into an active configuration following electrophoresis. To promote this refolding the
sample is initially solubilized in a lower concentration (eg., 0.1%) of SDS than normal and is
not heated. Then following electrophoresis the SDS is removed from the gels by washing the
gels in an appropriate buffer. The removal of the SDS and the refolding of the proteins can be
facilitated in some situations by including a non-ionic detergent (eg., Triton X-100) in the wash
buffer. This will lead to a replacement of the SDS by a more approiate detergent.
A common method to detect enzyme activity following
electrophoresis is to use substrates which form insoluble
products. These insoluble products will form a precipitate in the
gel at the position of the enzyme activity. For example,
tetrazolium salts are frequently used as color indicators for the
detection of enzyme systems in which reduction equivalents are
formed. The procedure is to incubate the gel with the
appropriate substrates and the indicator molecules. For exam-
ple, lactate dehydrogenase (see figure) can be detected by
incubating the gel with lactate, NAD
+
, phenazine methosufate
(PMS) and nitro blue tetrazolium (NBT). The NADH formed
by the dehydrogenease is not very efficient at transferring
hydrogens and electrons to NBT and therefore an intermediate
electron acceptor is needed (i.e., PMS). NBT is a soluble
yellow substance which when reduced to a formazan results in
the formation of an insoluble blue compound. Other dehydro-
genase activities or other redox reactions are detected by using the appropriate primary substrate
and changing the intermediate electron acceptor or tetrazolium salt as necessary.
It is also possible to detect enzymes which are generally not considered to be involved
in redox reactions using a substrate that can be coupled to the reduction of tetrazolium salts to
formazan dyes. For example, phosphatase activity can be detected by incubating with 5-bromo-
4-chloro-3-indolyl phosphate (BCIP) and NBT. After dephosphorylation of BCIP by the
phosphatase, the resulting indoxyl reduces the NBT to the foramazan dye. This subtrate pair
is widely used for the detection of enzyme-linked antibodies in immunoblotting procedures
(see chapter on immunoassays).
101
Proteases can also be detected after electrophoresis by co-polymerizing the gels with
gelatin or other proteins. Following electrophoresis and removal of the SDS, the gel is incu-
bated under conditions which promote proteolysis and then stained with Coomassie blue. Clear
regions will denote the positions of proteases.
Quantification. The results obtained from gel electrophoresis tend to be qualitative and
difficult to precisely quantify. One possible way to quantify the amount of a specific protein is
to electrophorese known amounts of a protein and to subjectively compare the staining
intensities with that of the unknown protein. The stained protein bands could also by excised,
the dye extracted with a solvent and the amount dye determined with a spectrophotometer. The
absorbance values could then be used to generate a standard curve. However, individual
proteins bind different amounts of Coomassie blue and there will be gel-to-gel variations.
Similarly radioactive proteins can be excised from the gel, the gel slice solubilized and the
amount of radioactivity determined by liquid scintillation counting. This method can be rather
laborious if all the proteins within a sample are being evaluated.
Scanning densitometry is usually a convenient method to quantify the amount of a
particular protein. Gels, autoradiographs, or even photographs are scanned and the peak height
and areas of bands are determined. The values are then used to calculate the amount of protein
based on standard curves. The uniformity of the shape and width of the bands also needs to be
considered.
PREPARATIVE ELECTROPHORESIS
Gel electrophoresis is a high resolution technique and can potentially be used for protein
purification. One major problem, however, is the limited amount of protein that can loaded onto
a gel. Another major problem is the recovery of proteins from gels, especially if the gels have
been fixed and stained. One possible method is by simple diffusion. The excised gel slice is
resuspended in a buffer and the protein allowed to diffuse out. This process is slow and the
protein is excessively diluted. Alternatively, the protein can be recovered from the gel slice by
electroelution using commercially available apparatuses. Both diffusion and electroelution are
characterized by low yields. An alternative strategy is to transfer the protein to a membrane
support and analyze the protein bound to the membrane as is done in immunoblotting or micro-
sequencing.
If the goal is to raise antibodies against the purified protein then it may not be necessary
to remove the protein from the gel. The excise gel slice containing the protein of interest is
frozen in liquid nitrogen and ground into a fine powder with a mortar and pestle. The ground
gel is then resuspended in saline and used to directly immunize animals. The protein is slowly
released from gel slices and actually enhances immunization through the 'depot' effect.
Commercial apparatuses for preparative electrophoresis are available. Most treat the gel
as a column and continue electrophoresis until all of the proteins migrate off from the bottom of
the gel. At the bottom of the gel is a chamber sealed off with a dialysis membrane to prevent the
proteins from migrating into the tank buffer. The protein coming off from the bottom of the gel
are continuously eluted and pumped to monitors and fraction collectors.
102
A commercially available preparative IEF apparatus, the Rotofor
)
low-melting temperature agarose
156
Variations in PFGE
Orthagonal-Field Alternation Gel
Electrophoresis
Field-Inversion Gel Electrophoresis
Transverse Alternating Gel
Electrophoresis
Programmable Autonomously
Controlled Electrode
Contoured-Clamped
Homogeneous Electric Field
CHEF Electrodes
Large DNA fragments are easily broken
by shear forces. To avoid breakage of chromo-
some-sized DNA fragments, whole cells are
embedded into agarose blocks. The cells are
lysed in the agarose block and subjected to
electrophoresis. The restriction digests can also
carried out in the agarose blocks before electro-
phoresis. Several electrophoretic variables can be manipulated and these will affect the resolu-
tion. The electrophoresis conditions will depend upon the particular apparatus being used and
the size range of DNA fragments to by separated.
Factors Affecting Resolution
uniformity of the two electric fields
lengths of the electric pulses
the ratio of the lengths of the pulses
the angles of the two electric fields
strengths of the electric fields
157
CHAPTER 19--HYBRIDIZATION AND BLOTTING TECHNIQUES
DNA can be separated into single strands by
disrupting the H-bonds which hold the complementary
strands together. Complementary DNA strands can
reform the double-stranded molecule in vitro. This
ability to reform dsDNA molecules, or hybridization,
allows for the detection of specific DNA fragments or
RNA molecules. Hybridization can be carried out in
solution or after target DNA has been transferred to a
membrane support. Nucleic acids immobilized on a
membrane support can be identified with a labeled DNA
probe by blotting techniques.
In 1975 Dr. Southern described a technique to detect
specific DNA fragments after gel electrophoresis and the tech-
nique became known as Southern blotting (Box). Others modi-
fied the technique to detect specific RNA fragments and this
method became known as Northern blotting. [When protein
blotting was developed it became known as Western blotting.]
Nucleic acids can also be bound to membranes without prior electrophoresis and this process is
referred to as dot blots.
GENERAL PROCEDURES
The first steps of nucleic acid blotting are to
isolate the nucleic acid of interest and prepare it for
analysis. For example, DNA is usually digested with
restriction enzyme(s) before electrophoresis. The sample
is then subjected to gel electrophoresis on agarose gels.
In the case of RNA or ssDNA the gels are usually
carried out under denaturing conditions to minimize
secondary structures.
An optional depurination step is sometimes carried out following the electrophoresis,
especially if very large fragments of DNA are being analyzed. This step is a brief incubation
of the gel in a dilute HCl solution followed by an incubation in a neutral buffer. The brief
acid treatment will randomly remove some purine bases and lead to random breaks in the
DNA. The smaller fragments of DNA are more efficiently transferred from the gel to the
membrane.
Double-stranded DNA is denatured (i.e., the complementary strands separated) by
treating the gel with a NaOH solution. The gel is neutralized by incubating in the
appropriate buffer before transferring the denatured DNA to membranes. It is not necessary
to carry out the denaturation step if RNA or ssDNA has been electrophoresed under
denaturing conditions.
Southern
Blot
DNA on
Gel
Northern
Blot
RNA on
Gel
Dot Blot
No Gel
Generic Blotting Protocol
1. Digest DNA or isolate RNA
2. Electrophoresis
3. Depurinate (optional)
4. Denature dsDNA
5. Transfer to membrane
6. Fix nucleic acid
7. Prehybridize
8. Incubate with probe
9. Wash
10. Detect (autoradiography)
158
Transfer of nucleic acids to membrane supports. Four methods for transferring nucleic acids to
membrane supports have been described. The original method developed by Southern uses
capillary action (Figure). In this method buffer being drawn through the gel carries the nucleic
acid. The nucleic acid then binds to the membrane. The method is still widely used but takes
several hours and typically is carried out overnight. Electrophoretic transfers are also possible
but not widely used. Special devices using either pressure or vacuum have been developed. The
vacuum blotting apparatus (Figure) is the more popular and can transfer nucleic acids in
approximately 30 minutes.
Several types of membranes are used in nucleic acid blotting techniques. Nitrocellulose
has been largely replaced by nylon as the membrane of choice. Nylon is a more durable
membrane and binds more nucleic acid. Special nylon membranes, which have been modified
to contain positive charges, bind even more DNA.
Fixation of the nucleic acid to the membrane improves the sensitivity by preventing loss
of target nucleic acid during the subsequent steps. The membranes can either be 'baked' (heated
159
to 80
o
for 2 hr) or cross-linked with UV radiation using a special apparatus. Membranes are then
'prehybridized' to block non-specific binding sites. The prehybridization solution contains non-
specific DNA, such as herring sperm or calf thymus DNA. Following the prehybridization, the
membrane is incubated with the 'probe' and then washed extensively. The bound probe is then
detected by autoradiography if radioactive probes were used, or by ELISA type procedures if
non-radiocative probes (see below) were used.
It is also possible to strip the blot of the probe by incubating under conditions which do
not allow for hybridization (eg., boiling in low ionic strength). The blot can then be reanalyzed
with a different probe. This is a convenient method to compare the expression of two different
genes by Northern blotting. However, the stripping and rehybridization can only be carried out
a few times.
FACTORS AFFECTING HYBRIDIZATION
Several factors affect the binding of a DNA probe to the
target nucleic acid (Box). All of these factors affect the number or
stability of the H-bonds formed between complementary strands.
Heating DNA destabilizes the H-bonds and increasing the temperature will make it more
difficult for the probe to bind to the target DNA. The hybridization of DNA fragments is
impeded by electrostatic repulsion due to the negative charge of the phosphate backbone.
Cations neutralize this charge-charge repulsion and adding salt will promote the interaction
between probe and target. The maximum effect is achieved with 1 M Na
+
. Chaotropic agents
affect H-bond stability and therefore will reduce the hybridization of probe to target DNA. The
length and the homology of the probe to the target DNA will determine the total number of
H-bonds formed between the target and the probe. However, the total probe length tends to only
have a major affect when oligonucleotides are used as probes. DNA with a higher percentage of
GC hybridizes will form more H-bonds since GC pairs have 3 H-bonds and AT pairs have 2
H-bonds. All of these factors will play a role in the overall stability of the duplex formed
between the target and the probe.
The separation of DNA strands is sometimes called melting and exhibits a melting
temperature, or T
m
. The T
m
reflects the overall stability of any particular DNA duplex. The
effective T
m
for any particular duplex will be determined by the summation of these various
factors that affect DNA hybridization (Box). For example, the following formula can be used to
approximate the T
m
under different hybridization conditions:
Effective T
m
= 81.5
o
+ 16.6log[Na
+
] + 0.41(%GC) -
0.72(%formamide) - 1.4(%mismatch)
Consistent with the above discussion, increasing the sodium concentration and percentage of
GC base pairs will raise the T
m
and increasing the formamide (a chaotropic agent) concentration
and decreasing the amount of homology between the probe and target will lower the T
m
. Often
the %mismatch is not known and it not used in the calculation. In the case of synthetic
oligonucleotides the absolute probe length and amount of GC base pairs are the major factors
involved in hybridization. Thus, the following formula results in a more accurate estimation of
temperature
ionic strength
chaotropic agents
probe length
probe mismatch
% GC
160
T
m
:
Effective T
m
= 2(A + T) + 4(G + C)
where A, T, G and C refer to the absolute numbers of each of the nucleotides.
Generally, hybridization is discussed in terms of strin-
gency and not the T
m
. Stringency refers to the conditions of the
hybridization. It is a relative term that is related to the T
m
(Box)
and reflects the homology between the probe and the target. For
example, only a probe with a high degree of homology to the
target DNA will hybridize under high stringency conditions, whereas low stingency will allow a
less homologous probe to hybridize to the target DNA.
The stringency is controlled by changing the hybridization conditions. For example,
increasing the temperature, decreasing the salt concentration, or including formamide all
increase the stringency. Likewise, the stringency can be decreased by lowering the temperature,
increasing the salt concentration, or decreasing the formamide concentration. In practical terms
it is often easier to vary the sodium or formamide concentrations rather than the temperature. A
common buffer for hybridization is SSC (standard sodium citrate) which is a citrate buffered
sodium solution. A stock solution of 20X SSC (= 3.3 M Na
+
) is diluted to achieve different
levels of stringency. Typically ranges of 0.1-6X SSC are used with the lower SSC
concentrations representing higher stringency. The formamide is typically used to lower the
temperature and at the same time maintain a certain level of stringency. For example, hybridiza-
tions carried out at 60-65
o
in the absence of formamide or at 37-42
o
with 50% formamide are
about equal in stringency. If incubations at high temperatures are inconvenient then formamide
can be included in the buffers and the hybridizations carried out at lower temperatures.
Stringency also applies to the wash steps. It is common to hybridize at low stringency
and then to wash at a higher stringency. This insures that the probe will bind to the target DNA
and any non-specific hybridization can be removed during the wash steps. The conditions for
hybridization (i.e., stringency) need to be determined empirically in conjunction with the above
formula as guidelines. A single blot can be sequentially examined under different stringencies.
Hybridization and washes are initially carried out at low stringency. The blot is wrapped in
plastic and not allowed to completely dry. After exposure to x-ray film, the blot is washed under
higher stringency and reexposed to X-ray film. Comparison of the different autoradiographs
will allow one to determine how homologous the probe is to the target DNA and the degree of
cross-hybridization to other DNA fragments.
PREPARATION OF LABELED DNA PROBES
The two major sources of probes are previously cloned
genes and synthetic oligonucleotides. In both cases a label needs
to be incorporated into the probe DNA. Radioactivity is a common label, but non-radioactive
probes are also available. Four methods for incorporating label into DNA probes have been
described (Box ). Nick translation is an older technique that has been replaced by random
Stringency vs. T
m
high T
m
- 15
o
moderate T
m
- 25
o
low T
m
- 35
o
Nick Translation
Random Priming
T4 Nucleotide Kinase
Terminal Transferase
161
priming. Random priming is the method of choice for labeling cloned DNA fragments.
Synthetic oligonucleotides are labeled using T4 nucleotide kinase.
Random Priming.
In random priming (Figure) DNA is
denatured by heating and mixed with hexamers
of random sequence (i.e., random primers). The
random primers are usually synthesized and
included as part of a kit. They can also be
prepared from genomic DNA. A few of primers
will be complementary to the probe DNA and
the duplex formed between the primer and the
probe DNA will serve as an initiation point for
the DNA polymerase. The DNA polymerase
used is Klenow. Klenow is the large subunit of
DNA polymerase I in which the 5'3'
exonuclease activity is removed. The four
dNTPs including a nucleotide containing a radioactive phosphate in the -position are also
added to the mixture. Therefore, the Klenow will make
radioactive copies of the template DNA. The probe
DNA is boiled immediately before use in the
hybridization assay to convert the dsDNA to ssDNA.
T4 Polynucleotide Kinase.
T4 polynucleotide kinase transfers the -PO
4
from ATP to the 5'-hydroxyl of polynucleotides. It is
therefore necessary to dephosphorylate the DNA with
alkaline phosphatase (AP) before carrying out the
phosphorylation. A disadvantage of this technique is
that only one radioactive atom is incorporated per
DNA strand. However, 5'-terminal phosphorylation is widely used to label oligonucleotide
probes that have been prepared synthetically. Synthetic oligonucleotides lack the 5-phosphate
and are too short for random priming. T4 kinase is also used in Maxim and Gilbert DNA
sequencing and to phosphorylate (non-radioactive) synthetic linkers.
Terminal Transferase.
Terminal deoxynucleotide transferase (TdT) adds
dNTPs to the 3-OH of either ssDNA or to 3' overhang. In
the presence of Co
2+
TdT will add dNTPs to the 3'-OH of
either dsDNA or 5' overhangs. TdT can be used to
radiolabel 3' ends if radioactive nucleotides are used. A
more common use, however, is to generate homopolymer tails for molecular cloning.
162
Non-radioactive Probes.
Several procedures have been devised for the
detection of hybridization using non-radioactive
probes (Box). All are based upon enzyme-linked
systems using either alkaline phosphatase (AP) or
horse-radish peroxidase (HRP). Biotinylated dNTPs
can be incorporated into the probe DNA by random
priming. The probe is then be detected with an
enzyme-linked streptavidin. Another approach is to
incorporate digoxigenin-11-(d)UTP into the DNA
probe and then subsequently detected with enzyme-
linked antibody against the digoxigenin. A
third method is to directly cross-link HRP
to the DNA probe.
Radioactive probes are generally
more sensitive and reliable. However,
non-radioactive probes can be adapted to
many applications and eliminate some of
the problems associated with the use of radioactivity such as waste disposal and safety issues. In
addition, the use of non-radioactive probes is are particularly advantages in situation where the
same probe is going to be used over a long period of time. The short half-life of
32
P (14 days)
necessitates that the probe be prepared on a monthly basis, whereas large amounts of a non-
radioactive probe can be prepared and stored for long periods of time.
Insoluble substrates, as described for Western blots, or chemiluminescent substrates can
be used in association with Northern and Southern blots. Chemiluminescent substrates produce
light when cleaved by the appropriate enzyme and this light is detected by autoradiography.
Substrates for both alkaline phosphatase (1,2 dioxetane) and peroxidase (luminol) are available
(figures). The use of chemiluminescence allows the blot to be striped and reprobed.
Labeling/Detection Systems
Biotin/Streptavidin
Digoxigenin-UTP/Antibody
Enzyme Crosslinking
163
RFLP AND RESTRICTION MAPPING
Restriction fragment length polymorphisms
(RFLP) refers to the gain of loss of restriction sites
associated with a genetic locus. These polymorph-
isms can be used to distinguish species, strains or
even individuals. Single nucleotide mutations can
result in the loss or gain of restriction sites, and thus
generate different sized DNA fragments associated
with that locus. The typical procedure is to digest the
target DNA with a restriction enzyme(s), separate the
fragments by gel electrophoresis, and to detect the
fragments of interest by Southern blotting (Figure).
The changes causing the size polymorphisms do not
have to be directly associated with the genetic locus
being used for a probe.
RFLP applications range from determining
specific mutations associated with a particular gene
to a genetic 'fingerprinting'. The optimal restriction
enzyme(s) and probes will need to be empirically determined for a particular application. A
limitation for the application of RFLP is that relatively large amounts of highly purified DNA
are needed for many applications. In addition, the procedure is laborious and can take several
days to carry out.
Restriction Mapping. Genetic loci can be defined by restriction maps which show the
relative positions of restriction sites. The maps can be generated from sequence data or
determined experimentally when sequence data is not available. Restriction maps are generated
by digesting DNA with different combinations of enzymes and analyzing the digests by gel
electrophoresis or Southern blotting. The sizes of the fragments will indicate the distant between
restriction sites. The general procedure is to digest the sample DNA with individual restriction
enzymes and combinations of the enzymes. The change in the size of the restriction fragments
in double digests is used to determine the relative positions of different restriction sites.
For example, in the situation on the left (see figure below) digestion with enzyme A
produces and single 10 kb fragment and digestion with enzyme B produces a single 8 kb
fragment. Carrying out a double digest with a mixture of enzymes A and B would result in the
same 8 kb fragment as digesting with enzyme B alone. This indicates that both of the B
restriction sites are between the A restriction sites, but no information about the distance
between site A and site B is obtained. If the situation is as depicted on the right, then a fragment
that is < 8 kb is produced. The size of this fragment will indicate the distance between the A and
B restriction sites. A more precise map can be generated in both situations if all of the
restriction fragments are detectable.
164
IN SITU HYBRIDIZATION
Cell or tissue specific gene expression
can be determined by in situ hybridization.
Tissues are fixed on slide and hybridized with
cDNA probes. The cells expressing the gene of
interest are detected by autoradiography. The
cells expressing the gene of interest are identi-
fied by the reduced silver grains (dark areas in
figure) after development of the photographic
emulsion. The probes are usually made with
35
S rather than
32
P. The probes can also be
labeled with fluorochromes and detected by
fluorescent microscopy. In situ hybridization is
commonly used in developmental biology to
determine when and where developmentally
regulated genes are expressed.
165
DNA MICROARRAYS
Most of the hybridization methods are designed to analyze one gene at a time. The DNA
microarray technology, also called gene chips, genome chips, biochips, DNA chips, provides a
means to simultaneously analyzed thousands of the genes. The array is an orderly arrangement
of known DNA samples. Sample spot sizes in macroarrays are generally > 300 microns in
diameter and can be imaged with conventional gel and blot scanners. Microarrays contain
thousands of spots that are generally less than 200 microns in diameter. Preparation of
microarrays requires specialized robotic equipment and analysis of the microarrays requires
special imaging equipment.
The DNA microarray is fabricated by spotting known DNA samples, or 'probes', on a
solid support such as glass or nylon through the use of high speed robotics. The probes can
either be known cDNA sequences (500-5000 bases) or synthetic oligonucleotides (20-80
nucleotides). The array is then exposed to flourescent-labeled cDNA prepared from total
mRNA. This free 'target' DNA will bind to the spots containing homologous sequences. The
identity and abundance of the complementary sequences can then be determined. It is also
possible to mix DNAs prepared with different fluorescent labels. Signals are measured as
absolute intensities for a given target, or as ratios of two probes with different fluorescent labels
representing two separate treatments to be compared or with one probe as an internal control.
http://www.bsi.vt.edu/ralscher/gridit/intro_ma.htm
167
CHAPTER 20--POLYMERASE CHAIN REACTION
One problem with detecting specific DNA sequences,
especially those of unique genes, is that a relatively large amounts
of pure DNA are needed. In addition, blotting techniques are
laborious and time consuming to carry out. To circumvent these
problems it is possible to enzymatically amplify a specific region
of DNA using the polymerase chain reaction (PCR). The ability
to detect minute amounts of specific DNA sequences has resulted
in the broad application of PCR for diagnosis, forensics,
molecular epidemiology, etc. In addition, PCR is an integral
aspect of many methods, such as gene cloning and sequencing.
PCR MECHANISM
PCR amplifies a specific segment of
DNA that lies between two known primer
sequences. DNA strands are separated by
heating and then annealed with a pair of
primers which are complementary to the
opposing strands (Figure). DNA polymerase
recognizes this small region of duplex DNA as
a substrate and in the presence of nucleotides
will synthesize the complementary strands of
both template strands. If this procedure is
repeated, the newly synthesized fragments also
serve as templates for subsequent rounds
resulting a geometric amplification. The end
product of PCR is a dsDNA molecule that is
defined by the 5'-ends of the primers. In other
words, the length of the DNA molecule is
determined by the distance between the
primers.
Typically, PCR results in a million-fold
amplification of the target DNA. Therefore,
sequences that only represent a small
proportion of the total DNA can be detect after
PCR and generally the DNA does not have to be highly purified. Furthermore, the procedure is
relatively easy to carry out and does not require expensive equipment or reagents.
One of the major factors in the success of PCR is the use of DNA polymerases isolated
from thermophilic organisms such as Thermus aquaticus. Taq polymerase is thermostable and
exhibits an optimal temperature for activity at 72-74
o
. Other thermostable DNA polymerases are
also available. The temperature necessary for the separation of DNA strands will destroy the
DNA polymerase activity from other sources. In addition, the optimal temperature for activity
PCR Applications
Diagnosis
Taxonomy
Forensics
Molecular
Epidemiology
Gene Expression
Sequencing
Gene Cloning
Probe Generation
Site-Directed
Mutagenesis
168
(i.e., 37
o
) would result in low stringency hybridization leading to the synthesis of irrelevant
fragments. The need to change the temperature during the PCR procedure (i.e., denaturation,
primer annealing, polymerization) requires a thermocycler. The thermocycler is an instrument
that rapidly and accurately changes the temperature of a metal block designed to hold 0.5 ml
microcentrifuge tubes.
PRACTICAL ASPECTS
The first step of PCR is to combine the template
DNA, primers, dNTPs, Mg
2+
and Taq polymerase in a
single tube (Box). Special thin-walled tubes of uniform
thickness are used to ensure rapid and equal temperature
changes throughout the reaction volume. Typical concentrations are approximately 0.1 pM of
the target DNA, 2 nM of primers with a T
m
> 55
o
, 20-200 M dNTPs (lower concentrations
lessen mispriming), and 2 units of enzyme. The optimal Mg
2+
concentration depends upon the
total dNTP concentration which includes: free dNTPs, primers, and template DNA. Since the
template DNA is the most variable, it is generally necessary to titrate the optimal Mg
2+
concentration for different sources of templates. In addition, the EDTA (a typical component of
buffers used for nucleic acid isolations) will affect the free Mg
2+
concentration.
The thermocycler is programmed for the desired times and temperatures of denature-
tion, annealing and polymerization (Table). The optimal conditions are determined empirically.
Most thermocyclers can also be programmed to vary these parameters in different cycles. For
example, the denaturation step in the first cycle is sometimes carried out for 2-5 minutes to
ensure a more complete melting of the target DNA. Likewise, after the last polymerization
cycle it is possible to lower the temperature to 4
o
(i.e., storage conditions).
PCR Parameters
STEP TEMP TIME NOTES
Denature 94-96
o
0.5-2 min
longer times denaturation, but
enzyme and template
Annealing 15-25
o
< T
m
0.5-2 min
higher temp. and shorter times
specificity, but yield
Polymerization 72-75
o
~1 min (<kb)
Taq processivity = 150
nucleotides/sec
The oligonucleotide primers are the most
critical element in terms of successful PCR (Box).
Computer programs are used to examine DNA sequen-
ces for potential primers. One consideration is distance
between the primers. Smaller DNA fragments are
amplified more efficiently than longer DNA fragments
and it is often particularly difficult to amplify frag-
ments larger than one kb. The primers should also be
unique in that they should not hybridize to other sites
in the target DNA. Generally primers of 20 nucleotides or greater will provide a satisfactory
PCR Procedure
1. Mix DNA, primers, dNTPs
and Taq polymerase.
2. Set the thermocycler for
desired times.
3. Analyze amplified DNA.
Primer Design
template length
uniqueness (18-28 bases)
no primer dimers
no internal complementarity
50% GC ratio
3'-GC 'caps'
HPLC purification
169
level of uniqueness. The primers should not exhibit complementarity to each other or internal
complementarity within a primer. Both of these will phenomenon will prevent the primer from
annealing to the template DNA. A balance nucleotide composition also tends to improve the
function of a primer. Designing a primer so that the last one or two bases on the 3'-end are either
a G or a C will result in a stronger hybridization and ensure recognition by the polymerase.
Purifying the primers by HPLC will improve their fidelity, but is not absolutely necessary.
Amplified DNA is analyzed by gel electrophoresis. In most applications the desired
result is a single band, or amplicon, detectable with ethidium bromide. Primers are usually
designed so that a sample can be tested for the presence or absence of the expected band. Size
heterogeneity can be determined if exhibited by that particular locus. Southern blotting of the
PCR products can also be carried out for either increased sensitivity or specificity.
Generally 25-30 cycles will yield the maximum amount of amplification. This is due to
loss of enzyme activity associated with the high temperatures and to the accumulation of pro-
ducts that inhibit or interfere with the amplification. Such products include fragments synthe-
sized as a result of mispriming and short fragments formed as a result of the polymerase
dissociating from the template before reaching the opposite primer. Subjecting the sample to a
second round of amplification can increase the sensitivity. Typically the reaction product from
the first cycle is diluted by a 100-1000 fold and the primers, nucleotides and polymerase are re-
added. Similarly, a nested PCR can be designed in which a second amplification is carried out
using a primer pair internal to the first set of primers (Figure).
Primers for Nested PCR
Site Directed Mutagenesis
PCR can also be used to manipulate DNA. For example, site-directed mutagenesis
can be carried out by designing primers with single nucleotide mismatches. Since
the primers serve as templates in subsequent rounds of DNA replication the PCR
products will contained the introduced nucleotide. Similarly, restriction sites are
easily added to the PCR products for subsequent subcloning as illustrated by the
following figure:
170
RNA-PCR
It is also possible to use PCR for the analysis of RNA and gene expression. This
method, called RNA-PCR or RT-PCR, detects specific transcripts and exhibits a greater
sensitivity than Northern blotting. The first step of RT-PCR is to make a DNA copy of the
mRNA (i.e., cDNA). The copy is made using reverse transcriptase (RT), an enzyme of
retroviruses which exhibits RNA-dependent DNA polymerase activity. There are three basic
strategies for the synthesis of cDNA: specific priming, oligo-dT priming, or random priming
(Figure). The cDNA is then subjected to PCR using a specific primer pair.
QUANTITATIVE PCR
Information obtained from PCR is primarily qualitative. The major problem is that
the analysis is an end-point determination. Since the inhibitory affects accumulate the
differences in the initial template concentration will be masked. In addition, quantification
of the end-point amplification product usually requires some post-amplification handling
which increases the labor and time of the assay.
One approach to obtaining quantitative information is to include a competitive
reporter with the template DNA. This reporter has the same primers as the target DNA, but
produces a different size amplicon. The target DNA is mixed with increasing known
amounts of the competitor and analyzed by PCR and gel electrophoresis. Since the reporter
and the target DNA are in the same tube, they will be similarly inhibited. Therefore, the
amount of the respective amplicons produced will be proportional to the initial template
concentrations. Approximately equal amounts of competitor and target amplicons will be
produced when their respective template concentrations are equal, and therefore, the amount
of target DNA (i.e., number of copies) can be estimated from the amount of reporter known
to be in that sample.
Another method for estimating the concentration of target DNA is by 'real time'
171
PCR. Real time PCR utilizes fluorescent probes for the detection of PCR products and
requires a special thermocycle (i.e., 'light cycler') which monitors fluorescence during the
reaction. The simplest method to monitor the accumulation of PCR products is to include a
dye in the PCR reaction which fluoresces when intercalated into dsDNA. SYBR green is the
most widely used dye for this application. The dye binds to the double-stranded PCR
products and fluoresces. Fluorescence is measured during the extension stage of each cycle
and thus represents the the accumulation of PCR products during the reaction. The cycle in
which significant fluorescence is first detectable is inversely proportional to the amount of
initial template. A standard curve can be prepared from this threshold cycle (C
t
) and the
template concentration of known standards. The amount of template present in an unknown
sample can then be extrapolated from this standard curve.
Since these dyes bind to any dsDNA, specificity can be a problem. This is especially
true towards the end of the PCR cycles when more non-specific products may be
accumulating. Furthermore, it is not possible to quantify multiple PCR products within the
same sample (i.e., multiplexing). Several single-stranded DNA detection methodologies
have been developed to overcome these limitations. Two examples include hydrolysis
probes (aka, F-Q probes or Taqman probes) and molecular beacons. Both of these methods
rely upon the use of specific probes to the amplified sequence which have been coupled with
fluorochromes and quenchers, thus adding some expense to the these assays. Through the
use of fluorochromes with different emission spectra it is possible to develop multiplex
assays in which differenent PCR products can be monitored simultaneously in the same
sample.
Hydrolysis probes. A probe homo-
logous to a sequence between the two
primers is designed. One end of the probe
contains a fluorochrome (eg., 5') and the
other end contains a quencher (eg., 3').
The energy of the excited fluorochrome is
transferred directly to the quencher and
therefore this probe does not fluoresce.
During annealing the probe also
hybridizes to the target DNA. As the
polymerase progresses down the template during the extension reaction the endogenous 5'-
172
exonuclease activity digests the F-Q probe and thereby releases the fluorochrome and
quencher. The fluorochrome and quencher are no longer held together in close proximity
and therefore the free fluorochrome fluoresces. Free fluorochrome accumulates after each
cycle and the fluorescence intenesity is a measure of the amount of specific PCR product.
There tends to be a high background associated with the F-Q probes since the fluorochrome
and quencher are separated by approximately 20 nucleotides.
Molecular beacons. Probes which form 'hiarpins'
have been designed to improve the intramolecular
quenching. As in the case of the F-Q probes a probe
homologous to a sequence between the primers is
designed. Complementary sequences are added to each
end as well as the the fluorochrome and quencher. These
complementary sequences will anneal and therefore
force the fluorochrome and quencher in close proximity
and thus increase the efficiency of quenching.
Hybridization of the probe to the target DNA results in
fluorescence since the fluorochrome and quencher are
now held far apart. As in the case of using non-specific
dsDNA binding dyes, the fluorescence is only observed
during the annealing step. During the extension reaction the probe is displaced and will be
recycled.
Special considerations are needed for probe and primer design in both the Taqman
and molecular beacon assays. The optimal amplicon length for both assays is 50-100 bp. In
both cases the probe needs to bind to the target in a quantitative manner and with the desired
specificity. The T
m
of the probe-target hybrid should by 8-10
o
C above the annealing temper-
ature of the PCR reaction. This is usually obtained with probes of 20-26 nucleotides. The
exact length will depend on GC content and the amount of tolerance for mismatches. The
stem region for the molecular beacon probes should also exhibit a T
m
of 8-10
o
C above the
annealing temperature so that unhybridized probe is kept in the non-fluorescent conforma-
tion during the annealing step. Stems of six nucleotides, of which five are G:C pairs are
usually the optimum.
LIMITATIONS
One limitation of PCR is that only DNA between two known
primer sequences is amplified, thus making it difficult to analyze
unknown sequences. Modifications of the PCR method which overcome this limitation have
been described (Box).
Inverse PCR (also known as chromosome crawling) is a method to amplify the
sequences flanking a known sequence. Genomic DNA is digested with a restriction enzyme
which produces appropriately sized fragments (eg., 3-5 kb) containing the target sequence. The
fragments are circularized with DNA ligase and amplified with primers that are directed away
from each other. This results in the amplification of the sequences that directly flank the known
inverse PCR
anchor PCR
RAPD
AFLP
173
sequence. The boundary between the two flanking sequences is demarcated by the restriction
site used to disgest the genomic DNA.
Known sequences, or 'anchors', can be also added to
unknown sequences and used as the source of PCR primers.
This anchor PCR is often used to amplify the unknown 5'-end
of a cDNA (i.e., mRNA). (Sometimes called RACE for rapid
amplification of cDNA ends.) In this method a cDNA copy of
the mRNA is made using a primer based on known sequence
(P1). A homopolymer tail is added to the 3'-end of the cDNA
with terminal deoxynucleotide transferase. A primer
containing sequence complementary to the homopolymer tail
(P3) is used in conjuction with a primer from the known
sequence (either P1 or P2) to amplify the target DNA.
Random portions of the genome can also be amplified
as a means to identify polymorphisms without prior
knowledge of the particular polymorphism. For example,
random amplified polymorphic DNA (RAPD), also called
arbitrarily primer PCR (AP-PCR), uses short (usually 10
nucleotides) random sequence primers to amplify random
portions of the genome. These short primers will
anneal to a number of locations within a genome
and in loci with inverted repeats the appropriate
distance apart an amplicon will be produced. The
fingerprint of DNA fragments can then be
compared between species or strains and
analyzed for polymorphisms. The RAPD method
has several advantages as an assay for
polymorphism. However, it does tend to exhibit
poor reproducibility.
Another method based on the amplifica-
tion of random portions of the genome is ampli-
fied fragment length polymorphisms (AFLP). The
advantage of this method over RAPD analysis is
that the polymorphisms are based on restriction
sites and not primer binding. Therefore, AFLP
analysis tends to be more reproducible than RAPD
analysis. The first step in AFLP analysis is to
digest genomic DNA with two restriction
enzymes. Typically one of the enzymes has a 6-
base recognition sequence and the other a 4-base
recognition sequence. The DNA is then ligated with adaptors corresponding to the two
restriction sites and PCR using primers based on the adaptor sequences are carried out in the
Advantages of RAPD
requires small amounts of DNA
(15-25 ng)
no prior sequence information
needed
easily produced and screened
relatively easy to convert into
more reproducible PCR assay
174
presence of either radioactive nucleotides or fluorochrome-labeled nucleotides. The PCR
products are analyzed on sequencing gels for polymorphic fragments. Both AFLP and RAPD
are used to identify strain or species specific markers similar to RFLP analysis. However, much
less DNA is need and these methods are less laborious and time consuming than traditional
RFLP analysis.
PRECAUTIONS
The ability of PCR to amplify minute amounts of
DNA is not only a strength, but also a potential weakness.
Under controlled situations amplification of a single copy of
DNA has been demonstrated. This ability poses a serious
problem in terms of contamination of buffers and samples
with unwanted DNA. Precautions against spurious contami-
nation need to be taken (Box). It is also advisable to include a control sample (no target DNA
added) in every PCR run.
Precautions
avoid contamination
aliquot reagents
add target DNA last
no target DNA control
prepare + control
elsewhere
175
CHAPTER 21--RECOMBINANT DNA
Molecular cloning, or recombinant DNA, is the process by which a single gene, or
segment of DNA, is isolated and amplified. This is accomplished by recombining DNA
fragments in vitro and then propagating the DNA fragments of interest. A source of nucleic
acids and the ability to manipulate them are needed to carry out molecular cloning (Box).
The source and type of nucleic acid will depend on
the gene being cloned and the species of interest. The vector,
when introduced into the appropriate host, is a replicating
piece of DNA. The foreign DNA is recombined with a
vector, which is then replicated by the host. Available
cloning vectors include plasmids, phage/viruses, or some
combination of the two. Phage, short for bacteriophage, are
viruses of bacteria.
In order to carry out recombination between the
vector and the foreign DNA, it is necessary to specifically and reproducibly cleave DNA.
Restriction enzymes cleave DNA in a site specific manner and thus provide this requirement.
DNA ligase is an enzyme that covalently joins two pieces of DNA. Therefore, restriction
enzymes and DNA ligase allow for the recombination of foreign DNA with vector DNA.
The DNA of interest is amplified by introducing the recombinant DNA (rDNA) into a
compatible host. The vector is replicated by the host. The introduction of vector in the host
depends upon the nature of the vector and host. For example, some viral vectors can be
introduced by infection. Introduction of naked viral DNA or plasmid DNA is referred to as
transfection and transformation, respectively. Finally a means to detect the molecular clone
of interest, or a screening mechanism, is needed.
PREPARATION OF FOREIGN DNA
The two major sources of foreign DNA for molecular cloning are genomic DNA
(gDNA) and complementary (or copy) DNA (cDNA). Complementary DNA is prepared by
making a copy of mRNA. One consideration in deciding whether to use gDNA or cDNA is the
copy number and the level of expression of the gene of interest. Single copy genes in large
genomes may require extensive screening. A gene expressed at high levels, though, will require
less screening to isolate a cDNA clone. Conversely genes expressed at low levels will be
difficult to detect in cDNA libraries. In addition, some genes may only be expressed at certain
times or in certain tissues that are inaccessible or unavailable, thus necessitating gDNA
libraries.
One also needs to consider how the recombinant DNA library will be screened and the
questions that will be asked about the cloned gene. For example, many eukaryotic genes contain
'introns' which will result in an interruption of the open reading frame. Therefore, cDNA is
usually a better starting material if an expression library is going to be screened or if the cloned
gene is going to be used for the production of recombinant protein. Similarly, comparing gDNA
Cloning Needs
foreign DNA
vector + host
means to cleave DNA
ability to join DNA
fragments
introduction of rDNA
into host
screening mechanism
176
and cDNA will allow for a precise mapping of the introns and splice sites.
Fragmenting gDNA. The extreme length of gDNA
necessitates that it be fragmented into smaller pieces before
molecular cloning (Box). The size of the DNA fragments
should take into account the vector capacity and the size of the
desired clone. Restriction enzymes reproducibly cleave DNA
at specific sites which are relatively easy to ligate into
restriction sites of vectors. If some randomness is needed (eg., expression libraries and
overlapping clones), it may be possible to carry out the digestions under 'star' conditions or to
use frequently cutting enzymes under conditions where the target DNA is only partially
digested.
Preliminary Southern blots are often carried out when a DNA probe is available. The
gDNA is digested with several different enzymes and analyzed for appropriate sized fragments.
The appropriateness of the size depends on the size of the genetic locus and the vector being
utilized. After deciding which restriction enzyme(s) is the most appropriate, a sufficient quantity
of DNA is digested and electrophoresed. The region of the gel corresponding to the desired size
range is excised and the DNA isolated. This size-fractionated DNA is then used to prepare a
library.
It is also possible to use a non-specific nuclease under controlled conditions to cleave
gDNA into appropriately sized pieces. For example, DNAse I in the presence of Mn
2+
will
cleave dsDNA at approximately the same site on both strands. Pilot experiments are carried out
to determine the optimal DNase/DNA ratios for the production of the desired sized fragments.
An application of this method is in 'shotgun' sequencing strategies which result in the
production of several overlapping clones. Mung bean nuclease in the presence of formamide
will also randomly cleave dsDNA.
DNA can also be broken by mechanical shear forces. Passage of a DNA solution
through a small gauge syringe needle or sonication will result in the DNA molecule being
broken in random positions. Following fragmentation by either method the DNA can be size
fractionation by either rate zonal centrifugation on sucrose gradients or by gel electrophoresis.
Restriction sites can be added to the ends of the gDNA fragments to increase the efficiency of
cloning (see below) as compared to blunt-end ligations.
PCR fragments can also be cloned. Amplifying DNA fragments of interest before
cloning will eliminate, or at least reduce, the screening of recombinant DNA libraries. However,
the cloning of PCR fragments is less efficient than anticipated due to the non-template
dependent addition of a single nucleotide to the 3'-end of PCR products by many thermostable
DNA polymerases. The most frequently added nucleotide is an adenosine residue. Vectors
containing a single 3'-T overhang (i.e., TA cloning) greatly enhances the efficiency of cloning.
In addition, it is possible to generate a restriction site during the amplification process (see
PCR).
Fragmenting gDNA
restriction enzymes
random nucleases
mechanical shearing
177
Preparing cDNA Libraries. The preparation of cDNA
from mRNA is a multistep process (Box). The first step in
preparing cDNA is to isolate mRNA. mRNA tends to be less
stable than DNA and requires more precautions than gDNA.
In addition, an enrich source of mRNA of interest can be
used. Enrichment for a particular mRNA could include:
choice of species, tissue, developmental stage, induction of
expression (eg., hormones), etc. It may also be possible to
enrich for the mRNA of interest by size fractionation,
immunological purification of polysomes, or substractive libraries. The integrity of mRNA
should be evaluated by Northern blotting and/or in vitro translation before proceeding with the
preparation of the library.
After obtaining the desired mRNA a DNA-RNA hybrid is synthesized with reverse
transcriptase (RT). Reverse transcriptase is a RNA-dependent DNA polymerase isolated from
retroviruses. In the presence of a mRNA template and primer, RT will copy the RNA template
resulting in the formation of a DNA-RNA hybrid. An oligo-dT primer of 12-18 bases in length
is used to initiate synthesis on poly-A messenger RNA. Sequences corresponding to restriction
sites can also be included in the oligo-dT primer. For example, a common primer-linker for the
synthesis of cDNA is 5'-(GA
10
)ACTAGTCTCGAG(T)
18
-3' which includes SpeI and XhoI sites.
Random priming can also be used to increase the chances of obtaining the 5'-end of long mRNA
or if the mRNA of interest lacks a poly-A tail.
Three Methods for the Synthesis of cDNA 2nd Strands
The RNA strand is replaced with a second DNA strand following the synthesis of the
RNA-DNA hybrid. Three methods for synthesizing the 2
nd
DNA are: 1) self-priming, 2)
Preparation of cDNA
1. Isolate mRNA
2. Synthesize DNA-RNA
hybrid
3. Synthesize 2
nd
DNA
strand
4. Add termini
178
replacement synthesis, and 3) primed synthesis (Figure). In self-priming the RNA-DNA hybrid
is denatured by heating or the RNA is hydrolyzed with NaOH. The 3'-termini of single-stranded
cDNA forms a hairpin loop that can function as a primer for DNA polymerase. Following the
completion of second strand synthesis, the ssDNA loop is then removed with S1 nuclease. The
self-priming is a poorly controlled reaction and treatment with S1 nuclease sometimes leads to
loss of the 5'-end of the message.
Replacement synthesis uses the DNA-RNA hybrid as a template for a 'nick
translation' reaction. The DNA-RNA hybrid is treat with RNAse H which produces nicks in
the RNA strand. The nicked RNA then functions as primers for DNA polymerase. In primed
synthesis, a homopolymeric tail (or other known sequence is added to the 3'-end using
terminal transferase (TdT). A primer complementary to the homopolymer tail is then used to
synthesize the second strand. This method may result in a higher efficiency of recombinant
clones containing the complete 5'-end of the message.
The synthesis of cDNA results in blunt-end DNA
without convenient restriction sites for cloning into
vectors. Linkers are added to the termini of the cDNA
molecules which will provided the necessary restriction
sites (Figure). Restriction sites within the insert DNA are
protected by methylation prior to the addition of the
linkers. The overhangs are then generated by digestion
with the appropriate restriction enzyme. The use of primer-
linkers allow for different restriction sites on the 5'-end and
the 3'-end (i.e., poly-A tail) and directional cloning.
Another strategy to create sticky ends is to add
complementary homopolymer tails with TdT to both the
insert DNA and the vector.
PLASMID VECTORS
Recombinant DNA vectors function as carriers
of the foreign DNA. Plasmids are extra-chromosomal
genetic elements found in a variety of species and are
widely used in molecular cloning. They are autono-
mously replicating circular DNA molecules that range in size from 1-200 kb. Their replication
can be under either stringent control (low copy number) or relaxed (high copy number).
Stringent control means that the plasmid is only replicated when the genome is replicated,
whereas relaxed plasmids are replicated continuously. Many plasmids confer antibiotic
resistance and are naturally transmitted between bacteria by conjugation.
Naturally occurring plasmids have been modified to make them more useful as cloning
vectors (Box). To be useful as cloning vectors, plasmids need to be relatively small, replicate in
relaxed fashion, have selectable markers (eg., antibiotic resistance) and contain unique
restriction sites. The most widely used plasmids are derivatives of either pBR322 or pUC
(where the lower case 'p' means plasmid). Typically modifications of plasmids include the
Useful Plasmid Features
relaxed replication
selectable markers
streamlined
unique restriction sites
recombinant identification
179
removal of unnecessary portions, or streamlining, and the introduction of several useful
restriction sites in one location. These restriction sites, call the multiple cloning site (MCS) or
polylinker, facilitate DNA cloning. This MCS is usually located within a gene which allows for
easy identification of recombinants.
Recombining target DNA with vector.
The first step in cloning involves
preparing the foreign or target DNA and
simultaneously preparing the plasmid
vector (Box). The exact method for
preparing the foreign DNA will depend on
the source of the nucleic acid and the nature of the gene
being cloned. For example, genomic DNA can prepared by
digesting with appropriate restriction enzyme(s). The
digested DNA can also be size-fractionated on agarose gels
and the desired size range of DNA fragments excised from
the gel.
The vector is prepared by digesting the plasmid
with the restriction enzyme(s) that are compatible with the
foreign DNA. Recombinant DNA molecules are generated
by simply mixing the prepared vector DNA with the
prepared foreign DNA in the presence of DNA ligase
(Figure). The complementary overhangs, or 'sticky-ends',
produced by the restriction enzyme(s) allow the foreign
DNA and vector DNA to transiently anneal. DNA ligase
catalyzes the formation of a phosphodiester bond between
a 5'-phosphate and a 3'-hydroxyl (Figure) and will result in
the covalent joining of DNA fragments. Typically, equal
molar amounts of vector and foreign DNA are mixed
during the ligation reaction to minimize the formation of
recombinants with tandem copies of the insert. The molar
ratio of vector to foreign DNA can be increased (eg., 1.5-2) to increase the amount of target
DNA incorporated into plasmids. Ligation reactions are usually carried out at lower
temperatures (8-15
o
) for extended time periods (2-24 hours) to promote the annealing of the
short (2-4 base) overhangs.
Generic Recombinant DNA Protocol
1. Prepare foreign DNA.
2. Prepare vector.
3. Combine foreign DNA with vector.
4. Introduce recombined vector into host.
5. Screen for rDNA of interest.
Example of a multiple cloning site
| SacI | | ScI I | | XbaI | | SpeI | | BamH| | SmaI | | PstI | | EcRI | | EcRV| | HI I I | | ClaI | | SalI | | XhoI | | KpnI |
GAGCTCCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGATATCAAGCTTATCGATACCGTCGACCTCGAGGGGGGGCCCGGTACC
CTCGAGGTGGCGCCACCGCCGGCGAGATCTTGATCACCTAGGGGGCCCGACGTCCTTAAGCTATAGTTCGAATAGCTATGGCAGCTGGAGCTCCCCCCCGGGCCATGG
180
During DNA ligations the vector can
ligate with itself in cases were the vector has
identical overhangs on both ends (including
blunt-ends). This intramolecular formation of
circles is kinetically favored and many of the
vectors will not contain insert DNA (i.e., be
non-recombinants). The formation of non-
recombinants is minimized by treating the
vector with phosphatase prior to the ligation
step. This pretreatment favors the formation of
recombinants since DNA ligase requires a 5'-
phosphate, which can now only be supplied by the foreign DNA insert (Figure).
Commonly used phosphatases are calf intestinal alkaline phosphatase (CIAP) and
shrimp alkaline phosphatase (SAP). SAP is inactivated by moderately high temperatures
whereas CIAP is more stable and requires higher temperatures or proteinase K treatment for
complete inactivation. The phosphatase activity needs to be completely inactivate before mixing
the vector with the foreign DNA so that the 5'-phosphates are not removed from the insert
DNA. The efficiencies of removing the 5'-phosphate from overhangs (i.e., extensions), recessed
ends, or blunt ends are different and the reaction conditions need to be adjusted accordingly.
The completeness of the phophatase step is easily checked by carrying out a ligation and
transformation without insert DNA and comparing the number of colonies formed to the
number of colonies obtained with an equal amount of plasmid which was not treated with
phophatase.
Ligation of DNA Fragments into Plasmid Vectors
TERMINI
CLONING
REQUIREMENTS COMMENTS
Identical
Overhangs
Phosphatase treatment of
linear plasmid improves
efficiency.
Restriction sites at junctions preserved.
Both orientations of insert DNA possible.
Tandem copies of insert possible.
Blunt-end
High concentrations of DNA
and ligase needed.
Phosphatase treatment.
Restriction sites at junctions often
eliminated. Tandem copies of insert DNA
possible. Both orientations possible.
Different
Overhangs
Purification of double-cut
plasmid increases
efficiency.
Restriction sites at junctions preserved.
Background of non-recombinants is low.
One possible orientation of insert. Tandem
copies unlikely.
181
The vector and foreign DNA can also be prepared with restriction enzymes that produce
blunt ends. The advantage of blunt ends is that all blunt ends are compatible. However, the
restriction sites will be lost or changed when blunt ends from different restriction enzymes are
ligated together. In addition, the ligation efficiency is much lower because there are no cohesive
termini to temporarily hold the two DNA fragments together. Therefore, higher DNA
concentrations (both vector and foreign) and DNA ligase concentrations are needed for blunt-
end ligations.
Plasmids with different protruding termini can also be prepared. Advantages of different
termini are a low background of non-recombinants, tandem copies of the insert DNA are less
likely, and the insert DNA can only be in one orientation.
Transformation and Screening.
Following ligation, the rDNA is
introduced into the host. Bacteria, and in
particular E. coli, are typically used as host
cells. The two most common methods used
to transform bacteria with plasmids are
'heat-shock' and 'electroporation'. In both
cases the bacteria must be made 'competent'
(i.e., ready to receive the DNA). In the heat
shock method the bacteria are pretreated with
CaCl
2
. The competent cells are incubated
with the recombined plasmid to allow DNA
to bind to the bacteria surface and then
briefly incubated at 40-42
o
. The heating
increases the fluidity of the membrane and
Transformation Efficiency
5000 bp/plasmid
X 660 daltons/bp
= 3x10
6
g/mole plasmid
X 10
6
g/g
= 3x10
12
g/mole plasmid
1/X 3x10
-13
moles/g DNA
X 6x10
23
plasmids/mole
= 2x10
11
plasmids/g DNA
Heat Shock
(10
5
-10
9
colonies/g DNA)
Electroporation
(10
9
-10
10
colonies/g DNA)
182
supposedly opens up temporary 'pores' in the bacterial membrane that allows the DNA to enter.
The efficiency of heat shock is typically 10
5
-10
9
colonies per g DNA, which is
relatively low. For example, a 1 g of a 5 kb plasmid will contain approximately 2 x 10
11
copies. This means that even at an efficiency of 10
9
colonies per g of DNA only 0.5% of the
plasmids were taken up by bacteria during transformation. Electroporation exhibits efficiencies
of 10
9
-10
10
colonies per g DNA and can be used for the transformation of prokaryotic cells. In
electroporation, the competent cells are exposed to pulses of high voltage which will produce
transient pores in membranes and permit DNA uptake. With both electroporation and heat
shock the efficiency of transformation decreases with increasing plasmid size.
After transformation with the recombinant
plasmids the bacteria are plated on antibiotic containing
media (Figure). The antibiotic will kill the bacteria
which do not contain plasmid. Therefore, all of the
colonies will represent bacteria with plasmid. However,
the bacteria will have different plasmids and it will be
necessary to identify the clone of interest by screening the rDNA library. A common method for
screening rDNA libraries is to use a 'DNA probe' which hybridizes to the recombinant clone of
interest. Sources of DNA probes include previously cloned genes or synthetic oligonucleotides
that exhibit sequence homology to the gene of interest (Box). For example, a previously cloned
gene from another species that is homologous to the gene of interest can be used as a DNA
probe. It is also possible to make a synthetic oligonucleotide probe from highly conserved
regions of known genes. Screening expression libraries with antibodies raised against the
protein of interest is also possible (see section on expression).
In situations where a homologous gene has not been cloned or not much is known about
the gene of interest it may be possible to develop a probe based upon a partial protein sequence
(referred to as reverse genetics). A mixture of synthetic oligonucleotides, based upon all the
possible codons for the polypeptide sequence, is synthesized and used to screen the recombinant
DNA library. If possible, the amino acid sequence should be chosen to minimize the
redundancy of the genetic code (see Table). For example, methionines and tryptophans, since
they only have one possible codon, and amino acids with only two possible codons are
especially useful. Conversely, amino acids with six possible codons should be avoided.
Codons for Hypothetical Heptapeptide
Met Trp Glu Leu Ile Ala Gly
ATG (100) TGG (100) GAA (87) CTT (11) ATT (40) GCT (42) GGT (47)
GAG (13) CTA (7) ATA (53) GCA (43) GGA (46)
CTG (2) ATC (7) GCG (4) GGG (3)
CTC (2) GCC (11) GGC (3)
TTA (64)
TTG (13)
Corresponding degenerate oligonucleotide for the heptapeptide:
Sources of Probes
previously cloned genes
synthetic oligonucleotides
mixed oligonucleotides
antibodies
183
A-T-G-T-G-G-G-A-R-Y-T-N-A-T-H-G-C-N-G-G-N
1x1x1x1x1x1x1x1x2x2x1x4x1x1x3x1x1x4x1x1x4 = 768
It may be possible to decrease the number of degenerate oligonucleotides by adjusting
for the codon usage in the species of interest. Many organisms exhibit a codon-usage bias in
that not all codons are used at equal frequencies (see http://www.kazusa.or.jp/codon/ for codon
usage tables). For example, the numbers in parentheses are percentages for each the codons in
Plasmodium falciparum. Since Plasmodium species have an AT-rich genome (approximately
80%) the third codon position is very biased towards A and T and it is possible to make less
degenerate probe which still may hybridize to the target sequence.
A 'colony lift' is used to detect
bacteria containing plasmids of interest
(Figure). In this procedure, a DNA probe
is used to screen the rDNA library
utilizing blotting techniques as discussed
previously. The transformed bacteria are
grown on agar plates in the presence of
antibiotic. When bacterial colonies
become visible a sterile nylon membrane
is laid on top of the plate. Orientation
marks are made on both the membrane
and plate so that the pertinent colonies
can be identified later. The membrane is
then carefully remove and laid onto
another nutrient agar plate with the
colony side up. In other words, this membrane is a replica of the original master plate. Both the
original plate and the membrane are returned to the incubator until the colonies are the desired
size. The bacteria are lysed and the plasmid DNA is released directly onto the membrane by
laying the membrane (colony side up) on filter paper saturated with buffers containing SDS.
The released DNA will bind to the membrane and it is then denature by moving the membrane
to a filter paper saturated with NaOH. Following neutralization, the DNA is fixed to the
membrane by baking or UV cross-linking, and then incubated with a radioactive DNA probe as
described for Southern blotting. The probe will hybridize to plasmids containing homologous
insert sequences and result in a spot on the autoradiograph corresponding to the position of the
colony containing the recombinant plasmid. The positive colonies are identified on the original
plate by aligning the autoradiograph with the master plate. The bacteria can be streaked on an
agar plate and retested for the plasmid of interest to insure that the original bacteria colony was
derived from a single bacteria. Bacteria from a positive colony are expanded in liquid culture
media containing antibiotic and the recombined plasmids (i.e., cloned DNA) isolated for further
characterized.
184
BACTERIOPHAGE
Viruses can also used as cloning vectors. The ability of a virus to replicate within a host
cell is exploited as a means to amplify DNA of interest. Bacteriophages are viruses that infect
bacteria and are used in various recombinant DNA methods. Phage has proven to be an
exceptionally powerful vector for molecular cloning.
Phage Life Cycle. 1) Phage attaches to bacteria. 2) DNA is injected and circularizes
vis-a-vis cos ends. 3) DNA is transcribed and replicated*. 4) Phage assembly. 5) Cell
lysis (plaque formation). *Alternatively can intergrate into host genome and undergo a
lysogeny.
Phage infects E. coli by injecting its DNA into the bacteria (Figure). The phage DNA
is initially linear but forms a circle as a result of cohesive, or cos, ends. Phage proteins are trans-
cribed from the phage DNA and the genome is replicated. DNA replication proceeds by a
'rolling circle' mechanism that generates long linear molecules composed of consecutive
genomes. Infectious particles are then assembled from the phage proteins and DNA. The
proteins making up the phage heads self-assemble into preheads. Other phage proteins bind the
linear phage DNA near the cos site, wind the DNA into the prehead, and cleaves the DNA at the
cos sites. A fully assembled tail structure is then attached to the prehead resulting in a mature
and infectious phage particle. The phage then induces host cell lysis releasing infectious phage
185
particles which are able to infect more E.
coli.
The infection and multiplication of
phage is known as the lytic cycle.
Alternatively, can also undergo a lyso-
genic cycle in which incorporates into the
host genome at a specific site and is
replicated with the host. At a later time, the
phage genome can excise from host
genome and undergo lytic cycle producing
infectious phage particles.
Lambda as a Cloning Vector.
Two features of make it a
powerful cloning vector: 1) foreign DNA
can be inserted into the genome, and 2)
infectious phage particles can be assembled in vitro. Phage has been extensively modified to
make it a more efficient cloning vector and many different vectors have been developed. Each
particular vector has an optimal host and sometimes different applications require different
host bacteria. It is important to choose the right host strain for each particular phage and the
application being carried out.
The two basic types of vectors are insertion
and replacement vectors (Figure). The genome is
approximately 50 kb. Phage assembly can occur if the
genome is 78-105% of the normal size. In other words
infectious phage particles can be assembled if the
genome is 40-52 kb. Insertion vectors have a small non-
essential central region of the genome removed. This
removed portion of the genome allows for the insertion
of up to 10 kb of foreign DNA (depending upon the
particular vector). In replacement vectors a 13 kb
fragment, called the stuffer fragment, is excised with
restriction enzymes and discarded. Only genes necessary
for the lysogenic cycle are on the stuffer fragment and
the lytic cycle is not affected. The stuffer fragment is
replaced with a foreign DNA insert of 11-21 kb. The
insertion vectors are easier to work with but accommodate less insert DNA than replacement
vectors.
The overall strategy of cloning into lambda is similar to that of cloning into other
vectors (Box). The DNA is isolated and digested with the appropriate restriction enzyme(s).
In the case of replacement vectors the left and right arms will be purified away from the stuffer
fragment. The vector can also be dephosphorylated to minimize vector self-ligation (as
186
discussed for plasmids) when identical overhangs. Generally
vectors which have already been digested with restriction
enzymes and dephosphorylated (i.e., ready for cloning) are
obtained commercially.
The vector and foreign DNA (digested with the
appropriate restriction enzyme) are mixed and ligated. Generally,
equal molar ratios of vector and foreign DNA work best. Ligation
results in the foreign DNA being combined with the vector. In
addition, the cos ends of phage are ligated together forming very
long DNA molecules of sequential recombinant phage. The
recombined concatenated phage DNA is then mixed with an
extract containing all of the proteins needed for phage assembly. This in vitro packaging extract
is prepared from E. coli which have been infected with a defective and usually obtained from
a commercial source. One of the mutations in the defective lambda reduces the packaging of the
endogenous phage DNA, but does not affect the synthesis of the phage coat proteins. Therefore,
the recombined phage DNA is preferentially packaged into phage particles when mixed with
extracts prepared from E. coli infected with this lambda mutant. Nucleases on the phage head
recognize and cleave the DNA at the cos sites resulting in the in vitro assembly of an infectious
phage particle. The phage particles will contain different insert DNA fragments and this mixture
of recombinant phage is called a library.
The next step is to titer the recombinant library and determine the plaque forming units
(pfu) per ml. Plaques are clear zones on a bacteria lawn which are the result of localized
bacteria lysis. The bacteria lawn is formed by mixing the phage with E. coli in a low
concentration of agar or agarose. This mixture is then poured onto an agar nutrient plate and
allowed to solidify. As the bacteria grow the plate will become opaque. Infected bacteria will
result in a clear plaque due to the destruction of neighboring bacteria following many cycles of
lysis and reinfection.
It is sometimes desirable to amplify the library. Amplifying will increase the total
volume of the library allowing for multiple screenings with different probes. Amplification is
accomplished by subjecting a portion of the library to several rounds of replication before
screening the library. Libraries can be amplified by either a plate lysate method or a liquid
culture method. Both methods consist of infecting the host bacteria with the recombinant phage
and allowing the phage to replicate until the bacteria are completely lysed. In both methods the
ratio of phage to bacteria, called the multiplicity of infection (m.o.i.), has a large impact on the
final yield of phage (i.e., titer). In the plate lysate method a bacterial lawn is prepared and buffer
is then added to the plate following the complete lysis of the host bacteria to recover the phage
particles. One drawback of amplification is that the relative frequencies of the different
recombinants may change since slowly replicating recombinants will be under represented in
the amplified library. libraries are stable for years if stored at 4
o
C in the presence of
chloroform.
Cloning into
1. Prepare vector DNA.
2. Prepare foreign
DNA.
3. Ligate vector and
foreign DNA.
4. In vitro packaging.
5. Titer and amplify(?)
6. Infect host E. coli.
7. Screen plaques.
8. Plaque purification.
9. Subclone fragment
i t l id
187
Screening libraries
The library is plated out on the appropriate strain of E. coli and screened. Recombinant
clones of interest are identified with DNA probes in a plaque lift. When plaques appear, the
plates are overlaid with a nylon membrane. The phage in the plaques stick to the membranes. In
general, plaque lifts are similar to colony lifts (Figure) except that it is not necessary to continue
growth after transfer to the membranes. Phage particles are lysed directly on the membrane and
the recombinant phage DNA is denatured and fixed to the membrane. The membranes are then
hybridized with a specific DNA probe. The
recombinant phage with the insert DNA of
interest is then identified by aligning the
autoradiograph with the original plate.
The recombinant phage of interest are
recovered by punching out the plaque of
interest from the agar plate with a Pastuer
pipet. The phage are eluted from the agar and
can be expanded by reinfecting E. coli. A
'plaque purification' can be carried out by
replating and rescreening the recombinant
phage. It is recommended to repeat this plaque
purification until all of the plaques are
positive for the insert DNA of interest. The cloned phage are then expanded and the DNA
isolated.
The high efficiency of infection and the ease at which relatively large numbers of
plaques can be screened make a good vector for cloning genes. However, isolating DNA from
is somewhat cumbersome compared to isolating plasmid DNA. Therefore, the recombinant
DNA insert is usually subcloned into a plasmid for further characterization. This is easily
accomplished by digesting the phage DNA with the appropriate restriction enzyme(s) and
ligating with plasmid previously digested with the same enzyme(s). It is usually not necessary
to purify the insert fragment since the phage arms are not efficiently incorporated into the
plasmid or transfected into the host bacteria.
188
FILAMENTOUS BACTERIOPHAGE
Single-stranded DNA filamentous phage
exhibit features that can be exploited for molecular
biology research. For example, M13 has been widely
used for the generation of ssDNA for DNA
sequencing and site-directed mutagenesis. More recently, though, sequencing of dsDNA has
replaced ssDNA and many site-directed mutagenesis applications now utilize PCR. Filamentous
phage are also used for 'display' of ligands or epitopes (known as phage display).
Life cycle. Filamentous phage attach to the F-pili of E. coli and inject single-stranded
circular DNA into the bacteria. The ssDNA is converted to a dsDNA form known as replicative
form (RF). The replicative form behaves as a plasmid within the bacteria and undergoes
multiple rounds of replication. It is this replicative form that is isolated and manipulated as a
cloning vector. Foreign DNA can be incorporated into cloning sites and bacteria transformed by
standard procedures. Structural genes are transcribed from the replicative form and the ssDNA
genome is produced from a special replication origin (usually called the f1 origin). The product
of gene II forms a nick in the initiation site of the
f1 replication origin. Host DNA polymerases
replicate the phage DNA starting at the nick and
displace one strand will progressing along the
template. When the polymerase completes the
circle, the gene II product cleaves the displaced
strand at the termination site within the replication
origin and the ssDNA is circularized.
Cloning in M13
isolate RF form and manipulate
as plasmid
transfect E. coli
differential centrifugation
bacteria pellet = RF form
phage supernatant =
ssDNA
Applications of ssDNA phage
DNA sequencing
site-direct mutagenesis
phage display
in vivo excision
189
The ssDNA is packaged at the membrane of the bacteria and the mature phage is
extruded without lysing the cell. Phage particles containing ssDNA are isolated from the culture
supernatant medium by differential centrifugation and the ssDNA is extracted from the phage
particles. The phage can also be plated on a bacterial lawn to produce plaques. However, these
plaques are 'fuzzy' since they are not formed as a result of cell lysis, but formed as a result of
diminished host cell growth.
Phagemids. Many plasmids have been modified to include a f1 origin of replication.
These 'phagemids' allow for the generation of ssDNA without some of the difficulties of
working with M13. In particular, incorporation of foreign DNA into M13 will often severely
affect phage replication. Foreign DNA is incorporated into these phagemids and propagated as
conventional plasmids. Single-stranded DNA is rescued by super-infecting the transformed
cells with a helper phage (eg., R408, M13KO7). The helper phage supplies enzymes (i.e., gene
II) that are necessary for synthesis of circular ssDNA molecules and the genes for the phage
coat proteins. The helper phage, however, has a defect in its own f1 origin so that the f1 origin
of the recombinant phagemid is the preferred substrate. The ssDNA is then packaged into the
phage particles and secreted into the culture media with some contamination by the helper
phage due to its slow replication. The exact yield of the ssDNA is dependent on the nature of
the insert DNA.
ZAP is another example of a
vector exploiting the f1origin. In this
case, a phagemid (pBluescript) is
contained within the DNA such that
initiation and termination regions of
the f1 origin are at opposite ends
(Figure). Co-infection with a helper phage leads to the displacement of a ssDNA molecule from
the initiation site followed by cleavage and circularization at the termination site. The ssDNA is
then packed into phage particles and extruded from the bacteria. The plasmid containing the
foreign DNA is obtained by infecting F' strains of E. coli with these phage particles isolated
from the culture supernatant. This process, called 'in vivo excision', eliminates the subcloning
step.
Phage display. Filamentous phage have also been used for expression vectors. Peptide
or protein sequences are expressed as fusion proteins with a coat protein of the bacteriophage,
resulting in the display of the fused protein on the surface of the phage. Fusions to the N-termini
of gp3 and gp8 have minimal effects of phage infectivity. Two common applications for this
phage display are peptide libraries and single-chain antibodies. Screening in both applications is
carried out by 'biopanning'.
Peptide libraries can be used for epitope mapping, analysis of protein-protein interac-
tions, and the isolation of inhibitors or other ligands. The libraries are prepared by cloning
oligonucleotide sequences, corresponding to random peptide sequences, into the N-terminal
portion of either gp3 or gp8. The gp8 site can only accommodate peptides of approximately 6
residues.
190
Single chain antibodies, or scFv, are produced by combining the heavy chain variable
region with the light chain variable region via a linker. This artificial antibody protein can fold
such that the light and heavy chain domains come together to form a functional binding site.
Combinatorial antibody libraries are generated from naive B-cells and cloned into the gp3 site.
In both cases the desired recombinant phage are isolated by a biopanning process. The
target protein (eg., antibody for peptide libraries or antigen for scFv libraries) are absorbed to a
solid support. This target is incubated with the phage display library and non-bound phage are
wash away. The bound phage are eluted and amplified, thereby enriching for the phage which
express peptides or proteins that bind the target. This enrichment is typically 100-1000 fold,
thus 3-4 rounds of biopanning are typically carried out. (In general, the maximum complexity of
the library ranges from 10
8
-10
9
.) The individual phage in the final biopanning are then analyzed
for the peptide sequences (eg., epitope) recognized by target protein, or the scFv are isolated
and used as a reagent for subsequent analyses.
COSMIDS AND YACS
One problem with cloning vectors is their limited size as compared to the genome size
of many organisms. For example, the human genome contains more than 10
9
bp. Typical
vectors will accommodate only 10-20 kb of DNA. Similarly plasmids, although in theory can
accommodate an unlimited amount of DNA are rarely functional above 10 kb. Cosmids and
YACS are two additional cloning vectors that increase the size of insert DNA that can be
incorporated.
Cosmids are plasmids that contain the cos ends from , an E. coli origin of replication
and a selectable marker (eg., ampicillin resistance gene). Foreign DNA with a size range of 35-
45 kb is ligated with the cosmid resulting in long concatemers of DNA. The DNA is then
packaged into heads and used to infect E. coli. Even in the absence of genes the DNA will
be packaged into phage heads if the cos sites are appropriately spaced. Once inside of the
bacteria the injected DNA will form circles and replicate as a large plasmid under antibiotic
pressure.
191
Yeast artificial chromosomes (YACS) are another means to clone large fragments of
DNA. YACS are linear pieces of DNA that replicate as chromosomes within yeast cells. The
vector contains elements that allow for its replication in both
bacteria and yeast (Box). The centromere, autonomously
replicating sequences (ARS), and telomere sequences are parti-
cularly important for its function as a linear chromosome. The
bacterial elements allow for the production of the plasmid in E.
coli. Foreign DNA (100 kb-2 mb) is then incorporated so that
it is a linear piece of DNA and is then introduced into yeast
cells.
QUALITY CONTROL
The success of molecular cloning often depends upon the ability to screen large
numbers of potential recombinants. Generally the screening step is the most labor intensive of
the entire process. Therefore, it is often desirable to evaluate the quality of a DNA library before
screening. For example, in the case of cDNA libraries the average insert size is determined by
selecting a few plaques or colonies at random and determining the size of the insert DNA. This
information gives some indication of the amount of full length cDNA present in the library.
Another measurement of library quality is the percentage of non-recombinants. Many vectors
have been modified so that recombinants and non-recombinants can be easily distinguished (see
below).
In addition, the ability to distinguished recombinants from non-recombinants eliminates
the need to screen in many subcloning procedures. For example, cloning PCR fragments or
other highly enriched DNA fragments often does not require screening if recombinants are
easily identified.
Distinguishing recombinant from non-recombinant clones. One of the first methods
for distinguishing recombinants was through the loss of antibiotic resistance in pBR322.
pBR322 contains both an ampicillin resistance gene and a tetracycline resistance gene. The
foreign DNA is cloned into either the ampicillin resistance gene or the tetracycline resis-
tance gene. Replicate plates are made on either ampicillin or tetracycline. Clones that are
resistance to both antibiotics are non-recombinants, whereas recombinants will only be
resistant to one of the antibiotics.
One of the simplest examples of distinguishing non-recombinants is illustrated by
gt10. Non-recombinant gt10 in the proper hosts (eg., HflA) undergo lysogeny and do not
produce plaques. Therefore, all plaques are recombinant and non-recombinants are excluded
from the screening process.
The most common method used to distinguish non-recombinants from recombinants is
through the interruption of the -galactosidase gene. Cloning of foreign DNA into this gene will
result in the loss of its activity. The bacteria or phage are grown on nutrients plates which
contain a -galactosidase substrate which turns blue in the presence of enzyme. Colonies or
YAC Vector
E. coli origin
antibiotic resistance
yeast centromere
and ARS
ciliate telomere
yeast selectable
marker
192
plaques from non-recombinants will turn blue in the presence of 5-bromo-4-chloro-3-indoly--
D-galactoside (X-gal), whereas recombinants will remain colorless. This process is often
referred to as blue/white color selection. Some vectors (eg., gt11) utilize the entire -
galactosidase gene whereas others (eg., pUC series) only utilize a portion of the -galactosidase
gene (lacZ in Figure). The latter is called -complementation (Box).
Identifying Recombinants
Blue/White Color Screening
(-complementation)
gt10
non-recombinants undergo
lysogeny (=no plaques)
pBR322
loss of antibiotic resistance in
recombinant
gt11
interruption of -galactosidase
gene in recombinants
pUC__
loss of -complementation in
recombinants (Box)
Host expresses C-terminal portion of
-galactosidase gene on F-factor.
Vector expresses N-terminal portion of
gene interrupted by MCS (Figure).
If both are present, then -gal is active
and substrate (X-gal) is cleaved to
produce blue color.
If vector contains insert, then -gal is
inactive and colonies (or plaques)
remain colorless.
193
CHAPTER 22--EXPRESSION OF RECOMBINANT PROTEINS
One potential of recombinant DNA is the production of proteins. Many systems have
been designed for the expression of recombinant proteins. Although E. coli are easy to grow in
large quantities there are some problems associated with the expression of eukaryotic proteins
in prokaryotes. Therefore, expression systems in eukaryotic systems have also been devised. In
addition, it is also possible to use expression vectors for the cloning of genes.
General considerations in the over production of
recombinant proteins (Box) include such features as
promoters and the nature of the host for expression. Ideally
the recombinant protein should be cloned in conjunction with
a strong promoter. Promoters are elements found on the 5'-
end of genes and control their expression. A strong promoter
results in a high level of gene expression. In addition to being
strong, promoters should be regulatable so that transcription
can be turned off and on. Recombinant proteins are
sometimes toxic for the host cell and this toxicity can be
minimized by controlling the expression. The use of high copy number plasmids also increases
the production of recombinant proteins by increasing the gene dosage.
Other features are included in many expression vectors. For example, it is often
convenient to have recombinant proteins that are exported from the host cell. This can be
accomplished by engineering localization signals within the recombinant protein so that they
are directed to a particular cellular compartment. In addition, the recombinant protein can also
be expressed as a fusion protein with another protein. This will sometimes stabilize the
recombinant protein and/or assist in the purification and characterization of the recombinant
protein. Proteolysis of recombinant proteins is often a major problem that is partially alleviated
by cloning into protease deficient hosts.
EXPRESSION IN E. COLI.
The general procedure for expression
of cloned genes in E. coli involves the
insertion of the coding region of interest into
a vector, usually a plasmid, so the region is
efficiently transcribed and translated. Since
eukaryotic genes do not contain the proper
signals for transcription initiation, ribosome
recognition, translation initiation, and translation termination, these signals need to be supplied
by the vector.
Common promoters used in bacterial expression vectors are: P
L
, lac, tac and T7
(Table). Of these, the lac and tac promoters are the most widely used. The control elements that
regulate expression from these promoters are supplied by either the host or the vector. The P
L
promoter is controlled by a mutant cI repressor protein that is non-functional at 42
o
. At
Over Production of
Recombinant Proteins
strong promoter
regulatable promoter
gene dosage
localization signals
protease defective
hosts
fusion proteins
Common Bacterial Promoters
Promoter Repressor Induction
P
L
cI857 (ts) 32
o
42
o
lac lacI
q
IPTG
tac lacI
q
IPTG
T7 - T7 gene 1
194
temperatures less that 42
o
the repressor protein (cI) binds to the promoter and prevents
expression. To induce expression the temperature is raised to that the repressor becomes non-
functional and expression is now permitted. One problem with this system is that heat-shock
proteins may also be induced. The T7 promoter is from the T7 phage and is only transcribed by
the T7 RNA polymerase (T7 gene 1). The host cell must also contain the T7 gene 1 in order to
express from this promoter. To regulate expression from this promoter it is necessary to be able
to regulate the expression of the T7 gene 1.
Promoters and Repressors
The lac and tac promoters are controlled by the lac repressor (Figure). The lac repressor
binds to the lac promoter and prevents RNA polymerase from transcribing the gene. Host
strains with lacI
q
gene express the lac repressor at 10-fold higher concentrations than the normal
lacI gene. IPTG (isopropyl-1-thio--D-galactopyanoside, an analog of lactose) binds to the
repressor and prevents its interaction with the lac promoter and allowing RNA polymerase to
transcribe the regulated gene. The tac promoter is a fusion of trp and lac promoters and is also
regulated by IPTG.
The production of recombinant fusion
proteins often stabilizes the expression of foreign
proteins in E. coli. Several plasmids that express
recombinant proteins as fusion proteins have been
developed (Table). In addition to stabilizing the
recombinant protein, the fusion partner is often
exploited for affinity purification or for the analysis of
the recombinant protein (see Appendix). However, for
many applications the fusion partner may interfere
with the activity of the recombinant protein. Some
expression vectors include a protease site between the
fusion partner and the multiple cloning site (MCS). The engineered protease site allows for the
removal of the fusion partner after its purification.
Other expression vectors will only include a small fusion partner, such as epitope
tagging and His
6
vectors. In both of these examples, only a few additional amino acids are
added at either end of the recombinant protein. In general, these few residues will not interfere
with the normal activity of the recombinant protein. Affinity columns prepared from mAbs
Fusion Protein Affinity Matrix
Glutathione-S-
Transferase
glutathione-
agarose
Thioredoxin
phenylarsine
oxide-agarose
Maltose Binding
Protein
amylose-
agarose
Six Histidine
Residues
Ni-agarose
195
against the epitope can be used for the purification
of the fusion protein in the case of epitope tagging.
Similarly the six consecutive histidine residues
added by His
6
vectors bind tightly to metals and are
easily purified on metal-chelating columns.
Recombinant proteins expressed at high
levels will sometimes form insoluble aggregates
known a inclusion bodies. In some applications it
is possible to take advantage of this phenomenon.
For example, the inclusion bodies can be isolated by differential centrifugation and solubilized
under denaturing conditions (eg., urea). It is sometimes possible to renature the protein and
regain activity. In addition, fusions with E. coli thioredoxin can circumvent inclusion body
formation.
PREPARATION OF EXPRESSION VECTORS.
The 'insert' DNA must be subcloned into the expression vector so that it is in frame with
the fusion protein (or a start ATG). Most expression vectors will have a MCS with several
different restriction sites. In addition, many expression vectors are designed so that variants with
all three reading frames are available. Therefore, it is generally simple to choose restriction
enzymes that will result in a continuous open reading frame (ORF) between the fusion protein
and the foreign protein. It is also possible to shift the reading frame by cutting with restriction
enzymes, filling in with Klenow, and religating (see Appendix). Digesting with an enzyme
producing a 4-base overhang will result in a -1 frameshift and digesting with an enzyme
producing a 2-base overhang will produce a +1 shift. In addition, stop codons can be produced
by this method with certain restriction enzymes (eg., HindIII, SpeI).
SCREENING LIBRARIES WITH ANTIBODIES.
It is also possible to utilize the expression vectors as a means to screen for the gene of
interest. Recombinant DNA clones expressing proteins of interest can be detected with
antibodies, ligands or other protein activity. gt11 is a common vector for cloning genes using
antibody probes. Foreign DNA is cloned
into a lac-promoter controlled -
galactosidase gene resulting in the
expression of fusion proteins. Recombi-
nant phage expressing the protein of
interest are detected with antibodies (Box
).
A recombinant gt11 library is plated on a lawn of E. coli Y1090 and incubated at 42
o
until plaques are visible. An IPTG saturated nitrocellulose membrane is then laid on the plate
and the incubation is continued for 1-3 hr at 37
o
. This will induce the expression of -
galactosidase fusion proteins within infected bacteria. Upon lysis the recombinant proteins are
released with other bacterial proteins into the plaque and adsorbed onto the membrane. The
Screening gt11 expression libraries
1. Plate phage on Y1090 lawn.
2. Grow at 42
o
until plaques appear.
3. Overlay with IPTG saturated membrane.
4. Continue incubation 1-3 hr at 37
o
.
5. Analyze plaque lift by Western blot.
196
membrane (i.e., plaque lift) is then analyzed by Western blotting using an antibody against the
protein of interest. This will result in a spot on membrane which corresponds to a plaque formed
by the recombinant gt11 expressing the protein of interest. Such plaques are identified by
aligning the membrane with the original plate. Rabbit antisera are often problematic due to a
strong background reactivity with E. coli proteins. It is sometimes possible to pre-absorb the
anti-sera with E. coli proteins to reduce the background.
It is also possible to use a cloned recombinant gt11 phage for the production of
recombinant protein. However, this is generally more difficult than subcloning the fragment into
a plasmid and therefore not widely used. The procedure involves the production of lysogens.
The lysogens are induced to produce high levels of phage from which the fusion protein is
expressed. The fusion protein is then isolated from the infected bacteria.
EXPRESSION IN EUKARYOTES
Although expression of recombinant
proteins in E. coli is usually fairly straight
forward, it is often desirable or necessary to
express cloned genes in eukaryotes. Eukaryotic
expression systems are often needed to insure
correct folding and disulfide-bond formation,
post-translational modifications, and processing. Yeast, such as Saccharomyces cerevisiae and
Pichia species, are useful hosts for the expression of recombinant proteins since they can be
grown and manipulated like a bacteria. Pichia expression systems often allow for high level
expression of recombinant proteins using a strong alcohol oxidase promoter which is induced
by methanol. Shuttle vectors contain both a bacterial origin of replication and the origin of
replication of interest (Box). This allows for manipulations of the plasmids to be carried out in
E. coli before transforming yeast or other eukaryotes.
The two major strategies for expression of
recombinant sequences in mammalian cells are 1) stable or
transient expression of transfected DNA and 2) the use of viral
expression vectors. Mammalian and other eukaryotic cells are
able to take up DNA. The introduction of DNA to cells is
often cell type dependent and problematic, though. Several
different methods for introducing DNA to cells are available
(box). One of the early methods for transfecting eukaryotic cells was to incubate a calcium
phosphate precipitate of the DNA with the target cells. This method is relatively inefficient.
Using DEAE-dextran instead of calcium phosphate is a little more efficient. Electroporation is
the application of a short pulse of high voltage. This method is effective for many cell types
once the optimal conditions are determined. DNA can also be incoporated into liposomes
prepared from cationic detergents. These liposomes (i.e., micelles) will fuse with the plasma
membrane and deliver the DNA. Similarly, protoplasts can be prepared by digesting the
bacterial cell wall and fusing these protoplasts with the target cells. Finally, DNA can be
directly introduced into cells by ballistics (i.e, gene gun) or microinjection. The gene gun shoots
small colloidal gold particles covered with DNA into cells with doing permanent membrane
Shuttle Vectors
prokaryotic replication origin
E. coli selectable marker
eukaryotic replication origin
eukaryotic promoters/enhancers
polyadenylation signals
eukaryotic selectable marker
calcium phosphate
DEAE-dextran
electroporation
liposomes
protoplast fusion
ballistics (gene gun)
microinjection
197
damage. In many cases the foreign DNA is quickly loss from the host cell and the expression is
only transient.
Several different eukaryotic viruses can also be used as cloning vectors for the
expression of recombinant proteins. Lytic viruses are good for transient expression whereas
episomal viruses are better for constitutive expression. Retroviruses can become incorporated
into the host cell genome and possibly lead to a stable transformation.
Baculoviruses are used for the production of recombinant eukaryotic proteins.
Autographica californica is a nuclear polyhedrosis virus (AcNPV) that infects insects. Sf9 cells,
derived from Spodoptera frugiperda, are readily grown in vitro and can be infected with
baculovirus. Extremely high levels of recombinant proteins can be expressed and many
eukaryotic post-translational modifications are correctly made in the host insect cells. This high
level of expression is driven by a strong promoter for the polyhedrin gene. The polyhedrin
protein is expressed late in infection as the virus is killing the host cell and is needed for the
dissemination of the virus in nature. However, the polyhedrin gene is unnecessary for viral
growth in tissue culture and can be replaced with a gene of interest.
Baculovirus expression vectors consist of
the viral genome (130 kb) and a transfer
plasmid vector which contains the regions
flanking the polyhedrin gene. The target gene
is inserted into the plasmid vector and host
cells are co-transfected with the parental
baculovirus and the engineered plasmid.
Recombination between the viral genome and
the plasmid results in replacement of the
polyhedrin gene with the target gene. The
efficiency of identifying recombinants is
greatly enhance by digesting the baculovirus
DNA with a restriction enzyme which
disrupts an essential gene and using a transfer
vector which contains this essential gene
(Figure). Recombinants between the transfer
vector and the virus will have a selective
advantage and produce plaques. The
recombinant virus can be isolated from plaques and then amplified to produce large amounts
of protein.
198
APPENDIX 1. CODES AND CODONS
A
C
G
T or U (DNA or RNA)
M A or C (methyl)
R A or G (purine)
W A or T (weak)
S G or C (strong)
Y C or T (pyrimidine)
K G or T (keto)
V A or C or G (not T = V)
H A or C or T (not G = H)
D A or G or T (not C = D)
B C or G or T (not A = B)
N A or C or G or T (any nucleotide)
Second Codon Position
U C A G
UUU Phe UCU Ser UAU Tyr UGU Cys U
UUC Phe UCC Ser UAC Tyr UGC Cys C
UUA Leu UCA Ser UAA Stop UGA Stop A
U
UUG Leu UCG Ser UAG Stop UGG Trp G
CUU Leu CCU Pro CAU His CGU Arg U
CUC Leu CCC Pro CAC His CGC Arg C
CUA Leu CCA Pro CAA Gln CGA Arg A
C
CUG Leu CCG Pro CAG Gln CGG Arg G
AUU Ile ACU Thr AAU Asn AGU Ser U
AUC Ile ACC Thr AAC Asn AGC Ser C
AUA Ile ACA Thr AAA Lys AGA Arg A
A
AUG Met ACG Thr AAG Lys AGG Arg G
GUU Val GCU Ala GAU Asp GGU Gly U
GUC Val GCC Ala GAC Asp GGC Gly C
GUA Val GCA Ala GAA Glu GGA Gly A
F
i
r
s
t
C
o
d
o
n
P
o
s
i
t
i
o
n
G
GUG Val GCG Ala GAG Glu GGG Gly G
T
h
i
r
d
C
o
d
o
n
P
o
s
i
t
i
o
n
A GCN
C TGY
D GAY
E GAR
F TTY
G GGN
H CAY
I ATH
K AAR
L CTN
M ATG
N AAY
P CCN
Q CAR
R CGN or AGR
S TCN or AGY
T ACN
V GTN
W TGG
Y TAY
* TAR or TGA
199
APPENDIX 2. FUSION PROTEINS
The gene of interest is cloned into the expression
vector leading to the creation of a gene fusion
between the target gene and the fusion partner (FP).
Transformed E. coli are grown in large-scale liquid
cultures and after reaching the appropriate density
are induced to express the recombinant protein.
A bacterial lysate is passed over an affinity column
made from a ligand binding the fusion partner. The
recombinant fusion protein is retained by the column
and other E. coli proteins are removed. The fusion
protein is eluted with free ligand or by other means.
Many expression vectors have a specific protease site
(eg., factor Xa) engineered between the fusion
partner and the protein of interest. Treatment with
the specific protease may result in separation of the
two proteins.
The fusion partner can be separated from the the
protein of interest by repeating the affinity
chromatography since the fusion partner will be
retained by the column.
200
APPENDIX 3. GENERATING FRAMESHIFTS
Generation of a -1 Frameshift
| Sal I | | Cl aI | | HI I I |
GGT CGA CGG TAT CGA TAA GCT TGA
CCA GCT GCC ATA GCT ATT CGA ACT
Gl y Ar g Ar g Tyr Ar g *** Al a ***
Sal I
GG T CGA CGG TAT CGA TAA GCT TGA
CCA GCT GCC ATA GCT ATT CGA ACT
+ Klenow + dNTPs
GGT CGA T CGA CGG TAT CGA TAA GCT TGA
CCA GCT A GCT GCC ATA GCT ATT CGA ACT
+ DNA ligase
GGT CGA TCG ACG GTA TCG ATA AGC TTG A
CCA GCT AGC TGC CAT AGC TAT TCG AAC T
Gl y Ar g Ser Thr Val Ser I l e Ser Leu
Generation of a +1 Frameshift
| Sal I | | Cl aI | | HI I I |
GGT CGA CGG TAT CGA TAA GCT TGA
CCA GCT GCC ATA GCT ATT CGA ACT
Gl y Ar g Ar g Tyr Ar g *** Al a ***
Cla I
GGT CGA CGG TAT CGA TAA GCT TGA
CCA GCT GCC ATA GC T ATT CGA ACT
+ Klenow + dNTPs
GGT CGA CGG TAT CG CGA TAA GCT TGA
CCA GCT GCC ATA GC GCT ATT CGA ACT
+ DNA ligase
GGT CGA CGG TAT CGC GAT AAG CTT GA
CCA GCT GCC ATA GCG CTA TTC GAA CT
Gl y Ar g Ar g Tyr Ar g Asp Lys Leu
Generation of a Stop Codon
| HI I I |
AAT TCG ATA TCA AGC TTA TCG
TTA AGC TAT AGT TCG AAT AGC
I l e Ser I l e Ser Ser Leu Ser
Hind III
AAT TCG ATA TCA AGC TTA TCG
TTA AGC TAT AGT TCG A AT AGC
+ Klenow + dNTPs
AAT TCG ATA TCA AGC T AGC TTA TCG
TTA AGC TAT AGT TCG A TCG AAT AGC
+ DNA ligase
AAT TCG ATA TCA AGC TAG CTT ATC GAT
TTA AGC TAT AGT TCG ATC GAA TAG CTA
I l e Ser I l e Ser Ser ***
201
CHAPTER 23--DNA SEQUENCING
Simple and reliable DNA sequencing methods have allowed for a relatively rapid
accumulation of gene sequence data. Two methods for sequencing DNA are the dideoxy chain
termination method developed by Sanger and the chemical cleavage method developed by
Maxim and Gilbert. The dideoxy procedure is the less laborious and the most widespread. The
chemical cleavage procedure is primarily used to sequence synthetic oligonucleotides.
DIDEOXY CHAIN TERMINATION
The dideoxy chain termination method is based upon the
use of 2',3'-dideoxynucleotides (figure) as chain terminators. These
ddNTPs will be randomly incorporated into the growing poly-
nucleotide chain if DNA synthesis is carried out in a mixture of
dNTPs and ddNTPs. Dideoxynucleotides lack the 3'-OH and,
therefore, additional nucleotides cannot be added during template
mediated DNA synthesis. Since the incorporation of the ddNTPs is random the results of the
DNA synthesis will be a mixture of newly synthesized DNA fragments of various lengths with
a dideoxy-nucleotide at the 3'-end. This mixture is then analyzed by gel electrophoresis under
conditions which will resolve DNA fragments that differ in length by single nucleotides. The
sequence is then determined from the dideoxy-nucleotide which is located at the 3'-end of
progressively longer oligonucleotides.
Dideoxy chain termination requires ssDNA as a template. The ssDNA can either be
isolated from M13, phagemids, etc., or be prepared by denaturing dsDNA with NaOH. The
sequencing is more efficient and less template DNA is needed if ssDNA is used. However, it is
more laborious to prepare and isolate ssDNA from filamentous phage, and therefore, plasmid
DNA denatured with NaOH is the most widely used template. Following denaturation in
NaOH, the ssDNA is precipitated with ethanol and redissolved in an appropriate buffer.
Original Method. The original dideoxy sequencing method is based on radiolabeling the
product strand. The first step is to incubate the template ssDNA with a primer under conditions
which promote hybridization. Primers are oligonucleotides complementary to the DNA to be
sequenced. Common sequencing vectors have well characterized primer sequences that flank
the MCS. The annealed primer/DNA is mixed with DNA polymerase, -
35
S-dATP, dGTP,
dCTP and dTTP and subject to a short labeling reaction. The nucleotide concentrations used in
this labeling reaction are relatively low so that DNA synthesis proceeds slowly. This results in
the synthesis of a short segment (15-30 bases) of radioactive DNA.
The labeled DNA is then divided into four tubes containing higher concentrations of
dNTPs and either ddATP, ddGTP, ddCTP or ddTTP. This step is called the termination
reaction. The increase in the dNTP concentration result in an increased rate of DNA synthesis.
The ddNTPs are at relatively low concentrations and are incorporated at random in the growing
DNA molecule. When a ddNTP is incorporated into the growing DNA strand no additional
nucleotides can be added resulting in a chain termination. Since ddNTP incorporation is
random, the result will be a mixture of nucleotides terminated at all possible positions. The ratio
202
of ddNTP/dNTP is crucial for the success of DNA sequencing. If the ddNTP is too high then
the DNA synthesis will terminate prematurely and only sequence close to the primer will be
determined. If the ddNTP concentration is too low then insufficient oligonucleotide chains of
appropriate lengths will be produced.
The newly synthesized DNA is denatured by heating and subjected to gel electro-
phoresis under conditions which separate DNA molecules that differ in size by only a single
base. The standard conditions are polyacrylamide gels (6-8%) containing urea. The urea will
prevent H-bonding and minimizes the formation of dsDNA and secondary structures. The four
termination reactions are electrophoresed side-by-side and DNA strands are detected by auto-
radiography. The smaller oligonucleotides representing termination events that occurred near
the primer will be at the bottom of the gel. Starting at the bottom of the gel the DNA sequence
can be read directly from the autoradiograph by noting the lane (i.e., ddNTP termination
reaction) of each progressively larger band.
Semi-automated Sequencing. Pouring, running and analyzing sequencing gels are
laborious procedures. Semi-automated DNA sequencers based on fluorescent dyes are now the
preferred method of sequencing DNA. In addition, to reducing the amount of work involved in
DNA sequencing, automated sequencing yields significantly more bases of readable sequence.
The basis of automated sequencing is similar to
that of manual sequencing except that product
strand is labeled with fluorescent dyes during the
extension reaction and then detected during elec-
trophoresis. Therefore, no preliminary labeling
reaction is needed.
Sequencing reactions are carried out with
a thermocycler in a single tube containing the
template DNA, a primer, a heat stable DNA
polymerase (eg., Taq), all four dNTPs and all
four ddNTPs. The four ddNTPs that are
conjugated with different fluorochromes (i.e.,
203
different emission spectra). Use of the thermocycler does not result in a geometric amplification
as observed during PCR since a single primer is being used and the product strands are not used
in subsequent cycles. The template strand is reused in subsequent cycles though. As in manual
DNA sequencing the ddNTPs are randomly incorporated into the product strands during the
extension reaction and no additional nucleotides can be added to that particular DNA product.
The result is a mixture of DNA molecules complementary to the
template strand but differing in length by a single nucleotide and
containing one of the four possible dideoxy nucleotides at their 3'-ends.
The products of this DNA synthesis (i.e., sequencing reaction)
are subjected to gel electrophoresis in a special apparatus that
continuously analyzes the DNA molecules for fluorescence as they pass
by an excitation laser. As in manual sequencing the gel can resolve
DNA molecules that differ by a single nucleotide. These progressively
longer DNA molecules pass through this fluorometer one at a time and
the fluorescence intensity for each of the four possible emission spectra
will be determined. The wavelength of the emission spectra will
indicate which of the dideoxynucleotides was incorporated into the
terminal position of that DNA molecule. Therefore, the DNA sequence
can be directly determined by the instrument during electrophoresis. The instrument provides
the sequence of the DNA as well as a
graphical printout of the fluorescence
intensities for each of the four chromophores
plotted against nucleotide number. The
graphical printout can help resolve any
ambiguities in the sequence.
Compressions and stops. Occasionally it is
not possible to determine the DNA sequence because
of compressions and stops. Compressions are caused
by secondary DNA structure in the 'product' strand.
DNA strands containing secondary structures that are
stable in urea will migrate faster during electrophore-
sis than unfolded DNA molecules. This will result in
bands that are close together and exhibit irregular
spacing. Stops, or bands in all four lanes, are the
result of false termination during the sequencing
reaction. These stops are due to secondary structures in the 'template' strand. When the
polymerase encounters a secondary structure in the template it will dissociate without
incorporating a nucleotide. The secondary structures are often the result of dyad symmetry
and or G-G base pairing that occurs in GC rich DNA.
Several different ways to alleviated or minimize compressions and stops have been
described (Box). The simplest and usually most reliable method is to sequence the other strand.
The factors contributing to the secondary structure are typically not found on the
Alleviating Compressions
sequence 'other' strand
formamide in gel
nucleotide analogs
dITP (inosine)
7-deaza-dGTP
Taq polymerase, 72
o
formamide or DMSO in rxn
terminal transferase chase
204
complementary strand. One strategy to eliminate compressions is to include formamide in the
gel in an attempt to reduce the amount of base pairing. Another strategy is to lower the stability
of the secondary structures in the product strand by substituting ITP or 7-deaza-dGTP for GTP.
These nucleotides will prevent some of the secondary structure due to G-G base pairing. Stops
may be eliminated by minimizing the secondary structure in the template strand either before or
during the sequencing reactions. For example, using the Taq polymerase (heat stable) at 72
o
might eliminate the secondary structure in the template. It is also possible to minimize template
secondary structure by including chaotropic agents such as formamide or DMSO (up to 10%) in
the sequencing reactions. An alternate strategy in cases template secondary structure persists,
such as especially GC-rich DNA, the product strands can be treated with terminal transferase.
DNA strands that are the result of false stops will still have a 3'-OH. The terminal transferase
will add a large random number of nucleotides to the 3'-OH and thus eliminate these false stops
from the analysis since these fragments will now migrate near the top of the gel and not
interfere with readable sequence. Furthermore, the random number of nucleotides added to the
3'-end will diminish the effects on the analysis.
EXTENDED SEQUENCING STRATEGIES
The number of nucleotides that can be determined from a single sequencing reaction is
limited. Several strategies have been described for the sequencing of long DNA fragments
(Table). The choice of method(s) will depend largely and how much sequencing needs to be
done and the resources available.
Extended Sequencing Strategies
Method Advantages Disadvantages
Restriction Digestion
and Subcloning
preparation simple
contig assembly easy
relies on convenient
restriction sites
Primer Walking preparation simple slow and expensive
Nested Deletions contig assembly easy laborious to generate
Shotgun
quick and easily
automated
gaps and inefficient
The most straightforward and simplest method is to take advantage of restriction sites
within the target DNA fragment. The cloned DNA is cut with a restriction enzyme within the
MCS and a restriction enzyme within the insert fragment (Figure). If the restriction sites are not
compatible, the recessed ends are filled-in with Klenow and dNTPs. The plasmid is then re-
circularize by treating with DNA ligase, and thereby creating a deletion mutant that can be
sequenced using primers flanking the MCS. Restriction fragments can also be subcloned and
sequenced. One limitation of this method is the potential lack of conveniently located restriction
sites.
205
Sequence Restriction Fragments Primer Walking
Another strategy for extended sequencing, often called 'prime and run' or 'look and leap',
is based upon synthesizing primers based upon known sequence (Figure). In this method one
sequences a region of DNA and then designs an oligonucleotide primer corresponding to most
distal tract of reliable sequence. This new primer is
then used to sequence more of the insert DNA and
the procedure is continued until the complete
sequence is obtained. The same general rules for the
design of PCR primers also apply to the design of
sequencing primers and several computer programs
that predict potential primer sequences are
available. Generally primers should be 40-60% GC
composition and be at least 18 nucleotides in length.
In addition, primers should not fold into hairpin
loops or other secondary structures.
Prime and run strategies tend to be slow and
expensive in that one needs to continuously
synthesize primers and only a small stretch of DNA
is sequenced before the next primer can be
synthesized. In addition, it may not be possible to
identify optimal sequencing primers resulting in
primers that do not work well in the sequencing
reaction. Therefore, this method is best for filling in
small gaps in sequence information or confirming
questionable stretches of DNA sequence.
The generation of a series of nested
unidirectional deletion mutants overcomes some of
the limitations in prime and run strategies and does
not rely on the presence of convenient restriction
sites. The plasmid containing the insert to be
206
sequenced is cut with two different restriction enzymes within the MCS (Figure). The site
closest to insert DNA should leave either a blunt end or 5'-overhang (S). The other restriction
enzyme should leave a 3'-overhang (I). Many of the common sequencing vectors have poly-
linkers in which the outermost restriction sites leave 3'-overhangs.
After the plasmid is linearized, it is digested with Exonuclease III which removes
nucleotides in the 5' to 3' direction. However, ExoIII cannot digest dsDNA which has a 3'-
overhang. Therefore, treatment of the linearized plasmid with ExoIII will only result in an
unidirectional digestion toward the insert DNA fragment. The vector, including the primer site,
will be protected because of the 3'-overhang. The ratio of DNA to ExoIII needs to be carefully
controlled so that the digestion proceeds at a known rate. Aliquots are remove at defined
intervals after the start of the ExoIII digestion and the reaction is stopped. Each subsequent
aliquot will contain progressively shorter DNA fragments.
The samples are then treated with S1 (or mung bean) nuclease to remove the single-
stranded protruding 3'-ends. The DNA is then treated with Klenow to repair any 5'-overhangs
generated by the S1 treatment, insuring that the ends are blunt. Following ligation and
transformation, colonies are picked and analyzed for the size of the insert fragment remaining.
Ideally this method will yield a series of clones with inserts that are progressively shorter by an
appropriate length. The nested deletion clones are then sequenced from the primer of the
plasmid and the entire sequence is obtained from the overlapping sequences. It is somewhat
laborious to generate the series of unidirectional mutants, but once they are obtained, the
sequencing proceeds rather rapidly. The nested deletions may also be useful for other
applications.
Another method for carrying out extending
sequencing is the 'shotgun method'. In this method a
series of random overlapping clones is generated
and sequenced. Digestion of DNA with DNaseI in
the presence of Mn
2+
will randomly cut dsDNA. The
resulting fragments are then size-fractionate,
subcloned, and sequenced. The sequences are then
analyzed by computer programs that will align the
series of overlapping clones and generate the entire
sequence. The DNAse treatment is very sensitive to
DNA/DNAse ratios and often fails to generate
appropriate sized fragments. In addition, to insure
that there are no gaps in the sequence due to lost
fragments, more sequencing than necessary is
carried out. Because of these problems, this method
is not widely used in small sequencing projects. However, this method is amenable to
automation and is used in large genome projects.
207
MAXIM AND GILBERT
The Maxim and Gilbert method is based on the principal
that DNA can be specifically cleaved at certain residues. Initially
the Maxim-Gilbert method was more reproducible and
accessible than the dideoxy method. However, the dideoxy
procedure is now superior and chemical cleavage is primarily used to check the sequence of
synthetic oligonucleotides. In addition, the chemical cleavage method is sometimes used to
sequence short stretches of GC-rich DNA, which is predisposed to compressions and stops in
the dideoxy method.
The first step in Maxim/Gilbert sequencing is to end label the DNA (Box). The most
straight forward method is to use T4 polynucleotide kinase and -
32
P-ATP, resulting in a single
32
P at the 5' end (see section on labeling DNA probes). Double stranded DNA will be labeled at
both ends and therefore the two stands must be separated. Sometimes it is possible to separated
the two single strands by electrophoresis. Generally, though, such preparations will result in
preparations in which the complementary strands contaminate each other. The labeled DNA can
also be digested with a restriction enzyme and the desired fragment isolated which would result
in only one of the strands containing a radiolabel. It is also possible to label recessed 3'-ends by
filling in with Klenow and -
32
P-dNTPs. This strategy, through the choice of restriction
enzymes and radioactive nucleotide, may result in the
asymmetric labeling of the two strands.
The labeled ssDNA is placed in four or five
separate tubes containing different chemicals that
specifically cleave at certain residues (Table). Some
protocols will omit the A>C reaction. The reaction
conditions must be carefully controlled so that the
cleavages are random (i.e., partial). The samples are then analyzed by gel electrophoresis under
conditions which allow the resolution of fragments differing by a single nucleotide, as described
for dideoxy sequencing. Since the chemical cleavage reactions are not absolutely base specific,
it is more difficult to determine the sequence than in the dideoxy-chain termination method.
Chemical Cleavage
1. End label DNA.
2. Cleavage reactions.
3. Gel electrophoresis.
Base Chemical
G dimethyl sulfate
R (A+G) piperidine formate
Y (C+T) hydrazine
C hydrazine + NaCl
A>C NaOH at 90
o
208
CHAPTER 24--SEQUENCE ANALYSIS AND BIOINFORMATICS
The field of bioinformatics represents a
convergence of explosive growth in both biotech-
nology and information technology. Traditionally
bioinformatics has been synonomous with the
management and analysis of DNA and protein
sequences. The term now is more broadly used to
include epidemiology (especially genetic
epidemiology) and evolutionary studies. One
aspect of computational biology research is the
development of new algorithms and statistics.
The other aspect of bioinformatics is the use of
these tools for the analysis and interpretation of
sequence data.
DNA sequencing produces large amounts
of data that would be extremely tedious to analyze without computers. Several commercially
available software packages will carry out routine sequence analyses (Box). Many sequence
analysis programs are also available on the internet (see Appendix). Some of these programs
can be downloaded and used on a free standing computer. In other cases the sequence is
submitted via the website or by email and the results of the analysis are provided.
A DNA sequencing project will require the use of a computer to assist in compiling and
editing the sequence data. Overlapping clones are found and assembled into contiguous
sequences. Computers are also used to generate the complementary sequence, reverse the 5'3'
orientation, or provide amino acid translations of nucleic acid sequences. It is also possible to
calculate various physical, biochemical or structural properties of both nucleic acids and
proteins. For example, algorithms to predict the secondary structure of either proteins or RNA
are available. Specific sites or motifs within a gene, such as restriction sites, promoter elements
or other DNA signals, as well as various protein motifs (eg., glycosylation sites, signal
sequences, etc.) can be identified with the computer.
Alignment of related sequences and homology searches are common analyses
performed on both nucleic acid and protein sequences. For example, it is relatively easy to
obtain sequence data, but it is quite difficult to predict protein structure and function. Protein
structure and function can be approximated from similarities to known sequences. Such
similarities are identified by aligning DNA or protein sequences.
SEQUENCE ALIGNMENT
Alignments provide a powerful way to compare sequences for either evolutionary
relatedness or structural/functional relatedness. Sequences can be compared by either global or
local alignments. Global alignment forces complete alignment of the input sequences, whereas
local alignments will only align their most similar segments. The choice of method will depend
on whether the sequences are presumed to be related over their entire lengths or to only share
Common Sequence Analyses
compiling and editing sequences
manipulating sequences
complement, reverse, or both
translating
structural analysis
searching for coding regions
physical properties
comparisons and homology
searches
aligning sequences
sites and motifs
gene identification
209
isolated regions of homology. The algorithms to carry out global and local alignments are
similar, but the statistics associated with the output are different.
Pair-wise sequence alignments use a scoring
matrix to calculate the best alignment between two
sequences. A scoring matrix contains information on
how to score each match in an alignment and
penalties for mismatches. For example in DNA
alignments, matches are assigned a value of 0.9 and mismatches a value of -0.1. Proteins are
more complicated and the scoring matrix must also take into account similarity between
residues and their relative abundance. For example, tyrosine and tryptophan residues are
uncommon and weighted heavier that alignments between common residues such as alanine
and serine. Similarly, alignments between glutamate and aspartate are scored positively
because of their chemical similarity, whereas matches between dissimilar residues are
penalized. Furthermore, amino acid similarity can be defined as similar on either a chemical
basis or a structural basis (Table). No single scoring matrix can be universally used for
proteins. BLOSUM and PAM are two well known scoring matrices.
The gap penalty is another parameter used in sequence
alignments. Mathematically, the penalty for opening a gap of
length k is defined as:
W
k
= a + bk
where a is the gap opening penalty and b is the gap
extension penalty. Both the opening penalty and the extension
penalty can be varied and it may be useful to run alignments with different values unless it is
already known the types of matches being searched for. For example, having a large open
and a large extend penalty is good for analyzing closely related proteins. A large open
penalty and small extend penalty may be good for situations where the distance between
domains is not crucial. A small open penalty and large extend penalty (ie, many small
inserts) is useful for distantly related homologous proteins.
Aligning sequences involves submitting the two sequences, choosing the scoring
matrix and prescribing the gap penalties. The alignment giving the best score for a particular
scoring matrix and the prescribed gap penalties is returned. However, this is not necessarily
the most biological significant alignment. Quite often finding the optimal alignment
Amino Acid Similarities
Chemical Physical
A, G
D, E
F, Y
K, R
I, L, M, V
Q, N
S, T
C, S
D, L, N
E, Q
F, H, W, Y
I, T, V
K, M, R
Homologs are structures or objects that share a common evolutionary
origin. Objects with similar structure or function, but no common
ancestor are analogs. Homologs can be classified as orthologs or
paralogs. Orthologs are homologous genes from different species that
arose from a common ancestor gene. Paralogs are homologous genes
that are the result of gene duplication within an evolutionary lineage
(eg., species) and may have different or similar functions.
GCGCCTC
| | | | |
GCGGGTC
(5 x 0.9) +
(2 x -0.1) = 4.3
210
involves carrying out several alignments using different values for these parameters. In
addition, the final alignment often involves using human insight.
In contrast to pair-wise alignments, which always return the best possible mathema-
tical match, multiple alignments are a first approximation. The human eye coupled with
biological insight is much better at spotting patterns in multiple alignments that the currently
available computer algorithms. Alignments are a non-trivial computational task and it is best
not to treat them like a black box programs
SEARCHING DATABASES
Comparing a sequence against a database to discover similarities is one of the most
frequently used and powerful tools in bioinformatics. In essence, searching a database is the
same as aligning two sequences. However, to perform a pair-wise alignment of the query
sequence with every sequence in the database
would be too time consuming. Therefore
programs use heuristic strategies to speed up the
analysis are usually used. FASTA and BLAST
are the two most commonly used programs for
searching databases. Both programs use rapid
exact match procedures to first identify
sequences which are most likely to be related.
These sequences are then subjected to further
analyses by alignment programs. BLAST (basic
local alignment search tool) uses an approach
based on matching short sequence fragments and then finds the best local alignments between
the query sequence and the database sequences. Several BLAST programs are available for
different types of sequence matching (see Table).
BLAST PROGRAMS
PROGRAM QUERY DB COMMENTS
BLASTP protein protein
compares amino acid query against protein
sequences
BLASTN DNA DNA
compares nucleotide query against DNA
sequences
BLASTX DNA protein
compares 6X translations of nucleotide query
against protein sequences
TBLASTN protein DNA
compares protein query against 6X
translations of DNA sequences
TBLASTX DNA DNA
compares 6X translations of nucleotide query
against 6X translations of DNA sequences
BLAST searches of the most current version of GenBank can be performed at the
National Center for Biotechnology Information (NCBI) by cutting and pasting the query
sequence onto their web page (http://www.ncbi.nlm.nih.gov/ BLAST/). The entire database or
Databases
primary (original biological data)
vs. secondary (value added)
three 1
o
DNA databases
GenBank
EMBL
DDBJ
subdivisions
annotated
211
subdivisions of the database can be searched. It is also desirable to 'filter' low complexity
sequences such as long runs of repetitive sequence (eg., tracts of poly-alanine, etc.) and most
BLAST programs filter by default. Such regions of sequence can give spuriously high scores
against unrelated proteins. Similarly, iterative searches are prone to contamination by regions
corresponding to coiled-coils or transmembrane domains. These characteristics might match the
initial search and the program then emphasizes these inappropriate characteristics. The user can
also choose cut-off values (i.e., E-values), the number of matches to report, and the number of
alignments to show.
The entire database(s) is searched and sequences with similarity to the query sequence
are identified and ranked accordingly (see Appendix 2 for sample output) to the alignment score
derived from the pair-wise alignment. In addition to the this 'raw or bit score', the output
includes a 'statistical score' and the alignments. The statistical score, or expectation value
(E-value), provides a measure of the expected number of sequences in the database that would
achieve a given alignment score by chance. The E-values are more useful in terms of judging
the significance of a match than the alignment score. E-values for proteins and DNA should be
less than 0.1 and 0.0001, respectively, to be considered significant. Examining the alignments
will also help in inferring whether the hit is significant. For example, protein global alignments
which show 25% or greater sequence identity over a stretch of at least 80 amino acids should
exhibit the same basic structure. The identified sequences can be also retrieved and subjected to
further analyses. Database searches may assist in identifying an unknown gene or provide clues
about its function.
PROTEOMICS
The availability of the complete genomic sequence from several organisms repre-
sents a major advancement in the understanding of biology. However, the gene sequences
provide a limited amount of information about the proteins that are encoded by the genes. In
addition, phenotype will be determined by the proteins and not the genes (i.e., genotype).
Efforts are now being directed towards the characterization of the proteome, or the complete
set of proteins found in a cell, tissue or organism. Proteomics encompasses many types of
activities and analyses with a goal of having a complete understanding of protein function
and to apply this knowledge (Figure).
212
One objective of proteomics is to identify the complete complement of proteins.
Genomics provides a first step in this process since all of the genes within a genome can
potentially be identified. However, the algorithms used to predict the exon/intron structure
of a gene, and to the lesser extend the beginning and end of a gene, are not always accurate.
In addition, some genes can undergo alternate splicing and thus produce multiple proteins
from the same gene. Therefore, many of the predicted genes will need to be confirmed by
additional analysis.
The proteome is a dynamic entity in that genes are expressed at specific times and
places and environmental conditions will also influence gene expression. Furthermore, many
proteins are found in specific subcellular compartments or modified post-translationally
(eg., phosphorylation, glycosylation, acylation, proteolysis, etc.). The subcellular location of
a protein as well as the post-translational modifications will have an impact on cellular
phenotype. Protein function is also dependent on protein-protein interactions and resolving
these networks of protein-protein interactions is also central to understanding protein
function and cellular phenotype. Knowing the structure of proteins also contributes to
understanding protein function. Protein structure can be determined by X-ray
crystallography and biophysical techniques. Some elements of protein structure can also be
inferred from the protein sequence and comparing these sequences to related proteins in
which the structures have been determined. The information about a protein's structure and
function can then be used in applications such as drug development.
Gene identification and expression. Some information on proteins is already
available due to previous research and protein characterization and this information is easily
incorporated into the genome databases. Similarly information on the identity and
expression of proteins will be continuously generated as particular proteins are studied.
However, this approach is selective in that proteins and genes which are associated with
interesting phenomena will be preferentially studied and it will take substantial time to
individually characterize all of the genes with unknown function.
Expressed sequence tags (ESTs) and DNA microarrays provide a more rapid means
in regards to characterizing genes and their expression. ESTs represent a collection mRNA
sequences (i.e., cDNA sequences) maintained in DNA sequence databases which have been
cloned from a defined source and partially sequenced. The cDNA clones have been chosen
at random from a cDNA library without selection and represent the mRNA profile of the
source (i.e., organism, tissue, cell, etc.) and thus provide information about gene expression.
These ESTs can also be used to assist in the identification of expression start sites and
positions of introns, even in the cases of unknown genes, by aligning the genomic sequence
with the EST sequence. The original clones from which the EST sequences were obtained
are maintain in respositories and can be obtained and sequenced in their entirities. Micro-
array technology (see section on DNA Microarrays in Hybridization Chapter) is being used
to identify the expression of mRNA on a large scale.
Protein identification. However, in many cases the genes of specific proteins have
not been identified and the presence of mRNA does not always correlate with protein
expression. The evaluation of proteins on a large scale, or by high throughput methods, is
213
not as advanced as the generation and analysis of DNA sequence. Much of protein analsysis
still involves the analysis of one protein at a time and requires the separation, identification
and characterization of proteins resolved from complex mixtures.
Gel electrophoresis of proteins is the predominant technique used in the separation
and isolation of proteins (see Chapter on Protein Electrophoresis). One-dimensional SDS gel
electrophoresis is capable of resolving many complex mixtures of proteins into individual
polypeptide chains. Two-dimensional gels (IEF + SDS-PAGE) can be used if additional
resolution is needed. Proteins are then be transferred to a membrane and subjected to
N-terminal microsequencing (see Microsequening section in Protein Purification Overview
chapter). In cases where the N-termini are blocked it may be possible to break the protein
into smaller peptides with site-specific proteases or chemicals and determine an internal
sequence. However, substantially more protein is needed to determine these internal
sequences.
Problems with blocked N-termini and low abundance may be alleviated by a mixed
peptide approach. In this method proteins are subjected to gel electrophoresis, transferred to
a membrane and the band of interest excised as in a typical microsequencing protocol. The
isolated protein is then cleaved into peptides with CNBr (cleaves at Met) or skatole (cleaves
at Trp). On average 3-5 peptides will be generated depending on the frequency of these
these amino acids. The membrane is then subjected to 6-12 automated Edman cycles. Every
cycle will result in several amino acid residues. This mixed sequence data are then analyzed
by a computer algorithm which will sort and match the data against protein or DNA
databases to identify candidate protein(s). (Additional information on these programs is
available at http://fasta.biochem.virginia.edu/)
Mass spectrometry. An increase in the sensitivity of protein identification can be
achieved with a mass spectrometer. Mass spectrometers consist of three basic components:
an ionization source, one or more mass analyzers, and an ion detector. Various types of
instruments utilizing different types of ionization sources and mass analyzers exist.
Biological samples are ionized through the addition or loss of protons. Following ionization
the masses of the components are determined. For example, in a time-of-flight mass
analyzer the time it takes to traverse the length of the flight tube is a function of mass. A
spectrum of the components plotted according to mass is recorded.
The mass spectrometer can be used to determine accurate peptide masses or amino
acid sequences of peptides. This information is then be used to identify proteins by
searching databases. For example, a protein is digested with trypsin, or another site specific
214
protease, and the resulting peptides analyzed by mass spectrometry. This acquired MS
spectrum can then be compared with predicted MS spectrums of all the proteins in a
database. The advantage of this method is that the analysis can be carried out quickly and
can be completely automated. However, there is some ambiguity in protein identification
due to peptide mass redundancy (i.e., same amino acid composition but different sequence
will be the same mass). In addition, factors which affect the accurate determination of
peptide mass (eg., post-translational modifications) will limit the abililty to successfully
identify proteins in databases.
Tandem mass spectrometry (MS/MS) can be used to deduce the amino acid sequence
of a peptide. In this approach ions with particular masses (i.e., m/z values) are separated
from the other ions and then fragmented in a collision chamber. The collision chamber is
filled with an inert gas (usually argon or nitrogen) and collisions with the ions and the gas
atoms result in covalent bonds being broken. The masses of the resulting fragments are then
determined by a second mass analyzer. The mass spectrum of the fragments is diagnostic of
the molecular structure of the parent ion. For example, peptides tend to fragment primarily
along the peptide backbone at the amide bond which creates a ladder of ions that is indica-
tive of the amino acid sequence. The sequence is used to search databases. Multiple peptides
from the same protein can be analyzed in this fashion and thus increasing the confidence of
the protein identification. The disadvantage of MS/MS is that the process is not easy to
completely automated. Although computer programs are available, interpretation and analy-
sis of the mass spectrum requires some human guidance.
High throughput analyses. The procedures described above rely upon identification
of proteins by gel electrophoresis followed by their subsequent identification using either
one- or two-dimensional gel electrophoresis. The ability of two-dimensional gels to resolve
215
thousands of polypeptides on a single gel makes it a powerful technique in proteomics.
However, 2-D gels are somewhat limited to the identification of relatively abundant proteins
in the mid-to-low molecular weight ranges. Furthermore, membrane associated proteins and
cytoskeletal proteins are difficult to solubilize and hydrophobic proteins do not always
resolve well in the isoelectric focusing dimension. In addition, two-dimensional gel
electrophoresis is a labor intensive and time consuming process and the protein 'spots' need
to be further characterized by mass spectrometry or Edman degradation individually.
To overcome these limitations high throughput methods to analyze complex
mixtures of proteins are being developed. One approach is to combine a high throughput
microcaillary liquid chromatography with tandem mass spectrotometry. In this approach
complex mixtures of proteins are treated with site-specific endoproteases. The resulting
peptides are subjected to liquid chromatography (HPLC) without a prior gel electrophoresis
step and then directly introduced into the tandem MS. Elimination of the gel electrophoresis
step provides provides a greater amount of flexibility in the proteolytic digestion and also
increases the overall sensitivity. The first MS analysis will determine an accurate mass of
the peptides which is indicative of the amino acid composition and then the fragmentation of
those peptides can be used to predict the amino acid sequence. Databases are then searched
for potential matches.
This LC/MS/MS approach can be used to generate protein expression maps that are
analogous to EST databases. Crude proteins from a particular tissue can be fractionated into
cytosolic, membrane/organellar, cytoskeletal, etc. fractions and then analyzed for the
expressed proteins in the mixture. This type of analysis will work best in organisms in
which the genome sequence or large banks of EST sequences are available. This approach
can also be used in the identification of the components of less complex protein mixtures
such as large multi-protein complexes. Similarly protein-protein interactions can be
discerned by affinity purifying all of the proteins that interact with the target protein and
then analyzing the mixture. Methods to purify binding proteins include: co-
immunoprecipitation with antibodies against the target protein, co-precipitation with an
affinity tagged (eg., His
6
) recombinant target protein, or affinity chromatography with the
target protein.
Additional Reading on Proteomics
Yates, J.R. 2000. Mass spectrometry from genomics to proteomics. Tr. Genet. 16:5-8.
Graves, P.R. and Haystead, T.A.J.. 2002. Molecular biologist's guide to protomics.
Microbiol. Mol. Biol. Rev. 66:39-63
216
APPENDIX 1. WEBSITES
List of links to molecular biology sites
http://www.expasy.ch/alinks.html
Sequence retrievial system (capable of searching numerous databases and medline
simutaneously)
http://www.ncbi.nlm.nih.gov/Entrez/
Database Searches (submit a query sequence and search for homologies in the databases)
http://www.ncbi.nlm.nih.gov/BLAST/
http://www2.ebi.ac.uk/fasta3/
Translation (translate nucleotide sequence into protein sequence)
http://www.expasy.ch/tools/dna.html
Pairwise Alignments
http://genome.eerie.fr/fasta/align-query.html
Multiple Alignments
http://www.ibc.wustl.edu/service/clustal.html
http://dot.imgen.bcm.tmc.edu:9331/multi-align/Options/clustalw.html
Protein Analysis (numerous programs for analyzing proteins)
http://www.expasy.ch
http://www.ebi.ac.uk/Tools/index.html
2
o
Protein Structure
http://www.embl-heidelberg.de/predictprotein/predictprotein.html
217
APPENDIX 2. RESULTS OF BLAST SEARCH
Quer y= Pbpp58b ( 423 l et t er s)
Dat abase: nr ( 493, 611 sequences; 154, 780, 071 t ot al l et t er s)
Scor e E
Sequences pr oduci ng si gni f i cant al i gnment s: ( bi t s) Val ue
sp| Q08168| HRP_PLABE 58 KD PHOSPHOPROTEI N ( HEAT SHOCK- RELATED PRO. . . 334 1e- 90
gb| AAC37300. 1| ( L21710) 58 kDa phosphopr ot ei n [ Pl asmodi umber ghei ] 329 3e- 89
pi r | | T10455 heat shock r el at ed pr ot ei n - Pl asmodi umber ghei >gi | . . . 250 2e- 65
sp| P50503| HI P_RAT HSC70- I NTERACTI NG PROTEI N >gi | 4379408| emb| CAA5. . . 106 5e- 22
sp| P50502| HI P_HUMAN HSC70- I NTERACTI NG PROTEI N ( PROGESTERONE RECE. . . 87 3e- 16
gb| AAF45894. 1| ( AE003429) CG2947 gene pr oduct [ Dr osophi l a mel ano. . . 87 4e- 16
pi r | | T24865 hypot het i cal pr ot ei n T12D8. 8 - Caenor habdi t i s el egan. . . 86 5e- 16
pi r | | T04562 hypot het i cal pr ot ei n T12H17. 60 - Ar abi dopsi s t hal i an. . . 81 2e- 14
.
.
.
.
.
gb| AAC60555. 2| ( S59774) STI 1 st r ess- i nduci bl e pr ot ei n homol og [ S. . . 48 2e- 04
gb| AAD33401. 1| AF129086_1 ( AF129086) car boxy t er mi nus of Hsp70- i n. . . 48 2e- 04
pi r | | A56534 P58 pr ot ei n - bovi ne >gi | 468012| gb| AAA17795. 1| ( U046. . . 48 2e- 04
gb| AAB49720. 1| ( U89984) t r ansf or mat i on- sensi t i ve pr ot ei n homol og. . . 47 4e- 04
pi r | | T16689 hypot het i cal pr ot ei n R05F9. 10 - Caenor habdi t i s el ega. . . 47 4e- 04
gb| AAD33400. 1| AF129085_1 ( AF129085) car boxy t er mi nus of Hsp70- i n. . . 46 6e- 04
.
.
.
.
.
.
emb| CAA61595. 1| ( X89416) pr ot ei n phosphat ase 5 [ Homo sapi ens] 43 0. 007
pdb| 1A17| Tet r at r i copept i de Repeat s Of Pr ot ei n Phosphat ase 5 43 0. 007
r ef | NP_006238. 1| | pr ot ei n phosphat ase 5, cat al yt i c subuni t >gi | 1. . . 43 0. 007
pi r | | S52570 phosphopr ot ei n phosphat ase ( EC 3. 1. 3. 16) 5, cat al yt i . . . 43 0. 007
gb| AAB18614. 1| ( U12203) phosphopr ot ei n phosphat ase [ Rat t us nor ve. . . 43 0. 007
sp| P53042| PPP5_RAT SERI NE/ THREONI NE PROTEI N PHOSPHATASE 5 ( PP5) . . . 43 0. 007
gb| AAB60384. 1| ( U25174) ser i ne- t hr eoni ne phosphat ase [ Homo sapi ens] 43 0. 007
sp| Q60676| PPP5_MOUSE SERI NE/ THREONI NE PROTEI N PHOSPHATASE 5 ( PP5. . . 42 0. 009
gb| AAB70573. 1| ( AF018262) pr ot ei n phosphat ase 5; PP5 [ Mus muscul us] 42 0. 009
Examples of Alignments
>sp| P50503| HI P_RAT HSC70- I NTERACTI NG PROTEI N >gi | 4379408| emb| CAA57546. 1| ( X82021)
Hsc70- i nt er act i ng pr ot ei n [ Rat t us nor vegi cus] ( Lengt h = 368)
Scor e = 106 bi t s ( 261) , Expect = 5e- 22
I dent i t i es = 60/ 224 ( 26%) , Posi t i ves = 97/ 224 ( 42%)
Quer y: 1 MDI EKI EDLKKFVASCEENPSI LLKPELSFFKDFI ESFGGKI KKDKMGYXXXXXXXXXXX 60
MD K+ +L+ FV C ++PS+L E+ F ++++ES GGK+
Sbj ct : 1 MDPRKVSELRAFVKMCRQDPSVLHTEEMRFLREWVESMGGKVPPATHKAKSEENTKEEKR 60
( SDEEEEDEEEEEEEEEDDDPEKLE)
Quer y: 61 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVECPPLAPXXXXXXXXXXXXXXCKLKEEA 120
+ P + K A
Sbj ct : 61 DKTTEDNI KTEEPSSEESDLEI DNEGVI EADTDAPQEMGDENAEI TEAMMDEANEKKGAA 120
Quer y: 121 VDLVENKKYEEALEKYNKI I SFGNPSAMI YTKRASI LLNLKRPKACI RDCTEALNLNVDS 180
+D + + + ++A++ + I A++Y KRAS+ + L++P A I RDC A+ +N DS
Sbj ct : 121 I DALNDGELQKAI DLFTDAI KLNPRLAI LYAKRASVFVKLQKPNAAI RDCDRAI EI NPDS 180
Filtering--Glu rich
Entries removed
for clarity
Entries removed
for clarity
Probability of match
appearing by chance
Alignment Score
Identifier Line:
database | accession # | name or locus
218
Quer y: 181 ANAYKI RAKAYRYLGKWEFAHADMEQGQKI DYDENLWDMQKLI Q 224
A YK R KA+R LG WE A D+ K+DYDE+ M + +Q
Sbj ct : 181 AQPYKWRGKAHRLLGHWEEAARDLALACKLDYDEDASAMLREVQ 224
>pi r | | T24865 hypot het i cal pr ot ei n T12D8. 8 - Caenor habdi t i s el egans ( Lengt h = 422)
Scor e = 86. 2 bi t s ( 210) , Expect = 5e- 16
I dent i t i es = 44/ 101 ( 43%) , Posi t i ves = 60/ 101 ( 58%) , Gaps = 2/ 101 ( 1%)
Quer y: 119 EAVDLVENKKYEEALEKYNKI I SFGNPSAMI YTKRASI LLNLKRPKACI RDCTEALNLNV 178
+A + N ++ AL + I SAM++ KRA++LL LKRP A I DC +A+++N
Sbj ct : 121 KAQEAFSNGDFDTALTHFTAAI EANPGSAMLHAKRANVLLKLKRPVAAI ADCDKAI SI NP 180
Quer y: 179 DSANAYKI RAKAYRYLGKWEFAHADMEQGQKI DYDE- - NLW217
DSA YK R +A R LGKW A D+ K+DYDE N W
Sbj ct : 181 DSAQGYKFRGRANRLLGKWVEAKTDLATACKLDYDEAANEW221
Scor e = 41. 4 bi t s ( 95) , Expect = 0. 016
I dent i t i es = 16/ 34 ( 47%) , Posi t i ves = 23/ 34 ( 67%)
Quer y: 9 LKKFVASCEENPSI LLKPELSFFKDFI ESFGGKI 42
LK+FV C+ NP++L PE FFKD++ S G +
Sbj ct : 7 LKQFVGMCQANPAVLHAPEFGFFKDYLVSLGATL 40
Middle row = matches and similar residues (+)
Gaps to maximize alignment
A second high-
scoring segment