Professional Documents
Culture Documents
Simatic Fault-Tolerant Systems S7-400H: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 A B C D E F
Simatic Fault-Tolerant Systems S7-400H: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 A B C D E F
Preface 1
Fault-tolerant automation
___________________
systems 2
___________________
S7-400H setup options 3
___________________
Getting Started 4
SIMATIC
___________________
Assembly of a CPU 41x–H 5
Special functions of a CPU
Fault-tolerant systems ___________________
41x-H 6
S7-400H S7–400H in PROFIBUS DP
___________________
mode 7
System and operating states
___________________
of the S7–400H 8
System Manual
___________________
Link-up and update 9
___________________
Using I/Os in S7–400H 10
___________________
Communication 11
___________________
Configuring with STEP 7 12
Failure and replacement of
components during operation 13
___________________
System modifications during
___________________
operation 14
___________________
Synchronization modules 15
S7-400 cycle and response
___________________
times 16
___________________
Technical data 17
Characteristic values of
___________
A
redundant automation
systems
___________________
Stand-alone operation B
Migrating from S5-H to
___________________
S7-400H C
Differences between fault-
___________
D
tolerant systems and
standard systems
Function modules and
___________
E
communication processors
supported by the S7-400H
12/2010
Connection examples for
A5E00267695-07
redundant I/Os F
___________________
Legal information
Legal information
Warning notice system
This manual contains notices you have to observe in order to ensure your personal safety, as well as to prevent
damage to property. The notices referring to your personal safety are highlighted in the manual by a safety alert
symbol, notices referring only to property damage have no safety alert symbol. These notices shown below are
graded according to the degree of danger.
DANGER
indicates that death or severe personal injury will result if proper precautions are not taken.
WARNING
indicates that death or severe personal injury may result if proper precautions are not taken.
CAUTION
with a safety alert symbol, indicates that minor personal injury can result if proper precautions are not taken.
CAUTION
without a safety alert symbol, indicates that property damage can result if proper precautions are not taken.
NOTICE
indicates that an unintended result or situation can occur if the corresponding information is not taken into
account.
If more than one degree of danger is present, the warning notice representing the highest degree of danger will
be used. A notice warning of injury to persons with a safety alert symbol may also include a warning relating to
property damage.
Qualified Personnel
The product/system described in this documentation may be operated only by personnel qualified for the specific
task in accordance with the relevant documentation for the specific task, in particular its warning notices and
safety instructions. Qualified personnel are those who, based on their training and experience, are capable of
identifying risks and avoiding potential hazards when working with these products/systems.
Proper use of Siemens products
Note the following:
WARNING
Siemens products may only be used for the applications described in the catalog and in the relevant technical
documentation. If products and components from other manufacturers are used, these must be recommended
or approved by Siemens. Proper transport, storage, installation, assembly, commissioning, operation and
maintenance are required to ensure that the products operate safely and without any problems. The permissible
ambient conditions must be adhered to. The information in the relevant documentation must be observed.
Trademarks
All names identified by ® are registered trademarks of the Siemens AG. The remaining trademarks in this
publication may be trademarks whose use by third parties for their own purposes could violate the rights of the
owner.
Disclaimer of Liability
We have reviewed the contents of this publication to ensure consistency with the hardware and software
described. Since variance cannot be precluded entirely, we cannot guarantee full consistency. However, the
information in this publication is reviewed regularly and any necessary corrections are included in subsequent
editions.
1 Preface .................................................................................................................................................... 15
1.1 Preface.........................................................................................................................................15
2 Fault-tolerant automation systems........................................................................................................... 19
2.1 Redundant SIMATIC automation systems...................................................................................19
2.2 Increasing the availability of plants ..............................................................................................21
3 S7-400H setup options ............................................................................................................................ 23
3.1 S7-400H setup options ................................................................................................................23
3.2 Rules for the assembly of fault-tolerant stations..........................................................................25
3.3 The S7–400H basic system .........................................................................................................26
3.4 I/O modules for S7–400H.............................................................................................................28
3.5 Communication ............................................................................................................................29
3.6 Tools for configuration and programming ....................................................................................30
3.7 The user program ........................................................................................................................31
3.8 Documentation .............................................................................................................................32
4 Getting Started ........................................................................................................................................ 33
4.1 Getting Started .............................................................................................................................33
4.2 Requirements...............................................................................................................................33
4.3 Hardware assembly and commissioning of the S7–400H ...........................................................34
4.4 Examples of the response of the fault-tolerant system to faults ..................................................36
5 Assembly of a CPU 41x–H....................................................................................................................... 37
5.1 Operator controls and display elements of the CPUs..................................................................37
5.2 Monitoring functions of the CPU ..................................................................................................42
5.3 Status and error displays .............................................................................................................45
5.4 Mode selector...............................................................................................................................48
5.5 Security levels ..............................................................................................................................49
5.6 Operating sequence for memory reset ........................................................................................50
5.7 Design and function of the memory cards ...................................................................................53
5.8 Multi-point interface (MPI)............................................................................................................57
5.9 PROFIBUS DP interface..............................................................................................................58
5.10 Overview of the parameters for the S7-400H CPUs....................................................................59
S7-400H
System Manual, 12/2010, A5E00267695-07 3
Table of contents
S7-400H
4 System Manual, 12/2010, A5E00267695-07
Table of contents
S7-400H
System Manual, 12/2010, A5E00267695-07 5
Table of contents
S7-400H
6 System Manual, 12/2010, A5E00267695-07
Table of contents
S7-400H
System Manual, 12/2010, A5E00267695-07 7
Table of contents
17.5 Runtimes of the FCs and FBs for redundant I/Os..................................................................... 326
A Characteristic values of redundant automation systems ........................................................................ 329
A.1 Basic concepts .......................................................................................................................... 329
A.2 Comparison of MTBF for selected configurations..................................................................... 334
A.2.1 System configurations with redundant CPU 417-4H ................................................................ 334
A.2.2 System configurations with distributed I/Os .............................................................................. 335
A.2.3 Comparison of system configurations with standard and fault-tolerant communication........... 338
B Stand-alone operation ........................................................................................................................... 339
C Migrating from S5-H to S7-400H............................................................................................................ 345
C.1 General aspects ........................................................................................................................ 345
C.2 Configuration, programming, and diagnostics .......................................................................... 346
D Differences between fault-tolerant systems and standard systems........................................................ 347
E Function modules and communication processors supported by the S7-400H...................................... 351
F Connection examples for redundant I/Os............................................................................................... 355
F.1 SM 321; DI 16 x DC 24 V, 6ES7 321–1BH02–0AA0 ................................................................ 355
F.2 SM 321; DI 32 x DC 24 V, 6ES7 321–1BL00–0AA0................................................................. 357
F.3 SM 321; DI 16 x AC 120/230V, 6ES7 321–1FH00–0AA0......................................................... 358
F.4 SM 321; DI 8 x AC 120/230 V, 6ES7 321–1FF01–0AA0 .......................................................... 359
F.5 SM 321; DI 16 x DC 24V, 6ES7 321–7BH00–0AB0 ................................................................. 360
F.6 SM 321; DI 16 x DC 24V, 6ES7 321–7BH01–0AB0 ................................................................. 361
F.7 SM 326; DO 10 x DC 24V/2A, 6ES7 326–2BF01–0AB0 .......................................................... 362
F.8 SM 326; DI 8 x NAMUR, 6ES7 326–1RF00–0AB0................................................................... 363
F.9 SM 326; DI 24 x DC 24 V, 6ES7 326–1BK00–0AB0 ................................................................ 364
F.10 SM 421; DI 32 x UC 120 V, 6ES7 421–1EL00–0AA0............................................................... 365
F.11 SM 421; DI 16 x DC 24 V, 6ES7 421–7BH01–0AB0 ................................................................ 366
F.12 SM 421; DI 32 x DC 24 V, 6ES7 421–1BL00–0AB0................................................................. 368
F.13 SM 421; DI 32 x DC 24 V, 6ES7 421–1BL01–0AB0................................................................. 369
F.14 SM 322; DO 8 x DC 24 V/2 A, 6ES7 322–1BF01–0AA0 .......................................................... 371
F.15 SM 322; DO 32 x DC 24 V/0,5 A, 6ES7 322–1BL00–0AA0...................................................... 372
F.16 SM 322; DO 8 x AC 230 V/2 A, 6ES7 322–1FF01–0AA0......................................................... 373
F.17 SM 322; DO 4 x DC 24 V/10 mA [EEx ib], 6ES7 322–5SD00–0AB0 ....................................... 374
F.18 SM 322; DO 4 x DC 15 V/20 mA [EEx ib], 6ES7 322–5RD00–0AB0 ....................................... 375
F.19 SM 322; DO 8 x DC 24 V/0.5 A, 6ES7 322–8BF00–0AB0 ....................................................... 376
F.20 SM 322; DO 16 x DC 24 V/0.5 A, 6ES7 322–8BH01–0AB0 ..................................................... 377
F.21 SM 332; AO 8 x 12 Bit, 6ES7 332–5HF00–0AB0 ..................................................................... 378
F.22 SM 332; AO 4 x 0/4...20 mA [EEx ib], 6ES7 332–5RD00–0AB0 .............................................. 379
S7-400H
8 System Manual, 12/2010, A5E00267695-07
Table of contents
Tables
S7-400H
System Manual, 12/2010, A5E00267695-07 9
Table of contents
Figures
S7-400H
10 System Manual, 12/2010, A5E00267695-07
Table of contents
S7-400H
System Manual, 12/2010, A5E00267695-07 11
Table of contents
Figure 11-6 Example of redundancy with fault-tolerant system and fault-tolerant CPU ...............................172
Figure 11-7 Example of redundancy with fault-tolerant system and redundant bus system.........................173
Figure 11-8 Example of redundancy with a fault-tolerant system, redundant bus system, and CP
redundancy on PC. ....................................................................................................................174
Figure 11-9 Example of linking standard and fault-tolerant systems in a simple bus system.......................176
Figure 11-10 Example of linking of standard and fault-tolerant systems in a redundant ring .........................177
Figure 11-11 Example of linking standard and fault-tolerant systems in a redundant bus system .................177
Figure 11-12 Example of redundancy with fault-tolerant systems and a redundant bus system with
redundant standard connections................................................................................................178
Figure 11-13 Example of connecting a fault-tolerant system to a single-channel third-party system .............179
Figure 11-14 Example of linking a fault-tolerant system to a single-channel third-party system ....................180
Figure 11-15 Communication load as a variable of data throughput (basic profile)........................................181
Figure 11-16 Communication load as a variable of response time (basic profile) ..........................................182
Figure 15-1 Synchronization module.............................................................................................................262
Figure 15-2 Fiber-optic cables, installation using distribution boxes.............................................................271
Figure 16-1 Elements and composition of the cycle time..............................................................................275
Figure 16-2 Different cycle times...................................................................................................................281
Figure 16-3 Minimum cycle time....................................................................................................................282
Figure 16-4 Formula: Influence of communication load ................................................................................283
Figure 16-5 Distribution of a time slice ..........................................................................................................283
Figure 16-6 Dependency of the cycle time on communication load..............................................................284
Figure 16-7 DP cycle times on the PROFIBUS DP network .........................................................................287
Figure 16-8 Shortest response time ..............................................................................................................288
Figure 16-9 Longest response time...............................................................................................................289
Figure A-1 MDT............................................................................................................................................330
Figure A-2 MTBF..........................................................................................................................................331
Figure A-3 Common Cause Failure (CCF) ..................................................................................................332
Figure A-4 Availability ..................................................................................................................................333
Figure B-1 Overview: System structure for system modifications during operation ....................................343
Figure F-1 Example of an interconnection with SM 321; DI 16 x DC 24 V..................................................356
Figure F-2 Example of an interconnection with SM 321; DI 32 x DC 24 V..................................................357
Figure F-3 Example of an interconnection with SM 321; DI 16 x AC 120/230 V.........................................358
Figure F-4 Example of an interconnection with SM 321; DI 8 x AC 120/230 V...........................................359
Figure F-5 Example of an interconnection with SM 321; DI 16 x DC 24V...................................................360
Figure F-6 Example of an interconnection with SM 321; DI 16 x DC 24V...................................................361
Figure F-7 Example of an interconnection with SM 326; DO 10 x DC 24V/2A ...........................................362
S7-400H
12 System Manual, 12/2010, A5E00267695-07
Table of contents
S7-400H
System Manual, 12/2010, A5E00267695-07 13
Table of contents
S7-400H
14 System Manual, 12/2010, A5E00267695-07
Preface 1
1.1 Preface
S7-400H
System Manual, 12/2010, A5E00267695-07 15
Preface
1.1 Preface
Note
There may be further restriction for individual modules. Refer to the information in the
corresponding product information and FAQ, or in SIMATIC NET News.
Approvals
For details on certifications and standards, refer to the S7-400 Automation System, Module
Data manual, Section 1.1, Standards and Certifications.
Online help
In addition to the manual, you will find detailed support on how to use the software in the
integrated online help system of the software.
The help system can be accessed using various interfaces:
● The Help menu contains several commands: Contents opens the Help index. You will find
help on H systems in Configuring H-Systems.
● Using Help provides detailed instructions on using the online help system.
● The context-sensitive help system provides information on the current context, for
example, on an open dialog box or an active window. You can call this help by clicking
"Help" or using the F1 key.
S7-400H
16 System Manual, 12/2010, A5E00267695-07
Preface
1.1 Preface
● The status bar provides a further form of context-sensitive help. It shows a short
description of each menu command when you position the mouse pointer over a
command.
● A short info text is also shown for the toolbar buttons when you hold the mouse pointer
briefly over a button.
If you prefer to read the information of the online help in printed form, you can print individual
topics, books or the entire help system.
Additional support
If you have any questions relating to the products described in this manual, and do not find
the answers in this documentation, please contact your Siemens partner at our local offices.
You will find information on who to contact at:
Contact partners (http://www.siemens.com/automation/partner)
A guide to the technical documents for the various SIMATIC products and systems is
available at:
Documentation (http://www.automation.siemens.com/simatic/portal/html_76/techdoku.htm)
You can find the online catalog and order system under:
Catalog (http://mall.automation.siemens.com/)
Training center
We offer a range of relevant courses to help you to get started with the SIMATIC S7
automation system. Please contact your local training center or the central training center.
Training (http://www.sitrain.com/index_en.html)
S7-400H
System Manual, 12/2010, A5E00267695-07 17
Preface
1.1 Preface
Additional information about our technical support is available on the Internet at:
Technical Support (http://support.automation.siemens.com)
S7-400H
18 System Manual, 12/2010, A5E00267695-07
Fault-tolerant automation systems 2
2.1 Redundant SIMATIC automation systems
5HGXQGDQWDXWRPDWLRQV\VWHPVHJ
)DXOWWROHUDQWRXWRIV\VWHPV )DLOVDIHRXWRIV\VWHPV
2EMHFWLYH5HGXFHGULVNRISURGXF 2EMHFWLYH3URWHFWOLIHWKH
WLRQORVVE\PHDQVRISDUDOOHO HQYLURQPHQWDQGLQYHVWPHQWVE\
RSHUDWLRQRIWZRV\VWHPV VDIHO\GLVFRQQHFWLQJWRDVHFXUH
RIISRVLWLRQ
S7-400H
System Manual, 12/2010, A5E00267695-07 19
Fault-tolerant automation systems
2.1 Redundant SIMATIC automation systems
Software redundancy
For many applications, the requirements for redundancy quality or the extent of plant
sections that may require redundant automation systems do not necessarily justify the
implementation of a special fault-tolerant system. Frequently, simple software mechanisms
are adequate to allow a failed control task to be continued on a substitute system if a
problem occurs.
The optional "SIMATIC S7 Software Redundancy" software package can be implemented on
S7-300 and S7-400 standard systems to control processes that tolerate switchover delays to
a substitute system in the seconds range, e.g. in water works, water treatment plants, or
traffic flows.
Redundant I/O
Input/output modules are termed redundant when they exist twice and they are configured
and operated as redundant pairs. The use of redundant I/O provides the highest degree of
availability, because the system tolerates the failure of a CPU or of a signal module. If you
require a redundant I/O, you use the blocks of the "Functional I/O Redundancy" function
block library, see section Connecting redundant I/O (Page 129).
S7-400H
20 System Manual, 12/2010, A5E00267695-07
Fault-tolerant automation systems
2.2 Increasing the availability of plants
System-wide integration
The S7-400H automation system and all other SIMATIC components such as the SIMATIC
PCS7 control system are matched to one another. The system-wide integration, ranging
from the control room to the sensors and actuators, is implemented as a matter of course
and ensures maximum system performance.
6HUYHU 6HUYHU
(QJLQHHULQJ
26ZRUNVWDWLRQ &OLHQW &OLHQW 6\VWHP
5HSRUWSULQWHU
&RQWURO
/$1UHGXQGDQW
6+ 6ZLWK
6 V\VWHP IDXOWWROHUDQW
6
$XWRPDWLRQV\VWHPV
352),%86'3UHGXQGDQW
(70 '33$EXVFRXSOHU
(7% (7/ (7;
'LVWULEXWHG,2
6HQVRUVDF
WXDWRUV
S7-400H
System Manual, 12/2010, A5E00267695-07 21
Fault-tolerant automation systems
2.2 Increasing the availability of plants
Redundancy nodes
Redundant nodes represent the fail safety of systems with redundant components. A
redundant node can be considered as independent when the failure of a component within
the node does not result in reliability constraints in other nodes or in the overall system.
The availability of the overall system can be illustrated simply in a block diagram. With a 1-
out-of-2 system, one component of the redundant node may fail without impairing the
operability of the overall system. The weakest link in the chain of redundant nodes
determines the availability of the overall system
No error/fault
5HGXQGDQWQRGHVZLWKRIUHGXQGDQF\
With error/fault
The following figure shows how a component may fail without impairing the functionality of
the overall system.
60
36 &38 %XV ,0
5HGXQGDQWQRGHVZLWKRIUHGXQGDQF\
S7-400H
22 System Manual, 12/2010, A5E00267695-07
S7-400H setup options 3
3.1 S7-400H setup options
The first part of the description deals with the basic setup of the fault-tolerant S7-400H
automation system, and with the components of an S7-400H basic system. We then
describe the hardware components with which you can expand this basic system.
The second part deals with the software tools required for configuring and programming the
S7-400H. Also included is a description of the extensions and functional expansions
available for the S7-400 standard system which you need to create your user program to
utilize all properties of your S7-400H in order to increase availability.
WARNING
Open equipment
S7–400 modules are classified as open equipment, meaning you must install the S7-400 in
an enclosure, cabinet, or switch room which can only be accessed by means of a key or
tool. Such enclosures, cabinets, or switch rooms may only be accessed by instructed or
authorized personnel.
The following figure shows an example of an S7-400H configuration with shared distributed
I/O and connection to a redundant plant bus. The next pages deal with the hardware and
software components required for the installation and operation of the S7-400H.
S7-400H
System Manual, 12/2010, A5E00267695-07 23
S7-400H setup options
3.1 S7-400H setup options
UHGXQGDQWV\VWHPEXV(WKHUQHW
6+$XWRPDWLRQ6\VWHP
'LVWULEXWHG,2(7
0
'LVWULEXWHG,2(7
5HGXQGDQW352),%86'3 0
Additional information
The components of the S7-400 standard system are also used in the fault-tolerant S7–400H
automation system. For a detailed description of all hardware components for S7–400, refer
to the Reference Manual S7-400 Automation System; Module Specifications.
The rules governing the design of the user program and the use of function blocks laid down
for the S7-400 standard system also apply to the fault-tolerant S7-400H automation system.
Refer to the descriptions in the Programming with STEP 7 manual, and to the System
Software for S7-300/400; Standard and System Functions Reference Manual.
S7-400H
24 System Manual, 12/2010, A5E00267695-07
S7-400H setup options
3.2 Rules for the assembly of fault-tolerant stations
S7-400H
System Manual, 12/2010, A5E00267695-07 25
S7-400H setup options
3.3 The S7–400H basic system
5DFN85+ 6+EDVHV\VWHP
5DFN 5DFN
ILEHURSWLFFDEOHV
Power supply
You require one power supply module from the standard range of the S7-400 for each H-
CPU, or to be more precise, for each of the two subsystems of the S7-400H.
To increase availability of the power supply, you can also use two redundant power supplies
in each subsystem. Use the power supply modules PS 405 R / PS 407 R for this purpose.
They can also be used together in redundant configurations (PS 405 R with PS 407 R).
S7-400H
26 System Manual, 12/2010, A5E00267695-07
S7-400H setup options
3.3 The S7–400H basic system
Synchronization modules
The synchronization modules are used to link the two CPUs. They are installed in the CPUs
and interconnected by means of fiber-optic cables.
There are two types of synchronization modules: one for distances up to 10 meters, and one
for distances up to 10 km between the CPUs.
A fault-tolerant system requires 4 synchronization modules of the same type. For more
information on synchronization modules, refer to section Synchronization modules for S7–
400H (Page 261).
Fiber-optic cable
The fiber-optic cables are used to interconnect the synchronization modules for the
redundant link between the two CPUs. They interconnect the upper and lower
synchronization modules in pairs.
You will find the specifications of fiber-optic cables suitable for use in an S7-400H in
section Selecting fiber-optic cables (Page 267).
S7-400H
System Manual, 12/2010, A5E00267695-07 27
S7-400H setup options
3.4 I/O modules for S7–400H
Additional information
For detailed information on using the I/O, refer to section Using I/Os in S7–400H (Page 121).
S7-400H
28 System Manual, 12/2010, A5E00267695-07
S7-400H setup options
3.5 Communication
3.5 Communication
The S7-400H supports the following communication methods and mechanisms:
● Plant buses with Industrial Ethernet
● Point-to-point connection
This equally applies to the central and distributed components. Suitable communication
modules are listed in Appendix Function modules and communication processors supported
by the S7-400H (Page 351).
Communication availability
You can vary the availability of communication with the S7-400H. The S7-400H supports
various solutions to meet your communication requirements. These range from a simple
linear network structure to a redundant optical two-fiber loop.
Fault-tolerant communication via PROFIBUS or Industrial Ethernet is supported only by the
S7 communication functions.
Additional information
For detailed information on communication with the S7-400H, refer to
section Communication (Page 163).
S7-400H
System Manual, 12/2010, A5E00267695-07 29
S7-400H setup options
3.6 Tools for configuration and programming
Optional software
All standard tools, engineering tools and runtime software used in the S7-400 system are
also supported by the S7-400H system.
S7-400H
30 System Manual, 12/2010, A5E00267695-07
S7-400H setup options
3.7 The user program
NOTICE
Required OBs
Always download these error OBs to the S7-400H CPU: OB 70, OB 72, OB 80, OB 82,
OB 83, OB 85, OB 86, OB 87, OB 88, OB 121 and OB 122. If you do not download
these OBs, the fault-tolerant system goes into STOP when an error occurs.
Additional information
For detailed information on programming the blocks listed above, refer to the Programming
with STEP 7 manual, and to the System Software for S7-300/400; System and Standard
Functions Reference Manual.
S7-400H
System Manual, 12/2010, A5E00267695-07 31
S7-400H setup options
3.8 Documentation
3.8 Documentation
The figure below provides an overview of the descriptions of the various components and
options in the S7-400H automation system.
6XEMHFW 'RFXPHQWDWLRQ
+DUGZDUH 6VWDQGDUGGRFXPHQWDWLRQ
3RZHUVXSSO\FDQEHUHGXQGDQW
+:DQG,QVW0RG6SHF,QVWUXFWLRQ/LVW
85+UDFN
,0
(7b0GLVWULEXWHG,2GHYLFH
,0
'33$b/LQNDQG</LQNEXVOLQNV
+VSHFLILFSURJUDPPLQJ+VSHFLILF2%V6)&V+VSHFLILFH[SDQVLRQRI66/HYHQWVDQGKHOSRQHUURU
67(3'RFXPHQWDWLRQ
3URJUDPPLQJZLWK67(396\VWHPDQG
6WDQGDUG)XQFWLRQVPDQXDODQGRQOLQHKHOS
+V\VWHPGHWDLOV
)DXOWWROHUDQW6\VWHPV,QVWDOOD
WLRQ2SWLRQV6+*HWWLQJ
6WDUWHG
6\VWHPPRGHV6+OLQNXS 6+DXWRPDWLRQV\VWHP
DQGXSGDWH,2&RQILJXULQJ
FRPPXQLFDWLRQZLWK67(3 )DXOWWROHUDQWV\VWHPVPDQXDO
)DOXUHDQGUHSODFHPHQW6\VWHP DQGRQOLQHKHOS
FKDQJHV
)DLOVDIHV\VWHPV
&RQILJXUDWLRQDQGSURJUDPPLQJ
RIIDLOVDIHV\VWHPV:RUNLQJZLWK 6b))+DXWRPDWLRQV\VWHPV
6)V\VWHPV9
0DQXDO
S7-400H
32 System Manual, 12/2010, A5E00267695-07
Getting Started 4
4.1 Getting Started
Based on a specific example, these instructions guide you through the steps to implement
commission all the way to a functional application. You will learn how an S7-400H
automation system operates and become familiar with its response to a fault.
It takes about 1 to 2 hours to work through this example, depending on your previous
experience.
4.2 Requirements
The following requirements must be met:
A correctly installed and valid version of the STEP 7 basic software on your programming
device; see section Configuring with STEP 7 (Page 185). Any necessary hardware updates
are installed.
The modules required for the hardware setup available:
● An S7-400H automation system consisting of:
– 1 UR2–H rack
– 2 PS 407 10 A power supply units
– 2 H–CPUs
– 4 synchronization modules
– 2 fiber-optic cables
● An ET 200M distributed I/O device with active backplane bus with
– 2 IM 153–2
– 1 digital input module, SM321 DI 16 x DC24V
– 1 digital output module, SM322 DO 16 x DC24V
● All necessary accessories such as PROFIBUS cables, etc.
S7-400H
System Manual, 12/2010, A5E00267695-07 33
Getting Started
4.3 Hardware assembly and commissioning of the S7–400H
5DFN 5DFN
6+$XWRPDWLRQ6\VWHP
'LVWULEXWHG,2(70
1. Assemble both modules of the S7-400H automation system as described in the S7-400
Automation Systems, Installation and Module Specifications manuals.
2. Set the rack numbers using the switch on the rear of the CPUs.
An incorrectly set rack number prevents online access and the CPU might not start up.
3. Install the synchronization modules in the CPUs as described in the S7-400 Automation
System, Installation manual.
4. Connect the fiber-optic cables.
Always interconnect the two upper and the two lower synchronization modules of the
CPUs. Route your fiber-optic cables so that they are reliably protected against any
damage.
You should also always make sure that the two fiber-optic cables are routed separately.
This increases availability and protects the fiber-optic cables from potential double errors
caused, for example, by interrupting both cables at the same time.
Furthermore, always connect the fiber-optic cables to both CPUs before you switch on
the power supply or the system. Otherwise both CPUs may execute the user program as
master CPU.
5. Configure the distributed I/O as described in the ET 200M Distributed I/O Device manual.
6. Connect the programming device to the first fault-tolerant CPU (CPU0). This CPU will be
the master of your S7-400H.
7. A high-quality RAM test is executed after POWER ON. This takes about 10 minutes. The
CPU cannot be accessed and the STOP LED flashes for the duration of this test. If you
use a backup battery, this test is no longer performed when you power up in future.
S7-400H
34 System Manual, 12/2010, A5E00267695-07
Getting Started
4.3 Hardware assembly and commissioning of the S7–400H
Note
You can also start and stop the S7-400H automation system using STEP 7.
For additional information, refer to the online help.
You can only initiate a cold restart using the programming device command "Cold
restart". For this purpose, the CPU must be in STOP mode and the mode selector switch
must be set to RUN. OB 102 is called in the cold restart routine.
S7-400H
System Manual, 12/2010, A5E00267695-07 35
Getting Started
4.4 Examples of the response of the fault-tolerant system to faults
S7-400H
36 System Manual, 12/2010, A5E00267695-07
Assembly of a CPU 41x–H 5
5.1 Operator controls and display elements of the CPUs
3ULQWHGLQIRUPDWLRQLQFOXGLQJWKH
PRGXOH,'SURGXFWYHUVLRQRUGHU &38+
X 2
QXPEHUDQGILUPZDUHYHUVLRQ 3 4
+-$%
9
,)0)
0HPRU\&DUGVORW ,)0)
)5&(
0675
5$&.
581 5$&.
6723
0RGHVHOHFWRU
581
6723
05(6
/RZHUVKURXGLQJFRYHU /RZHUVKURXGLQJFRYHU
03,352),%86'3
LQWHUIDFH 6XEPRGXOHVRFNHWIRU
V\QFKURQL]DWLRQVXEPRGXOH
'DWD0DWUL[&RGH
SVPS317696
X1
MPI/DP
6HULDOQXPEHU IF1
6XEPRGXOHVRFNHWIRU
V\QFKURQL]DWLRQVXEPRGXOH
)HHGRIH[WHUQDOEDFNXS
YROWDJHWRWKH&38 EXT.-BATT
5...15 V DC
IF2
RQWKHUHDUVLGH
6ZLWFKIRUVHWWLQJWKHUDFN
QXPEHU
Figure 5-1 Arrangement of the operator controls and display elements on the CPU 412-3H
S7-400H
System Manual, 12/2010, A5E00267695-07 37
Assembly of a CPU 41x–H
5.1 Operator controls and display elements of the CPUs
3ULQWHGLQIRUPDWLRQLQFOXGLQJWKH
PRGXOH,'SURGXFWYHUVLRQRUGHU &38+
X 2
QXPEHUDQGILUPZDUHYHUVLRQ 3 4
+0$%
9
0HPRU\&DUGVORW ,)0)
)5&(
0675
5$&.
581 5$&.
6723
0RGHVHOHFWRU
581
6723
05(6
/RZHUVKURXGLQJFRYHU /RZHUVKURXGLQJFRYHU
03,352),%86'3
LQWHUIDFH 6XEPRGXOHVRFNHWIRU
V\QFKURQL]DWLRQVXEPRGXOH
'DWD0DWUL[&RGH
SVPS317696
X1
MPI/DP
6HULDOQXPEHU IF1
352),%86'3
LQWHUIDFH
6XEPRGXOHVRFNHWIRU
V\QFKURQL]DWLRQVXEPRGXOH
X2
)HHGRIH[WHUQDOEDFNXS DP
YROWDJHWRWKH&38 EXT.-BATT
5...15 V DC
IF2
RQWKHUHDUVLGH
6ZLWFKIRUVHWWLQJWKHUDFN
QXPEHU
Figure 5-2 Layout of the operator controls and display elements of the CPU 414-4H/417-4H
S7-400H
38 System Manual, 12/2010, A5E00267695-07
Assembly of a CPU 41x–H
5.1 Operator controls and display elements of the CPUs
LED displays
The following table shows an overview of the LED displays on the individual CPUs.
Sections Monitoring functions of the CPU (Page 42) and Status and error displays
(Page 45) describe the states and errors/faults indicated by these LEDs.
Mode selector
You can use the mode selector switch to set the current operating mode of the CPU. The
mode selector switch is a toggle switch with three switching positions.
Section Mode selector (Page 48) describes the functions of the mode selector switch.
S7-400H
System Manual, 12/2010, A5E00267695-07 39
Assembly of a CPU 41x–H
5.1 Operator controls and display elements of the CPUs
MPI/DP interface
You can, for example, connect the following devices to the MPI of the CPU:
● Programming devices
● Operator control and monitoring devices
● For further S7-400 or S7-300 controllers, see section Multi-point interface (MPI)
(Page 57).
Use bus connectors with angled cable outlet, see the S7–400 Automation System,
Installation manual.
The MPI can also be configured for operation as DP master and therefore as a PROFIBUS
DP interface with up to 32 DP slaves.
PROFIBUS DP interface
The PROFIBUS DP interface supports the connection of distributed I/O, programming
devices and OPs.
S7-400H
40 System Manual, 12/2010, A5E00267695-07
Assembly of a CPU 41x–H
5.1 Operator controls and display elements of the CPUs
For incoming supply at the "EXT. BATT" socket, you require a connecting cable with a 2.5
mm ∅ jack connector as shown in the figure below. Observe the polarity of the jack
connector.
PPMDFNSOXJ %ODFNRUEOXH!PLQXVSROH
You can order an assembled jack connector and cable with the order number
A5E00728552A.
Note
If you replace a power supply module and want to backup the user program and the data (as
described above) in an RAM while doing so, you must connect an auxiliary power supply to
the "EXT. BATT." socket.
S7-400H
System Manual, 12/2010, A5E00267695-07 41
Assembly of a CPU 41x–H
5.2 Monitoring functions of the CPU
Type of error Cause of error Response of the operating system Error LED
Access error Module failure (SM, FM, CP) LED "EXTF" remains lit until the error EXTF
is eliminated.
In SMs:
Call of OB 122 with direct access,
call of OB 85 in the event of a
process image update
Entry in the diagnostic buffer
In the case of input modules: Entry
of "null" as date in the accumulator
or the process image
In the case of other modules:
Call of OB 122 with direct access,
call of OB 85 in the event of a
process image update
Time error The user program execution time (OB 1 LED "INTF" remains lit until the error is INTF
and all interrupts and error OBs) eliminated.
exceeds the specified maximum cycle Call of OB 80.
time. If the OB is not loaded: CPU changes
OB request error to STOP mode.
Overflow of the start information buffer
Time-of-day error interrupt
Power supply In the central or expansion rack: Call of OB 81 EXTF
module(s) fault If the OB is not loaded: The CPU
at least one backup battery in the power
(not power failure) remains in RUN.
supply module is flat.
the backup voltage is missing.
the 24 V supply to the power supply
module has failed.
Diagnostic An I/O module with interrupt capability Call of OB 82 EXTF
interrupt reports a diagnostic interrupt If the OB is not loaded: CPU changes
to STOP mode.
S7-400H
42 System Manual, 12/2010, A5E00267695-07
Assembly of a CPU 41x–H
5.2 Monitoring functions of the CPU
Type of error Cause of error Response of the operating system Error LED
Swapping interrupt Removal or insertion of an SM, and insertion Call of OB 83 EXTF
of a wrong module type. If the OB is not loaded: CPU changes
to STOP mode.
CPU hardware A memory error was detected and Call of OB 84 INTF
fault eliminated If the OB is not loaded: The CPU
Redundant link: Data transfer errors. remains in RUN.
S7-400H
System Manual, 12/2010, A5E00267695-07 43
Assembly of a CPU 41x–H
5.2 Monitoring functions of the CPU
Type of error Cause of error Response of the operating system Error LED
Programming User program error: Call of OB 121 INTF
error If the OB is not loaded: CPU changes
BCD conversion error
to STOP mode.
Range length error
Range error
Alignment error
Write error
Timer number error
Counter number error
Block number error
Block not loaded
MC7 code error Error in the compiled user program, for CPU changes to STOP mode. INTF
example, illegal OP code or a jump beyond Restart or memory reset required.
block end
S7-400H
44 System Manual, 12/2010, A5E00267695-07
Assembly of a CPU 41x–H
5.3 Status and error displays
LED Meaning
RUN STOP
Lit Dark The CPU is in RUN mode.
Dark Lit The CPU is in STOP mode. The user program is not being executed. Cold
restart/restart is possible. If the STOP status was triggered by an error, the error
indicator (INTF or EXTF) is also set.
Flashes Flashes CPU is DEFECTIVE. All other LEDs also flash at 2 Hz.
2 Hz 2 Hz
Flashes Lit HOLD status has been triggered by a test function.
0.5 Hz
Flashes Lit A cold restart/restart was initiated. The cold restart/warm start may take a minute or
2 Hz longer, depending on the length of the called OB. If the CPU still does not change to
RUN, there might be an error in the system configuration, for example.
Dark Flashes Self-test when unbuffered POWER ON is running. The self-test may take up to 10
2 Hz minutes
Memory is being reset
Irrelevant Flashes The CPU requests a memory reset.
0.5 Hz
Flashes Flashes Troubleshooting mode
0.5 Hz 0.5 Hz
LED Meaning
MSTR RACK0 RACK1
Lit Irrelevant Irrelevant CPU controls switched I/O
Irrelevant Lit Dark CPU on rack number 0
Irrelevant Dark Lit CPU on rack number 1
S7-400H
System Manual, 12/2010, A5E00267695-07 45
Assembly of a CPU 41x–H
5.3 Status and error displays
LED Meaning
INTF EXTF FRCE
Lit Irrelevant Irrelevant An internal error was detected (programming or parameter
assignment error).
Irrelevant Lit Irrelevant An external error was detected (i.e. an error whose cause is not in the
CPU module).
Irrelevant Irrelevant Lit A force request is active.
LED Meaning
BUS1F BUS2F
Lit Irrelevant An error was detected on the MPI/DP interface.
Irrelevant Lit An error was detected on the PROFIBUS DP interface.
Flashes Irrelevant DP master: No response from one or more slaves on PROFIBUS DP interface 1. DP
slave: Not addressed by the DP master.
Irrelevant Flashes DP master: No response from one or more slaves on PROFIBUS DP interface 2. DP
slave: Not addressed by the DP master.
LED Meaning
IFM1F IFM2F
Lit Irrelevant An error was detected on synchronization module 1.
Irrelevant Lit An error was detected on synchronization module 2
S7-400H
46 System Manual, 12/2010, A5E00267695-07
Assembly of a CPU 41x–H
5.3 Status and error displays
REDF LED
The REDF LED indicates specific system states and redundancy errors.
Diagnostic buffer
In STEP 7, you can select "PLC -> Module Information" to read the cause of an error from
the diagnostic buffer.
S7-400H
System Manual, 12/2010, A5E00267695-07 47
Assembly of a CPU 41x–H
5.4 Mode selector
Positions
The mode selector is designed as toggle switch. The following figure shows all possible
positions of the mode selector.
581
6723
05(6
The following table explains the positions of the mode selector. If an error or a startup
problem occurs, the CPU will either change to or stay in STOP mode regardless of the
position of the mode selector switch.
Position Explanations
RUN If there is no startup problem or error and the CPU was able to switch to RUN, the CPU either
executes the user program or remains idle. The I/O can be accessed.
STOP The CPU does not execute the user program. In the default parameter setting, the output modules
are disabled.
MRES Toggle switch position for CPU memory reset, see section Operating sequence for memory reset
(memory reset; (Page 50)
master reset)
S7-400H
48 System Manual, 12/2010, A5E00267695-07
Assembly of a CPU 41x–H
5.5 Security levels
S7-400H
System Manual, 12/2010, A5E00267695-07 49
Assembly of a CPU 41x–H
5.6 Operating sequence for memory reset
S7-400H
50 System Manual, 12/2010, A5E00267695-07
Assembly of a CPU 41x–H
5.6 Operating sequence for memory reset
Cold restart
● A cold restart resets the process image, all bit memories, timers, counters, and data
blocks to the initial values stored in the load memory, regardless of whether these data
were parameterized as being retentive or not.
● Program execution resumes with OB 1, or with OB 102 if available.
Warm restart
● A warm restart resets the process image and the non-retentive bit memories, timers,
times, and counters.
Retentive bit memories, timers, counters, and all data blocks retain their last valid value.
● Program execution resumes with OB 1, or with OB 100 if available.
● If the power supply is interrupted, the warm restart function is only available in backup
mode.
S7-400H
System Manual, 12/2010, A5E00267695-07 51
Assembly of a CPU 41x–H
5.6 Operating sequence for memory reset
S7-400H
52 System Manual, 12/2010, A5E00267695-07
Assembly of a CPU 41x–H
5.7 Design and function of the memory cards
Order numbers
The order numbers for memory cards are listed in the technical specifications, see section
Technical data of memory cards (Page 325).
)URQWYLHZ 6LGHYLHZ
1DPHRIWKHPHPRU\FDUG
7\SHSODWHZLWKVHULDOQXPEHU
HJ6931
2UGHUQXPEHU
+DQGOH
S7-400H
System Manual, 12/2010, A5E00267695-07 53
Assembly of a CPU 41x–H
5.7 Design and function of the memory cards
RAM card
Insert the RAM card to load the user program in the CPU. Load the user program in STEP 7
by selecting "PLC > Download user program to Memory Card".
You can load the entire user program or individual elements such as FBs, FCs, OBs, DBs, or
SDBs in the load memory in STOP or RUN mode.
When you remove the RAM card from the CPU, the information stored on it will be lost. The
RAM card is not equipped with an integrated backup battery.
If the power supply is equipped with an operational backup battery, or the CPU is supplied
with an external backup voltage at the "EXT. BATT." socket, the RAM card memory contents
are retained when power is switched off, provided the RAM card remains inserted in the
CPU and the CPU remains inserted in the rack.
FLASH card
If you use a FLASH card, there are two ways of loading the user program:
● Use the mode selector to set the CPU to STOP. Insert the FLASH card into the CPU, and
then download the user program to the FLASH card in
STEP 7 by selecting "PLC > Download user program to Memory Card".
● Load the user program into the FLASH card in offline mode on the programming
device/programming adapter, and then insert the FLASH card into the CPU.
The FLASH card is a non-volatile memory, i.e. its data are retained when it is removed from
the CPU or your S7-400 is being operated without backup voltage (without a backup battery
in the power supply module or external backup voltage at the "EXT. BATT." input of the
CPU).
S7-400H
54 System Manual, 12/2010, A5E00267695-07
Assembly of a CPU 41x–H
5.7 Design and function of the memory cards
NOTICE
Data block on FLASH card
Do not transfer any data blocks to the FLASH card that are automatically generated when
the CPU starts up.
The CPU will not start up if this is the case. The automatically generated data blocks will
only be available in an offline project, if you have downloaded them from the CPU to the
offline project.
S7-400H
System Manual, 12/2010, A5E00267695-07 55
Assembly of a CPU 41x–H
5.7 Design and function of the memory cards
S7-400H
56 System Manual, 12/2010, A5E00267695-07
Assembly of a CPU 41x–H
5.8 Multi-point interface (MPI)
Connectable devices
You can, for example, connect the following devices to the MPI:
● Programming devices (PG/PC)
● Operating and monitoring devices (OPs and TDs)
● Further SIMATIC S7 controllers
Various compatible devices take the 24 V supply from the interface. This voltage is non-
isolated.
PG/OP–CPU communication
A CPU is capable of handling several online connections to PGs/OPs in parallel. By default,
however, one of these connections is always reserved for a PG, and one for an OP/HMI
device.
CPU–CPU communication
CPUs exchange data by means of S7 communication.
For additional information, refer to the Programming with STEP 7 manual.
Connectors
Always use bus connectors with an angular cable outlet for PROFIBUS DP or PG cables to
connect devices to the MPI (see Installation Manual).
MPI as DP interface
You can also parameterize the MPI for operation as DP interface. To do so, reparameterize
the MPI under STEP 7 in the SIMATIC Manager. You can configure a DP segment with up to
32 slaves.
S7-400H
System Manual, 12/2010, A5E00267695-07 57
Assembly of a CPU 41x–H
5.9 PROFIBUS DP interface
Connectable devices
You can connect any standard-compliant DP slaves to the PROFIBUS DP interface.
Here, the CPU represents the DP master, and is connected to the passive slave stations or,
in stand-alone mode, to other DP masters via the PROFIBUS DP fieldbus.
Various compatible devices take the 24 V supply from the interface. This voltage is non-
isolated.
Connectors
Always use bus connectors for PROFIBUS DP and PROFIBUS cables to connect devices to
the PROFIBUS DP interface (refer to the Installation Manual).
Redundant mode
In redundant mode, the PROFIBUS DP interfaces have the same parameters.
S7-400H
58 System Manual, 12/2010, A5E00267695-07
Assembly of a CPU 41x–H
5.10 Overview of the parameters for the S7-400H CPUs
Default values
You can determine the CPU-specific default values by selecting "Configuring Hardware" in
STEP 7.
Parameter blocks
The responses and properties of the CPU are defined in parameters which are stored in
system data blocks. The CPUs have a defined default setting. You can modify these default
setting by editing the parameters in the hardware configuration.
The list below provides an overview of the parameterizable system properties of the CPUs.
● General properties such as the CPU name
● Start-up
● Cycle/clock memory, e.g. the scan cycle monitoring time
● Retentivity, i.e. the number of bit memories, timers, and counters retained
● Memory, e.g. local data
Note: If you change the work memory allocation by modifying parameters, this work
memory is reorganized when you download system data to the CPU. The result of this is
that data blocks that were created with SFC are deleted, and the remaining data blocks
are assigned initial values from the load memory.
If you change the following parameters, the work memory area available for logic blocks
and data blocks will be modified when loading the system data:
– Size of the process image, byte-oriented in the "Cycle/Clock memory" tab
– Communication resources in the "Memory" tab
– Size of the diagnostic buffer in the "Diagnostics/Clock" tab
– Number of local data for all priority classes in the "Memory" tab
● Assignment of interrupts (hardware interrupts, time delay interrupts, asynchronous error
interrupts) to the priority classes
● Time-of-day interrupts such as start, interval duration, priority
● Watchdog interrupts, e.g. priority, interval duration
● Diagnostics/clock, e.g. time-of-day synchronization
● Security levels
● Fault tolerance parameters
S7-400H
System Manual, 12/2010, A5E00267695-07 59
Assembly of a CPU 41x–H
5.10 Overview of the parameters for the S7-400H CPUs
Note
If you modify the parameters listed below, the operating system initializes the following:
Further settings
● The rack number of a fault-tolerant CPU, 0 or 1
Use the selector switch on the rear panel of the CPU to change the rack number.
● The operating mode of a fault-tolerant CPU: Stand-alone or redundant mode
For information on how to change the operating mode of a fault-tolerant CPU, refer to
Appendix Stand-alone operation (Page 339).
S7-400H
60 System Manual, 12/2010, A5E00267695-07
Special functions of a CPU 41x-H 6
6.1 Updating the firmware without a memory card
Basic procedure
To update the firmware of a CPU, you will receive several files (*.UPD) containing the
current firmware. Download these files to the CPU. You do not need a memory card to
perform an online update. However, it is still possible to update the firmware using a memory
card.
Requirement
The CPU whose firmware you want to update must be accessible online, e.g. via
PROFIBUS, MPI, or Industrial Ethernet. The files containing the current firmware versions
must be available in the programming device/PC file system. A folder may contain only the
files of one firmware version. If security level 2 or 3 is set for the CPU, you require the
password to update the firmware.
Note
You can update the firmware of the H-CPUs via Industrial Ethernet if the CPU is connected
to the Industrial Ethernet via a CP. Updating the firmware over a MPI can take a long time if
the transfer rate is low (e.g. approximately 10 minutes at 187.5 Kbit/s).
Procedure
Proceed as follows to update the firmware of a CPU:
1. Open the station containing the CPU you want to update in HW Config.
2. Select the CPU.
3. Select the "PLC -> Update Firmware" menu command.
4. In the "Update Firmware" dialog, select the path to the firmware update files (*.UPD)
using the "Browse" button.
After you have selected a file, the information in the bottom boxes of the "Update
Firmware" dialog box indicate the modules for which the file is suitable and from which
firmware version.
5. Click on "Run".
S7-400H
System Manual, 12/2010, A5E00267695-07 61
Special functions of a CPU 41x-H
6.1 Updating the firmware without a memory card
STEP 7 verifies that the selected file can be interpreted by the CPU and then downloads the
file to the CPU. If this requires changing the operating state of the CPU, you will be prompted
to do this in the relevant dialog boxes.
NOTICE
Power on/off without battery backup
If the firmware update is interrupted by a power cycle without battery backup, it is possible
that the CPU no longer has a functioning operating system. You can recognize this by the
LEDs INTF and EXTF both flashing. You can only correct this by reloading the firmware
from a memory card.
S7-400H
62 System Manual, 12/2010, A5E00267695-07
Special functions of a CPU 41x-H
6.2 Firmware update in RUN mode
Requirement
The size of the load memory on the master and reserve CPU is the same. Both Sync links
exist and are working.
Procedure with STEP 7 V5.3 SP2 up to and including STEP 7 V5.4 SP2
Follow the steps below to update the firmware of the CPUs of an H system in RUN:
1. In SIMATIC Manager, set one of the CPUs to STOP with "PLC -> Operating Mode
CPUs".
2. Select this CPU in HW Config.
3. Select the "PLC -> Update Firmware" menu command.
The "Update Firmware" dialog box opens. Select the firmware file from which the current
firmware will be downloaded to the selected CPU.
4. In SIMATIC Manager or HW Config, select the "PLC -> Operating Mode -> Switch to CPU
41xH" and select the "with altered operating system" check box.
The fault-tolerant system switches the Master/Reserve roles, after which the CPU will be
in RUN mode again.
5. Repeat steps 1 to 3 for the other CPU.
6. Restart the CPU. The fault-tolerant system will return to redundant mode.
S7-400H
System Manual, 12/2010, A5E00267695-07 63
Special functions of a CPU 41x-H
6.2 Firmware update in RUN mode
Both CPUs have updated firmware (operating system) and are in redundant mode.
NOTICE
Note the following for STEP 7 V5.3 SP2 up to and including STEP 7 V5.4 SP2:
With these STEP7 versions, if you run "PLC -> Update Firmware" from HW Config before
you have set the CPU to STOP in SIMATIC Manager, both CPUs go to STOP.
Note
Only the third number of the firmware versions of the master and reserve CPU may differ by
1. You can only update to the newer version.
Example: From V4.5.0 to V4.5.1
Please take note of any information posted in the firmware download area.
The constraints described in section System and operating states of the S7–400H
(Page 81) also apply to a firmware update in RUN
S7-400H
64 System Manual, 12/2010, A5E00267695-07
Special functions of a CPU 41x-H
6.3 Reading service data
Application case
If you need to contact Customer Support due to a service event, the department may require
specific diagnostic information on the CPU status of your system. This information is stored
in the diagnostic buffer and in the actual service data.
Select the "PLC -> Save service data" command to read this information and save the data
to two files. You can then send these to Customer Support.
Note the following:
● If possible, save the service data immediately after the CPU goes into STOP or the
synchronization of a fault-tolerant system has been lost.
● Always save the service data of both CPUs in an H system.
Procedure
1. Select the "PLC > Save service data" command
In the dialog box that opens up, select the file path and the file names.
2. Save the files.
3. Forward these files to Customer Support on request.
S7-400H
System Manual, 12/2010, A5E00267695-07 65
Special functions of a CPU 41x-H
6.3 Reading service data
S7-400H
66 System Manual, 12/2010, A5E00267695-07
S7–400H in PROFIBUS DP mode 7
7.1 CPU 41x–H as PROFIBUS DP master
Introduction
This chapter describes how to use the CPU as DP master and configure it for direct data
exchange.
Further references
For details and information on engineering, configuring a PROFIBUS subnet, and
diagnostics in a PROFIBUS subnet, refer to the STEP 7 Online Help.
Additional information
Details and information on migrating from PROFIBUS DP to PROFIBUS DPV1 can be found
on the Internet at:
http://support.automation.siemens.com
under entry number 7027576
DP diagnostics addresses occupy at least 1 byte for the DP master and each DP slave in the
input address area. At these addresses, the DP standard diagnostics can be called for the
relevant node by means of the LADDR parameter of SFC 13, for example. Define the DP
diagnostics addresses when you configure the project data. If you do not specify any DP
diagnostics addresses, STEP 7 automatically assigns the addresses as DP diagnostics
addresses in descending order, starting at the highest byte address.
In DPV1 mode of the master, the slaves are usually assigned 2 diagnostics addresses.
S7-400H
System Manual, 12/2010, A5E00267695-07 67
S7–400H in PROFIBUS DP mode
7.1 CPU 41x–H as PROFIBUS DP master
Requirement
You have to configure the relevant CPU interface for use as PROFIBUS DP master. This
means you must make the following settings in STEP 7:
● Assign a network
● Configure the CPU as PROFIBUS DP master
● Assign a PROFIBUS address
● Select the operating mode, S7–compatible or DPV1
The default setting is DPV1
● Link DP slaves to the DP master system
Note
Is one of the PROFIBUS DP slaves a CPU 31x or CPU 41x?
If yes, you will find it in the PROFIBUS DP catalog as "preconfigured station". Assign this
DP slave CPU a slave diagnostics address in the PROFIBUS DP master. Link the
PROFIBUS DP master to the DP slave CPU, and specify the address areas for data
exchange with the DP slave CPU.
NOTICE
S7-400H
68 System Manual, 12/2010, A5E00267695-07
S7–400H in PROFIBUS DP mode
7.1 CPU 41x–H as PROFIBUS DP master
Determining the bus topology in a DP master system using SFC 103 "DP_TOPOL"
A diagnostic repeater is available to make it easier to localize disrupted modules or DP cable
breaks when failures occur during operation. This module is a slave that discovers the
topology of a PROFIBUS subnet and detects any problems caused by it.
S7-400H
System Manual, 12/2010, A5E00267695-07 69
S7–400H in PROFIBUS DP mode
7.1 CPU 41x–H as PROFIBUS DP master
You can use SFC 103 "DP_TOPOL" to trigger the determination of the bus topology of a DP
master system by the diagnostic repeater. SFC 103 is described in the corresponding online
help and in the "System and Standard Functions manual. For information on the diagnostic
repeater refer to the "Diagnostic Repeater for PROFIBUS DP manual, order number
6ES7972–0AB00–8BA0.
Table 7- 2 Meaning of the "BUSF" LED of the CPU 41x operating as DP master
S7-400H
70 System Manual, 12/2010, A5E00267695-07
S7–400H in PROFIBUS DP mode
7.1 CPU 41x–H as PROFIBUS DP master
S7-400H
System Manual, 12/2010, A5E00267695-07 71
S7–400H in PROFIBUS DP mode
7.1 CPU 41x–H as PROFIBUS DP master
&38[+
'LDJQRVWLFVHYHQW
2%LVFDOOHG
5HDG2%B0'/B$''5DQG )RUWKHGLDJQRVLVRIWKHDIIHFWHG
2%B,2B)/$* ,2PRGXOH FRPSRQHQW&DOO6)%LQ'39
LGHQWLILHU HQYLURQPHQW
02'( VHW
(QWHUELWRIWKH2%B,2B)/$*
'LDJQRVWLFGDWDDUHHQWHUHGLQ
DVELWLQ2%B0'/B$''5
SDUDPHWHUV7,1)2DQG$,1)2
5HVXOW'LDJQRVWLFVDGGUHVV
2%B0'/B$''5
&DOO6)&&DOO6)& )RUWKHGLDJQRVLVRIWKHDIIHFWHGPRGXOHV&DOO
6)&
,QSDUDPHWHU/$''5HQWHUGLDJQRVWLFV ,QSDUDPHWHU,1'(;HQWHUGLDJQRVWLFVDGGUHVV
DGGUHVV2%B0'/B$''5
2%B0'/B$''5
,QSDUDPHWHU66/B,'
HQWHU,':% GLDJQRVWLFVGDWDRID
PRGXOH
S7-400H
72 System Manual, 12/2010, A5E00267695-07
S7–400H in PROFIBUS DP mode
7.1 CPU 41x–H as PROFIBUS DP master
6&38DV'3PDVWHU '3VODYH
352),%86
6SHFLI\GLDJQRVWLFDGGUHVVHVLQWKHFRQILJXUDWLRQ
'LDJQRVWLFDGGUHVV 'LDJQRVWLFDGGUHVV
'XULQJFRQILJXUDWLRQRIWKH'3PDVWHUVSHFLI\ 'XULQJFRQILJXUDWLRQRIWKH'3VODYHDOVR
DGLDJQRVWLFDGGUHVVIRUWKH'3VODYHLQWKH VSHFLI\DGLDJQRVWLFDGGUHVVWKDWLVDVVLJQHG
DVVRFLDWHGSURMHFWRIWKH'3PDVWHU7KLV WRWKH'3VODYHLQWKHDVVRFLDWHGSURMHFWRI
GLDJQRVWLFDGGUHVVLVLGHQWLILHGDVDVVLJQHGWR WKH'3VODYH7KLVGLDJQRVWLFDGGUHVVLV
WKH'3PDVWHUEHORZ LGHQWLILHGDVDVVLJQHGWRWKH'3VODYHEHORZ
7KLVGLDJQRVWLFDGGUHVVLVXVHGE\WKH'3 7KLVGLDJQRVWLFDGGUHVVLVXVHGE\WKH'3
PDVWHUWRREWDLQLQIRUPDWLRQDERXWWKHVWDWXV VODYHWRREWDLQLQIRUPDWLRQDERXWWKHVWDWXVRI
RIWKH'3VODYHRUDERXWEXVLQWHUUXSWLRQV WKH'3PDVWHURUDERXWEXVLQWHUUXSWLRQV
6HHDOVRWDEOHEHORZ
Event detection
The following table shows how the CPU 41xH in DP master mode detects operating state
changes on a DP slave or interruptions of the data transfer.
S7-400H
System Manual, 12/2010, A5E00267695-07 73
S7–400H in PROFIBUS DP mode
7.1 CPU 41x–H as PROFIBUS DP master
system=1022
The CPU calls OB 82 with the following information, for example: CPU: RUN → STOP
OB 82_MDL_ADDR:=1022 CPU generates a DP slave diagnostics frame.
OB82_EV_CLASS:=B#16#39
As incoming event
OB82_MDL_DEFECT:=module error
The CPU diagnostic buffer also contains this information
Your user program should also be set up to read the diagnostic
data of the DP slave using SFC 13 "DPNRM_DG".
Use SFB 54 in the DPV1 environment. This outputs the full interrupt
information.
S7-400H
74 System Manual, 12/2010, A5E00267695-07
S7–400H in PROFIBUS DP mode
7.2 Consistent data
Example 1:
In order to provide a consistent image of the process signals to the CPU for the duration of
cyclic program processing, the process signals are written to the process input image prior to
program execution, or the processing results are written to the process output image after
program execution. Subsequently, during program processing when the inputs (I) and
outputs (O) operand areas are addressed, the user program addresses the internal memory
area of the CPU on which the process image is located instead of directly accessing the
signal modules.
Example 2:
Inconsistency may develop when a communication block, such as SFB 14 "GET" or SFB 15
"PUT", is interrupted by a process alarm OB of higher priority. If the user program modifies
any data of this process alarm OB which in part have already been processed by the
communication block, certain parts of the transferred data will have retained their original
status which was valid prior to process alarm processing, while others represent data from
after process alarm processing.
This results in inconsistent data, i.e. data which are no longer associated.
SFC 81 "UBLKMOV"
Use SFC 81 "UBLKMOV" to copy the content of a memory area, the source area,
consistently to another memory area, the destination area. The copy operation cannot be
interrupted by other operating system activities.
SFC 81 "UBLKMOV" enables you to copy the following memory areas:
● Bit memory
● DB contents
● Process input image
● Process output image
The maximum amount of data you can copy is 512 bytes. Make allowances for the CPU-
specific restrictions listed in the instruction list.
Since copying cannot be interrupted, the alarm response times of your CPU may increase
when using SFC 81 "UBLKMOV".
The source and destination areas must not overlap. If the specified destination area is larger
than the source area, the function only copies the amount of data contained in the source
area to the destination area. If the specified destination area is smaller than the source area,
the function only copies as much data as can be written to the destination area.
S7-400H
System Manual, 12/2010, A5E00267695-07 75
S7–400H in PROFIBUS DP mode
7.2 Consistent data
7.2.3 Consistency rules for SFB 14 "GET" or read variable, and SFB 15 "PUT" or
write variable
SFB 14
The data are received consistently if you observe the following points:
Evaluate the entire, currently used part of the receive area RD_i before you activate a new
request.
S7-400H
76 System Manual, 12/2010, A5E00267695-07
S7–400H in PROFIBUS DP mode
7.2 Consistent data
SFB 15
When a send operation is initiated (rising edge at REQ), the data to be sent from the send
areas SD_i are copied from the user program. You can write new data to these areas after
the block call command without corrupting the current send data.
Note
Completion of transfer
The send operation is not completed until the status parameter DONE assumes value 1.
7.2.4 Reading data consistently from a DP standard slave and writing consistently to
a DP standard slave
S7-400H
System Manual, 12/2010, A5E00267695-07 77
S7–400H in PROFIBUS DP mode
7.2 Consistent data
In the general identification format (GIF), you can define a maximum length of consistent
data of 16 words = 32 bytes; 32 bytes for inputs, and 32 bytes for outputs. A greater length is
not possible.
In this context, consider that a CPU 41x operating as DP slave generally has to support its
configuration at an external master (implementation by means of GSD file) using the general
identification format. A CPU 41x operated as DP slave thus supports only a maximum length
of 16 words = 32 bytes in its transfer memory for PROFIBUS DP.
S7-400H
78 System Manual, 12/2010, A5E00267695-07
S7–400H in PROFIBUS DP mode
7.2 Consistent data
Example:
The example of the process image partition 3 "PIP 3" below shows a possible configuration
in HW Config:
● PIP 3 at output: Those 50 bytes are stored consistently in process image partition 3 (drop
down list box "Consistent over > Total length"), and can thus be read by means of
standard "Load input xy" commands.
● Selecting "Process image -> ---" under Input in the drop down list box means: no storage
in a process image. You must work with the system functions SFC14/15.
S7-400H
System Manual, 12/2010, A5E00267695-07 79
S7–400H in PROFIBUS DP mode
7.2 Consistent data
S7-400H
80 System Manual, 12/2010, A5E00267695-07
System and operating states of the S7–400H 8
8.1 System and operating states of the S7–400H
This chapter features an introduction to the subject of S7-400H fault-tolerant systems.
You will learn the basic terms that are used in describing how fault-tolerant systems operate.
Following that, you will receive information on fault-tolerant system states. They depend on
the operating states of the different fault-tolerant CPUs, which will be described in the next
section.
In describing these operating states, this section concentrates on the behavior that differs
from a standard CPU. You will find a description of the standard behavior of a CPU in the
corresponding operating mode in the Programming with STEP 7 manual.
The final section provides details on the modified time response of fault-tolerant CPUs.
8.2 Introduction
The S7-400H consists of two redundantly configured subsystems that are synchronized via
fiber-optic cables.
Both subsystems create a fault-tolerant automation system operating with a two-channel (1-
out-of-2) structure based on the "active redundancy" principle.
Convention
To identify the two subsystems, we use the traditional expressions of "master" and "reserve"
for dual-channel fault-tolerant systems in this description. The reserve always processes
events in synchronism with the master, and does not explicitly wait for any errors before
doing so.
The distinction made between the master and reserve CPUs is primarily important for
ensuring reproducible error reactions. For example, the reserve CPU may go into STOP
when the redundant link fails, while the master CPU remains in RUN.
S7-400H
System Manual, 12/2010, A5E00267695-07 81
System and operating states of the S7–400H
8.2 Introduction
Master/reserve assignment
When the S7-400H is initially switched on, the CPU that started up first assumes master
mode, and the partner CPU assumes reserve mode.
The preset master/reserve assignment is retained when both CPUs power up
simultaneously.
The master/reserve assignment changes when:
1. The reserve CPU starts up before the master CPU (interval of at least 3 s)
2. The master CPU fails or goes into STOP in redundant system mode
3. No error was found in ERROR-SEARCH mode (see also section ERROR-SEARCH mode
(Page 89))
6\QFKURQL]DWLRQ
Synchronization is performed automatically by the operating system and has no effect on the
user program. You create your program in the same way as for standard S7-400 CPUs.
S7-400H
82 System Manual, 12/2010, A5E00267695-07
System and operating states of the S7–400H
8.2 Introduction
Self-test
Malfunctions or errors must be detected, localized and reported as quickly as possible.
Consequently, extensive self-test functions have been implemented in the S7-400H that run
automatically and entirely in the background.
The following components and functions are tested:
● Coupling of the central racks
● Processor
● Internal memory of the CPU
● I/O bus
If the self-test detects an error, the fault-tolerant system tries to eliminate it or to suppress its
effects.
For detailed information on the self-test, refer to section Self-test (Page 91).
S7-400H
System Manual, 12/2010, A5E00267695-07 83
System and operating states of the S7–400H
8.3 The system states of the S7-400H
S7-400H
84 System Manual, 12/2010, A5E00267695-07
System and operating states of the S7–400H
8.4 The operating states of the CPUs
32:(521DW&38
0DVWHU&38 32:(521DW&38
6WDQGE\&38
6\VWHPVWDWH
8SGDWLQJWKHXVHU 67$5783
/LQNXS 581
SURJUDP /,1.83
8SGDWLQJG\QDPLF
8SGDWH 581 83'$7(
GDWD
Point Description
1. After the power supply has been turned on, the two CPUs (CPU 0 and CPU 1) are in STOP mode.
2. CPU 0 changes to STARTUP and executes OB 100 or OB 102 according to the startup mode; see also
section STARTUP mode (Page 87).
S7-400H
System Manual, 12/2010, A5E00267695-07 85
System and operating states of the S7–400H
8.4 The operating states of the CPUs
Point Description
3. If startup is successful, the master CPU (CPU 0) changes to single mode. The master CPU executes the
user program alone.
At the transition to the LINK-UP system mode, no block may be opened by the "Monitor" option, and no
variable table may be active.
4. If the reserve CPU (CPU 1) requests LINK-UP, the master and reserve CPUs compare their user programs.
If any differences are found, the master CPU updates the user program of the reserve CPU, see also
section LINK-UP and UPDATE modes (Page 87).
5. After a successful link-up, updating is started, see section Update sequence (Page 102). The master CPU
updates the dynamic data of the reserve CPU. Dynamic data are inputs, outputs, timers, counters, bit
memories, and data blocks.
Following the update, the memories of both CPUs have the same content, see also section LINK-UP and
UPDATE modes (Page 87).
6. The master and reserve CPUs are in RUN mode after the update. Both CPUs process the user program
synchronized with each other.
Exception: Master/reserve changeover for configuration/program modifications.
The redundant system mode is only supported with CPUs of the same version and firmware version.
NOTICE
Memory reset
The memory reset function affects only the selected CPU. To reset both CPUs, you must
reset one and then the other.
S7-400H
86 System Manual, 12/2010, A5E00267695-07
System and operating states of the S7–400H
8.4 The operating states of the CPUs
Startup modes
The fault-tolerant CPUs distinguish between cold restart and warm restart.
Fault-tolerant CPUs do not support warm restarts.
Additional information
For detailed information on STARTUP mode, refer to the Programming with STEP 7 manual.
S7-400H
System Manual, 12/2010, A5E00267695-07 87
System and operating states of the S7–400H
8.4 The operating states of the CPUs
S7-400H
88 System Manual, 12/2010, A5E00267695-07
System and operating states of the S7–400H
8.4 The operating states of the CPUs
Properties
● Link-up and update operations are not available while the fault-tolerant CPU is in HOLD
mode; the reserve CPU remains in STOP and outputs a diagnostics message.
● It is not possible to set breakpoints when the fault-tolerant system is in redundant system
mode.
Note
If the master CPU changes to STOP during troubleshooting, the troubleshooting is continued
on the reserve CPU. However, once troubleshooting is completed, the reserve CPU does not
start up again.
The self-test routine compares the master and reserve CPUs, and reports an error if any
differences are found. Errors could be caused by hardware faults, checksum errors and
RAM/POI comparison errors.
The following events will trigger ERROR-SEARCH mode:
1. If a one-sided call of OB 121 (on only one CPU) occurs in redundant mode, the CPU
assumes a hardware fault and enters ERROR-SEARCH mode. The partner CPU
assumes master mode as required, and continues operation in single mode.
2. If a checksum error occurs on only one CPU in redundant mode, that CPU enters
ERROR-SEARCH mode. The partner CPU assumes master mode as required, and
continues operation in single mode.
3. If a RAM/POI comparison error is detected in redundant mode, the reserve CPU enters
ERROR-SEARCH mode (default response), and the master CPU continues operation in
single mode.
The response to RAM/POI comparison errors can be modified in the configuration (for
example, the reserve CPU goes into STOP).
S7-400H
System Manual, 12/2010, A5E00267695-07 89
System and operating states of the S7–400H
8.4 The operating states of the CPUs
4. If a multiple-bit error occurs on a CPU in redundant mode, that CPU will enter ERROR-
SEARCH mode. The partner CPU assumes master mode as required, and continues
operation in single mode.
But: OB 84 is called when a single-bit error occurs on a CPU in redundant mode. The
CPU does not change to ERROR-SEARCH mode.
5. If synchronization is lost during redundant mode, the reserve CPU changes to ERROR-
SEARCH mode. The other CPU remains master and continues operation in single mode.
The purpose of ERROR-SEARCH mode is to find a faulty CPU. The reserve CPU runs the
full self-test, while the master CPU remains in RUN.
If a hardware fault is detected, the CPU changes to
DEFECTIVE mode. If no fault is detected the CPU is linked up again. The
fault-tolerant system resumes the redundant system mode. An automatic master-reserve
changeover then takes place. This ensures that when the next error is detected in error-
search mode, the hardware of the previous master CPU is tested.
No communication is possible with the CPU in ERROR-SEARCH mode, e.g. no access by a
programming device is possible. The ERROR-SEARCH mode is indicated by the RUN and
STOP LEDs, see section Status and error displays (Page 45).
For additional information on the self-test, refer to section Self-test (Page 91)
S7-400H
90 System Manual, 12/2010, A5E00267695-07
System and operating states of the S7–400H
8.5 Self-test
8.5 Self-test
S7-400H
System Manual, 12/2010, A5E00267695-07 91
System and operating states of the S7–400H
8.5 Self-test
Checksum errors
When a checksum error occurs for the first time after the last POWER ON without backup,
the system reacts as follows:
S7-400H
92 System Manual, 12/2010, A5E00267695-07
System and operating states of the S7–400H
8.5 Self-test
Hardware fault with one-sided call of OB 121, checksum error, second occurrence
A CPU 41x–4H reacts to a second occurrence of a hardware fault with a one-sided call of
OB 121 and to checksum errors as set out in the table below, based on the various operating
modes of the CPU 41x–4H.
Table 8- 6 Hardware fault with one-sided call of OB 121, checksum error, second occurrence
Error CPU in single mode CPU in stand-alone mode CPU in redundant mode
Hardware fault OB 121 is executed OB 121 is executed The faulty CPU enters ERROR-
with one-sided call SEARCH mode. The fault-
of OB 121 tolerant system switches to
single mode.
Checksum errors The CPU enters the The CPU enters the The CPU enters the
DEFECTIVE state if two errors DEFECTIVE state if two errors DEFECTIVE state if a second
occur within two successive test occur within two successive test error triggered by the first error
cycles (configure the length of cycles (configure the length of event occurs in ERROR-
the test cycle in HW Config). the test cycle in HW Config). SEARCH mode.
If a second checksum error occurs in single/stand-alone mode after twice the test cycle time
has expired, the CPU reacts as it did on the first occurrence of the error. If a second error
(hardware fault with one-sided call of OB 121, checksum error) occurs in redundant mode
when troubleshooting is finished, the CPU reacts as it did on the first occurrence of the error.
Multiple-bit errors
The CPU changes to ERROR-SEARCH mode when a multiple-bit error is detected while the
fault-tolerant system is operating in redundant mode. When troubleshooting is finished, the
CPU can automatically connect and update itself, and resume redundant operation. At the
transition to error-search mode, the address of the errors is reported in the diagnostic buffer.
Single-bit errors
The CPU calls OB 84 after detection and elimination of the error.
NOTICE
In a fail-safe system, you are not allowed to disable and then re-enable the cyclic self-tests.
For more details, refer to the SIMATIC Industrial Software S7 F/FH Systems manual.
S7-400H
System Manual, 12/2010, A5E00267695-07 93
System and operating states of the S7–400H
8.6 Time response
Response time
For detailed information on calculating response times, refer to section S7-400 cycle and
response times (Page 273).
Note that any update of the reserve CPU extends the alarm response time.
The alarm response time depends on the priority class, because a graduated delay of the
interrupts is performed during an update.
S7-400H
94 System Manual, 12/2010, A5E00267695-07
Link-up and update 9
9.1 Effects of link-up and updating
Link-up and updating are indicated by the REDF LEDs on the two CPUs. During link-up, the
LEDs flash at a frequency of 0.5 Hz, and when updating at a frequency of 2 Hz.
Link-up and update have various effects on user program execution and on communication
functions.
S7-400H
System Manual, 12/2010, A5E00267695-07 95
Link-up and update
9.2 Conditions for link-up and update
Link-up and Size and type of FW version in the Available sync Hardware version
update as PG load memory in master and connections on master and
command: the master and reserve CPUs reserve CPU
reserve CPUs
Restart of the Are identical Are identical 2 Are identical
reserve
Switch to CPU RAM and EPROM Are identical 2 Are identical
with modified mixed
configuration
Switchover to Size of load Are identical 2 Are identical
CPU with memory in the
expanded memory reserve CPU is
configuration larger than that of
the master
Switchover to Are identical Are different 2 Are identical
CPU with modified
operating system
CPUs with Are identical Are identical 2 Are different
changed hardware
version
Only one Are identical Are identical 1 Are identical
synchronization
link-up is available
over only one
intact redundant
link
S7-400H
96 System Manual, 12/2010, A5E00267695-07
Link-up and update
9.3 Link-up and update sequence
NOTICE
If a link-up and update operation is interrupted on the reserve CPU (for example due to
POWER OFF, STOP), this may cause data inconsistency and lead to a memory reset
request on this CPU.
The link-up and update functions are possible again after a memory reset on the reserve.
S7-400H
System Manual, 12/2010, A5E00267695-07 97
Link-up and update
9.3 Link-up and update sequence
6WDQGE\UHTXHVWV/,1.83
'HOHWLQJORDGLQJJHQHUDWLQJDQG 'HOHWLQJORDGLQJJHQHUDWLQJDQG
FRPSUHVVLQJEORFNVQRORQJHU FRPSUHVVLQJEORFNVQRORQJHU
SRVVLEOH7HVWDQGFRPPLVVLRQLQJ SRVVLEOH7HVWDQGFRPPLVVLRQLQJ
IXQFWLRQVQRORQJHUSRVVLEOH IXQFWLRQVQRORQJHUSRVVLEOH
&RPSDULVRQRIPHPRU\FRQILJXUDWLRQRSHUDWLQJV\VWHPYHUVLRQDQG
IODVKFRQWHQW
&RS\ORDGPHPRU\FRQWHQW
&RS\LQJXVHUSURJUDPEORFNVRIWKHZRUNPHPRU\
$OOFRQQHFWLRQVDUHDERUWHG
,QFOXVLRQRIWKH'3VODYHV
7DNHVRYHUFRQQHFWLRQ
8SGDWLQJVHHQH[WILJXUH
&DQFHOUHVWULFWLRQVFDWFKXSGHOD\HG &DQFHOUHVWULFWLRQVFDWFKXSGHOD\HG
SURFHVVLQJ SURFHVVLQJ
6\VWHPPRGHUHGXQGDQWRIPDVWHUVWDQGE\FKDQJHRYHUZLWK6723
RQQHZVWDQGE\
*) If the "Switchover to CPU with altered configuration" option is set, the content of the load
memory is not copied; what is copied from the user program blocks of the work memory
(OBs, FCs, FBs, DBs, SDBs) of the master CPU is listed in section Switch to CPU with
modified configuration or expanded memory configuration (Page 105)
S7-400H
98 System Manual, 12/2010, A5E00267695-07
Link-up and update
9.3 Link-up and update sequence
6WDWXVPHVVDJH8SGDWHWRDOOORJJHGRQ
SDUWQHUV
1HJDWLYHDFNQRZOHGJHPHQWRIDV\QFKUR
QRXV6)&VIRUGDWDUHFRUGV
0HVVDJHVDUHGHOD\HG
$OO2%VXSWRSULRULW\FODVVLQFO2%
ZLOOEHGHOD\HG
6WDUWRIPRQLWRULQJWKHPD[LPXPF\FOH
WLPHH[WHQVLRQ
0DVWHUFRSLHVFRQWHQWVRIWKHPRGLILHGGDWDEORFNV
&XUUHQWFRPPXQLFDWLRQUHTXHVWVDUH
GHOD\HGRUQHZRQHVDUHUHMHFWHG
6WDUWRIPRQLWRULQJPD[LPXPFRPPXQL
FDWLRQGHOD\
2%VRISULRULW\FODVVHV!DUHGHOD\HG
ZLWKWKHH[FHSWLRQRIWKHZDWFKGRJLQWHUUXSW
2%ZLWKVSHFLDOKDQGOLQJ
([HFXWLRQRIWKHZDWFKGRJLQWHUUXSW2%
ZLWKVSHFLDOKDQGOLQJDVUHTXLUHG
6WDUWRIPRQLWRULQJWKHPD[LPXP
WLPHRILQKLELWLRQRISULRULW\FODVVHV!
0DVWHUFRSLHVRXWSXWV
6WDUWRIPLQLPXP,2UHWHQWLRQWLPH 7KHRXWSXWVZLOOEHHQDEOHG
0DVWHUFRSLHVWKHFRQWHQWVRIWKHGDWDEORFNVZKLFK 5HGXQGDQW
KDYHEHHQPRGLILHGVLQFHWKH\ZHUHODVWFRSLHG RSHUDWLRQRU
FKDQJHRI
PDVWHUVKLS
0DVWHUFRSLHVWLPHUVFRXQWHUVPHPRU\
PDUNHUVLQSXWVDQGWKHGLDJQRVWLFVEXIIHU
)RUGHWDLOVRQWKHUHOHYDQW6)&V6)%VDQGFRPPXQLFDWLRQIXQFWLRQVUHIHU
WRWKHQH[WFKDSWHUV
S7-400H
System Manual, 12/2010, A5E00267695-07 99
Link-up and update
9.3 Link-up and update sequence
3URJUDPH[HFXWLRQWLPHRIWKH
'3RQO\7LPHWRXSGDWH SULRULW\FODVVHJUXQWLPH
,2VZRUVWFDVH[ 2%
0LQLPXPVLJQDOGXUDWLRQ
Figure 9-3 Example of minimum signal duration of an input signal during the update
S7-400H
100 System Manual, 12/2010, A5E00267695-07
Link-up and update
9.3 Link-up and update sequence
If 4. is inconsistent, the master CPU copies the user program from its load memory in RAM
to the reserve CPU.
The user program stored in load memory on the FLASH card is not transferred.
It must be identical before initiating link-up.
Note
Even though you have not modified the hardware configuration or the type of load memory
on the reserve CPU, there is nevertheless a master/reserve changeover and the previous
master CPU changes to STOP.
S7-400H
System Manual, 12/2010, A5E00267695-07 101
Link-up and update
9.3 Link-up and update sequence
For information on changing the type of memory or on load memory expansions, refer to
section Changing the CPU memory configuration (Page 250).
NOTICE
Assuming you have implemented a different type of load memory or operating system on
the reserve CPU, this CPU does not go into RUN, but rather returns to STOP and writes a
corresponding message to the diagnostic buffer.
Assuming you have not expanded load memory on the reserve CPU, this CPU does not go
into RUN, but rather returns to STOP and writes a corresponding message to the
diagnostic buffer.
The system does not perform a master/reserve changeover, and the previous master CPU
remains in RUN.
S7-400H
102 System Manual, 12/2010, A5E00267695-07
Link-up and update
9.3 Link-up and update sequence
Note
The watchdog interrupt OB with special handling is particularly important in situations
where you need to address certain modules or program parts within a specific time. This
is a typical scenario in fail-safe systems. For details, refer to the SIMATIC Industrial
Software S7 F/FH Systems and S7-300 Automation Systems, Fail-safe Signal Modules
manuals.
9. Transfer of outputs and of all data block contents modified again. Transfer of timers,
counters, bit memories, and inputs. Transfer of the diagnostic buffer.
During this data synchronization, the system interrupts the clock pulse for watchdog
interrupts, time-delay interrupts and S7 timers. This results in the loss of any synchronism
between cyclic and time-of-day interrupts.
10.Cancel all restrictions. Delayed interrupts and communication functions are executed. All
OBs are executed again.
A constant bus cycle time compared with previous calls can no longer be guaranteed for
delayed watchdog interrupt OBs.
Note
Process and diagnostic interrupts are stored by the I/O. Such interrupt requests issued by
distributed I/O modules are executed when the block is re-enabled. Any such requests by
central I/O modules can only be executed provided the same interrupt request did not
occur repeatedly while the status was disabled.
If the PG/ES requested a master/reserve changeover, the previous reserve CPU assumes
master mode and the previous master CPU goes into STOP when the update is completed.
Both CPUs will otherwise go into RUN (redundant system mode) and execute the user
program in synchronism.
When there is a master/reserve changeover, in the first cycle after the update OB 1 is
assigned a separate identifier (see System Software for S7-300/400, System and Standard
Functions Reference Manual). For information on other aspects resulting from modifying the
configuration, refer to section Switch to CPU with modified configuration or expanded
memory configuration (Page 105).
S7-400H
System Manual, 12/2010, A5E00267695-07 103
Link-up and update
9.3 Link-up and update sequence
Note
The last three of the functions listed are registered by a WinCC system, and automatically
repeated when the update is completed.
S7-400H
104 System Manual, 12/2010, A5E00267695-07
Link-up and update
9.3 Link-up and update sequence
Note
Even though you have not modified the hardware configuration or the type of load memory
on the reserve CPU, there is nevertheless a master/reserve changeover and the previous
master CPU changes to STOP.
Note
If you have downloaded connections using NETPRO, you can no longer change the memory
type of the load memory from RAM to FLASH.
When you initiate a link-up and update operation with the "Switch to CPU with modified
configuration" option in STEP 7, the system reacts as follows with respect to handling of the
memory contents.
Load memory
The contents of the load memory are not copied from the master to the reserve CPU.
Work memory
The following components are transferred from the work memory of the master CPU to the
reserve CPU:
● Contents of all data blocks assigned the same interface time stamp in both load
memories and whose attributes "read only" and "unlinked" are not set.
● Data blocks generated in the master CPU by SFCs.
The DBs generated in the reserve CPU by means of SFC are deleted.
If a data block with the same number is also found in the load memory of the reserve
CPU, link-up is cancelled with an entry in the diagnostic buffer.
● Process images, timers, counters, and bit memories
If there is insufficient memory, link-up is cancelled with an entry in the diagnostic buffer.
S7-400H
System Manual, 12/2010, A5E00267695-07 105
Link-up and update
9.3 Link-up and update sequence
Note
When changing over to a CPU with modified configuration, the size of load memories in the
master and reserve may be different.
NOTICE
Assuming you have implemented a different type of load memory or operating system on
the reserve CPU, this CPU does not go into RUN, but rather returns to STOP and writes a
corresponding message to the diagnostic buffer.
Assuming you have not expanded load memory on the reserve CPU, this CPU does not go
into RUN, but rather returns to STOP and writes a corresponding message to the
diagnostic buffer.
The system does not perform a master/reserve changeover, and the previous master CPU
remains in RUN.
For information on changing the type of memory or on load memory expansions, refer to
section Failure and replacement of components during operation (Page 191).
When you initiate a link-up and update with the "Switchover to CPU with expanded memory
configuration" option in STEP 7, the system reacts as follows with respect to the handling of
memory contents.
S7-400H
106 System Manual, 12/2010, A5E00267695-07
Link-up and update
9.3 Link-up and update sequence
CAUTION
Always perform link-up and update operations when the process is not in a critical state.
You can set specific start times for link-up and update operations at SFC 90 "H_CTRL". For
detailed information on this SFC, refer to the System Software for S7-300/400, System and
Standard Functions manual.
NOTICE
If the process tolerates cycle time extensions at any time, you do not need to call SFC 90
"H_CTRL".
The CPU does not perform a self-test during link-up and updating. If you use a fail-safe
user program, you should avoid any excessive delay for the update operation. For more
details, refer to the SIMATIC Industrial Software S7 F/FH Systems manual.
S7-400H
System Manual, 12/2010, A5E00267695-07 107
Link-up and update
9.4 Time monitoring
NOTICE
If you have not defined any default values for the monitoring times, make allowance for the
update in the scan cycle monitoring time. If in this case the update is cancelled, the fault-
tolerant system switches to single mode: The previous master CPU remains in RUN, and
the reserve CPU goes into STOP.
You can either configure all the monitoring times or none at all.
You made allowances for the technological requirements in your configuration of monitoring
times.
The monitoring times are described in detail below.
● Maximum cycle time extension
– Cycle time extension: The time during the update in which neither OB 1 nor any other
OBs up to priority class 15 are executed. "Normal" cycle time monitoring is disabled
within this time span.
– Max. cycle time extension: The maximum permissible cycle time extension configured
by the user.
● Maximum communication delay
– Communication delay: The time span during the update during which no
communication functions are processed. Note: The master CPU, however, maintains
all existing communication links.
– Maximum communication delay: The maximum permissible communication delay
configured by the user.
S7-400H
108 System Manual, 12/2010, A5E00267695-07
Link-up and update
9.4 Time monitoring
8SGDWH
W W W W W
W
0LQLPXP,2UHWHQWLRQWLPH
,QKLELWWLPHIRUSULRULW\FODVVHV!
&RPPXQLFDWLRQGHOD\
&\FOHWLPHH[WHQVLRQ
W(QGRIFXUUHQW2%VXSWRSULRULW\FODVV
W6WRSDOOFRPPXQLFDWLRQIXQFWLRQV
W(QGRIZDWFKGRJLQWHUUXSW2%ZLWKVSHFLDOKDQGOLQJ
W(QGRIFRS\LQJRIRXWSXWVWRWKHVWDQGE\&38
W5HGXQGDQWV\VWHPVWDWXVRUPDVWHUVWDQGE\FKDQJHRYHU
Response to time-outs
If one of the times monitored exceeds the configured maximum value, the following
procedure is started:
1. Cancel update
S7-400H
System Manual, 12/2010, A5E00267695-07 109
Link-up and update
9.4 Time monitoring
2. Fault-tolerant system remains in single mode, with the previous master CPU in RUN
3. Cause of cancelation is entered in diagnostic buffer
4. Call OB 72 (with corresponding start information)
The reserve CPU then reevaluates its system data blocks.
Then, but after at least one minute, the CPU tries again to perform the link-up and update. If
still unsuccessful after a total of 10 retries, the CPU abandons the attempt. You yourself will
then need to start the link-up and update again.
A monitoring timeout can be caused by:
● High interrupt load (e.g. from I/O modules)
● High communication load causing prolonged execution times for active functions
● In the final update phase, the system needs to copy large amounts of data to the
reserve CPU.
S7-400H
110 System Manual, 12/2010, A5E00267695-07
Link-up and update
9.4 Time monitoring
Note
The monitoring times determined by STEP 7 or by using formulas merely represent
recommended values.
These times are based on a fault-tolerant system with two communication peers and an
average communication load.
Your system profile may differ considerably from those scenarios, therefore the following
rules must be observed.
● The cycle time extension factor may increase sharply at a high communication load.
● Any modification of the system in operation may lead to a significant increase in cycle
times.
● Any increase in the number of programs executed in priority classes > 15 (in particular
processing of communication blocks) automatically increases the communication delay
and cycle time extension.
● You can even undercut the calculated monitoring times in small plants with high-
performance requirements.
S7-400H
System Manual, 12/2010, A5E00267695-07 111
Link-up and update
9.4 Time monitoring
If you have configured different monitoring times in the CPUs and perform a link-up and
update operation with master/reserve changeover, the system always applies the higher of
the two values.
0DVWHUFRSLHV
RXWSXWVPV
0D[LPXPLQKLELWWLPHIRU
0LQLPXP,2 SULRULW\FODVVHV!
UHWHQWLRQWLPH
Figure 9-5 Correlation between the minimum I/O retention time and the maximum inhibit time for
priority classes > 15
S7-400H
112 System Manual, 12/2010, A5E00267695-07
Link-up and update
9.4 Time monitoring
Calculating the maximum inhibit time for priority classes > 15 (TP15)
The maximum inhibit time for priority classes > 15 is determined by 4 main factors:
● As shown in Figure 8–2, all the contents of data blocks modified since the last copy to the
reserve CPU are transferred to the reserve CPU again when the update is completed.
The number and structure of the DBs you write to in the high-priority classes is a decisive
factor in the duration of this operation, and thus in the maximum inhibit time for priority
classes > 15. Relevant information is available in the remedies described below.
● In the final update phase, all OBs are either delayed or inhibited. To avoid any
unnecessary extension of the maximum inhibit time for priority classes > 15 due to
unfavorable programming, you should always process the time-critical I/O components in
a selected watchdog interrupt. This is particularly relevant in fail-safe user programs. You
can define this watchdog interrupt in your configuration. It is then executed again right
after the start of the maximum inhibit time for priority classes > 15, provided you have
assigned it a priority class > 15.
● In link-up and update operations with master/reserve changeover (see section Link-up
sequence (Page 100)), you also need to change over the active communication channel
on the switched DP slaves when the update is completed. This operation prolongs the
time within which valid values can neither be read nor output. How long this process
takes is determined by your hardware configuration.
● The technological conditions in your process also decide how long an I/O update can be
delayed. This is particularly important in time-monitored processes in fail-safe systems.
Note
For details, refer to the SIMATIC Industrial Software S7 F/FH Systems and S7-300
Automation Systems, Fail-safe Signal Modules manuals. This applies in particular to the
internal execution times of fail-safe modules.
1. Based on the bus parameters in STEP 7, for each DP master system you must define:
– TTR for the DP master system
– DP changeover time (referred to below as TDP_UM)
2. Based on the technical data of the switched DP slaves, define for each DP master
system:
– The maximum changeover time of the active communication channel
(referred to below as TSLAVE_UM).
3. Based on the technological settings of your system, define:
– The maximum permissible time during which there is no update of your I/O modules
(referred to below as TPTO).
4. Based on your user program, determine:
– The cycle time of the highest-priority or selected (see above) watchdog interrupt (TWA)
– The execution time of your program in this watchdog interrupt (TPROG)
S7-400H
System Manual, 12/2010, A5E00267695-07 113
Link-up and update
9.4 Time monitoring
NOTICE
If TP15(DP master system) < 0, stop the calculation here. Possible remedies are shown
below the following example calculation. Make appropriate changes and then restart the
calculation at 1.
NOTICE
If TP15_OD > TP15_HW, stop the calculation here. Possible remedies are shown below the
following example calculation. Make appropriate changes and then restart the
calculation at 1.
8. Using the information in section Link-up sequence (Page 100), calculate the share of the
maximum inhibit time for priority classes > 15 defined by the user program (TP15_AWP).
NOTICE
If TP15_AWP > TP15_HW, stop the calculation here. Possible remedies are shown below the
following example calculation. Make appropriate changes and then restart the
calculation at 1.
9. The recommended value for the maximum inhibit time for priority classes > 15 is now
obtained from:
TP15 = MAX (TP15_AWP, TP15_OD) [3]
S7-400H
114 System Manual, 12/2010, A5E00267695-07
Link-up and update
9.4 Time monitoring
TTR_1 = 25 ms
TTR_2 = 30 ms
TDP_UM_1 = 100 ms
TDP_UM_2 = 80 ms
2. Based on the technical data of the DP slaves used:
TSLAVE_UM_1 = 30 ms
TSLAVE_UM_2 = 50 ms
3. Based on the technological settings of your system:
TPTO_1 = 1250 ms
TPTO_2 = 1200 ms
4. Based on the user program:
TWA = 300 ms
TPROG = 50 ms
5. Based on the formula [1]:
TP15 (DP master system_1)
= 1250 ms - (2 x 25 ms + 300 ms + 50 ms + 100 ms + 30 ms) = 720 ms
TP15 (DP master system_2)
= 1200 ms - (2 x 30 ms + 300 ms + 50 ms + 80 ms + 50 ms) = 660 ms
Check: Since TP15 > 0, continue with
1. TP15_HW = MIN (720 ms, 660 ms) = 660 ms
2. Based on the formula [2]:
TP15_OD = 50 ms + TPH = 50 ms + 90 ms = 140 ms
Check: Since TP15_OD = 140 ms < TP15_HW = 660 ms, continue with
1. Based on section 7.4.4 with 170 KB of user program data:
TP15_AWP = 194 ms
Check: Since TP15_AWP = 194 ms < TP15_HW = 660 ms, continue with
1. Based on formula [3], we obtain the recommended max. inhibit time for priority
classes > 15:
TP15 = MAX (194 ms, 140 ms)
TP15 = 194 ms
This means that by setting a maximum inhibit time of 194 ms for priority classes > 15 in
STEP 7, you ensure that any signal changes during the update are detected with a signal
duration of 1250 ms or 1200 ms.
S7-400H
System Manual, 12/2010, A5E00267695-07 115
Link-up and update
9.4 Time monitoring
See also
Performance values for link-up and update (Page 117)
S7-400H
116 System Manual, 12/2010, A5E00267695-07
Link-up and update
9.4 Time monitoring
User program share TP15_AWP of the maximum inhibit time for priority classes > 15
The user program share TP15_AWP of the maximum inhibit time for priority classes > 15 can be
calculated using the following formula:
TP15_AWP in ms = 0.7 x size of DBs in work memory in KB + 75
The table below shows the derived times for some typical values in work memory data.
S7-400H
System Manual, 12/2010, A5E00267695-07 117
Link-up and update
9.4 Time monitoring
CAUTION
The update delay increases the time of single mode operation of the fault-tolerant system.
S7-400H
118 System Manual, 12/2010, A5E00267695-07
Link-up and update
9.5 Special features in link-up and update operations
S7-400H
System Manual, 12/2010, A5E00267695-07 119
Link-up and update
9.5 Special features in link-up and update operations
S7-400H
120 System Manual, 12/2010, A5E00267695-07
Using I/Os in S7–400H 10
10.1 Using I/Os in S7–400H
This section provides an overview of the different I/O installations in the S7-400H automation
system and their availability. It also provides information on configuration and programming
of the selected I/O installation.
10.2 Introduction
A dual-channel redundant configuration at user level is also possible. You nevertheless need
to implement the high availability in the user program (see section Other options for
connecting redundant I/Os (Page 156)).
Addressing
No matter whether you are using a single-channel one-sided or switched I/O, you always
access the I/O via the same address.
S7-400H
System Manual, 12/2010, A5E00267695-07 121
Using I/Os in S7–400H
10.2 Introduction
Module racks with even numbers are always assigned to central rack 0, and racks with odd
numbers are always assigned to central rack 1.
For applications with distributed I/O, each of the subsystems supports the connection of up
to 12 DP master systems (2 DP master systems on the integrated interfaces of the CPU and
10 via external DP master systems).
The integrated MPI/DP interface supports the operation of up to 32 slaves. You can connect
up to 125 distributed I/O devices to the integrated DP master interface and to the external
DP master systems.
S7-400H
122 System Manual, 12/2010, A5E00267695-07
Using I/Os in S7–400H
10.3 Using single-channel, one-sided I/Os
5DFN 5DFN
6LQJOHFKDQQHO,2PRGXOHVLQ
FHQWUDOXQLW
6LQJOHFKDQQHORQHVLGHGFHQWUDO
,2GHYLFHHJ(7%
S7-400H
System Manual, 12/2010, A5E00267695-07 123
Using I/Os in S7–400H
10.3 Using single-channel, one-sided I/Os
NOTICE
The user program also has to update the process image for single-channel, one-sided
output modules when the system is in single mode (direct access, for example). If you use
process image partitions, the user program must update them (SFC 27 "UPDAT_PO") in
OB 72 (recovery of redundancy). The system would otherwise first output old values on the
single-channel one-sided output modules of the reserve CPU when the system changes to
redundant mode.
S7-400H
124 System Manual, 12/2010, A5E00267695-07
Using I/Os in S7–400H
10.4 Using single-channel switched I/O
Each S7–400H subsystem is interconnected with one of the two DP slave interfaces of the
ET 200M via a DP master interface.
PROFIBUS PA can be connected to a redundant system via a DP/PA link.
You can use the following DP/PA links:
S7-400H
System Manual, 12/2010, A5E00267695-07 125
Using I/Os in S7–400H
10.4 Using single-channel switched I/O
6ZLWFKHG(70GLVWULEXWHG,2V\VWHP
'33$/LQNRU</LQN
Rule
A single-channel switched I/O configuration must always be symmetrical.
● This means, the fault-tolerant CPU and other DP masters must be installed in the same
slots in both subsystems (e.g. slot 4 in both subsystems)
● Or the DP masters must be connected to the same integrated interface in both
subsystems (e.g. to the PROFIBUS DP interfaces of both fault-tolerant CPUs)
S7-400H
126 System Manual, 12/2010, A5E00267695-07
Using I/Os in S7–400H
10.4 Using single-channel switched I/O
Note
If the DP master interface module can detect failure of the entire DP master system (due to
short-circuit, for example), it reports only this event ("Master system failure entering state"
W#16#39C3). The operating system no longer reports individual station failures. This feature
can be used to accelerate the changeover between the active and passive channel.
S7-400H
System Manual, 12/2010, A5E00267695-07 127
Using I/Os in S7–400H
10.4 Using single-channel switched I/O
You can determine the first two values from the bus parameters of your DP master system in
STEP 7. You can obtain the last value from the manuals of the relevant DP slave interface
module (distributed I/O device ET 200M or DP/PA bus link).
NOTICE
When using fail-safe modules, always set a monitoring time for each fail-safe module that is
longer than the changeover time of the active channel in the fault-tolerant system. If you
ignore this rule, you risk failure of the fail-safe modules during the changeover of the active
channel.
NOTICE
The above calculation also includes the processing time in OB 70 or OB 86. Make sure that
the processing time for a DP station does not last longer than 1 ms. In situations requiring
extensive processing, exclude this processing from direct execution of the OBs mentioned.
Note that the CPU can only detect a signal change if the signal duration is greater than the
specified changeover time.
When there is a changeover of the entire DP master system, the changeover time of the
slowest component applies to all DP components. A DP/PA link or Y link usually
determines the changeover time and the associated minimum signal duration. We therefore
recommend that you connect DP/PA and Y links to a separate DP master system.
When using fail-safe modules, always set a monitoring time for each fail-safe module that is
longer than the changeover time of the active channel in the fault-tolerant system. If you
ignore this, you risk failure of the fail-safe modules during the changeover of the active
channel.
S7-400H
128 System Manual, 12/2010, A5E00267695-07
Using I/Os in S7–400H
10.5 Connecting redundant I/O
Configurations
The following redundant I/O configurations are supported:
1. Redundant signal modules in the central and expansion devices
For this purpose, the signal modules are installed in pairs in the CPU 0 and CPU 1
subsystems. Redundant I/O in central and expansion devices
S7-400H
System Manual, 12/2010, A5E00267695-07 129
Using I/Os in S7–400H
10.5 Connecting redundant I/O
5HGXQGDQWPRGXOHSDLU
&HQWUDOXQLW &HQWUDOXQLW
([SDQVLRQXQLW ([SDQVLRQXQLW
5HGXQGDQWPRGXOHSDLU
S7-400H
130 System Manual, 12/2010, A5E00267695-07
Using I/Os in S7–400H
10.5 Connecting redundant I/O
5HGXQGDQWPRGXOHSDLU
S7-400H
System Manual, 12/2010, A5E00267695-07 131
Using I/Os in S7–400H
10.5 Connecting redundant I/O
5HGXQGDQWPRGXOHSDLU
5HGXQGDQWPRGXOHSDLU
S7-400H
132 System Manual, 12/2010, A5E00267695-07
Using I/Os in S7–400H
10.5 Connecting redundant I/O
Note
Channel and channel group
Depending on the module, a channel group contains a single channel, a group of several
channels, or all channels of the module. You can therefore operate all modules with
redundancy capability in channel group-specific redundancy mode.
An up-to-date list of modules with redundancy capability can be found in section Signal
modules for redundancy (Page 138).
Note
Operating redundant modules
When you are operating signal modules for the first time, use channel group-specific
redundancy with the blocks in the "Redundant IO CGP V50" library. This ensures maximum
flexibility when using redundant modules.
S7-400H
System Manual, 12/2010, A5E00267695-07 133
Using I/Os in S7–400H
10.5 Connecting redundant I/O
The "Functional I/O redundancy" block libraries that support the redundant I/O each contain
the following blocks:
● FC 450 "RED_INIT": Initialization function
● FC 451 "RED_DEPA": Initiate depassivation
● FB 450 "RED_IN": Function block for reading redundant inputs
● FB 451 "RED_OUT": Function block for controlling redundant outputs
● FB 452 "RED_DIAG": Function block for diagnostics of redundant I/O
● FB 453 "RED_STATUS": Function block for redundancy status information
Configure the numbers of the management data blocks for the redundant I/O in HW Config
"Properties CPU -> H Parameter". Assign free DB numbers to these data blocks. The data
blocks are created by FC 450 "RED_INIT" during CPU startup. The default setting for the
numbers of the management data blocks is 1 and 2. These data blocks are not the instance
data blocks of FB 450 "RED_IN" or FB 451 "RED_OUT".
You can open the libraries in the SIMATIC Manager with "File -> Open -> Libraries"
The functions and use of the blocks are described in the corresponding online help.
NOTICE
Blocks from various libraries
Only use blocks from one library. Simultaneous use of blocks from different libraries is not
permitted.
If you wish to replace one of the earlier libraries Redundant IO (V1) or Redundant IO CGP
with the Redundant IO CGP V5.0, you must first of all edit your user program accordingly.
Refer to the context-sensitive block help or the STEP 7 Readme for more information.
S7-400H
134 System Manual, 12/2010, A5E00267695-07
Using I/Os in S7–400H
10.5 Connecting redundant I/O
Block OB
FC 450 "RED_INIT" OB 72 "CPU redundancy error" (only with fault-tolerant systems)
FC 450 is only executed after the start event B#16#33:"Reserve-
master changeover by operator"
OB 80 "Timeout error" (only in single mode)
FC 450 is only executed after the start event "Resume RUN after
reconfiguring"
OB 100 "Restart" (the administration DBs are recreated, see the
online help)
OB 102 "Cold restart"
FC 451 "RED_DEPA" If you call FC 451 in OB 83 while inserting modules or in OB 85
during alarm output, depassivation is delayed by approximately 3
seconds.
Depassivation is delayed by 10 seconds with Version 3.5 or higher of
FB 450 "RED_IN" in the library "Redundant IO MGP" and Version 5.8
or higher of FB 450 "RED_IN" in the library "Redundant IO CGP"
V50.
FB 450 "RED_IN" OB 1 "Cyclic program"
OB 30 to OB 38 "Watchdog interrupt"
FB 451 "RED_OUT" OB 1 "Cyclic program"
OB 30 to OB 38 "Watchdog interrupt"
FB 452 "RED_DIAG" OB 72 "CPU redundancy error"
OB 82 "Diagnostic interrupt"
OB 83 "Swapping interrupt"
OB 85 "Program execution error"
FB 453 "RED_STATUS" OB 1 "Cyclic program" (fault-tolerant systems only)
OB 30 to OB 38 "Watchdog interrupt"
S7-400H
System Manual, 12/2010, A5E00267695-07 135
Using I/Os in S7–400H
10.5 Connecting redundant I/O
The valid values that can be processed by the user program are always located at the lower
address of both redundant modules. This means that only the lower address can be used for
the application; the values of the higher address are not relevant for the application.
Note
Use of FB 450 "RED_IN" and 451 "RED_OUT" when using process image partitions
For each priority class used (OB 1, OB 30 ... OB 38), you must use a separate process
image partition.
S7-400H
136 System Manual, 12/2010, A5E00267695-07
Using I/Os in S7–400H
10.5 Connecting redundant I/O
Note
System modifications during operation are also supported with redundant I/O. You are
not permitted to change the parameter settings for a redundant module per SFC.
NOTICE
Always switch off power to the station or rack before you remove a redundant digital
input module that does not support diagnostics functions and is not passivated. You
might otherwise passivate the wrong module. This procedure is necessary, for example,
when replacing the front connector of a redundant module.
Redundant modules must be in the process image of the inputs or outputs. Redundant
modules are always accessed using the process image.
When using redundant modules, select the "Cycle/Clock Memory" tab from "HW Config
-> Properties CPU 41x-H" and set the following:
"OB 85 call on I/O area access error > Only incoming and outgoing errors"
S7-400H
System Manual, 12/2010, A5E00267695-07 137
Using I/Os in S7–400H
10.5 Connecting redundant I/O
You achieve this by connecting a resistor via the encoder. Its value depends on the
type of switch and usually ranges between 6800 and 8200 ohms for contacts.
You achieve this by connecting a resistor via the encoder. Its value depends on the
type of switch and usually ranges between 6800 and 8200 ohms for contacts.
S7-400H
138 System Manual, 12/2010, A5E00267695-07
Using I/Os in S7–400H
10.5 Connecting redundant I/O
S7-400H
System Manual, 12/2010, A5E00267695-07 139
Using I/Os in S7–400H
10.5 Connecting redundant I/O
S7-400H
140 System Manual, 12/2010, A5E00267695-07
Using I/Os in S7–400H
10.5 Connecting redundant I/O
S7-400H
System Manual, 12/2010, A5E00267695-07 141
Using I/Os in S7–400H
10.5 Connecting redundant I/O
S7-400H
142 System Manual, 12/2010, A5E00267695-07
Using I/Os in S7–400H
10.5 Connecting redundant I/O
S7-400H
System Manual, 12/2010, A5E00267695-07 143
Using I/Os in S7–400H
10.5 Connecting redundant I/O
NOTICE
S7-400H
144 System Manual, 12/2010, A5E00267695-07
Using I/Os in S7–400H
10.5 Connecting redundant I/O
NOTICE
The time that the system actually needs to determine a discrepancy depends on various
factors: Bus delay times, cycle and call times in the user program, conversion times, etc.
Redundant input signals can therefore be different for a longer period than the
configured discrepancy time.
'LJLWDOLQSXWPRGXOHV
Figure 10-6 Fault-tolerant digital input module in 1-out-of-2 configuration with one encoder
S7-400H
System Manual, 12/2010, A5E00267695-07 145
Using I/Os in S7–400H
10.5 Connecting redundant I/O
You will find connection examples in Appendix Connection examples for redundant I/Os
(Page 355).
Note
Remember that the proximity switches (Beros) must provide the current for the channels of
both digital input modules. The technical data of the respective modules, however, specify
only the required current per input.
'LJLWDOLQSXWPRGXOHV
Figure 10-7 Fault-tolerant digital input modules in 1-out-of-2 configuration with two encoders
The use of redundant encoders also increases their availability. A discrepancy analysis
detects all errors, except for the failure of a non-redundant load voltage supply. You can
enhance availability by installing redundant load power supplies.
You will find connection examples in Appendix Connection examples for redundant I/Os
(Page 355).
S7-400H
146 System Manual, 12/2010, A5E00267695-07
Using I/Os in S7–400H
10.5 Connecting redundant I/O
,QWHUFRQQHFWLRQXVLQJH[WHUQDOGLRGHV ,QWHUFRQQHFWLRQZLWKRXWH[WHUQDOGLRGHV
The digital output modules must be connected to a common load voltage supply.
You will find connection examples in Appendix Connection examples for redundant I/Os
(Page 355).
S7-400H
System Manual, 12/2010, A5E00267695-07 147
Using I/Os in S7–400H
10.5 Connecting redundant I/O
NOTICE
The time that the system actually needs to determine a discrepancy depends on various
factors: Bus delay times, cycle and call times in the user program, conversion times, etc.
Redundant input signals can therefore be different for a longer period than the configured
discrepancy time.
S7-400H
148 System Manual, 12/2010, A5E00267695-07
Using I/Os in S7–400H
10.5 Connecting redundant I/O
Note
There is no discrepancy analysis when a channel reports an overflow with 16#7FFF or an
underflow with 16#8000. The relevant module/channel is passivated immediately.
You should therefore disable all unused inputs in HW Config using the "Measurement type"
parameter.
8 , ,
Figure 10-9 Fault-tolerant analog input modules in 1-out-of-2 configuration with one encoder
Remember the following when connecting an encoder to multiple analog input modules:
● Connect the analog input modules in parallel for voltage sensors (left in figure).
● You can convert a current into voltage using an external load to be able to use voltage
analog input modules connected in parallel (center in the figure).
● 2-wire transmitters are powered externally to allow you to repair the module online.
The redundancy of the fail-safe analog input modules enhances their availability.
You will find connection examples in Appendix Connection examples for redundant I/Os
(Page 355).
S7-400H
System Manual, 12/2010, A5E00267695-07 149
Using I/Os in S7–400H
10.5 Connecting redundant I/O
● Suitable encoder types are active 4-wire and passive 2-wire transmitters with output
ranges +/-20 mA, 0...20 mA, and 4...20 mA. 2-wire transmitters are powered by an
external auxiliary voltage.
● Criteria for the selection of resistance and input voltage range are the measurement
accuracy, number format, maximum resolution and possible diagnostics.
● In addition to the options listed, other input resistance and voltage combinations
according to Ohm’s law are also possible. Note, however, that such combinations may
lead to loss of the number format, diagnostics function and resolution. The measurement
error also depends largely on the size of the measure resistance of certain modules.
● Use a measure resistance with a tolerance of +/- 0.1% and TC 15 ppm.
The listed measuring error results solely from the interconnection of one or two voltage
inputs with a measure resistance. Allowance has neither been made here for the tolerance
nor for the basic/operational limits of the modules.
The measuring error for one or two inputs shows the difference in the measurement result
depending on whether two inputs or, in case of error, only one input acquires the current of
the transmitter.
AI 8x16bit 6ES7 331–7NF00–0AB0
● Use a 250 ohm resistor to map the current on a voltage:
S7-400H
150 System Manual, 12/2010, A5E00267695-07
Using I/Os in S7–400H
10.5 Connecting redundant I/O
S7-400H
System Manual, 12/2010, A5E00267695-07 151
Using I/Os in S7–400H
10.5 Connecting redundant I/O
● The 4-wire transmitters used must be capable of driving the load resulting from the circuit
above. You will find details in the technical specifications of the individual modules.
● When connecting up 2-wire transmitters, note that the Zener diode circuit weighs heavily
in the power budget of the transmitter. The required input voltages are therefore included
in the technical specifications of the individual modules. Together with the inherent supply
specified on the transmitter data sheet, the minimum supply voltage is calculated to L+ >
Ue-2w + UIS-TR
$QDORJLQSXWPRGXOH
Figure 10-10 Fault-tolerant analog input modules in 1-out-of-2 configuration with two encoders
S7-400H
152 System Manual, 12/2010, A5E00267695-07
Using I/Os in S7–400H
10.5 Connecting redundant I/O
$QDORJRXWSXWPRGXOHV
,
$FWXDWRU
Note
The output value drops briefly to half, and after the reaction in the program it is returned to
the proper value.
S7-400H
System Manual, 12/2010, A5E00267695-07 153
Using I/Os in S7–400H
10.5 Connecting redundant I/O
In the case of passivation or a CPU STOP, redundant analog outputs output a minimum
current of approximately 120 μA per module (or 240 μA for HART analog output modules),
meaning a total of approximately 240 µA (or 480 μA for HART analog output modules).
Considering the tolerance, this means that the output value is always positive. A configured
substitute value of 0 mA will produce at least these output values. In redundant mode, in the
event of a CPU STOP the response of the current outputs is automatically set to "zero
current and zero voltage" in their configuration.
NOTICE
If both channels of a channel pair were passivated (e.g. by OB 85), then nevertheless the
respective half current value is output to both storage locations in the process output
image. If one channel is depassivated, then the full value is output on the available channel.
If this is not required, a substitute value must be written to the lower channels of both
modules prior to executing FB 451 "RED_OUT".
Depassivation of modules
Passivated modules are depassivated by the following events:
● When the fault-tolerant system starts up
● When the fault-tolerant system changes over to "redundant" mode
● After system modifications during operation
● If you call FC 451 "RED_DEPA" and at least one redundant channel or module is
passivated.
The depassivation is executed in FB 450 "RED IN" after one of these events has occurred.
Completion of the depassivation of all modules is logged in the diagnostic buffer.
Note
When a redundant module is assigned a process image partition and the corresponding OB
is not available on the CPU, the complete passivation process may take approximately 1
minute.
S7-400H
154 System Manual, 12/2010, A5E00267695-07
Using I/Os in S7–400H
10.5 Connecting redundant I/O
Procedure
First, determine the passivation status by evaluating the status byte in the status/control
word "FB_RED_IN.STATUS_CONTROL_W". If you see that one or more modules have
been passivated, determine the status of the respective module pairs in
MODUL_STATUS_WORD.
S7-400H
System Manual, 12/2010, A5E00267695-07 155
Using I/Os in S7–400H
10.6 Other options for connecting redundant I/Os
Configurations
The following redundant I/O configurations are supported:
1. Redundant configuration with one-sided central and/or distributed I/O.
For this purpose, one signal module each is inserted into the CPU 0 and CPU 1
subsystems.
2. Redundant configuration with switched I/O
One signal module each is inserted into two ET 200M distributed I/O devices with active
backplane bus.
5HGXQGDQWRQHVLGHG,2
5HGXQGDQWVZLWFKHG,2
NOTICE
When using redundant I/O, you may need to add time to the calculated monitoring times;
see section Determining the monitoring times (Page 111)
S7-400H
156 System Manual, 12/2010, A5E00267695-07
Using I/Os in S7–400H
10.6 Other options for connecting redundant I/Os
NOTICE
It is not advisable to configure the input and output modules with the same logical
addresses. Otherwise, in addition to the logical address, you will also need to query the
type (input or output) of the defective module in OB 122.
The user program also has to update the process image for redundant one-sided output
modules when the system is in single mode (direct access, for example). If you use
process image partitions, the user program must update them (SFC 27 "UPDAT_PO") in
OB 72 (recovery of redundancy). The system would otherwise first output old values on
the single-channel one-sided output modules of the reserve CPU when the system
changes to redundant mode.
NOTICE
The MODA and IOAE_BIT variables must also be valid outside OB 1 and OB 122. The
ATTEMPT2 variable, however, is used only in OB 1.
S7-400H
System Manual, 12/2010, A5E00267695-07 157
Using I/Os in S7–400H
10.6 Other options for connecting redundant I/Os
5HWU\ )DOVH
5HDGPRGXOH
<HV $ILUVW" 1R
$FFHVVWR $FFHVVWR
PRGXOH$ PRGXOH%
b'RQRWUHDG b'RQRWUHDG
PRGXOH$ILUVWDQ\ PRGXOH%ILUVWDQ\
,2DFFHVV ,2DFFHVV
PRUHLQIXWXUH PRUHLQIXWXUH
HUURU" HUURU"
5HWU\ 758( 5HWU\ 758(
<HV <HV
1R 1R
5HWU\ 5HWU\
758(" 758("
1R 1R
<HV <HV
8VHYDOXHRI 8VHYDOXHRI
8VHVXEVWLWXWH
PRGXOH$ PRGXOH%
YDOXH
S7-400H
158 System Manual, 12/2010, A5E00267695-07
Using I/Os in S7–400H
10.6 Other options for connecting redundant I/Os
Example in STL
The required elements of the user program (OB 1, OB 122) are listed below.
STL Description
NOP 0;
SET;
R ATTEMPT2; //Initialization
A MODA; //Read module A first?
JCN CMOB; //If not, continue with module B
CMOA: SET;
R IOAE_BIT; //Delete IOAE bit
L PID 8; //Read from CPU 0
A IOAE_BIT; //Was IOAE detected in OB 122?
JCN IOOK; //If not, process access OK
A ATTEMPT2; //Was this access the second attempt?
JC CMO0; //If yes, use substitute value
SET;
R MODA; //Do not read module A first any more
//in future
S ATTEMPT2;
CMOB: SET;
R IOAE_BIT; //Delete IOAE bit
L PID 12; //Read from CPU 1
A IOAE_BIT; //Was IOAE detected in OB 122?
JCN IOOK; //If not, process access OK
A ATTEMPT2; //Was this access the second attempt?
JC CMO0; //If yes, use substitute value
SET;
S MODA; //Read module A first again in future
S ATTEMPT2;
JU CMOA;
CMO0: L SUBS; //Substitute value
IOOK: //The value to be used is in ACCU1
S7-400H
System Manual, 12/2010, A5E00267695-07 159
Using I/Os in S7–400H
10.6 Other options for connecting redundant I/Os
STL Description
// Does module A cause IOAE?
L OB122_MEM_ADDR; //Relevant logical base address
L W#16#8;
== I; //Module A?
JCN M01; //If not, continue with M01
//IOAE during access to module A
SET;
= IOAE_BIT; //Set IOAE bit
JU CONT;
// Does module B cause an IOAE?
M01: NOP 0;
L OB122_MEM_ADDR; //Relevant logical start address
L W#16#C;
== I; //Module B?
JCN CONT; //If not, continue with CONT
//IOAE during access to module B
SET;
= IOAE_BIT; //Set IOAE bit
CONT: NOP 0;
NOTICE
If you have made I/O modules redundant and have taken account of this in your program,
you may need to add an overhead to the calculated monitoring times so that no bumps
occur at output modules (in HW Config -> Properties CPU -> H Parameter).
An overhead is only required if you operate modules from the following table as redundant
modules.
S7-400H
160 System Manual, 12/2010, A5E00267695-07
Using I/Os in S7–400H
10.6 Other options for connecting redundant I/Os
S7-400H
System Manual, 12/2010, A5E00267695-07 161
Using I/Os in S7–400H
10.6 Other options for connecting redundant I/Os
S7-400H
162 System Manual, 12/2010, A5E00267695-07
Communication 11
11.1 Communication
This section provides an introduction to communications with fault-tolerant systems and their
specific characteristics.
It sets out the basic concepts, the bus systems you can use for fault-tolerant communication,
and the available types of connection.
It contains information on communication functions using fault-tolerant and standard
connections, and explains how to configure and program them.
● You will also find examples of communication over fault-tolerant S7 connections and
learn about the advantages it offers.
● By way of comparison, you will learn how communication takes place over S7
connections and how you can also communicate in redundant mode by means of S7
connections.
S7-400H
System Manual, 12/2010, A5E00267695-07 163
Communication
11.2 Fundamentals and basic concepts
Overview
Increased demands on the availability of an overall system require increased reliability of the
communication systems, which means implementing redundant communication.
Below you will find an overview of the fundamentals and basic concepts which you ought to
know with regard to using fault-tolerant communications.
Fault-tolerant communication
Fault-tolerant communication is the deployment of S7 communication SFBs over fault-
tolerant S7 connections.
Fault-tolerant S7 connections are only possible when using redundant communication
systems.
Redundancy nodes
Redundancy nodes represent extreme reliability of communication between two fault-tolerant
systems. A system with multi-channel components is represented by redundancy nodes.
Redundancy nodes are independent when the failure of a component within the node does
not result in any reliability impairment in other nodes.
Even with fault-tolerant communication, only single errors/faults can be tolerated. If more
than one error occurs between communication endpoints, communication can no longer be
guaranteed.
S7-400H
164 System Manual, 12/2010, A5E00267695-07
Communication
11.2 Fundamentals and basic concepts
6FRQQHFWLRQ
&38
&38
&38
Note
Generally speaking, "connection" in this manual means a "configured S7 connection". For
other types of connection, please refer to the SIMATIC NET NCM S7 for PROFIBUS and
SIMATIC NET NCM S7 for Industrial Ethernet manuals.
Fault-tolerant S7 connections
The requirement for higher availability with communication components (for example CPs
and buses) means that redundant communication connections are necessary between the
systems involved.
Unlike an S7 connection, a fault-tolerant S7 connection consists of at least two underlying
subconnections. From the user program, configuration and connection diagnostics
perspective, the fault-tolerant S7 connection with its underlying subconnections is
represented by exactly one ID (just like a standard S7 connection). Depending on the
configuration, it can consist of up to four subconnections, of which two are always
established (active) to maintain communication in the event of an error. The number of
subconnections depends on the possible alternative paths (see figure below) and is
determined automatically.
S7-400H
System Manual, 12/2010, A5E00267695-07 165
Communication
11.2 Fundamentals and basic concepts
5HGXQGDQWFRQQHFWLRQ
)DXOWWROHUDQW )DXOWWROHUDQW
V\VWHPD V\VWHPE
&38 &3 &38 &3
D D E E
%XV
%XV
/$1UHG
5HGXQGDQWFRQQHFWLRQ
&38D!&38E&38D!&38E&38D!&38E&38D!&38E
)DXOWWROHUDQW )DXOWWROHUDQW
V\VWHPD V\VWHPE
&38 &3 &38 &3
D D E E
6\VWHPEXVDVPXOWLPRGHILEHURSWLFULQJ
Figure 11-2 Example that shows that the number of resulting partial connections depends on the
configuration
If the active subconnection fails, the already established second subconnection automatically
takes over communication.
S7-400H
166 System Manual, 12/2010, A5E00267695-07
Communication
11.3 Usable networks
NOTICE
S7-400H
System Manual, 12/2010, A5E00267695-07 167
Communication
11.5 Communication via fault-tolerant S7 connections
Requirement
The essential requirement for the configuration of fault-tolerant connections with STEP 7 is a
configured hardware installation.
The hardware configuration in both subsystems of a fault-tolerant system must be identical.
This applies in particular to the slots.
Depending on the network used, CPs can be used for fault-tolerant and fail-safe
communication, see Appendix Function modules and communication processors supported
by the S7-400H (Page 351)
Only Industrial Ethernet with the ISO protocol or PROFIBUS without distributed I/O is
supported. You require a suitable CP for fault-tolerant S7 connections via PROFIBUS. These
connections are not possible via the internal PROFIBUS-DP interface.
To be able to use fault-tolerant S7 connections between a fault-tolerant system and a PC,
you must install the "S7-REDCONNECT" software package on the PC. Please refer to the
Product Information on "S7-REDCONNECT" to learn more about the CPs you can use at the
PC end.
Configuration
The availability of the system, including the communication, is set during configuration. Refer
to the STEP 7 documentation to find out how to configure connections.
Only S7 communication is used for fault-tolerant S7 connections. To set this up, open the
"New Connection" dialog box, then select "S7 Connection Fault-Tolerant" as the type.
The number of required redundant connections is determined by STEP 7 as a function of the
redundancy nodes. Up to four redundant connections can be generated, if supported by the
network. Higher redundancy cannot be achieved even by using more CPs.
In the "Properties - Connection" dialog box you can also modify specific properties of a fault-
tolerant connection if necessary. When using more than one CP, you can also route the
connections in this dialog box. This may be practical, because by default all connections are
routed initially through the first CP. If all the connections are busy there, any further
connections are routed via the second CP, etc.
Programming
Fault-tolerant communication can be implemented on the fault-tolerant CPU and is
implemented by means of S7 communication.
This is possible only within an S7 project/multiproject.
S7-400H
168 System Manual, 12/2010, A5E00267695-07
Communication
11.5 Communication via fault-tolerant S7 connections
Note
For information on programming the communication, refer to the STEP 7 documentation
(e.g. Programming with STEP 7).
The START and STOP communication functions act on exactly one CPU or on all CPUs of
the fault-tolerant system (for more details refer to the System Software for S7-300/400,
System and Standard Functions Reference Manual).
Any disruption of subconnections while communication jobs are active over fault-tolerant S7
connections leads to extended delay times.
NOTICE
Downloading the connection configuration during operation
If you download a connection configuration during operation, any established connections
could be canceled.
Availability
The easiest way to enhance availability between linked systems is to implement a redundant
plant bus, using a duplex fiber-optic ring or a dual electrical bus system. The connected
nodes may consist of simple standard components.
Availability can best be enhanced using a duplex fiber-optic ring. If the one of the multimode
fiber-optic cables breaks, communication between the systems involved is maintained. The
systems then communicate as if they were connected to a bus system (line). A ring topology
basically contains two redundant components and automatically forms a 1-out-of-2
redundancy node. A fiber-optic network can be set up as a line or star topology. However,
the line topology does not permit cable redundancy.
If one electrical cable segment fails, communication between the participating systems is
also upheld (1-out-of-2 redundancy).
The examples below illustrate the differences between the two variants.
S7-400H
System Manual, 12/2010, A5E00267695-07 169
Communication
11.5 Communication via fault-tolerant S7 connections
Note
The number of connection resources required on the CPs depends on the network used.
If you implement a duplex fiber-optic ring (see figure below), two connection resources are
required per CP. In contrast, only one connection resource is required per CP if a double
electrical network (see figure after next) is used.
+V\VWHPD +V\VWHPE
3ODQWEXVDVRSWLFDO
&38 &3 &38 &3 WZRILEHUULQJ
D D E E
+V\VWHPD
+V\VWHPE
260
&38D &3D EXVD &3E &38E
5HGXQGDQF\EORFN
GLDJUDP
&38D &3D 260 &3E &38E
EXVE
RXWRIUHGXQ
GDQF\
Figure 11-3 Example of redundancy with fault-tolerant system and redundant ring
)DXOWWROHUDQWV\VWHPD )DXOWWROHUDQWV\VWHPE
&38 &3 &38 &3
D D E E
%XV
%XV
5HGXQGDQF\EORFNGLDJUDP
)DXOWWROHUDQWV\VWHPD )DXOWWROHUDQWV\VWHPE
Figure 11-4 Example of redundancy with fault-tolerant system and redundant bus system
S7-400H
170 System Manual, 12/2010, A5E00267695-07
Communication
11.5 Communication via fault-tolerant S7 connections
)DXOWWROHUDQWV\VWHPD )DXOWWROHUDQWV\VWHPE
)DXOWWROHUDQWV\VWHPD )DXOWWROHUDQWV\VWHPE
&3D &3E
&38D %XV &38E
5HGXQGDQF\EORFN
GLDJUDP &3D &3E
&3D &3E
&38D %XV &38E
&3D &3E
Response to failure
If a duplex fiber-optic ring is used, only a double error within a fault-tolerant system (e.g.
CPUa1 and CPa2 in one system) leads to total failure of communication between the
systems involved (see first figure).
If a double error (e.g. CPUa1 and CPb2) occurs in the first case of a redundant electrical bus
system (see second figure), this results in a total failure of communication between the
systems involved.
In the case of a redundant electrical bus system with CP redundancy (see third figure), only
a double error within a fault-tolerant system (e.g. CPUa1 and CPUa2) or a triple error (e.g.
CPUa1, CPa22, and bus2) will result in a total failure of communication between the systems
involved.
Fault-tolerant S7 connections
Any disruption of subconnections while communication jobs are active over fault-tolerant S7
connections leads to extended delay times.
Availability
Availability can be enhanced by using a redundant plant bus and by using a fault-tolerant
CPU in a standard system.
If the communication peer is a fault-tolerant CPU, redundant connections can also be
configured, in contrast to systems with a CPU 416, for example.
S7-400H
System Manual, 12/2010, A5E00267695-07 171
Communication
11.5 Communication via fault-tolerant S7 connections
Note
Fault-tolerant connections use two connection resources on CP b1 for the redundant
connections. One connection resource each is occupied on CP a1 and CP a2 respectively.
In this case, the use of further CPs in the standard system only serves to increase the
resources.
+V\VWHPD 6WDQGDUGV\VWHPZLWK+&38
+V\VWHPD
6WDQGDUGV\VWHPZLWK+&38
Figure 11-6 Example of redundancy with fault-tolerant system and fault-tolerant CPU
Response to failure
Double errors in the fault-tolerant system (i.e. CPUa1 and CPa2) or single errors in a
standard system (CPUb1) lead to a total failure of communication between the systems
involved; see previous figure.
Availability
When fault-tolerant systems are linked to a PC, the availability of the overall system is
concentrated not only on the PCs (OS) and their data management, but also on data
acquisition in the automation systems.
PCs are not fault-tolerant due to their hardware and software characteristics. They can be
arranged redundantly within a system, however. The availability of such a PC (OS) system
and its data management is ensured by means of suitable software such as WinCC
Redundancy.
Communication takes place via fault-tolerant connections.
S7-400H
172 System Manual, 12/2010, A5E00267695-07
Communication
11.5 Communication via fault-tolerant S7 connections
Configuring connections
The PC must be engineered and configured as a SIMATIC PC station. Additional
configuration of fault-tolerant communication is not necessary at the PC end. Connection
configuration is handled by the STEP 7 project in the form of an XDB file at the PC end.
You can find out how to use STEP 7 to integrate fault-tolerant S7 communication for a PC
into your OS system in the WinCC documentation.
+V\VWHPD 3&
&38 &3 :LQ&& &3 3ODQWEXVDVRSWLFDO
D D 6HUYHU WZRILEHUULQJ
+V\VWHPD
RXWRIUHGXQGDQF\
Figure 11-7 Example of redundancy with fault-tolerant system and redundant bus system
S7-400H
System Manual, 12/2010, A5E00267695-07 173
Communication
11.5 Communication via fault-tolerant S7 connections
+V\VWHPD 3&
+V\VWHPD
RXWRIUHGXQGDQF\
Figure 11-8 Example of redundancy with a fault-tolerant system, redundant bus system, and CP
redundancy on PC.
Response to failure
Double errors in the fault-tolerant system (i.e. CPUa1 and CPa2) and failure of the PC result
in a total failure of communication between the systems involved (see previous figures).
S7-400H
174 System Manual, 12/2010, A5E00267695-07
Communication
11.6 Communication via S7 connections
Configuration
S7 connections are configured in STEP 7.
Programming
All communication functions are supported for standard communication on a fault-tolerant
system.
The communication SFBs are used in STEP 7 to program communication.
Note
The START and STOP communication functions act on exactly one CPU or on all CPUs of
the fault-tolerant system (for more details refer to the System Software for S7-300/400,
System and Standard Functions Reference Manual).
NOTICE
Downloading the connection configuration during operation
If you download a connection configuration during operation, any established connections
could be canceled.
S7-400H
System Manual, 12/2010, A5E00267695-07 175
Communication
11.6 Communication via S7 connections
Availability
Availability is also enhanced by using a redundant plant bus instead of a simple bus (see
image below) for communication between a fault-tolerant system and a standard system.
)DXOWWROHUDQWV\VWHP 6WDQGDUGV\VWHP
%XV
)DXOWWROHUDQWV\VWHP
&RQQHFWLRQ
%ORFNGLDJUDP
Figure 11-9 Example of linking standard and fault-tolerant systems in a simple bus system
In this configuration, the CPUa2 is connected to the standard system in redundant mode via
the reserve CPU and CPb1. This applies no matter which CPU is the master CPU.
On a plant bus configured as duplex fiber-optic ring, communication between the partner
systems is maintained if the duplex fiber-optic cable breaks. The systems then communicate
as if they were connected to a bus system (linear structure); see following figure.
For linked fault-tolerant and standard systems, the availability of communication cannot be
improved by means of a dual electrical bus system. To use the second bus system as a
redundant system, you will have to use and manage a second S7 connection in the user
program (see figure after next one).
S7-400H
176 System Manual, 12/2010, A5E00267695-07
Communication
11.6 Communication via S7 connections
+V\VWHP 6WDQGDUGV\VWHP
&RQQHFWLRQ
+V\VWHP
260 6WDQGDUGV\VWHP
&38D &3D EXV
260
%ORFNGLDJUDP EXV &3E &38E
&38D &3D 260
EXV
&RQQHFWLRQ
Figure 11-10 Example of linking of standard and fault-tolerant systems in a redundant ring
)DXOWWROHUDQWV\VWHP 6WDQGDUGV\VWHP
%XV
%XV
)DXOWWROHUDQWV\VWHP
&RQQHFWLRQ
%ORFNGLDJUDP
&RQQHFWLRQ
Figure 11-11 Example of linking standard and fault-tolerant systems in a redundant bus system
Response to failure
Duplex fiber-optic ring and bus system
Because standard S7 connections are used here (the connection ends at the CPU of the
subsystem, in this case CPUa1), an error in the fault-tolerant system (e.g. CPUa1 or CPa1)
or an error in system b (e.g. CP b) results in total failure of communication between the
systems involved (see previous figures).
There are no bus system-specific differences in the response to failure.
S7-400H
System Manual, 12/2010, A5E00267695-07 177
Communication
11.6 Communication via S7 connections
Availability
Availability can be enhanced by using a redundant plant bus and two separate CPs in a
standard system.
Redundant communication can also be operated with standard connections. For this two
separate S7 connections must be configured in the program in order to implement
connection redundancy. In the user program, both connections require the implementation of
monitoring functions in order to allow the detection of failures and to change over to the
standby connection.
The following figure shows such a configuration.
)DXOWWROHUDQW 6WDQGDUGV\VWHP
%XV
%XV
)DXOWWROHUDQW
%ORFNGLDJUDP
&38D &3D %XV &3E 6WDQGDUGV\VWHP
&38E
&38D &3D &3E
%XV
Figure 11-12 Example of redundancy with fault-tolerant systems and a redundant bus system with
redundant standard connections
S7-400H
178 System Manual, 12/2010, A5E00267695-07
Communication
11.6 Communication via S7 connections
Response to failure
Double errors in the fault-tolerant system (i.e. CPUa1 and CPa 2) or in the standard system
(CPb1 and CPb2), and single errors in the standard system (CPUb1) lead to a total failure of
communication between the systems involved (see previous figure).
Configuring connections
Redundant connections between the point-to-point CP and the fault-tolerant system are not
necessary.
+V\VWHPD 6LQJOHFKDQQHOWKLUGSDUW\V\VWHP
&3
&38
&38 &3
D
([W
&3
[ ,0
3W3
5HGXQGDQF\EORFN (70
GLDJUDP +V\VWHPD
&38D ,0D
Response to failure
Double errors in the fault-tolerant system (i.e. CPUa1 and IM 153-2) and single errors in the
third-party system lead to a total failure of communication between the systems involved
(see previous figure).
S7-400H
System Manual, 12/2010, A5E00267695-07 179
Communication
11.6 Communication via S7 connections
The point-to-point CP can also be inserted centrally in "Fault-tolerant system a". However, in
this configuration even the failure of the CPU, for example, will cause a total failure of
communication.
Configuring connections
Redundant connections between the gateway CP and the single-channel system are not
required.
The gateway CP is located on a PC system which has fault-tolerant connections to the fault-
tolerant system.
To configure fault-tolerant S7 connections between fault-tolerant system A and the gateway,
you first need to install S7-REDCONNECT on the gateway. The functions for preparing data
for their transfer via the single-channel link must be implemented in the user program.
For additional information, refer to the "Industrial Communications IK10" Catalog.
6LQJOHFKDQQHOOLQN
260 260
3ODQWEXVDVRSWLFDO
WZRILEHUULQJ
5HGXQGDQF\EORFNGLDJUDP
+V\VWHPD
S7-400H
180 System Manual, 12/2010, A5E00267695-07
Communication
11.7 Communication performance
Operating range
In every automation system there is a linear operating range in which an increase in
communication load will also lead to an increase in data throughput. This then results in
reasonable response times which are acceptable for the automation task at hand.
A further increase in communication load will push data throughput into the saturation range.
Under certain conditions, the automation system therefore may no longer be capable of
processing the request volume within the response time demanded. Data throughput
reaches its maximum, and the reaction time rises exponentially; see the figures below.
Data throughput may even be reduced somewhat due to additional internal loads inside the
device.
'DWDWKURXJKSXW
6WDQGDUG&38
)DXOWWROHUDQW&38
&RPPXQLFDWLRQORDG
S7-400H
System Manual, 12/2010, A5E00267695-07 181
Communication
11.7 Communication performance
5HDFWLRQWLPH
6WDQGDUG&38
)DXOWWROHUDQW&38
&RPPXQLFDWLRQORDG
S7-400H
182 System Manual, 12/2010, A5E00267695-07
Communication
11.8 General issues regarding communication
S7-400H
System Manual, 12/2010, A5E00267695-07 183
Communication
11.8 General issues regarding communication
OPC servers
When OPC is used to connect several HMI devices for your visualization tasks to a fault-
tolerant system, you should keep the number of OPC servers accessing the fault-tolerant
system as low as possible. OPC clients should address a shared OPC server, which then
fetches the data from the fault-tolerant system.
You can optimize data exchange by using WinCC and its client/server concept.
Various HMI devices of third-party vendors support the S7 communication protocol. You
should utilize this option.
S7-400H
184 System Manual, 12/2010, A5E00267695-07
Configuring with STEP 7 12
12.1 Configuring with STEP 7
This section provides an overview of fundamental issues to be observed when you configure
a fault-tolerant system.
The second section covers the PG functions in STEP 7.
For detailed information, refer to Configuring fault-tolerant systems in the basic help.
NOTICE
OBs required
Always download these error OBs to the S7-400H CPU: OB 70, OB 72, OB 80, OB 82,
OB 83, OB 85, OB 86, OB 87, OB 88, OB 121 and OB 122. If you do not download these
OBs, the fault-tolerant system goes into STOP when an error occurs.
S7-400H
System Manual, 12/2010, A5E00267695-07 185
Configuring with STEP 7
12.2 Configuring with STEP 7
Layout rules
● A fault-tolerant station may contain up to 20 expansion racks.
● Even-numbered mounting racks can be assigned only to central rack 0, whereas odd-
numbered mounting racks can be assigned only to central rack 1.
● Modules with communication bus interface can be operated only in racks 0 through 6.
● Communication-bus capable modules are not permissible in switched I/O.
● Pay attention to the mounting rack numbers when operating CPs for fault-tolerant
communication in expansion racks:
The numbers must be directly sequential and begin with the even number, e.g. rack
numbers 2 and 3, but not rack numbers 3 and 4.
● A rack number is also assigned for DP master no. 9 onwards if the central rack contains
DP master modules. The number of possible expansion racks is reduced as a result.
Compliance with the rules is monitored automatically by STEP 7 and considered accordingly
during configuration.
S7-400H
186 System Manual, 12/2010, A5E00267695-07
Configuring with STEP 7
12.2 Configuring with STEP 7
Introduction
Assigning parameters to modules in a fault-tolerant station is no different from assigning
parameters to modules in S7-400 standard stations.
Procedure
All the parameters of the redundant components (with the exception of MPI and
communication addresses) must be identical.
S7-400H
System Manual, 12/2010, A5E00267695-07 187
Configuring with STEP 7
12.2 Configuring with STEP 7
Note
The specific fault-tolerant CPU parameters, and thus also the monitoring times, are
calculated automatically. The work memory allocation of all data blocks is based on a CPU-
specific default value. If your fault-tolerant system does not link up, check the data memory
allocation (HW Config > CPU Properties > H Parameters > Work memory used for all data
blocks).
NOTICE
A CP 443-5 Extended (order number 6GK7443–5DX03) may only be used for transfer rates
of up to 1.5 MBaud in an S7–400H or S7–400FH when a DP/PA or Y link is connected
(IM157, order number 6ES7157-0AA00-0XA0, 6ES7157-0AA80-0XA0, 6ES7157-0AA81-
0XA0). Remedy: see FAQ 11168943 in
Service & Support (http://www.siemens.com/automation/service&support)
S7-400H
188 System Manual, 12/2010, A5E00267695-07
Configuring with STEP 7
12.2 Configuring with STEP 7
● If only one DP master system is available (in practice usually fiber-optic cables), four
connecting paths are used for a connection between two fault-tolerant stations. All CPs
are in this subnet:
S7-400H
System Manual, 12/2010, A5E00267695-07 189
Configuring with STEP 7
12.3 Programming device functions in STEP 7
Communication functions
For programming device (PG) functions that establish online connections (e.g. downloading
and deleting blocks), one of the two CPUs has to be selected even if the function affects the
entire system over the redundant link.
● Data which is modified in one of the central processing units in redundant operation affect
the other CPUs over the redundant link.
● Data which is modified when there is no redundant link (i.e. in single mode) initially
affects only the processed CPU. The blocks are applied by the master CPU to the
reserve CPU during the next link-up and update. Exception: After a configuration
modification no new blocks are applied (only the unchanged data blocks). Loading the
blocks is then the responsibility of the user.
S7-400H
190 System Manual, 12/2010, A5E00267695-07
Failure and replacement of components during
operation 13
13.1 Failure and replacement of components during operation
One factor that is crucial to the uninterrupted operation of the fault-tolerant controller is the
replacement of failed components during operation. Quick repairs will recover fault-tolerant
redundancy.
We will show you in the following sections how simple and fast it can be to repair and
replace components in the S7-400H. Also refer to the tips in the corresponding sections of
the manual S7-400 Automation Systems, Installation
S7-400H
System Manual, 12/2010, A5E00267695-07 191
Failure and replacement of components during operation
13.2 Failure and replacement of components during operation
NOTICE
New CPUs are always shipped with the latest operating system version. If this differs
from the version of the operating system of the remaining CPU, you will have to equip
the new CPU with the same version of the operating system. Either create an operating
system update card for the new CPU and use this to load the operating system on the
CPU or load the required operating system in HW Config with "PLC -> Update
Firmware", see section Updating the firmware without a memory card (Page 61).
Procedure
Follow the steps below to replace a CPU:
S7-400H
192 System Manual, 12/2010, A5E00267695-07
Failure and replacement of components during operation
13.2 Failure and replacement of components during operation
Procedure
Follow the steps below to replace the load memory:
Starting situation
Both CPUs are in RUN.
Procedure
Proceed as follows to replace a power supply module in the central rack:
S7-400H
System Manual, 12/2010, A5E00267695-07 193
Failure and replacement of components during operation
13.2 Failure and replacement of components during operation
Note
Redundant power supply
If you use a redundant power supply (PS 407 10A R), two power supply modules are
assigned to one fault-tolerant CPU. If a part of the redundant PS 407 10A R power supply
module fails, the associated CPU keeps on running. The defective part can be replaced
during operation.
Starting situation
Procedure
CAUTION
Note the different procedures.
Minor injury or damage to equipment is possible.
The procedure for replacing and input/output or function module differs for modules of the
S7-300 and S7-400.
Use the correct procedure when replacing a module. The correct procedure is described
below for the S7-300 and the S7-400.
To replace signal and function modules of an S7-300, perform the following steps:
S7-400H
194 System Manual, 12/2010, A5E00267695-07
Failure and replacement of components during operation
13.2 Failure and replacement of components during operation
To replace signal and function modules of an S7-400, perform the following steps:
S7-400H
System Manual, 12/2010, A5E00267695-07 195
Failure and replacement of components during operation
13.2 Failure and replacement of components during operation
Starting situation
Connection failed
In communication via redundant connections:
S7-400H
196 System Manual, 12/2010, A5E00267695-07
Failure and replacement of components during operation
13.2 Failure and replacement of components during operation
Procedure
Proceed as follows to replace a communication module for PROFIBUS or Industrial
Ethernet:
Starting situation
S7-400H
System Manual, 12/2010, A5E00267695-07 197
Failure and replacement of components during operation
13.2 Failure and replacement of components during operation
Procedure
Follow the steps below to replace a synchronization module or fiber-optic cable:
Note
If both fiber-optic cables or synchronization modules are damaged or replaced one after the
other, the system responses are the same as described above.
The only exception is that the reserve CPU does not change to STOP but instead requests a
memory reset.
S7-400H
198 System Manual, 12/2010, A5E00267695-07
Failure and replacement of components during operation
13.2 Failure and replacement of components during operation
Starting situation
Procedure
The double error described results in loss of redundancy. In this event proceed as follows:
Starting situation
S7-400H
System Manual, 12/2010, A5E00267695-07 199
Failure and replacement of components during operation
13.2 Failure and replacement of components during operation
Procedure
Follow the steps below to replace an interface module:
S7-400H
200 System Manual, 12/2010, A5E00267695-07
Failure and replacement of components during operation
13.2 Failure and replacement of components during operation
Starting situation
Procedure
Follow the steps below to replace an interface module:
S7-400H
System Manual, 12/2010, A5E00267695-07 201
Failure and replacement of components during operation
13.3 Failure and replacement of components of the distributed I/Os
Note
Replacing I/O and function modules located in a distributed station is described in section
Failure and replacement of an input/output or function module (Page 194).
Starting situation
Procedure
Proceed as follows to replace a PROFIBUS DP master:
S7-400H
202 System Manual, 12/2010, A5E00267695-07
Failure and replacement of components during operation
13.3 Failure and replacement of components of the distributed I/Os
Starting situation
Replacement procedure
Proceed as follows to replace the PROFIBUS DP interface module:
Starting situation
S7-400H
System Manual, 12/2010, A5E00267695-07 203
Failure and replacement of components during operation
13.3 Failure and replacement of components of the distributed I/Os
Procedure
Proceed as follows to replace a DP slave:
Starting situation
S7-400H
204 System Manual, 12/2010, A5E00267695-07
Failure and replacement of components during operation
13.3 Failure and replacement of components of the distributed I/Os
Replacement procedure
Proceed as follows to replace PROFIBUS DP cables:
S7-400H
System Manual, 12/2010, A5E00267695-07 205
Failure and replacement of components during operation
13.3 Failure and replacement of components of the distributed I/Os
S7-400H
206 System Manual, 12/2010, A5E00267695-07
System modifications during operation 14
14.1 System modifications during operation
In addition to the options of hot swapping failed components as described in section Failure
and replacement of components during operation (Page 191),
you can also make changes to the system in a fault-tolerant system without interrupting the
running program.
The procedure partially depends on whether you are working with your user software in PCS
7 or STEP 7.
The procedures described below for changes during operation are
designed so that you start with the redundant system mode (see section The system states
of the S7-400H (Page 84)) with the aim of returning to this mode when the procedures are
completed.
NOTICE
Keep strictly to the rules described in this section with regard to modifications of the system
in runtime. If you contravene one or more rules, the response of the fault-tolerant system
can result in its availability being restricted or even failure of the entire automation system.
Only perform a system change in runtime when there is no redundancy error, i.e. when the
REDF LED is not lit. The automation system may otherwise fail.
The cause of a redundancy error is listed in the diagnostic buffer.
Safety-related components are not taken into account in this description. For more
information on dealing with fail-safe systems refer to the SIMATIC Industrial Software S7
F/FH Systems manual.
S7-400H
System Manual, 12/2010, A5E00267695-07 207
System modifications during operation
14.2 Possible hardware modifications
WARNING
During a hardware modification, you can either remove or add modules. If you want to alter
your fault-tolerant system such that you remove modules and add others, you have to make
two hardware changes.
NOTICE
Always download configuration changes to the CPU using the "Configure hardware"
function.
Load memory data of both CPUs must be updated several times in the process. It is
therefore advisable to expand the integrated load memory with a RAM card (at least
temporarily).
You may only change the FLASH card to a RAM card as required for this if the FLASH card
has as much maximum storage space as the largest RAM card available. If you cannot
obtain a RAM card with a capacity to match the FLASH card memory space, split the
relevant configuration and program modifications into several smaller steps in order to
provide sufficient space in the integrated load memory.
Synchronization link
Whenever you make hardware modifications, make sure that the synchronization link
between the two CPUs is established before you start or turn on the reserve CPU. If the
power supply to the CPUs is on, the LEDs IFM1F and IFM2F that indicate errors on the
module interfaces on the two CPUs should go off.
If one of the IFM LEDs continues to be lit even after you have replaced the relevant
synchronization modules, the synchronization cables and even the reserve CPU, there is an
error in the master CPU. In this case, you can, however, switch to the reserve CPU by
selecting the "via only one intact redundancy link" option in the "Switch" STEP 7 dialog box.
S7-400H
208 System Manual, 12/2010, A5E00267695-07
System modifications during operation
14.2 Possible hardware modifications
NOTICE
Always switch off power before you add or remove IM460 and IM461 interface modules,
external CP443-5 Extended DP master interface modules, and their connecting cables.
S7-400H
System Manual, 12/2010, A5E00267695-07 209
System modifications during operation
14.2 Possible hardware modifications
● Always terminate both ends of PROFIBUS DP and PROFIBUS PA bus cables using
active bus terminating elements in order to ensure proper termination of the cables while
you are reconfiguring the system.
● PROFIBUS PA bus systems should be built up using components from the SpliTConnect
product range (see interactive catalog CA01) so that separation of the lines is not
required.
● Loaded data blocks must not be deleted and created again. In other words, SFC 22
(CREATE_DB) and SFC 23 (DEL_DB) may not be applied to DB numbers occupied by
loaded DBs.
● Always ensure that the current status of the user program is available as STEP 7 project
in block format at the PG/ES when you modify the system configuration. It is not enough
to upload the user program back from one of the CPUs to the PG/ES or to compile it
again from an STL source.
Note
After reloading connections/gateways, it is no longer possible to change from a RAM card to
a FLASH card.
S7-400H
210 System Manual, 12/2010, A5E00267695-07
System modifications during operation
14.2 Possible hardware modifications
Special features
● Keep changes to a manageable extent. We recommend that you modify only one DP
master and/or a few DP slaves (e.g. no more than 5) per reconfiguration run.
● When using an IM 153-2, active bus modules can only be plugged in if the power supply
is off.
NOTICE
Remember the following when using redundant I/O that you have implemented as one-
sided I/O at the user level (see section Other options for connecting redundant I/Os
(Page 156)):
Due to the link-up and update process carried out after a system modification, the I/O
data of the previous master CPU may be temporarily deleted from the process image
until all (changed) I/Os of the "new" master CPU are written to the process image.
During the first update of the process image after a system modification, you may
(incorrectly) have the impression that the redundant I/O has failed completely or that a
redundant I/O exists. So correct evaluation of the redundancy status is not possible until
the process image has been fully updated.
This does not apply for modules that have been enabled for redundant operation (see
section Connecting redundant I/O (Page 129)).
Preparations
To minimize the time during which the fault-tolerant system has to run in single mode,
perform the following steps before making the hardware change:
● Check whether the CPUs provide sufficient memory capacity for the new configuration
data and user program. If necessary, first expand the memory configuration (see section
Changing the CPU memory configuration (Page 250)).
● Always ensure that plugged modules which are not configured yet do not have any
unwanted influence on the process.
S7-400H
System Manual, 12/2010, A5E00267695-07 211
System modifications during operation
14.3 Adding components in PCS 7
Starting situation
You have verified that the CPU parameters (e.g. monitoring times) match the planned new
program. Adapt the CPU parameters first, if necessary (see section Editing CPU parameters
(Page 244)).
The fault-tolerant system is operating in redundant system mode.
Procedure
Carry out the steps listed below to add hardware components to a fault-tolerant system in
PCS 7. Details of each step are described in a subsection.
Exceptions
This procedure for system modification does not apply in the following cases:
● To use free channels on an existing module
● For adding interface modules (see section Adding interface modules in PCS 7
(Page 219))
Note
As of STEP 7 V5.3 SP2, after changing the hardware configuration, the load operation
runs largely automatically. This means that you no longer need to perform the steps
described in sections PCS 7, step 3: Stopping the reserve CPU (Page 214) to PCS 7,
step 6: Transition to redundant system mode (Page 216). The system behavior remains
unchanged as already described.
You will find more information in the HW Config online help, "Download to module ->
Download station configuration in RUN mode".
S7-400H
212 System Manual, 12/2010, A5E00267695-07
System modifications during operation
14.3 Adding components in PCS 7
Starting situation
The fault-tolerant system is operating in redundant system mode.
Procedure
1. Add the new components to the system.
– Plug new central modules into the racks.
– Plug new module into existing modular DP stations
– Add new DP stations to existing DP master systems.
NOTICE
With switched I/O: Always complete all changes on one segment of the redundant
DP master system before you modify the next segment.
Result
The insertion of non-configured modules will have no effect on the user program. The same
applies to adding DP stations.
The fault-tolerant system continues to operate in redundant system mode.
New components are not yet addressed.
Starting situation
The fault-tolerant system is operating in redundant system mode.
Procedure
1. Perform all the modifications to the hardware configuration relating to the added
hardware offline. Assign appropriate icons to the new channels to be used.
2. Compile the new hardware configuration, but do not load it into the target system just yet.
Result
The modified hardware configuration is in the PG/ES. The target system continues operation
with the old configuration in redundant system mode.
S7-400H
System Manual, 12/2010, A5E00267695-07 213
System modifications during operation
14.3 Adding components in PCS 7
Configuring connections
The interconnections with added CPs must be configured on both connection partners after
you complete the HW modification.
Starting situation
The fault-tolerant system is operating in redundant system mode.
Procedure
1. In SIMATIC Manager, select a CPU of the fault-tolerant system, then choose "PLC >
Operating Mode" from the menu.
2. In the "Operating Mode" dialog box, select the reserve CPU, then click "Stop".
Result
The reserve CPU switches to STOP mode, the master CPU remains in RUN mode, the fault-
tolerant system works in single mode. The one-sided I/O of the reserve CPU is no longer
addressed.
Although I/O access errors of the one-sided I/O will result in OB 85 being called, due to the
higher-priority CPU redundancy loss (OB 72) they will not be reported. OB 70 (I/O
redundancy loss) is not called.
14.3.4 PCS 7, step 4: Loading a new hardware configuration in the reserve CPU
Starting situation
The fault-tolerant system is operating in single mode.
Procedure
Load the compiled hardware configuration in the reserve CPU that is in STOP mode.
NOTICE
The user program and connection configuration cannot be downloaded in single mode.
S7-400H
214 System Manual, 12/2010, A5E00267695-07
System modifications during operation
14.3 Adding components in PCS 7
Result
The new hardware configuration of the reserve CPU does not yet have an effect on ongoing
operation.
Starting situation
The modified hardware configuration is downloaded to the reserve CPU.
Procedure
1. In SIMATIC Manager, select a CPU of the fault-tolerant system, then choose "PLC >
Operating Mode" from the menu.
2. In the "Operating Mode" dialog box, click the "Switch to..." button.
In the "Switch" dialog box, select the "with altered configuration" option and click the "Switch"
button.
1. Acknowledge the prompt for confirmation with "OK".
Result
The reserve CPU links up, is updated (see section Link-up and update (Page 95)) and
becomes the master. The previous master CPU switches to STOP mode, the fault-tolerant
system operates with the new hardware configuration in single mode.
S7-400H
System Manual, 12/2010, A5E00267695-07 215
System modifications during operation
14.3 Adding components in PCS 7
Starting situation
The fault-tolerant system is operating with the new hardware configuration in single mode.
Procedure
1. In SIMATIC Manager, select a CPU of the fault-tolerant system, then choose "PLC >
Operating Mode" from the menu.
2. From the "Operating Mode" dialog box, select the reserve CPU, then click "Warm
Restart".
Result
The reserve CPU links up and is updated. The fault-tolerant system is operating with the new
hardware configuration in redundant system mode.
Type of I/O One-sided I/O of reserve One-sided I/O of master Switched I/O
CPU CPU
Added I/O are given new parameter are updated by the CPU.
modules settings and updated by Driver blocks are not yet present. Process or
the CPU. diagnostic interrupts are detected, but are not
Driver blocks are not yet reported.
present. Any interrupts
occurring are not
reported.
I/O modules still are given new parameter continue operation without interruption.
present settings1) and updated by
the CPU.
Added DP stations as for added I/O modules Driver blocks are not yet present. Any interrupts
(see above) occurring are not reported.
1) Central modules are first reset. Output modules briefly output 0 during this time (instead of the
configured substitute or hold values).
S7-400H
216 System Manual, 12/2010, A5E00267695-07
System modifications during operation
14.3 Adding components in PCS 7
Starting situation
The fault-tolerant system is operating with the new hardware configuration in redundant
system mode.
CAUTION
The following program modifications are not possible in redundant system mode and result
in the system mode Stop (both CPUs in STOP mode):
Structural modifications to an FB interface or the FB instance data.
Structural modifications to global DBs.
Compression of the CFC user program.
Before the entire program is recompiled and reloaded due to such modifications the
parameter values must be read back into the CFC, otherwise the modifications to the block
parameters could be lost. You will find more detailed information on this topic in the CFC for
S7, Continuous Function Chart manual.
Procedure
1. Adapt the program to the new hardware configuration. You can add the following
components:
– CFCs and SFCs
– Blocks in existing charts
– Connections and parameter settings
2. Assign parameters for the added channel drivers and interconnect them with the newly
assigned icons (see section PCS 7, step 2: Offline modification of the hardware
configuration (Page 213)).
3. In SIMATIC Manager, select the charts folder and choose the "Options > Charts >
Generate Module Drivers" menu command.
S7-400H
System Manual, 12/2010, A5E00267695-07 217
System modifications during operation
14.3 Adding components in PCS 7
4. Compile only the modifications in the charts and download them to the target system.
NOTICE
Until an FC is called the first time, the value of its output is undefined. This must be
taken into account in the interconnection of the FC outputs.
5. Configure the interconnections for the new CPs on both communication partners and
download them to the target system.
Result
The fault-tolerant system processes the entire system hardware with the new user program
in redundant system mode.
S7-400H
218 System Manual, 12/2010, A5E00267695-07
System modifications during operation
14.3 Adding components in PCS 7
Procedure
1. Change the hardware configuration offline (see section PCS 7, step 2: Offline
modification of the hardware configuration (Page 213))
2. Stop the reserve CPU (see section PCS 7, step 3: Stopping the reserve CPU (Page 214))
3. Download the new hardware configuration to the reserve CPU (see section PCS 7, step
4: Loading a new hardware configuration in the reserve CPU (Page 214))
4. Proceed as follows to expand the subsystem of the present reserve CPU:
– Switch off the power supply of the reserve subsystem.
– Insert the new IM460 into the central unit, then establish the link to a new expansion
unit.
or
– Add a new expansion unit to an existing chain.
or
– Plug in the new external DP master interface, and set up a new DP master system.
– Switch on the power supply of the reserve subsystem again.
5. Switch to CPU with altered configuration (see section PCS 7, step 5: Switch to CPU with
modified configuration (Page 215))
6. Proceed as follows to expand the subsystem of the original master CPU (currently in
STOP mode):
– Switch off the power supply of the reserve subsystem.
– Insert the new IM460 into the central unit, then establish the link to a new expansion
unit.
or
– Add a new expansion unit to an existing chain.
or
– Plug in the new external DP master interface, and set up a new DP master system.
– Switch on the power supply of the reserve subsystem again.
7. Change to redundant system mode (see section PCS 7, step 6: Transition to redundant
system mode (Page 216))
8. Modify and download the user program (see section PCS 7, step 7: Editing and
downloading the user program (Page 217))
S7-400H
System Manual, 12/2010, A5E00267695-07 219
System modifications during operation
14.4 Removing components in PCS 7
Starting situation
You have verified that the CPU parameters (e.g. monitoring times) match the planned new
program. Adapt the CPU parameters first, if necessary (see section Editing CPU parameters
(Page 244)).
The modules to be removed and their connected sensors and actuators are no longer of any
significance to the process being controlled. The fault-tolerant system is operating in
redundant system mode.
Procedure
Carry out the steps listed below to remove hardware components from a fault-tolerant
system in PCS 7. Details of each step are described in a subsection.
Exceptions
This general procedure for system modifications does not apply to removing interface
modules (see section Removing interface modules in PCS 7 (Page 227)).
Note
After changing the hardware configuration, download takes place practically automatically.
This means that you no longer need to perform the steps described in sections PCS 7, step
3: Stopping the reserve CPU (Page 223) to PCS 7, step 6: Transition to redundant system
mode (Page 225). The system behavior remains as described.
You will find more information in the HW Config online help, "Download to module ->
Download station configuration in RUN mode".
S7-400H
220 System Manual, 12/2010, A5E00267695-07
System modifications during operation
14.4 Removing components in PCS 7
Starting situation
The fault-tolerant system is operating in redundant system mode.
Procedure
1. Perform offline only the configuration modifications relating to the hardware being
removed. As you do, delete the icons to the channels that are no longer used.
2. Compile the new hardware configuration, but do not load it into the target system just yet.
Result
The modified hardware configuration is in the PG/ES. The target system continues operation
with the old configuration in redundant system mode.
S7-400H
System Manual, 12/2010, A5E00267695-07 221
System modifications during operation
14.4 Removing components in PCS 7
Starting situation
The fault-tolerant system is operating in redundant system mode.
CAUTION
The following program modifications are not possible in redundant system mode and result
in the system mode Stop (both CPUs in STOP mode):
Structural modifications to an FB interface or the FB instance data.
Structural modifications to global DBs.
Compression of the CFC user program.
Before the entire program is recompiled and reloaded due to such modifications the
parameter values must be read back into the CFC, otherwise the modifications to the block
parameters could be lost. You will find more detailed information on this topic in the CFC for
S7, Continuous Function Chart manual.
Procedure
1. Edit only the program elements related to the hardware removal. You can delete the
following components:
– CFCs and SFCs
– Blocks in existing charts
– Channel drivers, interconnections and parameter settings
2. In SIMATIC Manager, select the charts folder and choose the "Options > Charts >
Generate Module Drivers" menu command.
This removes the driver blocks that are no longer required.
3. Compile only the modifications in the charts and download them to the target system.
NOTICE
Until an FC is called the first time, the value of its output is undefined. This must be
taken into account in the interconnection of the FC outputs.
Result
The fault-tolerant system continues to operate in redundant system mode. The new user
program will no longer attempt to access the hardware being removed.
S7-400H
222 System Manual, 12/2010, A5E00267695-07
System modifications during operation
14.4 Removing components in PCS 7
Starting situation
The fault-tolerant system is operating in redundant system mode. The user program will no
longer attempt to access the hardware being removed.
Procedure
1. In SIMATIC Manager, select a CPU of the fault-tolerant system, then choose "PLC >
Operating Mode" from the menu.
2. In the "Operating Mode" dialog box, select the reserve CPU, then click "Stop".
Result
The reserve CPU switches to STOP mode, the master CPU remains in RUN mode, the fault-
tolerant system works in single mode. The one-sided I/O of the reserve CPU is no longer
addressed.
14.4.4 PCS 7, step 4: Downloading a new hardware configuration to the reserve CPU
Starting situation
The fault-tolerant system is operating in single mode.
Procedure
Load the compiled hardware configuration in the reserve CPU that is in STOP mode.
NOTICE
The user program and connection configuration cannot be downloaded in single mode.
Result
The new hardware configuration of the reserve CPU does not yet have an effect on ongoing
operation.
S7-400H
System Manual, 12/2010, A5E00267695-07 223
System modifications during operation
14.4 Removing components in PCS 7
Starting situation
The modified hardware configuration is downloaded to the reserve CPU.
Procedure
1. In SIMATIC Manager, select a CPU of the fault-tolerant system, then choose "PLC >
Operating Mode" from the menu.
2. In the "Operating Mode" dialog box, click the "Switch to..." button.
3. In the "Switch" dialog box, select the "with altered configuration" option and click the
"Switch" button.
4. Acknowledge the prompt for confirmation with "OK".
Result
The reserve CPU links up, is updated (see section Link-up and update (Page 95)) and
becomes the master. The previous master CPU switches to STOP mode, the fault-tolerant
system operates with the new hardware configuration in single mode.
S7-400H
224 System Manual, 12/2010, A5E00267695-07
System modifications during operation
14.4 Removing components in PCS 7
Starting situation
The fault-tolerant system is operating with the new hardware configuration in single mode.
Procedure
1. In SIMATIC Manager, select a CPU of the fault-tolerant system, then choose "PLC >
Operating Mode" from the menu.
2. From the "Operating Mode" dialog box, select the reserve CPU, then click "Warm
Restart".
Result
The reserve CPU links up and is updated. The fault-tolerant system is operating with the new
hardware configuration in redundant system mode.
Type of I/O One-sided I/O of reserve One-sided I/O of master Switched I/O
CPU CPU
I/O modules to be are no longer addressed by the CPU.
removed1) Driver blocks are no longer present.
I/O modules still are given new parameter continue operation without interruption.
present settings2) and updated by
the CPU.
DP stations to be as for I/O modules to be removed (see above)
removed
1) No longer included in the hardware configuration, but still plugged in
2) Central modules are first reset. Output modules briefly output 0 during this time (instead of the
configured substitute or hold values).
S7-400H
System Manual, 12/2010, A5E00267695-07 225
System modifications during operation
14.4 Removing components in PCS 7
Starting situation
The fault-tolerant system is operating with the new hardware configuration in redundant
system mode.
Procedure
1. Disconnect all the sensors and actuators from the components you want to remove.
2. Unplug modules of the one-sided I/Os that are no longer required from the racks.
3. Unplug components that are no longer required from the modular DP stations.
4. Remove DP stations that are no longer required from the DP master systems.
NOTICE
With switched I/O: Always complete all changes on one segment of the redundant DP
master system before you modify the next segment.
Result
The removal of non-configured modules does not influence the user program. The same
applies to removing DP stations.
The fault-tolerant system continues to operate in redundant system mode.
S7-400H
226 System Manual, 12/2010, A5E00267695-07
System modifications during operation
14.4 Removing components in PCS 7
Procedure
1. Change the hardware configuration offline (see section PCS 7, step 1: Editing the
hardware configuration offline (Page 221))
2. Modify and download the user program (see section PCS 7, step 2: Editing and
downloading the user program (Page 222))
3. Stop the reserve CPU (see section PCS 7, step 3: Stopping the reserve CPU (Page 223))
4. Download the new hardware configuration to the reserve CPU (see section PCS 7, step
4: Downloading a new hardware configuration to the reserve CPU (Page 223))
5. Follow the steps below to remove an interface module from the subsystem of the reserve
CPU:
– Switch off the power supply of the reserve subsystem.
– Remove an IM460 from the central unit.
or
– Remove an expansion unit from an existing chain.
or
– Remove an external DP master interface module.
– Switch on the power supply of the reserve subsystem again.
6. Switch to CPU with altered configuration (see section PCS 7, step 5: Switching to CPU
with modified configuration (Page 224))
7. Proceed as follows to remove an interface module from the subsystem of the original
master CPU (currently in STOP mode):
– Switch off the power supply of the reserve subsystem.
– Remove an IM460 from the central unit.
or
– Remove an expansion unit from an existing chain.
or
– Remove an external DP master interface module.
– Switch on the power supply of the reserve subsystem again.
8. Change to redundant system mode (see section PCS 7, step 6: Transition to redundant
system mode (Page 225))
S7-400H
System Manual, 12/2010, A5E00267695-07 227
System modifications during operation
14.5 Adding components in STEP 7
Starting situation
You have verified that the CPU parameters (e.g. monitoring times) match the planned new
program. Adapt the CPU parameters first, if necessary (see section Editing CPU parameters
(Page 244)).
The fault-tolerant system is operating in redundant system mode.
Procedure
Carry out the steps listed below to add hardware components to a fault-tolerant system in
STEP 7. Details of each step are described in a subsection.
S7-400H
228 System Manual, 12/2010, A5E00267695-07
System modifications during operation
14.5 Adding components in STEP 7
Exceptions
This procedure for system modification does not apply in the following cases:
● To use free channels on an existing module
● For adding interface modules (see section Adding interface modules in STEP 7
(Page 235))
Note
After changing the hardware configuration, download takes place practically
automatically. This means that you no longer need to perform the steps described in
sections STEP 7, step 4: Stopping the reserve CPU (Page 231) to STEP 7, step 8:
Editing and downloading the user program (Page 234). The system behavior remains as
described.
You will find more information in the HW Config online help "Download to module ->
Download station configuration in RUN mode".
Starting situation
The fault-tolerant system is operating in redundant system mode.
Procedure
1. Add the new components to the system.
– Plug new central modules into the racks.
– Plug new module into existing modular DP stations
– Add new DP stations to existing DP master systems.
NOTICE
With switched I/O: Always complete all changes on one segment of the redundant
DP master system before you modify the next segment.
Result
The insertion of non-configured modules will have no effect on the user program. The same
applies to adding DP stations.
The fault-tolerant system continues to operate in redundant system mode.
New components are not yet addressed.
S7-400H
System Manual, 12/2010, A5E00267695-07 229
System modifications during operation
14.5 Adding components in STEP 7
Starting situation
The fault-tolerant system is operating in redundant system mode. The modules added are
not yet addressed.
Procedure
1. Perform all the modifications to the hardware configuration relating to the added
hardware offline.
2. Compile the new hardware configuration, but do not load it into the target system just yet.
Result
The modified hardware configuration is in the PG. The target system continues operation
with the old configuration in redundant system mode.
Configuring connections
The interconnections with added CPs must be configured on both connection partners after
you complete the HW modification.
Starting situation
The fault-tolerant system is operating in redundant system mode.
Procedure
1. Verify that the interrupt OBs 4x, 82, 83, 85, 86, OB 88 and 122 react to any interrupts of
the new components as intended.
2. Download the modified OBs and the corresponding program elements to the target
system.
Result
The fault-tolerant system is operating in redundant system mode.
S7-400H
230 System Manual, 12/2010, A5E00267695-07
System modifications during operation
14.5 Adding components in STEP 7
Starting situation
The fault-tolerant system is operating in redundant system mode.
Procedure
1. In SIMATIC Manager, select a CPU of the fault-tolerant system, then choose "PLC >
Operating Mode" from the menu.
2. In the "Operating Mode" dialog box, select the reserve CPU, then click "Stop".
Result
The reserve CPU switches to STOP mode, the master CPU remains in RUN mode, the fault-
tolerant system works in single mode. The one-sided I/O of the reserve CPU is no longer
addressed. OB 70 (I/O redundancy loss) is not called due to the higher-priority CPU
redundancy loss (OB72).
14.5.5 STEP 7, step 5: Loading a new hardware configuration in the reserve CPU
Starting situation
The fault-tolerant system is operating in single mode.
Procedure
Load the compiled hardware configuration in the reserve CPU that is in STOP mode.
NOTICE
The user program and connection configuration cannot be downloaded in single mode.
Result
The new hardware configuration of the reserve CPU does not yet have an effect on ongoing
operation.
S7-400H
System Manual, 12/2010, A5E00267695-07 231
System modifications during operation
14.5 Adding components in STEP 7
Starting situation
The modified hardware configuration is downloaded to the reserve CPU.
Procedure
1. In SIMATIC Manager, select a CPU of the fault-tolerant system, then choose "PLC >
Operating Mode" from the menu.
2. In the "Operating Mode" dialog box, click the "Switch to..." button.
3. In the "Switch" dialog box, select the "with altered configuration" option and click the
"Switch" button.
4. Acknowledge the prompt for confirmation with "OK".
Result
The reserve CPU links up, is updated and becomes the master. The previous master CPU
switches to STOP mode, the fault-tolerant system operates with the new hardware
configuration in single mode.
Type of I/O One-sided I/O of previous One-sided I/O of new master Switched I/O
master CPU CPU
Added I/O modules are not addressed by the CPU. are given new parameter settings and updated by the CPU.
The output modules temporarily output the configured
substitution values.
I/O modules still are no longer addressed by the are given new parameter continue operation without
present CPU. settings1) and updated by the interruption.
Output modules output the CPU.
configured substitute or holding
values.
Added DP stations are not addressed by the CPU. as for added I/O modules (see above)
1) Central modules are first reset. Output modules briefly output 0 during this time (instead of the configured substitute or
hold values).
S7-400H
232 System Manual, 12/2010, A5E00267695-07
System modifications during operation
14.5 Adding components in STEP 7
Starting situation
The fault-tolerant system is operating with the new hardware configuration in single mode.
Procedure
1. In SIMATIC Manager, select a CPU of the fault-tolerant system, then choose "PLC >
Operating Mode" from the menu.
2. From the "Operating Mode" dialog box, select the reserve CPU, then click "Warm
Restart".
Result
The reserve CPU links up and is updated. The fault-tolerant system is operating with the new
hardware configuration in redundant system mode.
Type of I/O One-sided I/O of reserve CPU One-sided I/O of master CPU Switched I/O
Added I/O modules are given new parameter are updated by the CPU. are updated by the CPU.
settings and updated by the Generate insertion interrupt;
CPU. must be ignored in OB 83.
The output modules
temporarily output the
configured substitution values.
I/O modules still are given new parameter continue operation without interruption.
present settings1) and updated by the
CPU.
Added DP stations as for added I/O modules (see are updated by the CPU.
above)
1) Central modules are first reset. Output modules briefly output 0 during this time (instead of the configured substitute or
hold values).
S7-400H
System Manual, 12/2010, A5E00267695-07 233
System modifications during operation
14.5 Adding components in STEP 7
Starting situation
The fault-tolerant system is operating with the new hardware configuration in redundant
system mode.
Restrictions
CAUTION
Procedure
1. Adapt the program to the new hardware configuration.
You can add, edit or remove OBs, FBs, FCs and DBs.
2. Download only the program changes to the target system.
3. Configure the interconnections for the new CPs on both communication partners and
download them to the target system.
Result
The fault-tolerant system processes the entire system hardware with the new user program
in redundant system mode.
S7-400H
234 System Manual, 12/2010, A5E00267695-07
System modifications during operation
14.5 Adding components in STEP 7
S7-400H
System Manual, 12/2010, A5E00267695-07 235
System modifications during operation
14.6 Removing components in STEP 7
Starting situation
You have verified that the CPU parameters (e.g. monitoring times) match the planned new
program. Adapt the CPU parameters first, if necessary (see section Editing CPU parameters
(Page 244)).
The modules to be removed and their connected sensors and actuators are no longer of any
significance to the process being controlled. The fault-tolerant system is operating in
redundant system mode.
Procedure
Carry out the steps listed below to remove hardware components from a fault-tolerant
system in STEP 7. Details of each step are described in a subsection.
S7-400H
236 System Manual, 12/2010, A5E00267695-07
System modifications during operation
14.6 Removing components in STEP 7
Exceptions
This general procedure for system modifications does not apply to removing interface
modules (see section Removing interface modules in STEP 7 (Page 243)).
Note
After changing the hardware configuration, download takes place practically automatically.
This means that you no longer need to perform the steps described in sections STEP 7, step
3: Stopping the reserve CPU (Page 238) to STEP 7, step 6: Transition to redundant system
mode (Page 240). The system behavior remains as described.
You will find more information in the HW Config online help "Download to module ->
Download station configuration in RUN mode".
Starting situation
The fault-tolerant system is operating in redundant system mode.
Procedure
1. Perform all the modifications to the hardware configuration relating to the hardware being
removed offline.
2. Compile the new hardware configuration, but do not load it into the target system just yet.
Result
The modified hardware configuration is in the PG. The target system continues operation
with the old configuration in redundant system mode.
S7-400H
System Manual, 12/2010, A5E00267695-07 237
System modifications during operation
14.6 Removing components in STEP 7
Starting situation
The fault-tolerant system is operating in redundant system mode.
Restrictions
CAUTION
Procedure
1. Edit only the program elements related to the hardware removal.
You can add, edit or remove OBs, FBs, FCs and DBs.
2. Download only the program changes to the target system.
Result
The fault-tolerant system continues to operate in redundant system mode. The new user
program will no longer attempt to access the hardware being removed.
Starting situation
The fault-tolerant system is operating in redundant system mode. The user program will no
longer attempt to access the hardware being removed.
Procedure
1. In SIMATIC Manager, select a CPU of the fault-tolerant system, then choose "PLC >
Operating Mode" from the menu.
2. In the "Operating Mode" dialog box, select the reserve CPU, then click "Stop".
Result
The reserve CPU switches to STOP mode, the master CPU remains in RUN mode, the fault-
tolerant system works in single mode. The one-sided I/O of the reserve CPU is no longer
addressed.
S7-400H
238 System Manual, 12/2010, A5E00267695-07
System modifications during operation
14.6 Removing components in STEP 7
14.6.4 STEP 7, step 4: Downloading a new hardware configuration to the reserve CPU
Starting situation
The fault-tolerant system is operating in single mode.
Procedure
Load the compiled hardware configuration in the reserve CPU that is in STOP mode.
NOTICE
The user program and connection configuration cannot be downloaded in single mode.
Result
The new hardware configuration of the reserve CPU does not yet have an effect on ongoing
operation.
Starting situation
The modified hardware configuration is downloaded to the reserve CPU.
Procedure
1. In SIMATIC Manager, select a CPU of the fault-tolerant system, then choose "PLC >
Operating Mode" from the menu.
2. In the "Operating Mode" dialog box, click the "Switch to..." button.
3. In the "Switch" dialog box, select the "with altered configuration" option and click the
"Switch" button.
4. Acknowledge the prompt for confirmation with "OK".
Result
The reserve CPU links up, is updated (see section Link-up and update (Page 95)) and
becomes the master. The previous master CPU switches to STOP mode, the fault-tolerant
system continues operating in single mode.
S7-400H
System Manual, 12/2010, A5E00267695-07 239
System modifications during operation
14.6 Removing components in STEP 7
Type of I/O One-sided I/O of previous One-sided I/O of new master Switched I/O
master CPU CPU
I/O modules to be are no longer addressed by the CPU.
removed1)
I/O modules still are no longer addressed by the are given new parameter continue operation without
present CPU. settings2) and updated by the interruption.
Output modules output the CPU.
configured substitute or holding
values.
DP stations to be as for I/O modules to be removed (see above)
removed
1) No longer included in the hardware configuration, but still plugged in
2) Central modules are first reset. Output modules briefly output 0 during this time (instead of the configured substitute or
hold values).
Starting situation
The fault-tolerant system is operating with the new (restricted) hardware configuration in
single mode.
Procedure
1. In SIMATIC Manager, select a CPU of the fault-tolerant system, then choose "PLC >
Operating Mode" from the menu.
2. From the "Operating Mode" dialog box, select the reserve CPU, then click "Warm
Restart".
Result
The reserve CPU links up and is updated. The fault-tolerant system is operating in redundant
system mode.
S7-400H
240 System Manual, 12/2010, A5E00267695-07
System modifications during operation
14.6 Removing components in STEP 7
Type of I/O One-sided I/O of reserve CPU One-sided I/O of master CPU Switched I/O
I/O modules to be are no longer addressed by the CPU.
removed1)
I/O modules still are given new parameter continue operation without interruption.
present settings2) and updated by the
CPU.
DP stations to be as for I/O modules to be removed (see above)
removed
1) No longer included in the hardware configuration, but still plugged in
2) Central modules are first reset. Output modules briefly output 0 during this time (instead of the configured substitute or
hold values).
Starting situation
The fault-tolerant system is operating with the new hardware configuration in redundant
system mode.
Procedure
1. Disconnect all the sensors and actuators from the components you want to remove.
2. Remove the relevant components from the system.
– Remove the central modules from the rack.
– Remove the modules from modular DP stations
– Remove DP stations from DP master systems.
NOTICE
With switched I/O: Always complete all changes on one segment of the redundant
DP master system before you modify the next segment.
S7-400H
System Manual, 12/2010, A5E00267695-07 241
System modifications during operation
14.6 Removing components in STEP 7
Result
The removal of non-configured modules does not influence the user program. The same
applies to removing DP stations.
The fault-tolerant system continues to operate in redundant system mode.
Starting situation
The fault-tolerant system is operating in redundant system mode.
Procedure
1. Make sure that the interrupt OBs 4x and 82 no longer contain any interrupts of the
removed components.
2. Download the modified OBs and the corresponding program elements to the target
system.
Result
The fault-tolerant system is operating in redundant system mode.
S7-400H
242 System Manual, 12/2010, A5E00267695-07
System modifications during operation
14.6 Removing components in STEP 7
S7-400H
System Manual, 12/2010, A5E00267695-07 243
System modifications during operation
14.7 Editing CPU parameters
NOTICE
If you edit any protected parameters, the system will reject any attempt to changeover to
the CPU containing those modified parameters. The event W#16#5966 is written to the
diagnostic buffer. and you will then have to restore the wrongly changed parameters in the
parameter configuration to their last valid values.
S7-400H
244 System Manual, 12/2010, A5E00267695-07
System modifications during operation
14.7 Editing CPU parameters
The selected new values should match both the currently loaded and the planned new user
program.
Starting situation
The fault-tolerant system is operating in redundant system mode.
Procedure
To edit the CPU parameters of a fault-tolerant system, follow the steps outlined below.
Details of each step are described in a subsection.
Note
After changing the hardware configuration, download takes place practically automatically.
This means that you no longer need to perform the steps described in sections Step 2:
Stopping the reserve CPU (Page 246) to Step 5: Transition to redundant system mode
(Page 248). The system behavior remains as described.
You will find more information in the HW Config online help "Download to module ->
Download station configuration in RUN mode". You will find more information in the HW
Config online help "Download to module -> Download station configuration in RUN mode".
S7-400H
System Manual, 12/2010, A5E00267695-07 245
System modifications during operation
14.7 Editing CPU parameters
Starting situation
The fault-tolerant system is operating in redundant system mode.
Procedure
1. Edit the relevant CPU properties offline in HW Config.
2. Compile the new hardware configuration, but do not load it into the target system just yet.
Result
The modified hardware configuration is in the PG/ES. The target system continues operation
with the old configuration in redundant system mode.
Starting situation
The fault-tolerant system is operating in redundant system mode.
Procedure
1. In SIMATIC Manager, select a CPU of the fault-tolerant system, then choose "PLC >
Operating Mode" from the menu.
2. In the "Operating Mode" dialog box, select the reserve CPU, then click "Stop".
Result
The reserve CPU switches to STOP mode, the master CPU remains in RUN mode, the fault-
tolerant system works in single mode. The one-sided I/O of the reserve CPU is no longer
addressed.
S7-400H
246 System Manual, 12/2010, A5E00267695-07
System modifications during operation
14.7 Editing CPU parameters
Starting situation
The fault-tolerant system is operating in single mode.
Procedure
Load the compiled hardware configuration in the reserve CPU that is in STOP mode.
NOTICE
The user program and connection configuration cannot be downloaded in single mode.
Result
The modified CPU parameters in the new hardware configuration of the standby CPU do not
yet have an effect on ongoing operation.
Starting situation
The modified hardware configuration is downloaded to the reserve CPU.
Procedure
1. In SIMATIC Manager, select a CPU of the fault-tolerant system, then choose "PLC >
Operating Mode" from the menu.
2. In the "Operating Mode" dialog box, click the "Switch to..." button.
3. In the "Switch" dialog box, select the "with altered configuration" option and click the
"Switch" button.
4. Acknowledge the prompt for confirmation with "OK".
Result
The reserve CPU links up, is updated and becomes the master. The previous master CPU
switches to STOP mode, the fault-tolerant system continues operating in single mode.
S7-400H
System Manual, 12/2010, A5E00267695-07 247
System modifications during operation
14.7 Editing CPU parameters
Type of I/O One-sided I/O of previous One-sided I/O of new master Switched I/O
master CPU CPU
I/O modules are no longer addressed by the are given new parameter continue operation without
CPU. settings1) and updated by the interruption.
Output modules output the CPU.
configured substitute or holding
values.
1) Central modules are first reset. Output modules briefly output 0 during this time (instead of the configured substitute or
hold values).
Starting situation
The fault-tolerant system operates with the modified CPU parameters in single mode.
Procedure
1. In SIMATIC Manager, select a CPU of the fault-tolerant system, then choose "PLC >
Operating Mode" from the menu.
2. From the "Operating Mode" dialog box, select the reserve CPU, then click "Warm
Restart".
Result
The reserve CPU links up and is updated. The fault-tolerant system is operating in redundant
system mode.
S7-400H
248 System Manual, 12/2010, A5E00267695-07
System modifications during operation
14.7 Editing CPU parameters
Type of I/O One-sided I/O of reserve CPU One-sided I/O of master CPU Switched I/O
I/O modules are given new parameter continue operation without interruption.
settings1) and updated by the
CPU.
1) Central modules are first reset. Output modules briefly output 0 during this time (instead of the configured substitute or
hold values).
S7-400H
System Manual, 12/2010, A5E00267695-07 249
System modifications during operation
14.8 Changing the CPU memory configuration
Restrictions
Memory should preferably be expanded using RAM cards, because this will ensure that the
user program is copied to load memory of the reserve CPU in the link-up process.
In principle, it is also possible to use FLASH Cards to expand load memory. However, it is
then your responsibility to download the entire user program and the hardware configuration
to the new FLASH Card (see procedure in section Changing the type of load memory
(Page 251)).
Starting situation
The fault-tolerant system is operating in redundant system mode.
S7-400H
250 System Manual, 12/2010, A5E00267695-07
System modifications during operation
14.8 Changing the CPU memory configuration
Procedure
Proceed as follows in the specified sequence:
Note
After reloading connections/gateways, it is no longer possible to change from a RAM card to
a FLASH card.
Starting situation
The fault-tolerant system is operating in redundant system mode.
S7-400H
System Manual, 12/2010, A5E00267695-07 251
System modifications during operation
14.8 Changing the CPU memory configuration
The current status of the user program is available on the PG/ES as a STEP 7 project in
block format.
CAUTION
You cannot deploy a user program you uploaded from the target system here.
It is not permissible to recompile the user program from an STL source file, because this
action would set a new time stamp at all blocks and so prevent the block contents from
being copied when there is a master-reserve changeover.
Procedure
Proceed as follows in the specified sequence:
S7-400H
252 System Manual, 12/2010, A5E00267695-07
System modifications during operation
14.8 Changing the CPU memory configuration
NOTICE
If you want to change to FLASH Cards, you can load them with the user program and
hardware configuration in advance without inserting them in the CPU. Steps 4 and 7 can
then be omitted.
However, the memory cards in both CPUs must be loaded in the same sequence.
Changing the order of blocks in the load memories will lead to termination of the link-up
process.
S7-400H
System Manual, 12/2010, A5E00267695-07 253
System modifications during operation
14.8 Changing the CPU memory configuration
4. Switch to the CPU with the changed configuration using the "Operating Mode" dialog.
5. Remove the FLASH Card from the CPU which is now in STOP. Adapt the RAM
configuration as required, and then perform a CPU memory reset.
6. Execute a warm restart of the reserve CPU using the "Operating Mode" dialog. The
system status now changes to "Redundant" mode.
S7-400H
254 System Manual, 12/2010, A5E00267695-07
System modifications during operation
14.9 Re-parameterization of a module
NOTICE
If you edit any protected parameters, the system will reject any attempt to changeover to
the CPU containing those modified parameters. The event W#16#5966 is written to the
diagnostic buffer. and you will then have to restore the wrongly changed parameters in the
parameter configuration to their last valid values.
The selected new values must match the current and the planned user program.
Starting situation
The fault-tolerant system is operating in redundant system mode.
Procedure
To edit the parameters of modules in a fault-tolerant system, perform the steps outlined
below. Details of each step are described in a subsection.
S7-400H
System Manual, 12/2010, A5E00267695-07 255
System modifications during operation
14.9 Re-parameterization of a module
Note
After changing the hardware configuration, download takes place practically automatically.
This means that you no longer need to perform the steps described in sections Step 2:
Stopping the reserve CPU (Page 257) to Step 5: Transition to redundant system mode
(Page 259). The system behavior remains as described.
You will find more information in the HW Config online help "Download to module ->
Download station configuration in RUN mode".
Starting situation
The fault-tolerant system is operating in redundant system mode.
Procedure
1. Edit the module parameters offline in HW Config.
2. Compile the new hardware configuration, but do not load it into the target system just yet.
Result
The modified hardware configuration is in the PG/ES. The target system continues operation
with the old configuration in redundant system mode.
S7-400H
256 System Manual, 12/2010, A5E00267695-07
System modifications during operation
14.9 Re-parameterization of a module
Starting situation
The fault-tolerant system is operating in redundant system mode.
Procedure
1. In SIMATIC Manager, select a CPU of the fault-tolerant system, then choose "PLC >
Operating Mode" from the menu.
2. In the "Operating Mode" dialog box, select the reserve CPU, then click "Stop".
Result
The reserve CPU switches to STOP mode, the master CPU remains in RUN mode, the fault-
tolerant system works in single mode. The one-sided I/O of the reserve CPU is no longer
addressed.
Starting situation
The fault-tolerant system is operating in single mode.
Procedure
Load the compiled hardware configuration in the reserve CPU that is in STOP mode.
NOTICE
The user program and connection configuration cannot be downloaded in single mode.
Result
The modified parameters in the new hardware configuration of the reserve CPU do not yet
have an effect on ongoing operation.
S7-400H
System Manual, 12/2010, A5E00267695-07 257
System modifications during operation
14.9 Re-parameterization of a module
Starting situation
The modified hardware configuration is downloaded to the reserve CPU.
Procedure
1. In SIMATIC Manager, select a CPU of the fault-tolerant system, then choose "PLC >
Operating Mode" from the menu.
2. In the "Operating Mode" dialog box, click the "Switch to..." button.
3. In the "Switch" dialog box, select the "with altered configuration" option and click the
"Switch" button.
4. Acknowledge the prompt for confirmation with "OK".
Result
The reserve CPU links up, is updated and becomes the master. The previous master CPU
switches to STOP mode, the fault-tolerant system continues operating in single mode.
Type of I/O One-sided I/O of previous One-sided I/O of new master Switched I/O
master CPU CPU
I/O modules are no longer addressed by the are given new parameter continue operation without
CPU. settings1) and updated by the interruption.
Output modules output the CPU.
configured substitute or holding
values.
1) Central modules are first reset. Output modules briefly output 0 during this time (instead of the configured substitute or
hold values).
S7-400H
258 System Manual, 12/2010, A5E00267695-07
System modifications during operation
14.9 Re-parameterization of a module
Calling OB 83
After transferring the parameter data records to the desired modules, OB 83 is called. The
sequence is as follows:
1. After you have made the parameter changes to an module in STEP 7 and loaded them in
RUN in the CPU, the OB 83 is started (trigger event W#16#3367). Relevant in the OB start
information are the logical start address (OB83_MDL_ADDR) and the module type
(OB83_MDL_TYPE). From now on, the input and/or output data of the module might no
longer be correct, and no SFCs that send data records to this module may be active.
2. After termination of OB 83, the parameters of the module are reset.
3. After termination of the parameter reset operation, the OB 83 is started again (trigger
event W#16#3267 if the parameterization was successful, or W#16#3968 if it was
unsuccessful). The input and output data of the module is the same as after an insertion
interrupt, meaning that under certain circumstances may not yet be correct. With immediate
effect, you can again call SFCs that send data records to the module.
Starting situation
The fault-tolerant system operates with the modified parameters in single mode.
Procedure
1. In SIMATIC Manager, select a CPU of the fault-tolerant system, then choose "PLC >
Operating Mode" from the menu.
2. From the "Operating Mode" dialog box, select the reserve CPU, then click "Warm
Restart".
Result
The reserve CPU links up and is updated. The fault-tolerant system is operating in redundant
system mode.
Type of I/O One-sided I/O of reserve CPU One-sided I/O of master CPU Switched I/O
I/O modules are given new parameter continue operation without interruption.
settings1) and updated by the
CPU.
1) Central modules are first reset. Output modules briefly output 0 during this time (instead of the configured substitute or
hold values).
S7-400H
System Manual, 12/2010, A5E00267695-07 259
System modifications during operation
14.9 Re-parameterization of a module
S7-400H
260 System Manual, 12/2010, A5E00267695-07
Synchronization modules 15
15.1 Synchronization modules for S7–400H
Long synchronization cables may increase cycle times by up to 10% per cable kilometer.
Note
A fault-tolerant system requires 4 synchronization modules of the same type.
S7-400H
System Manual, 12/2010, A5E00267695-07 261
Synchronization modules
15.1 Synchronization modules for S7–400H
Mechanical configuration
/('/,1.2.IRUFRPPLVVLRQLQJ
)LEHURSWLFLQWHUIDFH
CAUTION
Risk of injury.
The synchronization module is equipped with a laser system and is classified as a "CLASS
1 LASER PRODUCT" according to IEC 60825–1.
Avoid direct contact with the laser beam. Do not open the housing. Always observe the
information provided in this manual, and keep the manual to hand as a reference.
S7-400H
262 System Manual, 12/2010, A5E00267695-07
Synchronization modules
15.1 Synchronization modules for S7–400H
&/$66/$6(5352'8&7
/$6(5./$66(352'8.7
72(1
LED LINK OK
During commissioning of the fault-tolerant system, you can use the "LINK OK" LED on the
synchronization module to check the quality of the connection between the CPUs.
OB 84
When operating in redundant system mode, the CPU's operating system calls OB 84 if it
detects a reduced performance in the redundant link between the two CPUs.
Technical data
S7-400H
System Manual, 12/2010, A5E00267695-07 263
Synchronization modules
15.1 Synchronization modules for S7–400H
S7-400H
264 System Manual, 12/2010, A5E00267695-07
Synchronization modules
15.2 Installation of fiber-optic cables
Introduction
Fiber-optic cables may only be installed by trained and qualified personnel. Always observe
the applicable rules and statutory regulations. The installation must be carried out with
meticulous care, because faulty installations represent the most common source of error.
Causes are:
● Kinking of the fiber-optic cable due to an insufficient bending radius.
● Crushing of the cable as a result of excess forces caused by persons treading on the
cable, or by pinching, or by the load of other heavy cables.
● Overstretching due to high tensile forces.
● Damage on sharp edges etc.
Points to observe when installing the fiber-optic cables for the S7-400H synchronization link
Always route the two fiber-optic cables separately. This increases availability and protects
the fiber-optic cables from potential double errors caused, for example, by interrupting both
cables at the same time.
Always make sure the fiber-optic cables are connected to both CPUs before switching on the
power supply or the system, otherwise the CPUs may process the user program as the
master CPU.
S7-400H
System Manual, 12/2010, A5E00267695-07 265
Synchronization modules
15.2 Installation of fiber-optic cables
Cable pull-in
Note the points below when pulling-in fiber-optic cables:
● Always observe the information on pull forces in the data sheet of the corresponding
fiber-optic cable.
● Do not reel off any greater lengths when you pull in the cables.
● Install the fiber-optic cable directly from the cable drum wherever possible.
● Do not spool the fiber-optic cable sideways off the drum flange (risk of twisting).
● You should use a cable pulling sleeve to pull in the fiber-optic cable.
● Always observe the specified bending radii.
● Do not use any grease or oil-based lubricants.
You may use the lubricants listed below to support the pulling-in of fiber-optic cables.
– Yellow compound (Wire-Pulling, lubricant from Klein Tools; 51000)
– Soft soap
– Dishwashing liquid
– Talcum powder
– Detergent
S7-400H
266 System Manual, 12/2010, A5E00267695-07
Synchronization modules
15.3 Selecting fiber-optic cables
Pressure
Do not exert any pressure on the cable, for example, by the inappropriate use of clamps
(cable quick-mount) or cable ties. Your installation should also prevent anyone from stepping
onto the cable.
Influence of heat
Fiber-optic cables are highly sensitive to direct heat, so the cables must not be worked on
using hot-air guns or gas burners as used in heat-shrink tubing technology.
Cable length up to 10 m
The synchronization module 6ES7 960–1AA04–0XA0 can be operated in pairs with fiber-
optic cables up to a length of 10 m.
Select cables with the following specification for lengths up to 10 m:
● Multimode fiber 50/125 µ or 62,5/125 µ
● Patch cable for indoor applications
● 2 x duplex cables per fault-tolerant system, crossed
● Connector type LC–LC
Such cables are available in the following length as accessories for fault-tolerant systems:
S7-400H
System Manual, 12/2010, A5E00267695-07 267
Synchronization modules
15.3 Selecting fiber-optic cables
Cable length up to 10 km
The synchronization module 6ES7 960-1AB04-0XA0 can be operated in pairs with fiber-optic
cables up to a length of 10 km.
The following rules apply:
● Make sure there is enough strain relief on the modules if you use fiber-optic cables longer
than 10 m.
● Keep to the specified ambient operating conditions of the fiber-optic cables used (bending
radii, pressure, temperature...)
● Observe the technical specifications of the fiber-optic cable (attenuation, bandwidth...)
Fiber-optic cables with lengths above 10 m usually have to be custom-made. In the first step,
select the following specification:
● Single-mode fiber (mono-mode fiber) 9/125 µ
For short lengths required for testing and commissioning you may also use the lengths up
to 10 m available as accessories. For continuous use, only the specified cables with
single-mode fibers are permitted.
The table below shows the further specifications, based on your application:
S7-400H
268 System Manual, 12/2010, A5E00267695-07
Synchronization modules
15.3 Selecting fiber-optic cables
S7-400H
System Manual, 12/2010, A5E00267695-07 269
Synchronization modules
15.3 Selecting fiber-optic cables
S7-400H
270 System Manual, 12/2010, A5E00267695-07
Synchronization modules
15.3 Selecting fiber-optic cables
6ZLWK&38+ 6ZLWK&38+
UDFN UDFN
)XUWKHUGLVWULEXWLRQER[HVIRUH[DPSOHZLWK
6&RU67SOXJDQGVRFNHWFRQQHFWRUVLQ
RUGHUWRLQFUHDVHWRWDOOHQJWKVE\LQWHUFRQ
QHFWLQJWKHVLQJOHVHJPHQWV
'LVWULEXWLRQER[HJ
'LVWULEXWLRQER[HJ
ZLWK6&RU67SOXJDQG PD[NP ZLWK6&RU67SOXJDQG
VRFNHWFRQQHFWRUV LQVWDOODWLRQFDEOH VRFNHWFRQQHFWRUV
LQGRRURXWGRRU
3DWFKFDEOH 3DWFKFDEOH
GXSOH[HJ GXSOH[HJ
/&6&67 /&6&67
S7-400H
System Manual, 12/2010, A5E00267695-07 271
Synchronization modules
15.3 Selecting fiber-optic cables
S7-400H
272 System Manual, 12/2010, A5E00267695-07
S7-400 cycle and response times 16
This section describes the decisive factors in the cycle and response times of your of S7-400
station.
You can read out the cycle time of the user program from the relevant CPU using the
programming device (refer to the manual Configuring Hardware and Connections with
STEP 7).
The examples included show you how to calculate the cycle time.
An important aspect of a process is its response time. How to calculate this factor is
described in detail in this section. When operating a CPU 41x-H as master on the
PROFIBUS DP network, you also need to include the additional DP cycle times in your
calculation (see section Response time (Page 286)).
Additional information
For more detailed information on the following execution times, refer to the S7–400H
instruction list. This lists all the STEP 7 instructions that can be executed by the particular
CPUs along with their execution times and all the SFCs/SFBs integrated in the CPUs and
the IEC functions that can be called in STEP 7 with their execution times.
S7-400H
System Manual, 12/2010, A5E00267695-07 273
S7-400 cycle and response times
16.1 Cycle time
Process image
During cyclic program processing, the CPU requires a consistent image of the process
signals. To ensure this, the process signals are read/written prior to program execution.
Subsequently, during program processing the CPU does not access the signal modules
directly when addressing the input (I) and output (O) address areas, but rather it accesses
the CPU's internal memory area containing the I/O process image.
Step Sequence
1 The operating system initiates the scan cycle monitoring time.
2 The CPU copies the values from the process output images to the output modules.
3 The CPU reads the status of inputs of the input modules, and then updates the process
image of the inputs.
4 The CPU processes the user program in time slices and executes the instructions
specified in the program.
5 At the end of a cycle, the operating system executes pending tasks, e.g. loading and
deleting of blocks.
6 Finally, on expiration of any given minimum cycle time, the CPU returns to the start of
the cycle and restarts cycle monitoring.
S7-400H
274 System Manual, 12/2010, A5E00267695-07
S7-400 cycle and response times
16.1 Cycle time
3,2
7LPHVOLFHVPVHDFK
3,,
8VHUSURJUDP
6&&26
7LPHVOLFHPV
2SHUDWLQJV\VWHP
8VHUSURJUDP
&RPPXQLFDWLRQ
S7-400H
System Manual, 12/2010, A5E00267695-07 275
S7-400 cycle and response times
16.2 Calculating the cycle time
Influencing factors
The table below shows the factors influencing the cycle time.
Factors Remark
Transfer time for the process See tables from 16-3 onwards
output image (POI) and process
input image (PII)
User program execution time This value is calculated based on the execution times of the
various statements (see the S7-400 statement list).
Operating system execution time See Table 16-7
at the cycle control point
Extension of cycle time due to You configure the maximum permitted communication load on
communication load the cycle as a percentage in STEP 7 (Programming with STEP 7
manual). See section Communication load (Page 283).
Load on cycle times due to Interrupt requests can always stop user program execution. See
interrupts Table 16-8
S7-400H
276 System Manual, 12/2010, A5E00267695-07
S7-400 cycle and response times
16.2 Calculating the cycle time
Table 16- 3 Portion of the process image transfer time, CPU 412-3H
S7-400H
System Manual, 12/2010, A5E00267695-07 277
S7-400 cycle and response times
16.2 Calculating the cycle time
Table 16- 4 Portion of the process image transfer time, CPU 414-4H
Table 16- 5 Portion of the process image transfer time, CPU 417-4H
S7-400H
278 System Manual, 12/2010, A5E00267695-07
S7-400 cycle and response times
16.2 Calculating the cycle time
Start-up 412–3H stand- 412–3H 414–4H stand- 414–4H 417–4H stand- 417–4H
alone mode redundant alone mode redundant alone mode redundant
Factor 1.04 1.2 1.05 1.2 1.05 1.2
Long synchronization cables may further increase cycle times by up to 10% per cable
kilometer.
Table 16- 7 Operating system execution time at the cycle control point
S7-400H
System Manual, 12/2010, A5E00267695-07 279
S7-400 cycle and response times
16.2 Calculating the cycle time
CPU Hardware Diagnostic Time-of- Delay interrupt Watchdo Programming / I/O Asynchron
interrupt interrupt day g access error ous
interrupt interrupt
error
CPU 412-3 481 µs 488 µs 526 µs 312 µs 333 µs 142 µs / 134 µs 301 µs
stand-alone
mode
CPU 412-3 H 997 µs 843 µs 834 µs 680 µs 674 µs 427 µs / 179 µs 832 µs
redundant
CPU 414–4 H 315 µs 326 µs 329 µs 193 µs 189 µs 89 µs / 85 µs 176 µs
stand-alone
mode
CPU 414–4 H 637 µs 539 µs 588 µs 433 µs 428 µs 272 µs / 114 µs 252 µs
redundant
CPU 417–4 H 160 µs 184 µs 101 µs 82 µs 120 µs 36 µs / 35 µs 90 µs
stand-alone
mode
CPU 417–4 H 348 µs 317 µs 278 µs 270 µs 218 µs 121 µs / 49 µs 115 µs
redundant
The program runtime at interrupt level must be added to this time extension.
The corresponding times are added together if the program contains nested interrupts.
S7-400H
280 System Manual, 12/2010, A5E00267695-07
S7-400 cycle and response times
16.3 Different cycle times
2%
Fluctuation of the block processing time (e.g. OB 1) may also be a factor causing cycle time
fluctuation, due to:
● conditional instructions
● conditional block calls
● different program paths
● loops, etc.
S7-400H
System Manual, 12/2010, A5E00267695-07 281
S7-400 cycle and response times
16.3 Different cycle times
&XUUHQWF\FOH 1H[WF\FOH
7PD[
6WDQGE\
7PLQ
7F\F 7ZDLW
3& 2%
3& 2%
3& 3&
7PLQ FRQILJXUDEOHPLQLPXPF\FOHWLPH
7PD[ FRQILJXUDEOHPD[LPXPF\FOHWLPH
7F\F WKHF\FOHWLPH
7ZDLW GLIIHUHQFHEHWZHHQ7PLQDQGWKHDFWXDOF\FOHWLPH:LWKLQWKLVWLPH\RX
FDQSURFHVVLQWHUUXSWHYHQWVRU6&&WDVNV
3& 3ULRULW\&ODVV
The actual cycle time is the sum of Tcyc and Twait. It is thus always longer or equal to Tmin.
S7-400H
282 System Manual, 12/2010, A5E00267695-07
S7-400 cycle and response times
16.4 Communication load
$FWXDOF\FOH
&\FOHWLPH[
WLPH &RQILJXUHGFRPPXQLFDWLRQORDGLQ
5RXQGWKHUHVXOWXSWRWKHQH[WKLJKHVW
LQWHJHU
Data consistency
The user program is interrupted to process communications. This interruption can be
triggered after any statement. These communication jobs may lead to a change in user data.
As a result, data consistency cannot be ensured over several accesses.
How to ensure data consistency in operations comprising more than one command is
described in the "Consistent data" section.
7LPHVOLFHPV
,QWHUUXSWLRQRIWKHXVHU
SURJUDP
8VHUSURJUDP
&RQILJXUDEOHSRUWLRQEHWZHHQ
DQG
&RPPXQLFDWLRQ
The operating system takes a certain portion of the remaining time slice for internal tasks.
This portion is included in the factor defined in the tables starting at 16-3.
S7-400H
System Manual, 12/2010, A5E00267695-07 283
S7-400 cycle and response times
16.4 Communication load
This means that a setting of 20% communication load allocates an average of 200 µs to
communication and 800 µs to the user program in each time slice. So the CPU requires 10
ms / 800 µs = 13 time slices to execute one cycle. This means the physical cycle time is
equivalent to 13 times 1-ms time slice = 13 ms, if the CPU fully utilizes the configured
communication load.
That is to say, 20% communication does not extend the cycle by a linear amount of 2 ms,
but by 3 ms.
&\FOHWLPH
PV
<RXFDQVHWDFRPPXQLFDWLRQORDG
ZLWKLQWKLVUDQJH
PV
PV
PV
PV
PV
&RPPXQLFDWLRQORDG
S7-400H
284 System Manual, 12/2010, A5E00267695-07
S7-400 cycle and response times
16.4 Communication load
Remarks
● Change the value of the "communication load" parameter to check the effects on the
cycle time during system runtime.
● Always take the communication load into account when you set the maximum cycle time,
otherwise you risk timeouts.
Recommendations
● Use the default setting whenever possible.
● Increase this value only if the CPU is used primarily for communication, and if time is not
a critical factor for the user program! In all other situations you should only reduce this
value!
S7-400H
System Manual, 12/2010, A5E00267695-07 285
S7-400 cycle and response times
16.5 Response time
Fluctuation range
The actual response time lies between the shortest and the longest response time. You must
always assume the longest response time when configuring your system.
The section below deals with the shortest and longest response times, in order to provide an
overview of the fluctuation in the length of response times.
Factors
The response time depends on the cycle time and the following factors:
● Delay of the inputs and outputs
● Additional DP cycle times on the PROFIBUS DP network
● Execution in the user program
S7-400H
286 System Manual, 12/2010, A5E00267695-07
S7-400 cycle and response times
16.5 Response time
%XVUXQWLPH PV
PV
%DXGUDWH0ESV
PV
PV
PV
PV
%DXGUDWH0ESV
PV
PV
0LQVODYH
LQWHUYDO
1XPEHURI'3
VODYHV
If you are operating a PROFIBUS DP network with more than one master, you will need to
take the DP cycle time into account for each master. In other words, perform a separate
calculation for each master and add the results together.
S7-400H
System Manual, 12/2010, A5E00267695-07 287
S7-400 cycle and response times
16.5 Response time
6&&26
'HOD\RIWKHLQSXWV
3,2
,PPHGLDWHO\EHIRUHWKH3,,LVUHDGLQWKHVWDWXVRIWKHDQDO\]HG
LQSXWFKDQJHV7KHFKDQJHRILQSXWVLJQDOLVDOVRWDNHQLQWR
3,, DFFRXQWLQWKH3,,
5H
DF 8VHU
SURJUDP 7KHFKDQJHRILQSXWVLJQDOLVSURFHVVHGKHUHE\WKHXVHU
WLRQ SURJUDP
WLPH
6&&26
7KHUHDFWLRQRIWKHXVHUSURJUDPWRWKHFKDQJHRIWKHLQSXW
VLJQDOLVRXWSXWWHGKHUHWRWKHRXWSXWV
3,2
'HOD\RIWKHLQSXWV
Calculation
The (shortest) response time is calculated as follows:
● 1 x process image transfer time of the inputs +
● 1 x process image transfer time of the outputs +
● 1 x program processing time +
● 1 x operating system processing time at the SCCP +
● Delay of the inputs and outputs
The result is equivalent to the sum of the cycle time plus the I/O delay times.
Note
If the CPU and signal module are not in the central unit, you will have to add twice the delay
time of the DP slave frame (including processing in the DP master).
S7-400H
288 System Manual, 12/2010, A5E00267695-07
S7-400 cycle and response times
16.5 Response time
6&&26
'HOD\RIWKHLQSXWV
'3F\FOHWLPHRQ352),%86'3
3,2
:KLOHWKH3,,LVEHLQJUHDGLQWKHVWDWXVRIWKHDQDO\]HG
3,, LQSXWFKDQJHV7KHFKDQJHRILQSXWVLJQDOLVQRORQJHU
LQWRDFFRXQWLQWKH3,,
8VHU
SURJUDP
6&&26
5H
DF
WLRQ
WLPH 3,2
$OORZDQFHVDUHPDGHKHUHLQWKH3,,IRULQSXWVLJQDO
WUDQVLWLRQV
3,,
7KHFKDQJHRILQSXWVLJQDOLVSURFHVVHGKHUHE\WKH
8VHU XVHUSURJUDP
SURJUDP
7KHUHDFWLRQRIWKHXVHUSURJUDPWRWKHFKDQJHRI
6&&26 LQSXWVLJQDOLVSDVVHGKHUHWRWKHRXWSXWV
3,2 'HOD\RIWKHLQSXWV
'3F\FOHWLPHRQ352),%86'3
Calculation
The (longest) response time is calculated as follows:
● 2 x process image transfer time of the inputs +
● 2 x process image transfer time of the outputs +
● 2 x operating system processing time +
● 2 x program processing time +
● 2 x delay of the DP slave frame (including processing in the DP master) +
● Delay of the inputs and outputs
This is equivalent to the sum of twice the cycle time and the delay in the inputs and outputs
plus twice the DP cycle time.
S7-400H
System Manual, 12/2010, A5E00267695-07 289
S7-400 cycle and response times
16.5 Response time
Table 16- 10 Direct access of the CPUs to I/O modules in the expansion unit with local link
S7-400H
290 System Manual, 12/2010, A5E00267695-07
S7-400 cycle and response times
16.5 Response time
Table 16- 11 Direct access of the CPUs to I/O modules in the expansion unit with remote link
The specified times are purely CPU processing times and apply, unless otherwise stated, to
signal modules in the central unit.
Note
You can also achieve fast response times by using hardware interrupts; see section Interrupt
response time (Page 296).
S7-400H
System Manual, 12/2010, A5E00267695-07 291
S7-400 cycle and response times
16.6 Calculating cycle and response times
Cycle time
1. Using the Instruction List, determine the runtime of the user program.
2. Calculate and add the process image transfer time. You will find guide values for this in
the tables starting at 16-3.
3. Add the processing time at the scan cycle checkpoint. You will find guide values for this in
Table 16–8.
4. Multiply the calculated value by the factor in Table 16–7.
The final result is the cycle time.
S7-400H
292 System Manual, 12/2010, A5E00267695-07
S7-400 cycle and response times
16.7 Examples of calculating the cycle and response times
Example I
You have installed an S7-400 with the following modules in the central unit:
● a 414-4H CPU in redundant system mode
● 2 digital input modules SM 421; DI 32xDC 24 V (each with 4 bytes in the PI)
● 2 digital output modules SM 422; DO 32xDC 24 V/0.5 (each with 4 bytes in the PI)
User program
According to the instruction list, the user program runtime is 15 ms.
S7-400H
System Manual, 12/2010, A5E00267695-07 293
S7-400 cycle and response times
16.7 Examples of calculating the cycle and response times
Example II
You have installed an S7-400 with the following modules:
● a 414–4H CPU in redundant system mode
● 4 digital input modules SM 421; DI 32×DC 24 V (each with 4 bytes in the PI)
● 3 digital output modules SM 422; DO 16xDC 24 V /2 (each with 2 bytes in the PI)
● 2 analog input modules SM 431; AI 8x13 bit (not in the PI)
● 2 analog output modules SM 432; AO 8x13 bit (not in the PI)
CPU parameters
The CPU was parameterized as follows:
● Cycle load due to communication: 40%
User program
According to the instruction list, the user program runtime is 10.0 ms.
S7-400H
294 System Manual, 12/2010, A5E00267695-07
S7-400 cycle and response times
16.7 Examples of calculating the cycle and response times
S7-400H
System Manual, 12/2010, A5E00267695-07 295
S7-400 cycle and response times
16.8 Interrupt response time
Table 16- 13 Process and interrupt response times; maximum interrupt response time without
communication
S7-400H
296 System Manual, 12/2010, A5E00267695-07
S7-400 cycle and response times
16.8 Interrupt response time
Signal modules
The hardware interrupt response time of signal modules is made up as follows:
● Digital input modules
Hardware interrupt response time = internal interrupt processing time + input delay
You will find these times in the data sheet for the respective digital input module.
● Analog input modules
Hardware interrupt response time = internal interrupt processing time + conversion time
The internal interrupt processing time for analog input modules can be neglected. The
conversion times can be found in the data sheet for the individual analog input modules.
The diagnostic interrupt response time of the signal modules is the time from detection of a
diagnostic event by the signal module to the triggering of the diagnostic interrupt by the
signal module. This short time can be neglected.
S7-400H
System Manual, 12/2010, A5E00267695-07 297
S7-400 cycle and response times
16.9 Example of calculation of the interrupt response time
Calculation
In this example, the hardware interrupt response time is based on following time factors:
● Hardware interrupt response time of CPU 417-4H: Approx. 0.6 ms (mean value in
redundant system mode)
● Extension due to communication according to the description in section Interrupt
response time (Page 296):
100 µs + 1000 µs × 20% = 300 µs = 0.3 ms
● Hardware interrupt response time of SM 421; DI 16×UC 24/60 V:
– Internal interrupt processing time: 0.5 ms
– Input delay: 0.5 ms
● The DP cycle time on the PROFIBUS DP is irrelevant, because the signal modules are
installed in the central unit.
The hardware interrupt response time is equivalent to the sum of the listed time factors:
Hardware interrupt response time = 0.6 ms + 0.3 ms + 0.5 ms + 0.5 ms = approx. 1.9 ms.
This calculated hardware interrupt response time is the time between detection of a signal at
the digital input and the call of the first instruction in OB 4x.
S7-400H
298 System Manual, 12/2010, A5E00267695-07
S7-400 cycle and response times
16.10 Reproducibility of delay and watchdog interrupts
Definition of "reproducibility"
Time-delay interrupt:
The period that expires between the call of the first operation in the interrupt OB and the
programmed time of interrupt.
Watchdog interrupt:
The fluctuation range of the interval between two successive calls, measured between the
respective initial operations of the interrupt OB.
Reproducibility
The following table contains the reproducibility of time-delay and watchdog interrupts of the
CPUs.
Module Reproducibility
Time-delay interrupt Watchdog interrupt
CPU 412-3H stand-alone mode -499 µs / +469 µs -315 µs / +305 µs
CPU 412-3H redundant -557 µs / +722 µs -710 µs / +655 µs
CPU 414-4H stand-alone mode -342 µs / +386 µs -242 µs / +233 µs
CPU 414-4H redundant -545 µs / +440 µs -793 µs / +620 µs
CPU 417-4H stand-alone mode -311 µs / +277 µs -208 µs / +210 µs
CPU 417-4H redundant -453 µs / +514 µs -229 µs / +289 µs
These times only apply if the interrupt can actually be executed at this time and if it is not
delayed, for example, by higher-priority interrupts or queued interrupts of equal priority.
S7-400H
System Manual, 12/2010, A5E00267695-07 299
S7-400 cycle and response times
16.10 Reproducibility of delay and watchdog interrupts
S7-400H
300 System Manual, 12/2010, A5E00267695-07
Technical data 17
17.1 Technical data of the CPU 412–3H; (6ES7 412–3HJ14–0AB0)
Word instructions 75 ns
Fixed-point arithmetic 75 ns
Default From C 0 to C 7
S7 timers 2048
Retentivity, configurable From T 0 to T 2047
S7-400H
System Manual, 12/2010, A5E00267695-07 301
Technical data
17.1 Technical data of the CPU 412–3H; (6ES7 412–3HJ14–0AB0)
Blocks
OBs See instruction list
Size Maximum 64 KB
Nesting depth
Per priority class 24
S7-400H
302 System Manual, 12/2010, A5E00267695-07
Technical data
17.1 Technical data of the CPU 412–3H; (6ES7 412–3HJ14–0AB0)
Number of DP masters
integrated 1
Resolution 1 ms
Runtime meter 8
Number/number range 0 to 7
Granularity 1 hour
Retentive Yes
S7-400H
System Manual, 12/2010, A5E00267695-07 303
Technical data
17.1 Technical data of the CPU 412–3H; (6ES7 412–3HJ14–0AB0)
S7 message functions
Number of stations that can log on for message Maximum 8
functions (e.g. WIN CC or SIMATIC OP)
Block-related messages Yes
Simultaneously active Alarm_S/SQ blocks or Maximum 100
Alarm_D/DQ blocks
Alarm_8 blocks Yes
Number of communication jobs for ALARM_8 Maximum 600
blocks and blocks for S7 communication
(selectable)
Default 300
Forcing Yes
Variable Inputs/outputs, bit memories, distributed
inputs/outputs
Number of variables Maximum 256
Default 120
Communication
PG/OP communication Yes
Routing Yes
S7 communication Yes
User data per job Maximum 64 KB
S7 basic communication No
S7-400H
304 System Manual, 12/2010, A5E00267695-07
Technical data
17.1 Technical data of the CPU 412–3H; (6ES7 412–3HJ14–0AB0)
S7 message functions
Global data communication No
S7-400H
System Manual, 12/2010, A5E00267695-07 305
Technical data
17.1 Technical data of the CPU 412–3H; (6ES7 412–3HJ14–0AB0)
S7 message functions
S5-compatible communication Using FC AG_SEND and AG_RECV, max. via 10
CPs 443–1 or 443–5
User data per job Maximum 8 KB
PROFIBUS DP DP master
Routing Yes
S7 communication Yes
S7 basic communication No
Routing Yes
S7 communication Yes
S7 basic communication No
S7-400H
306 System Manual, 12/2010, A5E00267695-07
Technical data
17.1 Technical data of the CPU 412–3H; (6ES7 412–3HJ14–0AB0)
S7 message functions
SYNC/FREEZE No
Enable/disable DP slaves No
SFC 58 "WR_REC" 8
SFC 55 "WR_PARM" 8
SFC 57 "PARM_MOD" 1
SFC 56 "WR_DPARM" 2
SFC 13 "DPNRM_DG" 8
SFC 51 "RDSYSST" 8
S7-400H
System Manual, 12/2010, A5E00267695-07 307
Technical data
17.1 Technical data of the CPU 412–3H; (6ES7 412–3HJ14–0AB0)
S7 message functions
The total number of active SFCs on all external chains may be four times more than on one single
chain.
System function blocks (SFB) See instruction list
Number of simultaneously active SFBs per chain
SFB 52 "RDREC" 8
SFB 53 "WRREC" 8
The total number of active SFBs on all external chains may be four times more than on one single
chain.
User program protection Password protection
Access to consistent data in the process image Yes
CiR synchronization time (in stand-alone mode)
Base load 150 ms
Time per I/O byte 40 µs
Dimensions
Mounting dimensions W x H x D (mm) 50 x 290 x 219
Slots required 2
Weight Approx. 0.990 kg
Voltages and currents
Current consumption from the S7-400 bus (5 V Typ. 1.2 A
DC) Max. 1.5 A
Current consumption from S7-400 bus (24 V DC) Total current consumption of the components
The CPU does not consume any current at 24 V, connected to the MPI/DP interfaces, however
it only makes this voltage available on the with a maximum of 150 mA per interface
MPI/DP interface.
Current output to DP interface (5 V DC) Max. 90 mA
Backup current Average 190 µA (up to 40 °C)
Maximum 660 µA
Maximum backup time See Module Specifications Reference Manual,
Section 3.3.
Feed of external backup voltage to the CPU 5 V to 15 V DC
Power loss Typ. 6.0 W
S7-400H
308 System Manual, 12/2010, A5E00267695-07
Technical data
17.2 Technical data of the CPU 414–4H; (6ES7 414–4HM14–0AB0)
Word instructions 45 ns
Fixed-point arithmetic 45 ns
Default From C 0 to C 7
S7 timers 2048
Retentivity, configurable From T 0 to T 2047
S7-400H
System Manual, 12/2010, A5E00267695-07 309
Technical data
17.2 Technical data of the CPU 414–4H; (6ES7 414–4HM14–0AB0)
Blocks
OBs See instruction list
Size Maximum 64 KB
Nesting depth
Per priority class 24
S7-400H
310 System Manual, 12/2010, A5E00267695-07
Technical data
17.2 Technical data of the CPU 414–4H; (6ES7 414–4HM14–0AB0)
Number of DP masters
integrated 2
Resolution 1 ms
Runtime meter 8
Number 0 to 7
Granularity 1 hour
Retentive Yes
S7-400H
System Manual, 12/2010, A5E00267695-07 311
Technical data
17.2 Technical data of the CPU 414–4H; (6ES7 414–4HM14–0AB0)
S7 message functions
Number of stations that can log on for message Maximum 8
functions (e.g. WIN CC or SIMATIC OP)
Block-related messages Yes
Simultaneously active Alarm_S/SQ blocks or Maximum 100
Alarm_D/DQ blocks
Alarm_8 blocks Yes
Number of communication jobs for ALARM_8 Maximum 1200
blocks and blocks for S7 communication
(selectable)
Default 900
Forcing Yes
Variable Inputs/outputs, bit memories, distributed
inputs/outputs
Number of variables Maximum 256
Default 120
Communication
PG/OP communication Yes
Routing Yes
S7 communication Yes
User data per job Maximum 64 KB
S7 basic communication No
Global data communication No
S7-400H
312 System Manual, 12/2010, A5E00267695-07
Technical data
17.2 Technical data of the CPU 414–4H; (6ES7 414–4HM14–0AB0)
S7 message functions
S5-compatible communication Using FC AG_SEND and AG_RECV, max. via 10
CPs 443–1 or 443–5
User data per job Maximum 8 KB
PROFIBUS DP DP master
Routing Yes
S7 communication Yes
S7 basic communication No
Routing Yes
S7 communication Yes
S7 basic communication No
S7-400H
System Manual, 12/2010, A5E00267695-07 313
Technical data
17.2 Technical data of the CPU 414–4H; (6ES7 414–4HM14–0AB0)
S7 message functions
Constant bus cycle time No
SYNC/FREEZE No
Enable/disable DP slaves No
2. interface
Designation of the interface X2
Type of interface integrated
Physics RS 485/Profibus
Isolated Yes
Interface power supply (15 to 30 V DC) Maximum 150 mA
Number of connection resources 16
Functionality
PROFIBUS DP DP master
Routing Yes
S7 communication Yes
S7 basic communication No
SYNC/FREEZE No
Enable/disable DP slaves No
S7-400H
314 System Manual, 12/2010, A5E00267695-07
Technical data
17.2 Technical data of the CPU 414–4H; (6ES7 414–4HM14–0AB0)
S7 message functions
Direct data exchange (slave-to-slave No
communication)
SFC 58 "WR_REC" 8
SFC 55 "WR_PARM" 8
SFC 57 "PARM_MOD" 1
SFC 56 "WR_DPARM" 2
SFC 13 "DPNRM_DG" 8
SFC 51 "RDSYSST" 8
The total number of active SFCs on all external chains may be four times more than on one single
chain.
System function blocks (SFB) See instruction list
S7-400H
System Manual, 12/2010, A5E00267695-07 315
Technical data
17.2 Technical data of the CPU 414–4H; (6ES7 414–4HM14–0AB0)
S7 message functions
Number of simultaneously active SFBs per chain
SFB 52 "RDREC" 8
SFB 53 "WRREC" 8
The total number of active SFBs on all external chains may be four times more than on one single
chain.
User program protection Password protection
Access to consistent data in the process image Yes
CiR synchronization time (in stand-alone mode)
Base load 100 ms
Time per I/O byte 25 µs
Dimensions
Mounting dimensions W x H x D (mm) 50 x 290 x 219
Slots required 2
Weight Approx. 0.995 kg
Voltages and currents
Current consumption from S7–400 bus (5 V DC) Typ. 1.4 A
Max. 1.7 A
Current consumption from S7-400 bus (24 V DC) Total current consumption of the components
The CPU does not consume any current at 24 V, connected to the MPI/DP interfaces, however, a
it only makes this voltage available on the maximum of 150 mA per interface
MPI/DP interface.
Current output to DP interface (5 V DC) Max. 90 mA
Backup current Average 190 µA (up to 40 °C)
Maximum 660 µA
Maximum backup time See Module Specifications Reference Manual,
Section 3.3.
Feed of external backup voltage to the CPU 5 V to 15 V DC
Power loss Typ. 7.0 W
S7-400H
316 System Manual, 12/2010, A5E00267695-07
Technical data
17.3 Technical data of the CPU 417–4H; (6ES7 417–4HT14–0AB0)
Word instructions 18 ns
Fixed-point arithmetic 18 ns
Floating-point arithmetic 54 ns
Default From C 0 to C 7
S7 timers 2048
Retentivity, configurable From T 0 to T 2047
S7-400H
System Manual, 12/2010, A5E00267695-07 317
Technical data
17.3 Technical data of the CPU 417–4H; (6ES7 417–4HT14–0AB0)
Blocks
OBs See instruction list
Size Maximum 64 KB
Nesting depth
Per priority class 24
S7-400H
318 System Manual, 12/2010, A5E00267695-07
Technical data
17.3 Technical data of the CPU 417–4H; (6ES7 417–4HT14–0AB0)
Number of DP masters
integrated 2
Resolution 1 ms
Runtime meter 8
Number 0 to 7
Granularity 1 hour
Retentive Yes
S7-400H
System Manual, 12/2010, A5E00267695-07 319
Technical data
17.3 Technical data of the CPU 417–4H; (6ES7 417–4HT14–0AB0)
Default 1200
Forcing Yes
Variable Inputs/outputs, bit memories, distributed
inputs/outputs
Number of variables Maximum 512
Default 120
Communication
PG/OP communication Yes
Routing Yes
Number of connection resources for S7 64, incl. one each reserved for programming
connections via all interfaces and CPs device and OP
S7 communication Yes
User data per job 64 bytes
S7-400H
320 System Manual, 12/2010, A5E00267695-07
Technical data
17.3 Technical data of the CPU 417–4H; (6ES7 417–4HT14–0AB0)
PROFIBUS DP DP master
Routing Yes
S7 communication Yes
S7 basic communication No
Routing Yes
S7 communication Yes
S7-400H
System Manual, 12/2010, A5E00267695-07 321
Technical data
17.3 Technical data of the CPU 417–4H; (6ES7 417–4HT14–0AB0)
S7 basic communication No
SYNC/FREEZE No
Enable/disable DP slaves No
2. interface
Designation of the interface X2
Type of interface integrated
Physics RS 485/Profibus
Isolated Yes
Interface power supply (15 to 30 V DC) Maximum 150 mA
Number of connection resources 32,
a diagnostic repeater in the chain reduces the
number of connection resources by 1
Functionality
PROFIBUS DP DP master
Routing Yes
S7 communication Yes
S7 basic communication No
S7-400H
322 System Manual, 12/2010, A5E00267695-07
Technical data
17.3 Technical data of the CPU 417–4H; (6ES7 417–4HT14–0AB0)
SYNC/FREEZE No
Enable/disable DP slaves No
SFC 58 "WR_REC" 8
SFC 55 "WR_PARM" 8
SFC 57 "PARM_MOD" 1
SFC 56 "WR_DPARM" 2
SFC 13 "DPNRM_DG" 8
SFC 51 "RDSYSST" 8
S7-400H
System Manual, 12/2010, A5E00267695-07 323
Technical data
17.3 Technical data of the CPU 417–4H; (6ES7 417–4HT14–0AB0)
SFB 53 "WRREC" 8
The total number of active SFBs on all external chains may be four times more than on one single
chain.
User program protection Password protection
Access to consistent data in the process image Yes
CiR synchronization time (in stand-alone mode)
Base load 60 ms
Time per I/O byte 10 µs
Dimensions
Mounting dimensions W x H x D (mm) 50 x 290 x 219
Slots required 2
Weight Approx. 0.995 kg
Voltages and currents
Current consumption from S7–400 bus (5 V DC) Typ. 1.5 A
Max. 1.8 A
Current consumption from S7-400 bus (24 V DC) Total current consumption of the components
The CPU does not consume any current at 24 V, connected to the MPI/DP interfaces, however, a
it only makes this voltage available on the maximum of 150 mA per interface
MPI/DP interface.
Current output to DP interface (5 V DC) Max. 90 mA
Backup current Average 970 µA (up to 40 °C)
Maximum 1980 µA
Maximum backup time See Module Data Reference Manual, section 3.3
Feed of external backup voltage to the CPU 5 V to 15 V DC
Power loss Typ. 7.5 W
S7-400H
324 System Manual, 12/2010, A5E00267695-07
Technical data
17.4 Technical data of memory cards
Data
S7-400H
System Manual, 12/2010, A5E00267695-07 325
Technical data
17.5 Runtimes of the FCs and FBs for redundant I/Os
S7-400H
326 System Manual, 12/2010, A5E00267695-07
Technical data
17.5 Runtimes of the FCs and FBs for redundant I/Os
NOTICE
These are guide values, not absolute values. The actual value may deviate from these
specifications in some cases. This overview is intended as a guide and should help you
estimate how use of the RED_IO library may change the cycle time.
S7-400H
System Manual, 12/2010, A5E00267695-07 327
Technical data
17.5 Runtimes of the FCs and FBs for redundant I/Os
S7-400H
328 System Manual, 12/2010, A5E00267695-07
Characteristic values of redundant automation
systems A
This appendix provides a brief introduction to the characteristic values of redundant
automation systems, and shows the practical effects of redundant configurations, based on a
selection of configurations.
You will find an overview of the MTBF of various SIMATIC products in the SIMATIC FAQ at:
http://support.automation.siemens.com
under entry ID 16818490
Reliability
Reliability refers to the capability of technical equipment to fulfill its function during its
operating period. This is usually no longer the case if any of its components fails.
So a commonly used measure for reliability is the MTBF (Mean Time Between Failure). This
can be analyzed statistically based on the parameters of running systems, or by calculating
the failure rates of the components used.
Reliability of modules
The reliability of SIMATIC components is extremely high as a consequence of extensive
quality assurance measures in design and production.
S7-400H
System Manual, 12/2010, A5E00267695-07 329
Characteristic values of redundant automation systems
A.1 Basic concepts
0'7
4XDOLILHGSHUVRQQHO
'LDJQRVWLFV 5HSDLUVWUDWHJ\
/RJLVWLFV
S7-400H
330 System Manual, 12/2010, A5E00267695-07
Characteristic values of redundant automation systems
A.1 Basic concepts
The figure below shows the parameters included in the calculation of the MTBF of a system.
([SHULHQFH
(UURUPRGHO
6\VWHPHUURU
0'7&&)'&
07%)RIWKH
&RPSRQHQW V\VWHP
FKDUDFWHULVWLFV
0DUNRYPRGHO
0LQLPDO&XW6HW0&6
0&6FODVV
Requirements
This analysis assumes the following conditions:
● The failure rate of all components and all calculations is based on an average
temperature of 40 °C.
● The system installation and configuration is free of errors.
● All replacement parts are available locally, in order to prevent extended repair times due
to missing spare parts. This keeps the component MDT down to a minimum.
● The MDT of individual components is 4 h. The system's MDT is calculated based on the
MDT of the individual components plus the system structure.
● The MTBF of the components conforms to the SN 29500 standard, which corresponds to
MIL–HDBK 217–F.
● The calculations are made using the diagnostic coverage of each component.
● A CCF factor between 0.2% and 2% is assumed, depending on the system configuration.
S7-400H
System Manual, 12/2010, A5E00267695-07 331
Characteristic values of redundant automation systems
A.1 Basic concepts
● Electromagnetic interference
● Electrostatic discharge
● RF interference
● Unexpected sequence of events
● Operating errors
The CCF factor defines the ratio between the probability of the occurrence of a CCF and the
probability of the occurrence of any other error.
Typical CCF factors range from 2% to 0.2% in a system with identical components, and
between 1% and 0.1% in a system containing different components.
Within the range stipulated in IEC 61508, a CCF factor between 0.02% and 5% is used to
calculate the MTBF.
&&)DIIHFWVERWK
(UURURQFKDQQHO FKDQQHOV (UURURQFKDQQHO
Reliability of an S7-400H
The use of redundant modules prolongs the system MTBF by a large factor. The integrated
high-grade self-test and the test/message functions of the S7-400H CPUs enable the
detection and localization of virtually all errors. The calculated diagnostic coverage is around
90%.
The reliability in stand-alone mode is described by the corresponding failure rate. The failure
rate for all S7 components is calculated according to the SN29500 standard.
The reliability in redundant mode is described by the failure rate of the components involved.
This is termed "MTBF" below. Those combinations of failed components which cause a
system failure are described and calculated using Markov models. Calculations of the
system MTBF take account of the diagnostic coverage and the common cause factor.
Availability
Availability is the probability that a system is operable at a given point of time. This can be
enhanced by means of redundancy, for example by using redundant I/O modules or multiple
encoders at the same sampling point. Redundant components are arranged such that
system operability is not affected by the failure of a single component. Here, again, an
important element of availability is a detailed diagnostics display.
The availability of a system is expressed as a percentage. It is defined by the mean time
between failure (MTBF) and the mean time to repair MTTR (MDT). The availability of a two-
channel (1-out-of-2) fault-tolerant system can be calculated using the following formula:
S7-400H
332 System Manual, 12/2010, A5E00267695-07
Characteristic values of redundant automation systems
A.1 Basic concepts
07%) Y
9
07%)Y 0'7
S7-400H
System Manual, 12/2010, A5E00267695-07 333
Characteristic values of redundant automation systems
A.2 Comparison of MTBF for selected configurations
&38+
36$
&38+
&38+
[ILEHURSWLFFDEOHV
S7-400H
334 System Manual, 12/2010, A5E00267695-07
Characteristic values of redundant automation systems
A.2 Comparison of MTBF for selected configurations
36$
&38+
&38+
[ILEHURSWLFFDEOHV
36$
&38+
&38+
(70
,0
S7-400H
System Manual, 12/2010, A5E00267695-07 335
Characteristic values of redundant automation systems
A.2 Comparison of MTBF for selected configurations
36$
&38+
(70 &38+
'3
,0
,0
,0
,0
,0
,0
S7-400H
336 System Manual, 12/2010, A5E00267695-07
Characteristic values of redundant automation systems
A.2 Comparison of MTBF for selected configurations
Summary
There are now several thousand applications of redundant automation systems in the field,
in various configurations. To calculate the MTBF, we assumed an average configuration.
Based on experience in the field, an assumption of MTBF of 3000 hours is 95% reliable.
The system MTBF value calculated is about 230 years for a system configuration with
redundant CPU 417-4H.
S7-400H
System Manual, 12/2010, A5E00267695-07 337
Characteristic values of redundant automation systems
A.2 Comparison of MTBF for selected configurations
S7-400H
338 System Manual, 12/2010, A5E00267695-07
Stand-alone operation B
Overview
This appendix provides the necessary information for you to operate a fault-tolerant CPU
(414-4H or 417-4H) in stand-alone mode. You will learn:
● how stand-alone mode is defined
● when stand-alone mode is required
● what you have to take into account for stand-alone operation
● how the fault tolerance-specific LEDs react
● how to configure stand-alone operation of a fault-tolerant CPU
● how you can expand it to form a fault-tolerant system
The differences from a standard S7-400 CPU that you have to take into account when
configuring and programming the fault-tolerant CPU are given in appendix Differences
between fault-tolerant systems and standard systems (Page 347).
Definition
By stand-alone operation, we mean the use of a fault-tolerant CPU in a standard SIMATIC-
400 station.
Note
The self-test of the fault-tolerant CPU is also performed in stand-alone mode.
S7-400H
System Manual, 12/2010, A5E00267695-07 339
Stand-alone operation
What you have to take into account for stand-alone operation of a fault-tolerant CPU
NOTICE
Although a fault-tolerant CPU has additional functions compared to a standard S7-400 CPU,
it does not support specific functions. So particularly when programming your automation
system, you need to know the CPU on which you are going to run the user program. A user
program written for a standard S7-400 CPU usually will not run on a fault-tolerant CPU in
stand-alone mode without adaptations.
The table below lists the differences between the operation of a fault-tolerant CPU in stand-
alone mode and in redundant mode.
Table B-1 Differences between stand-alone mode and redundant mode
S7-400H
340 System Manual, 12/2010, A5E00267695-07
Stand-alone operation
LED Behavior
REDF Unlit
IFM1F Unlit
IFM2F Unlit
MSTR Lit
RACK0 Lit
RACK1 Unlit
WARNING
You can only expand your system to a fault-tolerant system if you have not assigned any
odd numbers to expansion units in stand-alone mode.
S7-400H
System Manual, 12/2010, A5E00267695-07 341
Stand-alone operation
S7-400H
342 System Manual, 12/2010, A5E00267695-07
Stand-alone operation
03,'3LQWHUIDFHRID&38[RU'3LQWHUIDFHRID
&38[RUH[WHUQDO'3LQWHUIDFHPRGXOH&3
H[W
352),%86'3PDVWHUV\VWHP
68%1(73$PDVWHUV\VWHP
,0
0RGXODU'3 '33$
'3PDVWHU VODYH(70 FRXSOHU
(76RU
(7L6 3$/LQN
3$VODYHILHOG
GHYLFH
Figure B-1 Overview: System structure for system modifications during operation
Note
You can freely combine components which support system modifications during
operation with those that do not. Depending on your selected configuration, there may be
restrictions affecting the components on which you can make system modifications during
operation.
S7-400H
System Manual, 12/2010, A5E00267695-07 343
Stand-alone operation
S7-400H
344 System Manual, 12/2010, A5E00267695-07
Migrating from S5-H to S7-400H C
This appendix will help you to migrate to fault-tolerant S7 systems if you are already familiar
with the fault-tolerant systems of the S5 family.
Basic knowledge of the STEP 7 configuration software is required for converting from the
S5-H to the S7-400H.
Documentation
The following manuals are available to familiarize you with the STEP 7 basic software:
● Configuring hardware and connections in STEP 7
● Programming with STEP 7
Information on the various programming languages is available in the reference manuals
listed below.
● System and standard functions
● STL, LAD, FBD for S7-300/400
The From S5 to S7 manual supports you with details on migration.
S7-400H
System Manual, 12/2010, A5E00267695-07 345
Migrating from S5-H to S7-400H
C.2 Configuration, programming, and diagnostics
Configuration
Configuration was performed in STEP 5 using a dedicated configuration package, such as
COM 155H.
In STEP 7, the fault-tolerant CPUs are configured using the base software. In SIMATIC
Manager, you can create a fault-tolerant station and configure it in HW Config. The special
features of the redundant CPUs are grouped on a small number of tabs. Integration into
networks and configuration of connections is handled with NetPro.
Topic in S5 Equivalent in S7
Error OB 37 Error OBs OB 70 and OB 72
Memory control word SFC 90 "H_CTRL"
Memory status word SSL71
Error block Diagnostic buffer
S7-400H
346 System Manual, 12/2010, A5E00267695-07
Differences between fault-tolerant systems and
standard systems D
When configuring and programming a fault-tolerant automation system with fault-tolerant
CPUs, you must make allowances for a number of differences from the standard S7-400
CPUs. A fault-tolerant CPU has additional functions compared to a standard S7-400 CPU,
on the other hand it does not support specific functions. This has to be taken in account
particularly if you wish to run a program that was created for a standard S7-400 CPU on a
fault-tolerant CPU.
The ways in which the programming of fault-tolerant systems differs from that for standard
systems are summarized below. You will find further differences in appendix Stand-alone
operation (Page 339).
If you use any of the affected calls (OBs and SFCs) in your user program, you will need to
adapt your program accordingly.
S7-400H
System Manual, 12/2010, A5E00267695-07 347
Differences between fault-tolerant systems and standard systems
S7-400H
348 System Manual, 12/2010, A5E00267695-07
Differences between fault-tolerant systems and standard systems
S7-400H
System Manual, 12/2010, A5E00267695-07 349
Differences between fault-tolerant systems and standard systems
See also
System and operating states of the S7–400H (Page 81)
S7-400H
350 System Manual, 12/2010, A5E00267695-07
Function modules and communication processors
supported by the S7-400H E
You can use the following function modules (FMs) and communication processors (CPs) on
an S7-400 automation system:
S7-400H
System Manual, 12/2010, A5E00267695-07 351
Function modules and communication processors supported by the S7-400H
Note
You can use all the FMs and CPs released for the ET 200M with the S7-400H in distributed
and one-sided mode.
S7-400H
352 System Manual, 12/2010, A5E00267695-07
Function modules and communication processors supported by the S7-400H
NOTICE
S7-400H
System Manual, 12/2010, A5E00267695-07 353
Function modules and communication processors supported by the S7-400H
S7-400H
354 System Manual, 12/2010, A5E00267695-07
Connection examples for redundant I/Os F
F.1 SM 321; DI 16 x DC 24 V, 6ES7 321–1BH02–0AA0
The diagram below shows the connection of two redundant encoders to two SM 321; DI 16 x
DC 24 V. The encoders are connected to channel 0.
S7-400H
System Manual, 12/2010, A5E00267695-07 355
Connection examples for redundant I/Os
F.1 SM 321; DI 16 x DC 24 V, 6ES7 321–1BH02–0AA0
1
1
9
S7-400H
356 System Manual, 12/2010, A5E00267695-07
Connection examples for redundant I/Os
F.2 SM 321; DI 32 x DC 24 V, 6ES7 321–1BL00–0AA0
9
9
S7-400H
System Manual, 12/2010, A5E00267695-07 357
Connection examples for redundant I/Os
F.3 SM 321; DI 16 x AC 120/230V, 6ES7 321–1FH00–0AA0
1
9
1
S7-400H
358 System Manual, 12/2010, A5E00267695-07
Connection examples for redundant I/Os
F.4 SM 321; DI 8 x AC 120/230 V, 6ES7 321–1FF01–0AA0
1
9
1
S7-400H
System Manual, 12/2010, A5E00267695-07 359
Connection examples for redundant I/Os
F.5 SM 321; DI 16 x DC 24V, 6ES7 321–7BH00–0AB0
&+
9V
9V
&+
&+
9V
9V
&+
0
9
S7-400H
360 System Manual, 12/2010, A5E00267695-07
Connection examples for redundant I/Os
F.6 SM 321; DI 16 x DC 24V, 6ES7 321–7BH01–0AB0
&+
9V
9V
&+
&+
9V
9V
&+
0
9
S7-400H
System Manual, 12/2010, A5E00267695-07 361
Connection examples for redundant I/Os
F.7 SM 326; DO 10 x DC 24V/2A, 6ES7 326–2BF01–0AB0
9
9 9
9
9 9
S7-400H
362 System Manual, 12/2010, A5E00267695-07
Connection examples for redundant I/Os
F.8 SM 326; DI 8 x NAMUR, 6ES7 326–1RF00–0AB0
9
9
S7-400H
System Manual, 12/2010, A5E00267695-07 363
Connection examples for redundant I/Os
F.9 SM 326; DI 24 x DC 24 V, 6ES7 326–1BK00–0AB0
9 9
9 9
S7-400H
364 System Manual, 12/2010, A5E00267695-07
Connection examples for redundant I/Os
F.10 SM 421; DI 32 x UC 120 V, 6ES7 421–1EL00–0AA0
R
R
R
R
R
R
R
R
1
R
R
R
R
R
98& R
R
R
1
R
R
R
R
R
R
R
R
R
R
R
R
1
R
R
R
R
R
R
R
1 R
R
R R
R R
R R
R
R 1
R
R
R
1
R
R
R
R
R
R
R
R
1
R
R
R
R
R
R
R
R
1
S7-400H
System Manual, 12/2010, A5E00267695-07 365
Connection examples for redundant I/Os
F.11 SM 421; DI 16 x DC 24 V, 6ES7 421–7BH01–0AB0
R
R
R
R
R
R
R
R
R
R
R
R
R
R
R
R
R
R
R
R
9
R
R
S7-400H
366 System Manual, 12/2010, A5E00267695-07
Connection examples for redundant I/Os
F.11 SM 421; DI 16 x DC 24 V, 6ES7 421–7BH01–0AB0
S7-400H
System Manual, 12/2010, A5E00267695-07 367
Connection examples for redundant I/Os
F.12 SM 421; DI 32 x DC 24 V, 6ES7 421–1BL00–0AB0
R
R
R
R
R
9
R
S7-400H
368 System Manual, 12/2010, A5E00267695-07
Connection examples for redundant I/Os
F.13 SM 421; DI 32 x DC 24 V, 6ES7 421–1BL01–0AB0
R
R
R
9
R
S7-400H
System Manual, 12/2010, A5E00267695-07 369
Connection examples for redundant I/Os
F.13 SM 421; DI 32 x DC 24 V, 6ES7 421–1BL01–0AB0
S7-400H
370 System Manual, 12/2010, A5E00267695-07
Connection examples for redundant I/Os
F.14 SM 322; DO 8 x DC 24 V/2 A, 6ES7 322–1BF01–0AA0
/
0
9
0
S7-400H
System Manual, 12/2010, A5E00267695-07 371
Connection examples for redundant I/Os
F.15 SM 322; DO 32 x DC 24 V/0,5 A, 6ES7 322–1BL00–0AA0
/
HJ1
0
/
HJ1
9
0
S7-400H
372 System Manual, 12/2010, A5E00267695-07
Connection examples for redundant I/Os
F.16 SM 322; DO 8 x AC 230 V/2 A, 6ES7 322–1FF01–0AA0
/
1
9
/
1
S7-400H
System Manual, 12/2010, A5E00267695-07 373
Connection examples for redundant I/Os
F.17 SM 322; DO 4 x DC 24 V/10 mA [EEx ib], 6ES7 322–5SD00–0AB0
/
1
HJ1
HJ1
9
S7-400H
374 System Manual, 12/2010, A5E00267695-07
Connection examples for redundant I/Os
F.18 SM 322; DO 4 x DC 15 V/20 mA [EEx ib], 6ES7 322–5RD00–0AB0
/
1
1IRUH[DPSOH
1IRUH[DPSOH
9
S7-400H
System Manual, 12/2010, A5E00267695-07 375
Connection examples for redundant I/Os
F.19 SM 322; DO 8 x DC 24 V/0.5 A, 6ES7 322–8BF00–0AB0
/
0
9
0
S7-400H
376 System Manual, 12/2010, A5E00267695-07
Connection examples for redundant I/Os
F.20 SM 322; DO 16 x DC 24 V/0.5 A, 6ES7 322–8BH01–0AB0
S7-400H
System Manual, 12/2010, A5E00267695-07 377
Connection examples for redundant I/Os
F.21 SM 332; AO 8 x 12 Bit, 6ES7 332–5HF00–0AB0
/
0
9
0
S7-400H
378 System Manual, 12/2010, A5E00267695-07
Connection examples for redundant I/Os
F.22 SM 332; AO 4 x 0/4...20 mA [EEx ib], 6ES7 332–5RD00–0AB0
/
1
9
S7-400H
System Manual, 12/2010, A5E00267695-07 379
Connection examples for redundant I/Os
F.23 SM 422; DO 16 x AC 120/230 V/2 A, 6ES7 422–1FH00–0AA0
R
R
R
R
/
1
R
R
R
9 R
O
1
R
R
R
R
R
/
R
1
R
R
R
/
R
1
R
R
R
R /
R 1
R
O
1
R
R
R
R
/
1
R
R
R
R
/
1
S7-400H
380 System Manual, 12/2010, A5E00267695-07
Connection examples for redundant I/Os
F.24 SM 422; DO 32 x DC 24 V/0.5 A, 6ES7 422–7BL00–0AB0
R
R
HJ1
R
R
R
R
R
R
R
R
R
R
R
R
R
R
R
HJ1
R
R
R
R
R
R
R
R
R
R
R
9
R
R
S7-400H
System Manual, 12/2010, A5E00267695-07 381
Connection examples for redundant I/Os
F.25 SM 331; AI 4 x 15 Bit [EEx ib]; 6ES7 331–7RD00–0AB0
ZLUH
WUDQVGXFHU
P$
0
9
Figure F-25 Example of an interconnection with SM 331, AI 4 x 15 Bit [EEx ib]
S7-400H
382 System Manual, 12/2010, A5E00267695-07
Connection examples for redundant I/Os
F.26 SM 331; AI 8 x 12 Bit, 6ES7 331–7KF02–0AB0
/
0
/
7UDQVGXFHU
9
9
S7-400H
System Manual, 12/2010, A5E00267695-07 383
Connection examples for redundant I/Os
F.27 SM 331; AI 8 x 16 Bit; 6ES7 331–7NF00–0AB0
7UDQVGXFHU
9
9
9
ZLUHWUDQVGXFHU
8+
˖
8+
S7-400H
384 System Manual, 12/2010, A5E00267695-07
Connection examples for redundant I/Os
F.28 SM 331; AI 8 x 16 Bit; 6ES7 331–7NF10–0AB0
ZLUHWUDQVGXFHU
8+
˖ 7UDQVGXFHU
9
9
8+ 9
9
S7-400H
System Manual, 12/2010, A5E00267695-07 385
Connection examples for redundant I/Os
F.29 AI 6xTC 16Bit iso, 6ES7331-7PE10-0AB0
7F
7F
9
S7-400H
386 System Manual, 12/2010, A5E00267695-07
Connection examples for redundant I/Os
F.30 SM331; AI 8 x 0/4...20mA HART, 6ES7 331-7TF01-0AB0
/
0[
9
0[
ZLUH
WUDQVGXFHU
8+
0
8+
/
0[
9
0[
%=;&9
IRUH[DPSOH
The diagram below shows the connection of a 2-wire transmitter to two redundant SM 331;
AI 8 x 0/4...20mA HART.
S7-400H
System Manual, 12/2010, A5E00267695-07 387
Connection examples for redundant I/Os
F.30 SM331; AI 8 x 0/4...20mA HART, 6ES7 331-7TF01-0AB0
/
/
ZLUH
0[ WUDQVGXFHU
9
0[
/
0[
9
0[
%=;&9
IRUH[DPSOH
S7-400H
388 System Manual, 12/2010, A5E00267695-07
Connection examples for redundant I/Os
F.31 SM 332; AO 4 x 12 Bit; 6ES7 332–5HD01–0AB0
/
0
/
0DQD
9
0
S7-400H
System Manual, 12/2010, A5E00267695-07 389
Connection examples for redundant I/Os
F.32 SM332; AO 8 x 0/4...20mA HART, 6ES7 332-8TF01-0AB0
/
&K[
&K[
/
&K[
&K[
9
0
S7-400H
390 System Manual, 12/2010, A5E00267695-07
Connection examples for redundant I/Os
F.33 SM 431; AI 16 x 16 Bit, 6ES7 431–7QH00–0AB0
S7-400H
System Manual, 12/2010, A5E00267695-07 391
Connection examples for redundant I/Os
F.33 SM 431; AI 16 x 16 Bit, 6ES7 431–7QH00–0AB0
S7-400H
392 System Manual, 12/2010, A5E00267695-07
Glossary
1-out-of-2 system
See dual-channel fault-tolerant system
Comparison error
An error that may occur while memories are being compared on a fault-tolerant system.
ERROR-SEARCH
An operating mode of the reserve CPU of a fault-tolerant system in which the CPU performs
a complete self-test.
Fail-safe systems
Fail-safe systems are characterized by the fact that, when certain failures occur, they remain
in a safe state or go directly to another safe state.
Fault-tolerant station
A fault-tolerant station containing two central processing units (master and reserve).
Fault-tolerant system
A fault-tolerant system consists of at least two central processing units (master and reserve).
The user program is processed identically in both the master and reserve CPUs.
Fault-tolerant systems
Fault-tolerant systems are designed to reduce production downtime. Availability can be
enhanced, for example, by means of component redundancy .
I/O, one-sided
We speak of a one-sided I/O when an input/output module can be accessed by only one of
the redundant central processing units. It may be single-channel or multi-channel
(redundant) module.
S7-400H
System Manual, 12/2010, A5E00267695-07 393
Glossary
I/O, redundant
We speak of a redundant I/O when there is more than one input/output module available for
a process signal. It may be connected as one-sided or switched module. Terminology:
"Redundant one-sided I/O" or "Redundant switched I/O"
I/O, single-channel
When there is only one input/output module for a process signal, in contrast to a redundant
I/O, this is known as a single-channel I/O. It may be connected as one-sided or switched
module.
I/O, switched
We speak of a switched I/O when an input/output module can be accessed by all of the
redundant central processing units of a fault-tolerant system. It may be single-channel or
multi-channel (redundant) module.
Link-up
In the link-up system mode of a fault-tolerant system, the master CPU and the reserve CPU
compare the memory configuration and the contents of the load memory. If they establish
differences in the user program, the master CPU updates the user program of the reserve
CPU.
Master CPU
The central processing unit that is the first redundant central processing unit to start up . It
continues to operate as the master when the redundancy connection is lost . The user
program is processed identically in both the master and reserve CPUs.
S7-400H
394 System Manual, 12/2010, A5E00267695-07
Glossary
Redundancy, functional
Redundancy with which the additional technical means are not only constantly in operation
but also involved in the scheduled function. Synonym: active redundancy.
Redundant
In redundant system mode of a fault-tolerant system the central processing units are in RUN
mode and are synchronized over the redundant link.
Redundant link
A link between the central processing units of a fault-tolerant system for synchronization and
the exchange of data .
Redundant systems
Redundant systems are characterized by the fact that important automation system
components are available more than once (redundant). When a redundant component fails,
processing of the program is not interrupted.
Reserve CPU
The redundant central processing unit of a fault-tolerant system that is linked to the master
CPU. It goes to STOP mode when the redundancy connection is lost. The user program is
processed identically in both the master and reserve CPUs.
Self-test
In the case of fault-tolerant CPUs defined self-tests are executed during startup, cyclical
processing and when comparison errors occur. They check the contents and the state of the
CPUs and the I/Os.
Single mode
An H system changes to single mode, when it was configured to be redundant and only one
CPU is in RUN. This CPU is then automatically the master CPU.
Stand-alone operation
Stand-alone mode is the use of a fault-tolerant CPU in a standard SIMATIC-400 station.
Stop
With fault-tolerant systems: In the stop system mode of a fault-tolerant system, the central
processing units of the fault-tolerant system are in STOP mode.
S7-400H
System Manual, 12/2010, A5E00267695-07 395
Glossary
Synchronization module
An interface module for the redundant link in a fault-tolerant system.
Update
In the update system mode of a fault-tolerant system, the master CPU updates the dynamic
data of the reserve CPU.
S7-400H
396 System Manual, 12/2010, A5E00267695-07
Index
Comparison error, 92
Components
Basic system, 26
Duplicating, 21
A
Configuration, 29
A&D Technical Support, 17 Configuration, 29
Address area Configuring, 185
CPU 41xH, 67 Connecting with diodes, 153
Analog output signals, 153 Connection
Applied value, 148 Fault-tolerant S7, 165
Availability S7, 164
Communication, 29 Consistent data, 75
Definition, 332 Consistent data access, 78
I/O, 121 Continued bumpless operation, 83
of plants, 21 CPU
Mode selector, 48
Parameter, 59
B CPU 412-3H
Operator controls and display elements, 37
basic knowledge
CPU 414-4H
Required, 15
Operator controls and display elements, 38
Basic system, 26
CPU 417-4H
Bus connectors, 58
Operator controls and display elements, 38
MPI, 57
CPU 41xH
PROFIBUS DP interface, 58
DP address areas, 67
Bus interruption, 73
DP master: diagnostics with LEDs, 70
Bus topology, 69
CPU redundancy errors, 31
BUSF, 70
CPU-CPU communication, 57
BUSF1, 46
Cycle control
BUSF2, 46
Execution time, 279
Cycle load
Communication via MPI and communication
C
bus, 276
Central processing unit, 26 Cycle time, 274
Change memory type, 251 Elements, 275
Checksum errors, 92 Extending, 276
Cold restart, 51 Cyclic self-test, 93
Operating sequence, 52
Commissioning, 33
Requirements, 33 D
Commissioning the S7-400H, 35
Data consistency, 75
Communication, 29
Determining memory requirements, 55
Communication blocks
SM 321
Consistency, 76
Example of an interconnection,
Communication functions, 104
SM 321
Communication processors, 351
Example of an interconnection,
Communication via MPI and communication bus
SM 321
Cycle load, 276
Example of an interconnection,
S7-400H
System Manual, 12/2010, A5E00267695-07 397
Index
SM 321 EXTF, 46
Example of an interconnection,
Diagnostic address, 73
Diagnostic buffer, 47 F
Diagnostics
Fail-safe, 19
Evaluating, 72
Failure of a CPU, 36
Digital output
Failure of a fiber-optic cable, 36
Fault-tolerant, 147, 153
Failure of a power supply module, 36
Direct current measurement, 151
Failure of a redundancy node, 22
Direct I/O access, 94
Failure of components, 191
Discrepancy
in central and expansion racks, 191
Digital input modules, 144
of distributed I/Os, 202
Discrepancy time, 144, 148
Fault-tolerant, 165
SM 422
Fault-tolerant communication, 164
Example of an interconnection,
Fault-tolerant connections
SM 322
Configuration, 168
Example of an interconnection,
Programming, 168, 175
SM 322
Properties, 168
Example of an interconnection,
Fault-tolerant station, 185
Documentation, 32
Fault-tolerant system
DP interface, 58
Starting, 3535
DP master
FB 450 RED_IN, 134
Diagnostics using LEDs, 70
FB 451 RED_OUT, 134
Diagnostics with STEP 7, 71
FB 452 RED_DIAG, 134
DP master system
FB 453 RED_STATUS, 134
Startup, 68
FC 450 RED_INIT, 134
DPV1, 69
FC 451 RED_DEPA, 134
DPV1 and EN 50170, 69
Fiber-optic cable, 27
DPV1 master, 69
Cable pull-in, 266
DPV1 mode, 69
Installation, 265
DPV1 slaves, 69
Replacement, 198
Selection, 267
Storage, 266
E
Firmware
EN 50170, 69 Updating, 61
Encoders FLASH card, 54
Double redundant, 146 FRCE, 46
Error LEDs Function modules, 351
All CPUs, 46 Functional I/O redundancy, 133
CPU 414-4H, 47
CPU 417-4H, 47
Synchronization module, 263 H
Error messages, 42
Hardware
Execution time
Components, 26
Cycle control, 279
Configuration, 35, 186
Operating system, 279
Setup, 34
Process image update, 277
Hardware interrupt
User program, 276
in the S7-400H system, 94
Expanded memory configuration, 101
Hardware interrupt processing, 297
Expanding the load memory, 53
Hardware interrupt response time
External backup voltage, 40
of signal modules, 297
External diodes, 147
S7-400H
398 System Manual, 12/2010, A5E00267695-07
Index
S7-400H
System Manual, 12/2010, A5E00267695-07 399
Index
S7-400H
400 System Manual, 12/2010, A5E00267695-07
Index
SFB 14, 76 T
SFB 15, 77
Technical data
SFC 103 DP_TOPOL, 69
Memory cards, 325
SFC 109 PROTECT, 49
Technical support, 17
SFC 14 DPRD_DAT, 77
Time monitoring, 108
SFC 15 DPWR_DAT, 77
Time response, 110
SFC 81 UBLKMOV, 75
Time-out, 109
Signal modules for redundancy, 138
Toggle switch, 48
SIMATIC Manager, 190
Tolerance window, 148
Single mode, 88
Tools, 30
Single-bit errors, 93
Single-channel one-sided I/O, 123
Failure, 124
U
Single-channel switched I/O, 125
Failure, 127 Update, 95, 96, 97, 107, 110, 160
Slot for interface modules, 40 Delay, 118
Software Minimum input signal duration, 100
Redundancy, 20 Monitoring times, 160
Stand-alone operation Sequence, 102
Configuring, 341 Time response, 110
Definition, 339 UPDATE, 87
Points to note, 340 Updating online
to a fault-tolerant system, 341 the firmware, 61
Startup modes, 87 Updating the firmware, 61
Startup processing, 87 Usable CPs, 168
Startup time monitoring, 68 User program, 276
Status byte, 155 User program execution time, 276
Status displays
All CPUs, 45
CPU 414-4H, 45 W
CPU 417-4H, 45
Warm restart, 51
Status word, 155
Operating sequence, 51
STOP, 86
Work memory, 105
Subconnection
Writing data consistently to a DP standard slave, 77
Active, 166
Switch to CPU with modified configuration, 105
Switchover to CPU with expanded memory
configuration, 106
Synchronization, 263
Event-driven, 8282
Synchronization module
Function, 261
Replacement, 198
Synchronization modules
Technical data, 263
Synchronization modules, 27
System modifications during operation
Hardware requirements, 343
Software requirements, 343
Stand-alone operation, 342
System states, 84
S7-400H
System Manual, 12/2010, A5E00267695-07 401
Index
S7-400H
402 System Manual, 12/2010, A5E00267695-07