Toshiba T Rad Plus CMT Installation and Service Manual

Model RS-580 Series
“CMT” Ceiling Mounted

Tube Support
Installation and Service Manual
Manual Part No. DC30-019 Revision E

This manual is copyrighted and all rights are reserved. No portion of this document may be copied, pho-
tocopied, reproduced, translated, or reduced to any electronic medium or machine readable form without
prior consent in writing from Quantum Medical Imaging, LLC.
Copyright© 2003 By QMI
Quantum Medical Imaging, LLC

2905 Veterans Memorial Highway
Ronkonkoma, New York 11779 USA
Phone: (631) 567-5800
Fax: (631) 567-5074
Revision History & Contents
REVISION HISTORY
REVISION DATE TYPE OF MODIFICATION
A 12/15/00 Initial Release.
B 9/17/02 Added Trunnion Ring installation sheet, Hi-

Voltage Cable Installation Instructions
C 11/8/02 Added brake adjustment instructions, PS-6,

PS-7 power supply wiring instructions
D 2/6/03 Made operating instructions separte manual
E 5/1/03 Replaced trunnion install procedure, added

parts lists
MANUAL CONTENTS
SECTION 1 3D TOP Ceiling Stand Planning Guide
SECTION 2 3D-TOP Overhead Support Installation Instructions
SECTION 3 Hi Voltage Cable Installation Instructions
SECTION 4 Quantum Medical Imaging CMT RS-580 Interconnection Diagram
SECTION 5 MULTIX TOP Adjustment Instructions
SECTION 6 MULTIX TOP Maintenance Instructions
SECTION 7 Overhead Support 3D TOP Parts Lists
NOTE: The following pages contain planning, installation, startup,

and maintenance instructions for Quantum Medical Imaging LLC’s
“CMT” Ceiling mounted Tube Support (Catalog No. RS-580). Where
applicable, disregard information relating to Siemens Table, Bucky,
Generator and Multileaf collimator. For these items, refer to the
manufacturer’s documentation provided with each component.
i
Revision History & Contents
THIS PAGE INTENTIONALLY LEFT BLANK

Section
1
3D TOP Ceiling Stand

Planning Guide
3D TOP Ceiling Stand
AX
Planning Guide
© S ie m en s AG 1 99 8
The reproduction, transmission or
use of this document or its contents
is not permitted without express
written authority. Offenders will be
liable for damages. All rights,
including rights created by patent
grant or registration of a utility
model _or_ design,_are_ reserved.
English
Print No.: RX22-040.021.01.02.02 Doc. Gen. Date: 01.00
Replaces: RX22-040-021.01.01.02
0-2 Revision
Chapter Page Revision

all all 01
all all 02
3D TOP Ceiling Stand RX22-040.021.01 Page 2 of 4 Siemens AG

Rev. 02 01.00 TD PS 3 Medical Engineering
Contents 0-3
Page
1 _______General Remarks_______________________________________________ 1 - 1
General Remarks . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 - 1
Safety . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 - 2
2 _______Room Planning ________________________________________________ 2 - 1
Dimensions of 3D TOP for MULTIX . . . . . . . . . . . . . . . . . . . . . . . . . . .2 - 1

Useful range of 3D TOP for MULTIX . . . . . . . . . . . . . . . . . . . . . . . . . .2 -3
Useful range of 3D TOP for SIRESKOP SX. . . . . . . . . . . . . . . . . . . . . . .2 -8
Useful range of 3D TOP for SIRESKOP SX. . . . . . . . . . . . . . . . . . . . . . .2 -9
Room planning example of 3D TOP for SIRESKOP SX . . . . . . . . . . . . . . . 2 - 10
Dimensions of SIRESKOP SX, 3D TOP with Tomo Device . . . . . . . . . . . . . . 2 - 11
Dimensions of 3D TOP for SIRESKOP SX . . . . . . . . . . . . . . . . . . . . . . 2 - 12
3 _______Installation Preparation__________________________________________ 3 - 1
Installation Notes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 - 1
Requirements: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 - 1
Fastening: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 - 1
Shortening of the Transverse Bridge: . . . . . . . . . . . . . . . . . . . . . . . . 3 - 1
Ceiling installation for 3D TOP . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 - 2
Requirements for installation of the 3D TOP ceiling stand without structural calculation of
the ceiling subconstruction . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 - 3
Ceiling installation for 3D TOP . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 - 4
Ceiling mounting points . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 - 5
4 _______System Connections ____________________________________________ 4 - 1
Notes on cable run . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .4 -1

Layout of fixpoints . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .4 -2
List of fixed points, Ceiling Stand 3D TOP with Multix. . . . . . . . . . . . . . . . . .4 -3
List of fixed points, Ceiling Stand 3D TOP with SIRESKOP SX . . . . . . . . . . . . .4 -3
List of the fixed points used . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .4 -3
5 _______Technical Data _________________________________________________ 5 - 1
Electrical data . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .5 -1
Weights and heat dissipation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .5 -1
Environmental conditions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .5 -1
Packaging and transport routes . . . . . . . . . . . . . . . . . . . . . . . . . . . .5 -1
Surface colors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .5 -1
Siemens AG RX22-040.021.01 Page 3 of 4 Ceiling stand 3D TOP

Medical Engineering Rev. 02 01.00 TD PS 3
0-4 Contents
Page
6 ______ Transport Specifications_________________________________________6 - 1
7 ______ Changes to Previous Version _____________________________________7 - 1
Ceiling stand 3D TOP RX22-040.021.01 Page 4 of 4 Siemens AG

General Remarks 1 1-1
General Remarks 1
- With distribution of this revision level, all preceding planning guides, Speed Infos (PG’s) and drafts
lose their validity.
- All layouts issued by the Planning Departments must bear a note referring to the installation and
delivery conditions of the Siemens Medical Engineering Group. The installation and delivery
conditions must be submitted with the layouts.
- Unless otherwise specified, all dimensions are indicated in "mm".
- This symbol indicates a change (see revision status).
- Orientation points
Points specific to system components which are referenced when positioning system components
to each other or in the room.
The isocenter of a radiographic system is always designated as the orientation point.
- Fixpoints
Clearly marked points on system components, installation ceiling, walls or floor at which cable
outlets are located.
Illustration in the drawings: circle with letter/number combination.
The cable lengths establish the maximum fixpoint distances and thus the maximum distances
between the individual system components.
- Room height
The room height is the distance measured from the top surface of the floor to the bottom surface of
the ceiling structural elements (Unistrut rails) (bottom surface of drop ceiling).
- Room lighting
According to DIN 68 68-57 (international standard being prepared), the lighting in rooms in which
diagnosis is made on image playback devices (monitors) must meet the following
requrements:
adjustable, no anti-glare screen, reproducible adjustment of lighting (e. g. dimmer with
scale),
no glare or reflection from windows, lights and light boxes in the standard working position of
the monitors.
Hotline + 49 (9191) 18 - 8080

1-2 General Remarks
Safety 1
- The provisions of the relevant fire safety regulations for the premises must be observed.
- The system has been developed according to EN60601 - 1.
- Minimum dimensions (e.g. room heights, safety distances) indicated in the planning guides are
marked "min."
- Basic imperviousness to electromagnetic interference.

Result of lightning discharges.
The protective targets of the various lightning protection areas up to the unit connection are also
specified in the IEC 1024, DIN 48810, VDE 0675 and in the DEMVT recommendations.

Upper edge
Siemens AG
of spacer
Medical Engineering
Telescope
Room Planning
Telescope tube
with 3 m transverse bridge
Transverse carriage
carriage Focus
Focus Support arm
*1
*1
Axis of
rotation
Dimensions of 3D TOP for MULTIX
Multileaf
Rev. 02
Longitudinal rail collimator
01.00
Movement range
RX22-040.021.01
Operator
*1 When configured with a
telescope tube extension
(option), the distance is
TD PS 3
increased by 200 mm
Page 1 of 12
2
Transverse Focus
carriage
Corrugated hose Cable outlet
Movement range
Tomographic
1 : 25 attachment
2
2-1
Ceiling stand 3D TOP

2-2
Upper edge of spacer

Telescope
Telescope tube carriage
Focus Support arm Transverse

Focus
carriage
*1
*1
Dimensions of 3D TOP for MULTIX
*1 When configured with a telescope

Axis of
Rev. 02
Multileaf collimator tube extension (option), the distance is rotation
increased by 200 mm
Longitudinal rail
01.00
RX22-040.021.01
Movement range
Transverse bridge
TD PS 3
Page 2 of 12
Operator Focus Corrugated hose
Cable outlet
1 : 25
Movement range
Siemens AG
2
Medical Engineering
Room Planning
Room Planning 2-3
Useful range of 3D TOP for MULTIX 2
with the 3 m transverse carriage (beam directed towards the Bucky wall stand)
Head end
Rotation point
(+ 154o, - 182o)
Operator
Transverse bridge
Longitudinal rails
Focus
1 : 50
Foot end
Direction of tube assembly for Bucky wall stand
Support arm 0o
Support arm rotated -90o
Support arm rotated 90o
Support arm rotated -180o
NOTICE The tube assembly was rotated in 90o steps in the clockwise direction. Rota-
tion of the tube assembly by 90o in the counterclockwise direction is also pos-
sible.

2-4 Room Planning
with 3 m transverse carriage
Head end
Rotation point
(+ 154o, -182o)
Focus
Transverse bridge
Operator
Longitudinal rails
1 : 50
Foot end
Support arm 0o
Support arm rotated - 90o
sible.

Room Planning 2-5
with the 4 m transverse carriage (beam directed towards the Bucky wall stand)
Head end
Rotation point
(+ 154o, -182o)
Operator
Transverse bridge
Longitudinal rails
Focus
1 : 50
Foot end
Support arm 0o
sible.

2-6 Room Planning
with 4 m transverse carriage
Head end
Rotation point
(+ 154 o, -182o)
Focus
Operator Transverse bridge
Longitudinal rails
1 : 50
Foot end
Support arm 0o
sible.

Room Planning 2-7
Dimensions of 3D TOP for MULTIX 2
with Tomo Device

Tomo device
Longitudinal rails
Tomography range
*1
Transverse Corrugated hose

carriage
Tomographic attachment
Focus
Tomographic angle
(8o, 20o, 30o, 40o)
Tomographic height
Table plane
Film plane Catapult Bucky
1 : 20
*1 When configured with a telescope tube extension (option), the distance is increased by 200 mm
NOTICE The room height of min. 2721 mm (up to top edge of spacer) corresponds to an
average tabletop height of 750 mm and an SID of 1150 mm (telescope tube,
complete)

2-8 Room Planning
Useful range of 3D TOP for SIRESKOP SX 2
for Bucky wall stand

Foot end
Rotation point
(+ 154 o, - 182o)
Focus
Transverse bridge
Operator
Longitudinal rails
Head end 1 : 50

Support arm 0o
NOTICE The tube assembly was rotated in 90o steps in the clockwise direction.
Rotation of the tube assembly by 90o in the counterclockwise direction is also
possible.

Room Planning 2-9
Useful range of 3D TOP for SIRESKOP SX 2
Foot end
Rotation point
o o
(+ 154 , - 182 )
Focus
Operator
1 : 50
Head end
Support arm 0o
NOTICE The tube assembly was rotated in 90o steps in the clockwise direction.
Rotation of the tube assembly by 90o in the counterclockwise direction is also
possible.

2 - 10 Room Planning
Room planning example of 3D TOP for SIRESKOP SX 2
Ceiling mount
Tomo device
Operator
1 : 50

Room Planning 2 - 11
Dimensions of SIRESKOP SX, 3D TOP with Tomo Device 2
Longitudinal rails Tomo device
Tomography range
Transverse carriage
*1

Corrugated
hose Tomographic
attachment
Focus
Tomographic angle
(8o, 20o, 30o, 40o)
Tomographic height
Table plane
Catapult Bucky
Film plane
1 : 20

2 - 12 Room Planning
Dimensions of 3D TOP for SIRESKOP SX 2
with X-Ray tube assembly Hole spacing
Longitudinal rails
Corrugated hose
*1
Corrugated hose
*1
Focus Tomographic
attachment
± 120o
*2
Focus
Axis of rotation *2 With tomo stands: 286 mm

+ 154o
- 182o
Beam direction Longitudinal rails
Beam direction
Tomographic attachment
Focus
Cable control
corrugated hose
1 : 20

Installation Preparation 3 3-1
Installation Notes 3
Requirements: 3
- On-site substructure of Wieland, Schwerter, Unistrut or similar support rails.

- Installation device, Part No. 87 63 872 G2122
- Since the longitudinal rails are part of the preinstallation, they must be ordered in advance (service
contractor).
Fastening: 3
- The standard length of the longitudinal rails is 4250 mm.

- Longitudinal rail extension is possible.
- At least 4 mounting points for each standard longitudinal rail are required.
- Mounting materials for 7 mounting points per rail are included in the shipment.
- Stop spacing (mounting spacing) can be between 675 - 1350 mm.
Shortening of the Transverse Bridge: 3
The transverse bridges for the 3D TOP ceiling stands can be shortened as follows:
Versions for Multix TOP: Versions for Sireskop SX:

1. 3 m transverse bridge without tomo: 1. 3 m transverse bridge without tomo:
User side: 700 mm User side: 700 mm
Wall inlet side: 650 mm Wall inlet side: 650 mm
2. 4 m transverse bridge without tomo: 2. 2.62 m transverse bridge without tomo:

Wall inlet side 750 mm Wall inlet side: 650 mm
3. 3 m transverse bridge with tomo: 3. 3 m transverse bridge with tomo:

4. 4 m transverse bridge with tomo: 4. 2.62 m transverse bridge with tomo:

The dimensions represent the maximum amount that can be shortened on one side and are relative
to the particular rail end. If needed, the length of the corrugated hose must be adapted.

3-2 Installation Preparation
Ceiling installation for 3D TOP 3
Detailed view of the longitudinal rail
On-site sub-
structure
Spacer
Clamping part
M10 screw
1:2
Longitudinal rail
Hole spacing
*1 *1
*1
1:5
The spacing for the 4 m transverse bridge is added in parentheses

*1 Hole spacing

Installation Preparation 3-3
Requirements for installation of the 3D TOP ceiling stand without

structural calculation of the ceiling subconstruction 3
When there is 500 - 800 mm spacing of the mounting points for the subconstruction (e.g. Unistrut rails),
each rail must be able to support a load of at least 7.0 kN.
Each Unistrut mounting point must be able to support a load of at least 5.0 kN.
The longitudinal rails must be positioned as shown in the following sketch.
Longitudinal rail 3D TOP Vertical attachment to the ceiling

≤ 200 mm
675 - 1350 mm
1350 mm
e1=
500 - 800 mm
≥e2 ≥e2 ≥e2 ≥e2
1350 mm
1350 mm
Support profile of subcon-

1450 mm
struction, e.g. Unistrut
The longitudinal rails may not be mounted directly below the Unistrut mounting points.
Example with 4 mounting points per rail, with a stop spacing of 1350 mm and a rail spacing of
100 mm.
e1 [mm] 800 700 600 500
e2 [mm] 220 190 160 140
The load distribution through the rest of the building is not taken into consideration here.
e2 = distance from longitudinal rail to next mounting point for Unistrut rail
ü = Rail overhang

Ceiling installation for 3D TOP 3
*2
*1
*2
*1
Holding loads per mounting point (kN)

With rail overhang (*2) max. 200 mm
Fy 7.0
Fz 2.7
Fx 2.1
CAUTION The fastener materials for 7 mounting points per rail are included in the ship-
ment. Hole spacings (grid) between 675 and 1350 mm are possible, with a rail
overhang (*2) of 80 to 400 mm. At least 4 mounting points are required for each
standard longitudinal rail.
NOTICE The indicated forces include:

the static load forces as well as
the dynamic load forces for a movement speed of up to 0.6 m/s in the Fy
direction.
*1 With rail overhang, observe 150 mm minimum overhang for the rail extension adapter. The exten-
sion must not project into main working area.

Installation Preparation 3-5
Ceiling mounting points 3
Mounting points for the chain hoists to

install the transverse bridge
Mounting points for the chain hoists to 1 : 50

install the telescope carriage
NOTICE An appropriate substructure (preferably Unistrut rails) must be installed. The

chain hoists and eye bolts must be used for the particular subconstruction.

This page intentionally left blank.

System Connections 4 4-1
Notes on cable run 4
Suggested cable run
Cable duct depth 60 mm

if required, deeper at cable crossovers.
Run high voltage and power cables separately from control and video cables
(use shielding if possible).
Make asbolutely sure to:

Avoid cable looping and, as far as possible, crossovers.
• Run cables in separate conduits or closed cable ducts.
• If open cable ducts are used, run the cables separately using metal dividers or similar devices.
Metal dividers
Cable duct

4-2 System Connections
Layout of fixpoints 4
NOTICE To ground the longitudinal rails (head- and foot ends) for the 3D TOP ceiling
stand, a 6 mm2 ground conductor must be provided on-site.

System Connections 4-3
List of fixed points, Ceiling Stand 3D TOP with Multix 4
Cable from to Cable duct Conduit, Minimum Maximum Remark

har- fixed fixed cross- diameter opening in fixed point
ness point point section in inside in mm distance in
mm2
No. inches m
1 C H2 2205 3 42 12 High voltage cable
2 B6 H2 1531 2 35 10
3
4
5
6
7
List of fixed points, Ceiling Stand 3D TOP with SIRESKOP SX 4
Cable from to Cable duct Conduit, Minimum Maximum Remark

har- fixed fixed cross- diameter opening in fixed point
ness point point section in inside in mm distance in
mm2
No. inches m
1 C H2    8 Distributor system
2 A1 H2    8 Distributor system
3
4
5
5
7
List of the fixed points used 4
Fixed Remark
Subsystem
points
A/C Generator cabinet Floor fixed points
B6 MULTIX - Table Floor fixed points
H2 Ceiling Stand Floor fixed points

4-4 System Connections

Technical Data 5 5-1
Electrical data 5
Ceiling stand 3D TOP Power supply

from particular system
Weights and heat dissipation 5
Weight [kg] Heat dissipation [W]

Central electronics  approx. 300
Ceiling stand 3D TOP max. 100
(without tomographic device)
approx. 347
with 4 m transverse bridge approx. 361
2 longitudinal rails (4.25 m) each approx. 26.5 

Transverse track (3 m) approx. 56 
Transverse track (4 m) approx. 70 
Telescope carriage complete approx. 238 
Tomographic device approx. 27 
Environmental conditions 5
Operation Transport Storage

permissible ambient
10° ... 40° C - 20° ... 70° C - 20° ... 70° C
temperature
permissible relative air
20 % ... 75 % 10 % ... 95 % 10 % ... 95 %
humidity
permissible air pressure 700 hPa ... 1060 hPa 500 hPa ... 1060 hPa 500 hPa ... 1060 hPa
Packaging and transport routes 5
largest crate L 1484 x W 1024 x H 1526 mm

heaviest single part approx. 410 kg
minimum door width and min. 820 mm door width
corridor width for transport approx. 940 mm corridor width
Surface colors 5
white textured enamel, Med. surface No. 4146

Primary color
similar RAL gray - white 9002
Combination color medical blue, Med. surface No. 4511

5-2 Technical Data

Transport Specifications 6 6-1
n.a.

6-2 Transport Specifications

Changes to Previous Version 7 7-1
Chapter Page Change

1 1-1 General notes updated
3 3-1 Text added
4 4-2 List of fixed points updated
4 4-3 List of fixed points new
Weight changed;
5 5-1
Ambient conditions updated
Old chapter 7 deleted;
7 7-1/2
7 deleted "Changes to Previous Version" updated

7-2 Changes to Previous Version

Section
2
3D-TOP Overhead
Support Installation
Instructions
3D-TOP Overhead Support
AX
Installation Instructions
Overhead Support 3D-TOP
Manual
Also for:
ICONOS R200
MULTIX TOP
© Sieme ns AG 1997
The reproduction, transmission or use
of this document or its contents is not
permitted without express written au-
thority. Offenders will be liable for dam-
ages. All rights, including rights
created by patent grant or registration
of a utility model or design, are re-
served.
Print No.: RX22-040.031.01.05.02 English

Replaces: RX22-040.031.01.04.02 Doc. Gen. Date: 05.00
2 Table of Contents
1- 0Table of Contents
1 _______ General Informations_____________________________________________ 3
General Information . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3
Safety Notes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3
Tolerances. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3
Product-specific Notes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4
Required Documentation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4
Required Measuring Instruments, Tools and Aidsl . . . . . . . . . . . . . . . . . . . . . . . . . . . 4
Colors Used . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4
Cleaning . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4
Abbreviations Used . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4
2 _______ Installation Procedure ____________________________________________ 5
Installing the Longitudinal Rails. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5

Preparations . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5
Extending the Longitudinal Rails (Option) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6
Installing the Longitudinal Rails on the ceiling. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9
Installing the Middle Position Stop, SID Stops, Rubber Bumper Stops and Cover Panels
. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13
Installing the Transvers Bridge . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16
Shortening the Transverse Bridge . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16
Installing the Lifting Device . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18
Unpacking the Transverse Bridge . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19
Installing the Transverse Bridge in the Longitudinal Rails. . . . . . . . . . . . . . . . . . . . . 21
Removing the Lifting Device . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21
Adjusting the Lateral Guide Bearings . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21
Installing the Telescope . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23
Adjusting the Lateral Guide Bearing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26
Adjusting the Collimator Mounting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28
Functions of the Rotating Flange. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28
With a Fixed Collimator Mounting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28
3 _______ Electrical Connections __________________________________________ 29
Laying the Corrugated Hose . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29

Cabling . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 31
3D-TOP with MULTIX TOP . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 31
3D-TOP with ICONOS R200 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 31
4 _______ Subsequent Installation of the Diamentor Chamber __________________ 32
Installation Procedure . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32
5 _______ Changes to previous Version _____________________________________ 34
3D-TOP Overhead Support RX22-040.031.01.05.02 Page 2 of 34 Siemens AG

05.00 TD SD 21 Medical Engineering
General Informations 3
2-
General Information
1General Informations
This document was originally written in German.
Safety Notes 0
While carrying out all work steps and checks the general safety notes contained in the
system manual must be observed.
Tolerances 0
General tolerances for dimensions per ISO 2768
Limit dimen- over 3 mm over over over over over over

sions for to 6 mm 6 mm to 30 mm to 120 mm 400 mm 1000 mm 2000 mm
nom.dimens. 30 mm 120 mm to to to to
range 400 mm 1000 mm 2000 mm 4000 mm
Admissible ± 0.5 mm ± 1 mm ± 1.5 mm ± 2.5 mm ± 4 mm ± 6 mm ± 8 mm
tolerance
These tolerances apply to all dimensions indicated in the present instructions, if no other
tolerance is stated expressly behind the value.
A tolerance of ± 10 % is permissible for torque values.
Siemens AG RX22-040.031.01.05.02 Page 3 of 34 3D-TOP Overhead Support

Medical Engineering TD SD 21 05.00
4 General Informations
Product-specific Notes 0
Required Documentation 0
• Installation Protocol MULTIX PRO/TOP RXB1-140.039.01...
Required Measuring Instruments, Tools and Aidsl 0
NOTICE All tools, measuring instruments and aids are listed and specified
in the Service Tools Catalogue, with the exception of the "stan-
dard installation tools".
• Standard installation tools

• Hand drill
• Torque wrench, 20-100 Nm 44 30 906 RH090
• Allen wrench set 44 16 814 RH090
• ESD equipment, type 8501-3M 97 02 606 Y3121
• Installation device 87 63 872 G2122
• Spring balance 44 29 122 RH090
Colors Used 0
White Textured enamel 4146

Spray cans 84 27 734 RE999
Paint stick 34 44 403 RE999
Cleaning 0
Before the unit is cleaned, it must in any event be switched off or separated from the
power supply.
Clean the unit only with water or with a hand-warm, diluted aqueous solution, consisting of
water and a household detergent.
Do not use any abrasive cleaning agents or no organic solvents or cleaning agents, such
as washing benzine, alcohol, spot water, etc.
For further information refer to the "Cleaning/Disinfection" operating instructions.
Abbreviations Used 0
ISK = Allen screw

Installation Procedure 5
3-
Installing the Longitudinal Rails
2Installation Procedure
Preparations 0
Fig. 1

6 Installation Procedure
• Take the parts (see Fig. 2 Page: 6) out

of the transport crate of the installation
device (see Fig. 1 Page: 5). The list of
contents with materials packing list can
be found in one of the crates.
Pos:1 2 rail holders with M10x40 Allen
screws
Pos.:2 Drilling template
Pos.:3 Twist drill bit, 12 mm ∅
Pos.:4 3 spacer gauges
Pos.:5 1 gauge
Pos.:6 1 tubing water level
Fig. 2
Extending the Longitudinal Rails (Option) 0
Fig. 3

If needed, the longitudinal rails can be cut using a power saw or a hand saw and after-
wards, butt the two original ends up against one another, i.e., the cut ends should com-
prise the ends of the rails.
NOTICE If the longitudinal rails (see 1/Fig. 3 Page: 6) are cut by hand, use
a carpenter’s square (see 2/Fig. 3 Page: 6) to make a right-angle
line on the rail. Cut approx. 2 to 3 mm into all sides of the rail with
the hand saw so that the saw will have a guide when sawing com-
pletely through the rail. Deburr the cut edges of the rail.
Fig. 4 Fig. 5
Fig. 6 Fig. 7
• Insert an end stop (see 1/Fig. 4 Page: 7) into each of the cut off ends of the longitudinal
rails and secure them in place so they are flush with the ends.
• Use the Allen-head set screws (see 2/Fig. 4 Page: 7) to mark the position of the drill
holes needed; to do this, tighten the set screws to leave a score mark.
• Drill the positions marked (see 1/Fig. 5 Page: 7) with a 7 mm drill bit approx. 5 mm
deep.

• Position the original end of the rail on a stabile base (see Fig. 6 Page: 7), and when do-
ing this, be careful of the position of the profile!
• Mark the dimensions 75 mm and 140 mm on the outside surface of the rail
(see Fig. 6 Page: 7).
• Slide the drilling template (see 1/Fig. 6 Page: 7) into the slot in the rail. (The drilling
template is part of the installation kit).
• Slide the 12 mm drill guide on the drilling template (see 1/Fig. 7 Page: 7) with the help
of the marking aid (see 2/Fig. 7 Page: 7) over the position that was marked (140 mm)
and use the 3 Allen screws to tighten down the drilling template on the rail.
• Drill through the first wall of the rail profile using the 12 mm drill bit.
• After loosening the 3 Allen screws, slide the drilling template over to the second mark
(75 mm), and as described above, tighten the template down on the rail.
Fig. 8 Fig. 9
Fig. 10
• Drill the second hole as described above.

• Clean the rail of any drill shavings.
• Insert the linking piece (see 1/Fig. 8 Page: 8) into the longitudinal rail profile as shown
in (see Fig. 8 Page: 8) until the tip of the Allen-head set screw (see 1/Fig. 9 Page: 8) is
positioned over the first hole (see 2/Fig. 8 Page: 8).

• In this position, tighten the set screw.

- The linking piece will be pressed up.
• Tighten the two other Allen-head set screws (without pointed ends),
(see 2/Fig. 9 Page: 8) through the two 12 mm drill holes (see 3/Fig. 8 Page: 8).
• Position the original end of the second longitudinal rail (see 1/Fig. 10 Page: 8) as
shown in (see Fig. 10 Page: 8); when doing so, pay attention to the position of the rail
profile!
• Mark the dimensions 75 mm and 140 mm on the rail, similar to what was done with the
first rail.
• Drill the holes in the same way as with the first rail.
NOTICE Install the rails on the ceiling in accordance with the following
paragraph. Mounting the rails to the ceiling is done in a similar
manner as the mounting of the linking piece.
Installing the Longitudinal Rails on the ceiling 0
Fig. 11

NOTICE Installation of the mounting elements is shown in

Installing the Rear (Wall-side) Longitudinal Rail

• Take the longitudinal rails out of the wooden crate.
• Determine the outside mounting points of the rear longitudinal rail per the Project Plan
(room plan).
• Insert the Unistrut nuts (see 1/Fig. 11 Page: 9) to install the longitudinal rail holders
(see 2/Fig. 11 Page: 9) in the Unistrut rails (see 3/Fig. 11 Page: 9).
NOTICE These Unistrut nuts are not included in the shipment, they must
be obtained from the customer’s contractor. They must be hard-
ness rating 8.8.
The M10x35 Allen screws in hardness rating 8.8 (included in ship-
ment) must be turned at least 10 mm into the Unistrut nuts (if
needed, use longer Allen screws with hardness rating 8.8).
Fig. 12 Fig. 13
• Loosely install the two longitudinal rail holders (see 1/Fig. 12 Page: 10) at the outside
ends of the rail using two M10x40 Allen screws (see 1/Fig. 13 Page: 10) for each.

• Insert the rear longitudinal rail (see 2/Fig. 12 Page: 10) in the longitudinal rail holders
(see 1/Fig. 12 Page: 10).
NOTICE The overhang X must be the same length on both sides of the rail!
• Straighten the longitudinal rail per the room plan. Hand-tighten the Allen screws
• Insert additional Unistrut nuts into the Unistrut rail according to the number of intended
mounting points (see 3/Fig. 12 Page: 10).
NOTICE At least four mounting points are required for each rail. Materials
for a max. of 7 mounting points are supplied for each rail!
• Insert the plate (see 9/Fig. 11 Page: 9).

• Install the clamping block (see 4/Fig. 11 Page: 9) with a M10x35 screw. To do this, an
Allen wrench attachment (see 5/Fig. 11 Page: 9) must be used.
Installing the Front (Physician’s Side) Longitudinal Rail

• Determine the required distance between the longitudinal rails.
• Remove the two longitudinal rail holders from the rear longitudinal rail and install them
for the front longitudinal rail. Installation of the front longitudinal rail is done in the same
manner as for the rear longitudinal rail.
Adjusting the Spacing of the Rails
*1
Fig. 14 Fig. 15

*1 With the 4 m transverse carriage, the spacer gauges cannot be used (these were
designed only for the 3 m transverse carriage). The space dimensions specified in the
Project Plan must be maintained.
• Take the 3 spacer gauges (see 1/Fig. 14 Page: 11) (see 1/Fig. 15 Page: 11) out of the
installation kit and loosely install them as shown in (see Fig. 14 Page: 11).
• Clamp the spacer gauges to the rear longitudinal rail; when doing this, the end piece
(see 2/Fig. 14 Page: 11) must be up against the rail. For this, lift up the plate
(see 3/Fig. 14 Page: 11) and hand-tighten the screw (see 4/Fig. 14 Page: 11).
• Position the front longitudinal rail until it is also up against the end piece
Aligning the Front Ends of the Longitudinal Rails
Fig. 16
• Place the measuring gauge (see 1/Fig. 16 Page: 12) into the two holes
(see 2/Fig. 16 Page: 12) in the front longitudinal rail and place it diagonally to the rear
longitudinal rail (see Fig. 16 Page: 12). Use a pencil to mark the position of
(see X/Fig. 16 Page: 12).
• In the same manner (see 2, broken line/Fig. 15 Page: 11) place the measuring gauge
crossed over into the holes in the rear longitudinal rail and at the mark X on the front rail.
• The two X dimensions (see Fig. 15 Page: 11) must be equal (tolerance: 2 mm). If need-
ed, reposition the front longitudinal rail accordingly.
• Secure the clamping blocks (see 4/Fig. 11 Page: 9) at the ends of the rails by tighten-
ing the mounting screws (see 6/Fig. 11 Page: 9).
• Remove the longitudinal rail holders (see 2/Fig. 11 Page: 9).
Leveling the Two Longitudinal Rails

• Use the tubing water level to determine the lowest point on the longitudinal rails

• The end mounting points of the rails must be leveled to this point and the difference in
height must be evened out by inserting the supplied shims (1 mm/3 mm),
• Recheck the level of the longitudinal rails with the tubing water level. The difference in
height over a rail length of 4 m may be 2 mm.
• Insert shims under the remaining mounting points.

• Tighten all mounting screws to a torque of 50 Nm.
• Remove the spacer gauges (see 1/Fig. 14 Page: 11).
NOTICE If the longitudinal rails were preinstalled (advanced shipment)

continue here with further installation.
Assembling the Rubber Bumper Stops
Fig. 17
• Loosely install the tab (see 1/Fig. 17 Page: 13) to the housing (see 3/Fig. 17 Page: 13)
with two M6x8 Allen screws (see 2/Fig. 17 Page: 13).
• Insert the rubber bumper (see 4/Fig. 17 Page: 13) into the housing and turn in the two
Allen-head set screws (see 5/Fig. 17 Page: 13) until they are flush with the housing.
Installing the Middle Position Stop, SID Stops, Rubber Bumper Stops and

Cover Panels 0
Part No.: 30 70 906

2
Fig. 18 Fig. 19
• Insert the middle position stop (see 1/Fig. 18 Page: 14) into the front of the longitudinal
rail.
• If a Bucky wall stand is positioned in the table longitudinal axis, additional SID stops
must be inserted.
NOTICE If the Bucky wall stand is positioned in the table transverse axis,
after installation of the transverse bridge is completed, the SID
stops must be inserted into the head-end of the transverse bridge
rail (side on which the brake assembly is located) in a similar
manner (see Fig. 18 Page: 14). For this, a cover the front end of
the transverse bridge must be removed.
• Insert the rubber bumper stops (see 2/Fig. 18 Page: 14) (see 2/Fig. 19 Page: 14) into
the rails at the four ends of the rails and secure them in place by turning the two
Allen-head set screws (see 5/Fig. 17 Page: 13) into the holes provided.
• Attach the 4 plastic covers (see 3/Fig. 18 Page: 14) to the rubber bumper housing
(see 2/Fig. 18 Page: 14) using two M6x10 countersunk Allen-head screws for each.
• Tighten the Allen screws (see 2/Fig. 17 Page: 13).
• Tighten the Allen-head set screws (see 5/Fig. 17 Page: 13).

Ground Wire Connection for the Longitudinal Rails
Fig. 20
• Attach the ground wire (see 1/Fig. 20 Page: 15) at the ends of each of the longitudinal
rails.
NOTICE Remove the protective foil on the longitudinal rails only after the
telescope has been installed.

Installing the Transvers Bridge 0
Shortening the Transverse Bridge 0
If necessary, the transverse carriages of the 3D TOP ceiling stand can be shortened as
follows, see also the Project Plan.
CAUTION The transverse bridge may be shortened to max., see table.

Ï The dimensions represent the maximum amount that can
be shortened at one end and refer to the particular rail
end. if necessary, the length of the corrugated hose can
be adapted.
Versions for the MULTIX TOP:

3 m transverse carriage without tomo: 30 73 009 G6019
Operator’s side: 700 mm
Wall side: 650 mm
4 m transverse carriage without tomo: 30 73 249 G6019
Wall side: 750 mm
3 m transverse carriage with tomo: 30 73 249 G6019
Wall side: 100 mm
4 m transverse carriage with tomo 30 73 017 G6019
Wall side: 200 mm
Fig. 21 Fig. 22

Fig. 23
• Use 2 installation supports, or take the two wooden installation frames

(see 1/Fig. 21 Page: 16) from the packing for the transverse bridge and secure a wood-
en strut (see 2/Fig. 21 Page: 16) on the front with nails to stabilize the installation
frames (see 1/Fig. 21 Page: 16).
• Place the transverse bridge down on the installation support or on the wooden installa-
tion frames.
• Remove the wall-side or operator’s side cover panel (see 1/Fig. 22 Page: 16).
• Remove the rubber bumpers (see 4/Fig. 22 Page: 16) and cover panel.
Only with tomo stands, shorten the cable channel as follows:
- Remove the mounting screws for the cable channel.
- Shorten the cable channel accordingly.
- Reinstall the cable channel; if needed, drill new 3.7 mm diameter mounting holes and
install the cable channel with self-tapping M4 x 12 mm-Z screws.
• Shorten the transverse bridge (see 3/Fig. 22 Page: 16) per the table. For this, mark the
saw-cut location with a square all around (see arrows/Fig. 21 Page: 16).
• Make an initial cut approx. 3 mm using a hand saw on all four surfaces so that the saw
will later have a guide when making the cut through.
• Deburr the cut surfaces.
• Transfer the holes for the rubber bumpers from the cut end (see Fig. 23 Page: 17) and
drill the two 7.0 mm dia. holes approx. 7-8 mm deep.
• Reinstall the rubber bumpers and cover panel.
• Shorten the operator’s side in the same manner.

Installing the Lifting Device 0
Fig. 24 Fig. 25
NOTICE In (see Fig. 24 Page: 18) shows the mounting materials for the lift-
ing device.
• Assemble the squared 1045 mm rails (see 1/Fig. 24 Page: 18)

(see 1/Fig. 25 Page: 18) and the two squared 1450 mm rails (see 2/Fig. 24 Page: 18)
(see 2/Fig. 25 Page: 18) using two M10x100 Allen screws, washers, nuts (in accesso-
ry pack) (see 7/Fig. 24 Page: 18) together. Position the rails so that the two passage
holes are located at (see 5/Fig. 25 Page: 18).
• Install the eye bolt (see 3/Fig. 24 Page: 18) (see 3/Fig. 25 Page: 18) on the rail using
one M10x50 Allen screw (see 1/Fig. 25 Page: 18).
• Place the four supports (see 4, 5/Fig. 24 Page: 18) (see 4, 5/Fig. 25 Page: 18) as
shown in (see Fig. 25 Page: 18) over the two rails (see 2/Fig. 25 Page: 18).
• Attach the U-rail (see 2/Fig. 25 Page: 18) using one M8x80 Allen screw, contact wash-
er, washer and nut on each rail (see 6/Fig. 25 Page: 18).
• Install the two front supports(see 5/Fig. 25 Page: 18) using two M8x20 Allen screws,
contact washers, washers and nuts for each to the U-rail (see 6/Fig. 25 Page: 18). The
two rear supports (see 4/Fig. 25 Page: 18) do not get installed.
• Attach the two eye bolts (see 3a/Fig. 24 Page: 18) (see 3a/Fig. 25 Page: 18) to the
rails (see 2/Fig. 25 Page: 18) using one M10x50 Allen screw for each.

Unpacking the Transverse Bridge 0
Fig. 26 Fig. 27
• Remove the lid on the crate.

• Pull the nails (see arrow/Fig. 26 Page: 19) out of the installation frame from the outside.
• Take out the two small wooden frames (see 1/Fig. 26 Page: 19), at the front, remove
the two boards (see 2/Fig. 26 Page: 19) and attach them to the two small wooden
frames (see 1/Fig. 26 Page: 19) with nails (see 2/Fig. 27 Page: 19).
• Place the two wooden frames (see 1/Fig. 27 Page: 19) at the installation location un-
der the longitudinal rails (see Fig. 27 Page: 19).
• With two persons, place the transverse bridge down (see 4/Fig. 27 Page: 19) on the
wooden frames (see 1/Fig. 27 Page: 19) so that the brake assembly
(see 6/Fig. 27 Page: 19) is positioned at the front (operator’s side) of the unit.
• Place the lifting device (see 3/Fig. 27 Page: 19) from below on the transverse bridge
(see 4/Fig. 27 Page: 19) and attach it using eight M8x20 Allen screws, washers at
(see 5/Fig. 27 Page: 19). The Unistrut nuts are located in the rail profiles in the trans-
verse bridge.

Fig. 28 Fig. 29
Fig. 30
• Place 1 Unistrut nut each at the 3 mounting points for the chain hoists per the dimen-
sions given in(see Fig. 28 Page: 20), then turn in the eye bolts (see 1/Fig. 28 Page: 20)
and tighten them.
• Hook on the 3 chain hoists (see 8/Fig. 24 Page: 18) into the eye bolts
• Place the hooks for the chain hoists into the eye bolts on the lifting device
• The four roller bearings (see 2/Fig. 29 Page: 20) must be pushed in (direction of arrow).
• Set the brake assembly back (see 1/Fig. 30 Page: 20) to a distance of 115 mm as
shown in (see Fig. 30 Page: 20) and secure it in place.

Installing the Transverse Bridge in the Longitudinal Rails 0
Fig. 31 Fig. 32
• With two persons, evenly raise the transverse bridge; when doing this, use the supplied
gloves.
NOTICE When raising the transverse bridge, make sure that the brake
assembly does not get damaged!
• Raise the transverse bridge so that the lateral guide bearings (see 1/Fig. 31 Page: 21)
can be inserted into the longitudinal rail profile (see 2/Fig. 31 Page: 21) and the 4 roller
bearings (see 3/Fig. 31 Page: 21) can be in-serted into the rail profiles.

In this position, tighten the set screws (see 4/Fig. 31 Page: 21) to a torque of 25 Nm.
Removing the Lifting Device 0
• Remove the eight M8x20 Allen screws from the lifting device (see 5/Fig. 27 Page: 19),
move the parts (see 1/Fig. 32 Page: 21) to the middle so that the lifting device can be
lowered.
• Lower the lifting device and unhook the chain hoists.
• Remove the left chain hoist (see 2/Fig. 32 Page: 21) with the eye bolt.
Adjusting the Lateral Guide Bearings 0
• Loosen the set screws (see 5/Fig. 31 Page: 21).

• Using a 5 mm Allen wrench from below (see 6/Fig. 31 Page: 21), adjust the two eccen-
tric bearings (see 1/Fig. 31 Page: 21) through the aluminum profile so that the two
bearings are just touching the outside surface of the longitudinal rail. When doing this,
make sure that the eccentric bearings are not pushed up
• Retighten the set screws (see 5/Fig. 31 Page: 21).

• Carry out this adjustment for both eccentric bearings.
Fig. 33
• Extend the two chain hoists (see 3/Fig. 32 Page: 21) and position the transverse bridge
under the two chain hoist hooks.
• Position the two chain hoist hangers (see eye bolts, 1/Fig. 33 Page: 22) 85 cm apart
and centered to the transverse bridge opening and secure them in place
• Hook the two chain hoists between the rails of the transverse bridge again.

Installing the Telescope 0
Fig. 34 Fig. 35
• Unpack the telescope and position it under the transverse bridge so that the operating
handle(see 1/Fig. 34 Page: 23) in facing in the direction of the operator’s side.
• Remove the top carton (see 2/Fig. 34 Page: 23) containing the telescope cables and
place the contents down on the floor. Remove the carton with the telescope cover pan-
els from the pallet.
• Remove the wooden frame (see 3/Fig. 34 Page: 23).
• Remove the support strut (see 4/Fig. 34 Page: 23).
NOTICE All other support struts must remain installed to assure stability!
• Remove the packing around the collimator.

• Remove the protective cap (see 1/Fig. 35 Page: 23).
• Remove the three red transport safety devices (see 2/Fig. 35 Page: 23) from the colli-
mator.
• Lightly lubricate the tube assembly flange with the Longtime PD2 (from the accessory
pack) which is included in the shipment.

Fig. 36 Fig. 37
• Mount the collimator on the flange of the tube assembly (see Fig. 36 Page: 24); when
doing this, actuate the middle position lever (see 1/Fig. 36 Page: 24).
CAUTION Observe the further work steps!

Ï When inserting the collimator, do not place strain on the
cables or kink them. Under no circumstances should
other parts of the transport carriage be removed.
• Remove the four hex screws (see 2/Fig. 37 Page: 24).

• Hook the chain hoists onto the transport carriage (see 1/Fig. 37 Page: 24) and pull up
the slack on the chains.
• Slightly raise the telescope and remove the pallet.

Fig. 38 Fig. 39
• Raise the telescope and insert it into the transverse bridge.

• Insert the 3 roller bearings (see 1/Fig. 39 Page: 25) into the guide rail
• Insert the 4 roller bearings (see 3/Fig. 39 Page: 25) into the guide rail of the transverse
bridge all the way to stop

• And tighten the 4 set screws (see 4/Fig. 39 Page: 25) to a torque of 13 Nm.
• Remove the two chain hoists with the eye bolts.
• Remove the cross support (see 1/Fig. 38 Page: 25) from the transport carriage.
• Remove the two transport carriage parts (see 2/Fig. 38 Page: 25) from the telescope
(see 3/Fig. 38 Page: 25) and take them away.

2
1
2
2
Fig. 40 Fig. 41
• Unlatch the stop (see 1/Fig. 40 Page: 26).

• Loosen the 4 Allen screws on the brake assembly (see 2/Fig. 40 Page: 26).
Adjusting the Lateral Guide Bearing 0
• Loosen the set screw (see 1/Fig. 41 Page: 26) on the middle guide bearing.
• Using a 5 mm Allen wrench (see 2/Fig. 41 Page: 26) from below, adjust the eccentric
bearing (see 3/Fig. 41 Page: 26) so that the contact surface of the longitudinal rail is
just touched.
• Retighten the set screw.
Fig. 42 Fig. 43

Trunnion Ring Installation
(Model RS-580 Overhead Tubecrane)
1. Remove back cover from Tube Fork and slide the cover back on the shaft (see Figure 1).
REMOVE TWO (2) ALLEN

SCREWS FROM BACK
COVER
Figure 1. Removing Back Cover
2. Remove Metal Plate and discard plate. (See Figure 2.)
3.
Figure 2. Fork Cable Plate
4. Position Trunnion Rings on the Tube Fork with the flat part of the Trunnion Rings towards
the bottom (see Figure 3). Screw in the Trunnion Bracket from the rear using the four (4)
Allen screws (see Figure 3). Verify the Trunnion Rings are lying flat on the Tube Fork
and tighten the four (4) black Allen screws.
ALLEN SCREWS (4X)
FLAT SURFACE
Figure 3. Trunnion Rings (Side View)
5. With Trunnion Rings installed, place the tube in the Trunnion Rings. Before clamping the
tube down, tilt the tube up slightly to install the High Voltage cables. (See Figure 4.)
Figure 4. X-ray Tube and High Voltage Cable

6. Once the High Voltage cable are installed, level the tube. Clamp the tube down using the
top half of the Trunnion rings and tighten screws. (See Figure 5.)
Figure 5. Clamping Tube Down
7. Install Tube cover; be careful not to pinch front panel wires when installing cover. (See
Figure 6.)
Figure 6. Tube Cover Installed

WARNING Risk of accident in a service situation!

Ï If only the two side plates (see 1/Fig. 42 Page: 26)
(see 1/Fig. 43 Page: 26) are used to lower the telescope,
for safety reasons the threaded stud
(see 2/Fig. 42 Page: 26)(see 2/Fig. 43 Page: 26) abso-
lutely must be installed.

Adjusting the Collimator Mounting 0
Functions of the Rotating Flange 0
Fig. 44
• Tighten one of the 3 screws (see 1/Fig. 44 Page: 28) so that the collimator just cannot
be turned any more.
• Hook a spring balance (100 N) to the lever of the rotating flange,
• Loosen this screw again so that the collimator can turn when a force of 20 - 30 N is ap-
plied to the spring balance.
• Tighten one of the other two screws to 40 - 50 N as described previously and tighten the
3rd screw to 60 - 70 N using the spring balance.
With a Fixed Collimator Mounting 0
• Tighten one of the 3 screws (see 1/Fig. 44 Page: 28) so that the collimator just cannot
be turned any more.
• Loosen this screw again by 1/2 turn.
• Repeat this procedure with another screw.
• Tighten the 3rd screw so that the collimator just cannot be turned any more.
• Tighten the 1st and 2nd screw the 1/2 turn back again.
NOTICE Pertains only to the manual collimator G052G:

If only “inch” cassette formats are used by the customer, so
place the “inch format” scale adhesive label over the “cm format”
scale.
The original adhesive label is not removed!

Electrical Connections 29
4-
Laying the Corrugated Hose
3Electrical Connections
5 1
370
2
M4
6
4 3
Special case: 4 m Rails
Fig. 45
• Lay out the corrugated hose so there are no kinks in it and attach it at (see 1,
2/Fig. 45 Page: 29) to the Unistrut nut using two M8 x 20 Allen screws and lock wash-
ers for each; the Unistrut nuts are located in the rail profile in the transverse bridge.
• Lay the cables (see 3/Fig. 45 Page: 29) to the M4 brake assembly in the cable channel
• Connect the M4.X1 cables (see 5/Fig. 45 Page: 29).
• Attach the ground wire (see 6/Fig. 45 Page: 29).

30 Electrical Connections
• Secure the cables with cable ties.

Contact
surface, seiling
Contact
surface wall
Fig. 46
• Attach the corrugated hose coming from the ceiling stand to the wall or to the ceiling per
the project plans as shown in (see Fig. 46 Page: 30). To do this:
- Attach the holder (see 1/Fig. 46 Page: 30) to the wall or ceiling;
- Attach the corrugated hose to the holder using the corrugated hose holder
(see 2/Fig. 46 Page: 30);
- Place on the cover panel (see 3/Fig. 46 Page: 30);
- Secure the cover panel with 2 screws (see 4/Fig. 46 Page: 30).
• Lay the cables to the generator and to the table per the system cabling plan and the ca-
ble table.

Electrical Connections 31
Cabling 0
3D-TOP with MULTIX TOP 0
Diamentor -> Generator

Tube assembly ground wire-> Generator
Öl pressure switch -> Generator
X86 power supply -> Generator
3D TOP manual X58 park position / safety circuit -> Generator
X99 Tube selection -> Generator
6 mm2 -> Generator
3D-TOP with ICONOS R200 0
Diamentor -> Generator

Tube assembly ground wire -> Generator
Oil pressure switch (D160.X62) -> Generator
M2.X86 power supply -> Generator1
3D-TOP manual D25.X58 Parkposition / safety circuit -> Generator2
X99 Tube selection -> Generator
6o ye/gn -> Generator
1. Central electronics in the generator cabinet

2. Via the central electronics (generator) to the basuc unit

32 Subsequent Installation of the Diamentor Chamber
5-
Installation Procedure
4Subsequent Installation of the Diamentor Chamber
Fig. 47 Fig. 48
• Pivot the tube assembly.

• Remove the 4 countersunk Allen screws (see 1/Fig. 47 Page: 32).
• Carefully remove the cover panel (see 2/Fig. 47 Page: 32) towards the front (cover
panel is attached with rivets).
• Remove the plexiglass panel (cross hairs) (see 3/Fig. 47 Page: 32).
• Insert the Diamentor chamber (see 1/Fig. 48 Page: 32) in the collimator as shown in
(see Fig. 48 Page: 32) (cable outlet, top right).
• Reinsert the plexiglass panel (see 3/Fig. 47 Page: 32).
• Press the cover panel (see 2/Fig. 47 Page: 32) with the rivets through the plexiglass
panel (factory adjusted).
• Install the cover panel using four M3x8 Allen screws (see 1/Fig. 47 Page: 32).

Subsequent Installation of the Diamentor Chamber 33
Fig. 49 Fig. 50
• Remove the rubber grommet (see 1/Fig. 49 Page: 33) from the cable and the pull the
cable completely through the outlet (see 2/Fig. 49 Page: 33).
• Pivot the tube assembly.
• Remove the cover panel (see 1/Fig. 50 Page: 33) (two M4x10 paneling screws).
• Remove the cable holder (see 2/Fig. 50 Page: 33) (two M6x16 Allen screws).
• Remove the tube assembly housing (see 3/Fig. 50 Page: 33) (two M4x18 paneling
screws). Swing out the cover panel towards the front and secure it.
• Connect the Diamentor cable to the cable already pulled through the corrugated hose
and securely stow it in the empty area.
• Reinstall the tube assembly housing (see 3/Fig. 50 Page: 33), cable holder
(see 2/Fig. 50 Page: 33) and cover panel (see 1/Fig. 50 Page: 33).
NOTICE When turning the collimator, make sure that the collimator can be
turned easily. The cables may not be stretched!

34 Changes to previous Version
6- 5Changes to previous Version
Chapter: “Installation Procedure”

Section ”Installing the Trans-
verse Bridge”: Shortening the Transverse Bridge added.
Chapter: “Electrical Connections”

Section “Cabling”: Text for ICONOS R200 updated.
Section “Cabling”: Text for ICONOS R200 updated.

RS-580 CABLE INTERCONNECTION
1. Connect plug X-86 into connector P86 on PS-6 or PS-7 Power Supply Box (see figure below) provided with the RS-580 Overhead Tube
Crane. Power Supply PS-6 provides +30 VDC for operation of the Overhead Tube Crane’s locks in addition to 24 VAC power for the
collimator; Power Supply PS-7 provides +30 VDC for operation of the Overhead Tube Crane’s locks.
2. The Rotor Cable contains three black wires that are marked “0” for MAIN, “1” for PHASE and “3” for COMMON at both ends of the cable
drape. Also, a ground wire is provided at the tube end of the drape.
3. The Collimator Cable is located under the tube cover. It is marked “24 VAC Collimator Power Supply” and is used for a manual collimator.
When using an automatic collimator, the collimator cable must be routed either through the corrugated cable tubing, or secured along the
outside of the corrugated cable tubing.
4. No other cables are required to interface with Quantum products.
PS-6 POWER SUPPLY WIRING DIAGRAM

PS-7 POWER SUPPLY WIRING DIAGRAM
Section
3
High Voltage Cable

RH 098-5DF6 071
X-Ray Diagnostic System
AX
Titel der
High voltage
Unterlage
cable hier
RH 098-5DF6
eintragen 071
© Siem ens A G 1 996

Register 3 English
Print No.: RX0-000.031.01.03.02 Doc. Gen. Date: 06.97
Replaces: RX0-000.031.01.02.02
0-2 Revision

0 all 02
1 all 02
2 all 01
0 all 03
1 all 03
2 all 02
X-Ray Diagnostic System Register 3 RX0-000.031.01 Page 2 of 4 Siemens AG

Rev. 03 06.97 TD AX 1 Medical Engineering
Contents 0-3
Page
1 _______High-voltage cable RH 098-5DF6 071 ______________________________ 1 - 1
Prerequisites . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1 - 1
Validity . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1-1
Abbreviations . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1-1
Insulating material permissible . . . . . . . . . . . . . . . . . . . . . . . . . . .1-1
Identification . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1-2
Making HV plug connections . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1-4
Inserting the HV plug into the tube assembly . . . . . . . . . . . . . . . . . . . . . .1-5
Insertion with corona disks . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1-5
Inserting the HV plug onto the HV generator . . . . . . . . . . . . . . . . . . . . . .1-6
Insertion with transformer oil. . . . . . . . . . . . . . . . . . . . . . . . . . . . .1-6
2 _______Changes to previous version _____________________________________ 2 - 1
Siemens AG Register 3 RX0-000.031.01 Page 3 of 4 X-Ray Diagnostic System

Medical Engineering Rev. 03 06.97 TD AX 1
0-4 Contents

High-voltage cable RH 098-5DF6 071 1 1-1
Prerequisites 1
Validity 1
These instructions are valid only for 3-core high-voltage cables RH 098 with the high-volt-
age conductor "SIEMENS 5DF6 071" in connection with the Siemens 0 receptacles.
Valid part numbers:
44 66 389 RH 098 4m
44 66 397 RH 098 6m
44 66 405 RH 098 8m
44 66 413 RH 098 10 m
44 66 421 RH 098 12 m
44 66 439 RH 098 14 m
44 66 447 RH 098 16 m
44 66 454 RH 098 18 m
44 66 462 RH 098 20 m
44 66 470 RH 098 22 m
44 66 488 RH 098 24 m
44 66 496 RH 098 26 m
44 66 371 RV 098 .. m-goods
Max. operating voltage = 75 kV DC

For the assembly is needed in addition:
1 allen-key 2 mm
Abbreviations 1
HV = high-voltage
Insulating material permissible 1
Corona disk, 3 pole 17 86 508 R4176

Seal 17 86 995 R4176
Silicone oil (AK 350) 17 87 035 R4176
Transformer oil accord.
to RA0-000.076.18.01..
e.g. Transformer oil 1l 44 10 023 RV090
Transformer oil 20 l 16 97 432 R1151
Cooling oil 20 l 73 84 860 R1151
The permissible oils are mineral oils.

They are rated as water polluting and shall be disposed
by a qualified waste disposal enterprise !

1-2 High-voltage cable RH 098-5DF6 071
Identification 1
Accessories pack
Fig. 1
11 Union
2 setscrews (M4 x 6)
12 2 half-shells
with screws
13 Gasket 17 86 995 R4176
14 Corona disk 17 86 508 R4176
15 Silicone oil (AK 350) 17 87 035 R4176

High-voltage cable RH 098-5DF6 071 1-3
HV cable
Fig. 2
21 HV conductor
22 HV plug
23 Kink protection
HV plug
Fig. 3
31 Insulating piece
32 Nose
33 Plug bottom
34 Contact pins
35 Sealing surface
36 Plug flange

Making HV plug connections 1
The following items have to be observed in order to

guarantee permanent faultless function:
• Observe the sequence of the work steps.
• Use only specified materials and undamaged parts.
• Make sure that the plugs, the receptacles and also the insulating materials,
auxiliary equipment and tools are clean.
• Do not touch the insulating pieces with your bare hands.
Sweat on the hands can cause spark-overs.
• For cleaning use only a clean and soft cloth free of fluff.
• Remove heavy dirt with undenatured ethyl alcohol and dry the plug connections.
• Check the HV plugs and receptacles for cracks and scorching.
Use intact insulating pieces only.
• Do not mix the silicone oil and the transformer oil.
• Use the "Corona disk" only if the margin of 3 mm on the bottom
of the socket (sealing surface) is not damaged.
A plug with a damaged sealing surface must only be used on the HV generator with
transformer oil.
• The silicone oil allows the corona disk and the sealing ring to swell up,
thus guaranteeing that the plug connection is protected against humidity.
If the plug connections are removed again after a longer period of operation
(after 8 days), the corona disk and the silicone sealing ring have to be renewed.
• In the case of high-voltage generators with receptacles in a vertical operating position,
use only transformer oil without corona disk and sealing ring.
• Do not use transformer oil for X-ray tube assemblies.
• When inserting the plugs, the slot and the nose have to be located opposite one another.
WARNING When using force, it is possible that, due to the tolerances, the
plug - turned by 120°- can be inserted into the receptacle despite
the slot and the nose.
When installing the high-voltage cables pay attention

to the minimal bending radius !
At a single permanent installation r ≥ 24 mm

At a fixed installation r ≥ 100 mm
At a free installation r ≥ 165 mm

High-voltage cable RH 098-5DF6 071 1-5
Inserting the HV plug into the tub assembly 1
Fig. 4
Insertion with corona disks 1
• Push the union (Fig. 4/11) over the plug, the thread points to the plug.
• Attach the half-shells over the flange (Fig. 3/36)
with the slot close to the limit stop.
Observe the installation direction, no height adjustment possible!
• Fasten the screw on the half-shells even at both sides (max. 1Nm).
The shielding braid is connected to the ground via the tightened clamp,
important for functioning!
• Clean the insulating piece (Fig. 3/31) on the plug, do not touch with your bare hands.
• Pull the gasket (Fig. 4/13) over the plug up to the flange.
• Moisten the corona disk (Fig. 4/14) generously with silicone oil (Fig. 1/15)
on both sides and push it over the plug contacts.
• Insert the HV plug - pay attention to the nose (Fig. 3/32) and the slot -
into the receptacle until the contact pins are engaged.
• Tighten the union manually by holding the HV cable so that it does not get twisted.
• Tighten both setscrews with the allen key
until slight counter-pressure (max. 1Nm) occurs.
Locking element!
The upper edge of the setscrew may be turned only max. 2mm
from the surface of the union (Fig. 4/11).
If no counter-pressure occurs, turn back the setscrew
until the upper edge is flush with surface of the union.

Inserting the HV plug onto the HV generator 1
Insertion with transformer oil 1
In the case of HV generators with HV receptacles in vertical position,

the HV plugs are inserted with transformer oil without corona disk and sealing.
If the HV receptacles are not in a vertical or variable position,
the HV plugs are inserted the same way as into the tube assembly, see page 1-6.
• Check the oil level and, if necessary, fill it up.
Minimum oil level without inserted plug = 5 mm or 5 ml.
• Push the union (Fig. 4/11) over the plug, the thread points to the plug.
• Attach the half-shells over the flange (Fig. 3/36)
with the slot close to the limit stop.
Observe the installation direction, no height adjustment possible!
• Fasten the screw on the half-shells even at both sides (max. 1Nm).
The shielding braid is connected to the ground via the tightened clamp,
important for functioning!
• Clean the insulating piece (Fig. 3/31) on the plug, do not touch with your bare hands.
• Insert the HV plug - pay attention to the nose (Fig. 3/32) and the slot -
into the respectable until the contact pins are engaged.
• When the plug is inserted, the oil level must reach at least up to half the height
of the insulating piece and max. up to the upper edge of the plug flange.
• Tighten the union manually by holding the HV cable so that it does not get twisted.
• Tighten both setscrews with the allen key
until slight counter-pressure (max. 1Nm) occurs.
Locking element!
The upper edge of the setscrew may be turned only max. 2mm
from the surface of the union (Fig. 4/11).
If no counter-pressure occurs, turn back the setscrew
until the upper edge is flush with surface of the union.

Changes to previous version 2 2-1
Chapter 0: Revision page and Table of Contents have been updated.
Chapter 1: Page 4: Bending radius changed; wrong: ≤ ; o.k.: ≥
Chapter 2: "’Changes to previous version" has been added.

2-2 Changes to previous version
TD AX 4 / Link
TD AX 1 / Kern R.

Section
4
Quantum Medical
Imaging CMT RS-580-
Interconnection Diagrams
WIRING DIAGRAM FOR RS-580 (CMT) TUBECRANE
(MODIFIED SIEMENS 3D TOP CEILING STAND WITH PS-6 POWER SUPPLY)
TELESCOPIC
110 VAC CMT PS-6 POWER SUPPLY (SEE NOTE)
NOTE: CARRIAGE
TELESCOPIC BRAKE
PS-6 POWER SUPPLY X-3
24VAC 30VDC IS COMPATIBLE FOR USE WITH
POWER POWER
SUPPLY SUPPLY QUANTUM OVERHEAD TUBE
CRANE CONFIGURED WITH M-1
MANUAL COLLIMATOR
(QUANTUM P/N R40-MC) TRANSVERSE LOCKS
X-1
CMT PS-6 POWER SUPPLY SPECS.
POWER INPUT: 110-120 VAC, 4A, 50/60 HZ

POWER OUTPUT: 24 VAC, 250W
10
1
2
3
4
5
6
7
8
9
+30 VDC, 100W (120W MOM.)
10
1
2
3
4
5
6
7
8
X86 9
24V COM
24V COM
30V RTN
30V RTN
24VAC
24VAC
+30V
+30V
WHITE
BROWN COLLIMATOR
BLUE QMI P/N R40-MC
RED
TELESCOPIC TUBE SUPPORT ARM

BROWN
WHITE
CARRIAGE
BLUE
M-4
RED
M-1
12
11 SWIVEL & ROTARY BRAKES HANDGRIPS
10
9 X-1 X-2
8 X-1
7 M-4
D14X6 6 LONGITUDINAL LOCKS
5
4 X-1
3
2
1
X-3
X-4
X-1
X-10 X-20 X-5

WIRING DIAGRAM FOR RS-580 (CMT) TUBECRANE
(SIEMENS 3D TOP CEILING STAND WITH PS-7 POWER SUPPLY)
NOTE:
PS-7 POWER SUPPLY IS COMPATIBLE TELESCOPIC
110 VAC CMT PS-7 POWER SUPPLY FOR USE WITH CMT OVERHEAD
INPUT TUBE CRANE CONFIGURED WITH CARRIAGE
POWER INPUT: 110-120 VAC, 4A, 50/60 HZ TELESCOPIC BRAKE
POWER OUTPUT: +30 VDC, 100W (120W MOM.) MANUAL COLLIMATOR(QUANTUM X-3
P/N R40-M-P). THE 24 VAC SUPPLY
30VDC IS FROM THE GENERATOR.
POWER
SUPPLY M-1
GENERATOR
TB1
TRANSVERSE LOCKS
3 3
BLACK 2 2 24 VAC
RED POWER X-1
1 1 OUTPUT
P86
1
2
3
4
5
6
7
8
9
10
1
2
3
4
5
6
7
8
9
10
X86
24V COM
24V COM
30V RTN
30V RTN
24VAC
24VAC
+30V
+30V
WHITE
BROWN COLLIMATOR
BLUE QMI P/N R40-MC
RED
TELESCOPIC TUBE SUPPORT ARM

BROWN
CARRIAGE
WHITE
M-4
BLUE
RED
M-1
12
11 SWIVEL & ROTARY BRAKES HANDGRIPS
10
9 X-1 X-2
8 X-1
7 M-4
D14X6 6 LONGITUDINAL LOCKS
5
4 X-1
3
2
1
X-3
X-4
X-1
X-10 X-20 X-5
09 8 7 6 5 4 3 2
Section
5
MULTIX TOP
Adjustment Instructions
MULTIX TOP
AX
Also Applicable for VERTIX Solitaire
Service
Adjustment Instructions
© Sie mens AG 1998

English
Print No.: RXB1-150.071.01.06.02 Doc. Gen. Date: 07.01
Replaces: RXB1-150.071.01.05.02
0-2 Revision
all all 01
all all 02
all all 03
all all 04
all all 05
all all 06
Document revision level

The document corresponds to the version/revision level effective at the time of system
delivery. Revisions to hardcopy documentation are not automatically distributed.
Please contact your local Siemens office to order current revision levels.
Disclaimer
The installation and service of equipment described herein is to be performed by qualified
personnel who are employed by Siemens or one of its affiliates or who are otherwise
authorized by Siemens or one of its affiliates to provide such services.
Assemblers and other persons who are not employed by or otherwise directly affiliated
with or authorized by Siemens or one of its affiliates are directed to contact one of the
local offices of Siemens or one of its affiliates before attempting installation or service
procedures.
MULTIX TOP RXB1-150.071.01 Page 2 of 6 Siemens AG

Service Rev. 06 07.01 TD SD 21 Medical Solutions
Contents 0-3
Page
1 _______Requirements/Remarks _________________________________________ 1 - 1
Manufacturer’s Note . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1- 1

Safety Information . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1- 1
Protection against Laser Radiation . . . . . . . . . . . . . . . . . . . . . . . . . . .1-1
Tolerances . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1-1
Maximum Torque Values (Table) . . . . . . . . . . . . . . . . . . . . . . . . . . . .1-2
Required Test Equipment, Tools and Aids. . . . . . . . . . . . . . . . . . . . . . . .1- 3
Text Emphasis . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1- 4
Abbreviations Used . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1- 4
Remark Regarding Working with the SSW . . . . . . . . . . . . . . . . . . . . . . .1-4
Definition of Terms for Cassettes and for Radiation . . . . . . . . . . . . . . . . . . .1-5
Information Regarding the VERTIX Solitaire . . . . . . . . . . . . . . . . . . . . . .1-5
Special Symbols. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1- 6
2 _______Ceiling Stand __________________________________________________ 2 - 1
Height Guide Bearings . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2- 1

M4 Transverse Bridge Lateral Guide Bearings . . . . . . . . . . . . . . . . . . . . .2-2
M1 Telescope Carriage Lateral Guide Bearings. . . . . . . . . . . . . . . . . . . . .2-2
Longitudinal Carriage . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2- 3
Stops, Longitudinal (SID) and Tomo Centering . . . . . . . . . . . . . . . . . . .2-3
Stops, Transverse (SID) and Tomo Centering . . . . . . . . . . . . . . . . . . .2-4
Adjusting the Longitudinal Brake Assembly Stops . . . . . . . . . . . . . . . . . . .2-5
Adjustment for the 3 D-TOP ACSS / 3 D-TOP-ACSS P . . . . . . . . . . . . . . .2-5
Adjustment for the 3 D-TOP manual. . . . . . . . . . . . . . . . . . . . . . . . .2- 7
Adjusting the Transverse Brake Assembly . . . . . . . . . . . . . . . . . . . . .2-8
Adjustment for the 3 D-TOP ACSS / 3 D-TOP-ACSS P . . . . . . . . . . . . . . .2-8
Adjustment for the 3 D-TOP manual. . . . . . . . . . . . . . . . . . . . . . . . .2- 9
Checking the Braking Force in the Longitudinal and Transverse Directions . . . . . 2 - 10
Pre-adjustment of the Brake Assembly (old Version) . . . . . . . . . . . . . . . . . 2 - 11
Definitions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 - 13
S42/43 Safety Limit Switches (with Tomo only) . . . . . . . . . . . . . . . . . . . . 2 - 14
R40 ACSS Sensor, Longitudinal . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 - 15
R16 ACSS Sensor, Transverse . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 - 15
M1 Telescope Carriage . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 - 16
Adjustment of Potentiometer R10 . . . . . . . . . . . . . . . . . . . . . . . . . 2 - 16
Adjustment of the SG10 Absolute Value Sensor . . . . . . . . . . . . . . . . . 2 - 17
Adjusting the Y13 Lift Brake . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 - 17
Adjusting the Weight Compensation with the Extension Spring . . . . . . . . . . 2 - 17
Adjusting the Telescope Sections . . . . . . . . . . . . . . . . . . . . . . . . . 2 - 18
Adjusting the Vertical Reference SID for the 3 D TOP ACSS / ACSS P . . . . . 2 - 19
Adjusting the Vertical Reference SID for the 3 D TOP manual . . . . . . . . . . 2 - 20
Adjusting the M3 Support Arm . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 - 21
Adjusting the Rotation Brake for the Tube Unit . . . . . . . . . . . . . . . . . . 2 - 21
Leveling the Support Arm . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 - 21
DVA Stop . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 - 22
Siemens AG RXB1-150.071.01 Page 3 of 6 MULTIX TOP

Medical Solutions Rev. 06 07.01 TD SD 21 Service
0-4 Contents
Page
DHA Stop . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2 - 23
Adjusting the R30 Potentiometer for Tube Unit Rotation . . . . . . . . . . . . . .2 - 24
Fine Adjustment of the Angle Display . . . . . . . . . . . . . . . . . . . . . . .2 - 24
Rotation Origin and R31 Potentiometer . . . . . . . . . . . . . . . . . . . . . .2 - 25
Adjusting the Central Beam . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2 - 26
Checking and Adjusting the Central Beam in the Transverse Direction . . . . . .2 - 26
Checking and Adjusting the Central Beam in the Longitudinal Direction . . . . . .2 - 27
Adjusting the Collimator / Focus-near Plates . . . . . . . . . . . . . . . . . . . .2 - 28
Adjusting the Collimator with the Rotation Flange . . . . . . . . . . . . . . . . .2 - 29
Adjusting the Collimator without the Rotation Flange. . . . . . . . . . . . . . . .2 - 29
Adjusting the Middle Position of the Rotation Flange . . . . . . . . . . . . . . . .2 - 29
Adjusting the Time Switch for the Collimator Light Localizer . . . . . . . . . . . .2 - 30
Changing the Format Size (for ACSS only). . . . . . . . . . . . . . . . . . . . .2 - 30
Programming the Collimator Display (for ACSS only) . . . . . . . . . . . . . . .2 - 30
Checking and Adjusting the Radiation Field to the Light Field . . . . . . . . . . .2 - 31
Checking and Adjusting Format Collimation by Hand . . . . . . . . . . . . . . .2 - 31
Checking the Lamp Voltage in the Collimator . . . . . . . . . . . . . . . . . . . . .2 - 33
Adjusting the Laser Light Localizer . . . . . . . . . . . . . . . . . . . . . . . . .2 - 36
Adjusting the Tomo Drive (with the Tomo Version only) . . . . . . . . . . . . . . . .2 - 37
3 ______ Table _________________________________________________________3 - 1
Patient Table . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-1

Longitudinal Roller Bearings . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-2
Bucky Longitudinal Drive (for Tomo Version only) . . . . . . . . . . . . . . . . . . . 3-3
Adjusting the S111, S112 Safety Limit Switches . . . . . . . . . . . . . . . . . . 3-3
R11 Potentiometer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-3
Adjusting the Toothed Belt Tension . . . . . . . . . . . . . . . . . . . . . . . . 3-4
Lift Drive . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-5
Manually Adjusting the Lift Drive . . . . . . . . . . . . . . . . . . . . . . . . . . 3-5
Adjusting the R10 Lift Potentiometer . . . . . . . . . . . . . . . . . . . . . . . . 3-6
S10/S11 Safety Limit Switches for the Lift Drive . . . . . . . . . . . . . . . . . . 3-6
Adjusting the Pinion Rack for Lift Sensing (R10 Potentiometer) . . . . . . . . . . 3-7
Adjusting the R10 Lift Potentiometer (with pinion rack; ACSS/ACSS P) . . . . . . 3-7
Adjusting the S10/S11 Safety Limit Switches for the Lift Drive
(with pinion rack; ACSS/ACSS P) . . . . . . . . . . . . . . . . . . . . . . . . . 3-8
Adjusting the R10 Lift Potentiometer and S10/S11 Safety Limit Switches . . . . . 3-9
Adjusting the Table Lift Guide . . . . . . . . . . . . . . . . . . . . . . . . . . .3 - 10
Bucky . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 - 11
General Settings . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .3 - 11
Grid Blurring . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .3 - 12
Grid Drive . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .3 - 13
Checking the Safety Circuit. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .3 - 14
Tabletop Brakes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .3 - 15
Adjustment of the Air Gap . . . . . . . . . . . . . . . . . . . . . . . . . . . . .3 - 15
Programming the Table Key Type (except for TOP man. with D55) . . . . . . . .3 - 15
Programming the Table Key Type for TOP man. . . . . . . . . . . . . . . . . . .3 - 16
Programming the Buzzer Status with a Floating Tabletop . . . . . . . . . . . . . . .3 - 16

Service Rev. 06 07.01 TD SD 21 Medical Engineering
Contents 0-5
Page
Setting a Customer-specific Table Lift Stop Position . . . . . . . . . . . . . . . . . 3 - 16
Setting a Customer-specific Table Lift Stop Position . . . . . . . . . . . . . . . . . 3 - 17
Tomo Device (for Versions with Tomo only) . . . . . . . . . . . . . . . . . . . . . . 3 - 18
Adjustment of the Tomo Device . . . . . . . . . . . . . . . . . . . . . . . . . . 3 - 18
Adjustment of the Catapult Bucky Center . . . . . . . . . . . . . . . . . . . . . 3 - 18
Adjustment of Stand - Center of Table . . . . . . . . . . . . . . . . . . . . . . 3 - 18
Test Conditions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 - 19
Brief Description of the Test . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 - 19
Description of the Tomo Test Block . . . . . . . . . . . . . . . . . . . . . . . . . . 3 - 20
Test Procedures . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 - 22
Evaluation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 - 23
Accuracy of the Tomo Height Display . . . . . . . . . . . . . . . . . . . . . . . 3 - 23
Adjustment of the Tomo Height . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 - 23
Programming in the Service PC beginning with SSW VB01A . . . . . . . . . . . 3 - 23
Optical Resolution Power . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 - 24
Tomo Figure and Even Movement of the Tomo Device . . . . . . . . . . . . . . 3 - 24
Overall Evaluation of the Tomo Device . . . . . . . . . . . . . . . . . . . . . . . . 3 - 25
Form and Movement of the Tomo Figure . . . . . . . . . . . . . . . . . . . . . 3 - 25
Evenness of Blurring. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 - 26
Tomo Symmetry . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 - 27
Adjusting the Tomo Height Light Localizer (Option with Tomo Versions) . . . . . . . 3 - 28
4 _______VERTIX PRO/TOP ______________________________________________ 4 - 1
R1 Potentiometer (VERTIX TOP only) . . . . . . . . . . . . . . . . . . . . . . . . .4- 1

Adjusting the Stop for the 0° Bucky Position (VERTIX TOP only). . . . . . . . . . . .4- 2
Adjusting Switches S3 / S2 for the 0° / 90° Bucky Position . . . . . . . . . . . . . . .4- 2
Catapult Bucky 0°/ 90° Tilt Brake . . . . . . . . . . . . . . . . . . . . . . . . . . . .4- 2
Stand Carriage Brake, vertical . . . . . . . . . . . . . . . . . . . . . . . . . . . . .4-3
Replacing the Vertical Brake, cpl. . . . . . . . . . . . . . . . . . . . . . . . . . .4- 3
Replacing the Brake Cable . . . . . . . . . . . . . . . . . . . . . . . . . . . . .4- 3
Adjusting the Vertical Brake . . . . . . . . . . . . . . . . . . . . . . . . . . . . .4- 4
VERTIX TOP Weight Compensation . . . . . . . . . . . . . . . . . . . . . . . . . .4-5
VERTIX PRO Compensation Weight . . . . . . . . . . . . . . . . . . . . . . . . . .4-6
Replacing the Support Cable . . . . . . . . . . . . . . . . . . . . . . . . . . . .4- 9
Bucky . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 - 10
General Adjustments . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 - 10
Grid Blur . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 - 11
Grid Drive . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 - 12
5 _______Changes to Previous Version_____________________________________ 5 - 1

0-6 Contents

Service Rev. 06 07.01 TD SD 21 Medical Engineering
Requirements/Remarks 1 1-1
Manufacturer’s Note 1
This document was originally published in German.
Safety Information 1
When carrying out the work steps and checks, the product-specific safety information
contained in this document, as well as the general safety information must be observed.
Protection against Laser Radiation 1
• This system contains a Class 2 laser.

• When working on the laser light localizer, do not look directly into the laser beam.
• See also ARTD, Part 2 “Laser Radiation”.
Tolerances 1
General tolerances for linear dimensions per ISO 2768
Tolerance over over over over over over over

limit for 3 mm 6 mm 30 mm 120 mm 400 mm 1000 mm 2000 mm
nominal to to to to to to to
dimension 6 mm 30 mm 120 mm 400 mm 1000 mm 2000 mm 4000 mm
range
Admissible ± 0.5 mm ± 1 mm ± 1.5 mm ± 2.5 mm ± 4 mm ± 6 mm ± 8 mm
tolerance
These tolerances ally for dimensions listed in these instructions, as long as no other toler-
ance is expressly listed after the value.

1-2 Requirements/Remarks
Maximum Torque Values (Table) 1
Nominal thread Screw material Steel per DIN 267 Brass

diameter CuZn
alloy
Hardness rating 4.6 4.8 5.8 8.8 10.9 12.9
M3 0.5 0.67 0.83 1.3 1.9 2.2 0.62
M 3.5 0.76 1.0 1.3 2.0 2.8 3.4 0.95
M4 1.1 1.5 1.9 3.0 4.2 5.1 1.4
M5 2.2 3.0 3.7 6.0 8.4 10.1 2.8
M6 3.8 5.1 6.4 10.2 14.4 17.3 4.8
M8 9.5 12.6 15.8 25.3 35.6 42.7 11.9
M 10 18.7 24.8 31.1 49.8 70.0 84.0 23.3
M 12 32.9 43.8 54.8 87.6 123.3 147.9 41.1
When checking threaded connections, use the corresponding torque values for hardness
rating 8.8.
A tolerance of ± 10% is admissible for torque values.

Requirements/Remarks 1-3
Required Test Equipment, Tools and Aids 1
NOTICE All tools, test equipment and aids, with the exception of the "stan-
dard installation tool kit" are listed and specified in the Service
Tools Catalogue.
• Standard installation tool kit

• Open-end wrench, 4 mm
• Spring balance, 5 N 44 29 106 NH 029
• Spring balance, 200 N 44 15 113 RH 090
• Spring balance, 100 N 44 29 122 RH 090
• ESD equipment, Type 8501 - 3M 97 02 606 Y 3121
• Digital multimeter,
e.g.: Fluke 8060 A 97 02 101 Y4290
• KV measuring chamber 96 60 754 RE999
• Memory oscilloscope, Fluke 3390A 99 00 861 RE999
• Ground wire test instrument 44 15 899 RV090
• Service PC
• Spirit level (accuracy: 1 mm per meter)
• Space gauge (DIN 2275) 52 12 667 F1608
• Copper filter set (10 pcs., 0.3 mm) 44 06 120 RV090
• Pin-hole collimator 72 52 067 G2080
• Tomo block 44 06 054 RV090
• Torque wrench 1/4" (3-20 Nm) 34 24 553
• Torque wrench 20-100 Nm 44 30 906 RH090

Text Emphasis 1
WARNING All texts labeled with “WARNING” are intended to call attention to
potential risk to health or life.
CAUTION All texts labeled with “CAUTION” contain information regarding

risks and measures to avoid danger.
NOTICE All texts labeled with “NOTICE” contain additional information

about the work step that follows, and which provides a better
understanding of the work step or a warning about unnecessary
and avoidable difficulties.
CAUTION Checks or adjustments that must be performed with radiation

switched on are labeled with the radiation warning symbol .
While performing such adjustments, radiation protective clothing
must be worn.
Abbreviations Used 1
SID = Source-to-image distance

DVM = Digital voltmeter
DHA = Rotation around the horizontal axis
DVA = Rotation around the vertical axis
SPC = Service PC
SSW = Service Software
Remark Regarding Working with the SSW 1
Many adjustments are performed using the SSW. A help text is available for the individual
input masks. Explanations about the individual adjustment steps are listed in the help
texts.
Select Help text: “F1” key
Quit Help text: “Esc” key

Requirements/Remarks 1-5
Definition of Terms for Cassettes and for Radiation 1
The terms ”length” and ”width” used, as well as insertion of cassettes should be under-
stood as illustrated in the sketch:
Length
Tabletop
24 cm x 30 cm cassette
*1
Width
30 cm x 24 cm cassette
Patient
*1 This digit always
indicates the width!
Information Regarding the VERTIX Solitaire 1
This system is comprised of the 3D TOP manual, central unit and a VERTIX PRO or
VERTIX TOP components.

Special Symbols 1
- Symbol for working with radiation.
- Symbol for working with dangerous voltage.
- Symbol for torque value.
- Symbol for working with laser radiation.

Ceiling Stand 2 2-1
3 1
Fig. 1
Height Guide Bearings 2
• Slightly loosen the set screws (3/Fig. 1) for the roller bearings.
• Adjust the height guide bearing (1/Fig. 1) using the threaded rod (2/Fig. 1).
• Counter the threaded rod (2/Fig. 1).
• It must be just possible to still turn the height guide bearing (1/Fig. 1) by hand over the
entire movement path.
• Tighten the set screw (3/Fig. 1) to a torque of 20 Nm.
• Adjust the other 3 height guide bearings in the same way.

2-2 Ceiling Stand
1 2
2
Fig. 2 Fig. 3
M4 Transverse Bridge Lateral Guide Bearings 2
• Loosen the set screws (1/Fig. 2).

• Using an Allen wrench (5 mm) from below (2/Fig. 2) through the aluminum rail, adjust the
two eccentric bearings (3/Fig. 2) so that both bearings are just touching the outside
surface of the longitudinal rail (4/Fig. 2). When doing this, make sure that the eccentric
bearing does not get pushed up.
• Retighten the set screws (1/Fig. 2).
• Carry out this adjustment on both eccentric bearings.
M1 Telescope Carriage Lateral Guide Bearings 2
• Loosen the set screw (1/Fig. 3) on the middle guide bearing.

• Using an Allen wrench (5 mm) (2/Fig. 3) from below, adjust the eccentric bearing
(3/Fig. 3) so that the contact surface of the longitudinal rail is just touched.
• Retighten the set screw.

Ceiling Stand 2-3
1 2
1
Transverse rail Longitudinal rail

2
3 4 5
Fig. 4 Fig. 5
Longitudinal Carriage 2
NOTICE The single slot (4/Fig. 5) in the template is used to adjust the table
transverse direction, the double slot (5/Fig. 5) is used to adjust
the table longitudinal direction.
The opening (3/Fig. 5) is placed over the roller bearings of the
telescope and of the transverse bridge (adjustment of the middle
position).
Stops, Longitudinal (SID) and Tomo Centering 2
• Move the Bucky into the middle position.

• Switch on the light localizer.
• Move the telescope longitudinally, press the key, and center on the mark on the
handgrip on the cassette tray.
• Place the template (1/Fig. 4) at a right angle over the roller bearing of the telescope
(2/Fig. 4).
• Use a pencil to make a mark on the rail, see Fig. 4.
• Move the transverse carriage approx. 1 m to the side.
• Position the template in the rail as shown in Fig. 5, line up the double slot (5/Fig. 5) and
push the stop detent (2/Fig. 5) up against the template.
• Secure the stop detent in place with the two Allen-head set screws.
Torque: 10 Nm
• Remove the template.
• Move the telescope into the stop detent, press the key.
• Switch on the light localizer in the collimator.
• The light localizer must line up with the mark on the handgrip of the cassette tray.

2-4 Ceiling Stand
2 1 2
1
Fig. 6 Fig. 7
Stops, Transverse (SID) and Tomo Centering 2
• Place the template (1/Fig. 6) at a right angle over the roller bearing (user side, left) of the
telescope (2/Fig. 6).
• Use a pencil to make a mark on the rail (see Fig. 6).
• Move the telescope approx. 1 m to the side.
• Position the template so that the single slot (1/Fig.7) is lined up with the mark as shown in
Fig. 7 and push the stop detent (2/Fig. 7) up against the template as shown in Fig. 7.
• Secure the stop detent in place with the two Allen-head set screws.
Torque: 10 Nm
• Move the telescope into the stop detent, press the key.
• Switch on the light localizer in the collimator.
• The light localizer must line up with the center mark on the tabletop.

RS-580 BRAKE ADJUSTMENT PROCEDURE
When adjusting the Longitudinal Brake on the RS-580 Overhead Tube crane, proceed as follows:
Set DIP Switch S4-8 to ON position.
1. Squeeze the brake pad in toward the magnet.
2. Slide the Brake Assembly to the rail until it just touches the rail.
3. Tighten the four screws.
4. Set DIP Switch S4-8 to OFF position.
When adjusting the Transverse Brake on the RS-580 Overhead Tube crane, perform same
procedure as above using DIP Switch S4-7 instead of DIP Switch S4-8.
DIP Switch S4 Settings:
DIP SWITCH SETTING FUNCTION

S4-1 ON No detent activity when using the ALL LOCK
switches on the Hand Grips
S4-2 ON Activate the transverse detent (For service only, do
not use for longer than 15 minutes at a time)
S4-3 ON Activate longitudinal detent (For service only, do not
use for longer than 15 minutes at a time)
S4-4 ON Release brake for tube vertical movement (For
service only, do not use for longer than 15 minutes at
a time)
S4-5 ON Release vertical axis tube rotation brake (For service
only, do not use for longer than 15 minutes at a time)
S4-6 ON Release horizontal axis tube rotation brake (For
a time)
S4-7 ON Release brake for tube transverse movement (For
a time)
S4-8 ON Release brake for tube longitudinal movement (For
a time)
After all adjustments are finished, leave S4-1 in ON position and set S4-2 through S4-8 to OFF
position.
NOTE: If using a Quantum Model QT-750 Radiographic Table, make sure

Jumper X-16 is installed on pins 1 and 2 on Circuit Board D13.
Ceiling Stand 2-5
X1
1 2 2 10
1 9
1 8 X71
ON
OFF X70
S4
V171
V55
3 V54
V56
Fig. 8 Fig. 9
Adjusting the Longitudinal Brake Assembly Stops 2
• Loosen the 4 Allen screws on the brake assembly (1,3 /Fig. 8) (front longitudinal rail).
Adjustment for the 3 D-TOP ACSS / 3 D-TOP-ACSS P 2
• Adjustment of the longitudinal brake is carried out using the SSW. To do this, select the
following routine per the SSW:
- Menu: Adjustment, Calibration
- Function groups: Stand
- Adjustments: Releasing the Stand Brakes
- Brake: Longitudinal
• Insert the template (2/Fig. 8) between the brake and the rail.
• Press the brake by hand in the direction of the arrow (arrow/Fig. 8) up against the
template until the magnet audibly pulls in.When doing this, make sure the mounting plate
for the brake assembly is pulled in evenly (may not twist) and both brake linings are flat
and even against the rail.

2-6 Ceiling Stand
Fig. 10 Fig. 11
• Pre-tension the brake assembly using the tensioning aid (1/Fig. 10) as shown in
Fig. 10; when doing this, make sure that a short-circuit does not occur on the soldering
terminal (1/Fig. 11) and that no wires get damaged.
- Pre-tension the brake assembly only so far that the feeler gauge can be removed
again.
• In this position, secure the brake assembly with the 4 Allen screws (1,3/Fig. 8). When
doing this, first tighten the two mounting screws (1/Fig. 8) and then the screws
(3/Fig. 8).
A torque of 10 Nm applies for all screws.
• Remove the tensioning aid and adjustment gauge, then deactivate the brake assembly.
• Conclude the adjustment of the longitudinal brake in the SSW (Cancel).

Ceiling Stand 2-7
Adjustment for the 3 D-TOP manual 2
• On the D13 board (ceiling stand) set the S4.8 Dip switch (1/Fig. 9) to the up position.
➪ LED v51 goes on.
• Insert the template (2/Fig. 8) between the brake and the rail.
• Push the brake by hand in the direction of the arrow (Fig. 8) up against the template until
the magnet audibly pulls in.
• When doing this, make sure the mounting plate for the brake assembly is pulled in evenly
(may not twist) and both brake linings are flat and even against the rail.
• Pre-tension the brake assembly using the tensioning aid (1/Fig. 10) as shown in
Fig. 10; when doing this, make sure that a short-circuit does not occur on the soldering
terminal (1/Fig. 11) and that no wires get damaged.
- Pre-tension the brake assembly only so far that the feeler gauge can be removed
again.
• In this position, secure the brake assembly in position by tightening the 4 Allen screws
(1,3/Fig. 8). When doing this, first tighten the two mounting screws (1/Fig. 8) and then the
screws (3/Fig. 8).
• Remove the tensioning aid and feeler gauge, then deactivate the brake assembly.
• Set the S4.8 Dip switch on the D13 back to the down position.

2-8 Ceiling Stand
1
1
2
Fig. 12 Fig. 13
Adjusting the Transverse Brake Assembly 2
• Loosen the 4 Allen screws on the brake assembly (1, 2/Fig. 12).
Adjustment for the 3 D-TOP ACSS / 3 D-TOP-ACSS P 2
• Adjustment of the longitudinal brake is performed using the SSW. To do this, select the
following routine per the SSW:
- Menu: Adjustment, Calibration
- Adjustments: Release the stand brakes
- Brake: Transverse
• Insert the template (1/Fig. 13) between the brake and rail.
• Push the brake by hand in the direction of the arrow (Fig. 12) up against the template
until the magnet audibly pulls in.
• In this position, secure the brake assembly in place by tightening the 4 Allen screws
(1, 2/Fig. 12).
When doing this, first tighten the two outside mounting screws (1/Fig. 12) and then the
screws (2/Fig. 12).
• Remove the template and move the telescope away.
• Conclude the adjustment of the transverse brakes in the SSW (Cancel).

Ceiling Stand 2-9
X1
2 10
1 9
1 8 X71
ON
OFF X70
S4
V171
V55
V54
V56
Fig. 14
Adjustment for the 3 D-TOP manual 2
• On the D13 board (ceiling stand) set the S4.7 Dip switch (1/Fig. 14) to the up position.
➪ LED v53 goes on.
• Insert the template (1/Fig. 13) between the brake and rail.
• Push the brake by hand in the direction of the arrow (arrow /Fig. 12) against the template
until the magnet audibly pulls in.
• In this position, secure the brake assembly in position by tightening the 4 Allen screws (1,
2/Fig. 12). When doing this, first tighten the two outside mounting screws (1/Fig. 12) and
then the screws (2/Fig. 12).
• Remove the adjustment strip and move the transverse bridge away.
• Set the S4.7 Dip switch on the D13 back to the down position.

2 - 10 Ceiling Stand
Fig. 15 Fig. 16
Checking the Braking Force in the Longitudinal and Transverse

Directions 2
• Check the braking force with a spring balance; to do this, hook the spring balance onto
the telescope as shown in Fig. 15 / Fig. 16.
- The measured values should be between 90 N and 120 N.
• If the measured value is below 90 N, repeat the adjustment of the brakes.
- In this instance, the distance between brake and rail is too large or the brake linings are
not flat against the rail. When readjusting, press the brake harder and more evenly
against the adjustment strip.
• Check all extreme positions and if there is any jamming a this point on the rail, readjust
the brakes.

Ceiling Stand 2 - 11
3
2
Fig. 17
Pre-adjustment of the Brake Assembly (old Version) 2
NOTICE The brake stop assembly must be correctly adjusted as regards

position and spacing!
The switch hysteresis of both the S1/S2 switches must be equal
and must be disassembled to be checked.
• Move the brake stop assembly so it is over the stop detent.

• Loosen the mounting screws (5/Fig. 17).
• Insert the template (6/Fig. 17) (same one used to adjust the brake linings) between the
switch and the stop detent.
• Press the mounting plate with the microswitch (1/Fig. 17) against the template (6/Fig. 17)
and press the stop detent until the metal border around the balls in the microswitch are
flat on the template.
• Tighten the screws (5/Fig. 17).
• Check the function of the S1, S2 switches at all stops.
• Check the function of the S3 switch (2/Fig. 17):
- The S3 switch must positively actuate when movement is made into the stop latch
(3/Fig. 17).
If necessary, adjust by slightly bending the switch strike plate (4/Fig. 17).
NOTICE The screws (7/Fig. 15) are coated with enamel. If the screws are
replaced or readjusted, coat them again with enamel.

4
2
Fig. 18
Pre-adjustment of the Brake Assembly (new Version)

• Pre-adjust the two microswitches, S1 and S2, if necessary, place the brake assembly on
a flat surface as shown in (1/Fig. 18).
- Insert a spacer, 6 mm thick, as shown in (2/Fig. 18) under the lever (3/Fig. 18) of the
switch block.
- Move the switch block so that the lever is up against the housing of the microswitch.
- Secure the switch block in place in this position and secure the screws with securing
enamel.
NOTICE The switch block has been preinstalled and adjusted at the fac-
tory, the screws are recognizable by the securing enamel.
If the brake assemblies are installed in the transverse bridge and
telescope carriage, the function of the microswitches must be
rechecked and, if needed, readjusted.
• If the two switches, S1 and S2, in the brake assembly actuate when installed (despite the
pre-adjustment, not secure), recognizable because it is difficult to find the stop position,
the entire switch block must be adjusted directly on the stop detent. To do this, proceed
as follows:
- Slightly loosen the two mounting screws (4/Fig. 18) using the special Allen wrench
included in the shipment through the two holes in the transverse strut of the transverse
bridge or through the opening in the telescope carriage and move the entire switch
block so that the two switch levers of the microswitches are actuated by switch strike
plate of the stop detent.

575, +50mm 410, +50mm

Transverse bridge
Tomo from the left
1 925, +50mm 670, +50mm
2
Center of
table
450, +50mm 535, +50mm

Transverse bridge
Tomo from the right

800, +50mm 795, +50mm
1 2
Center of
table
Fig. 19
Definitions 2
Tomography from the left:

In the tomo procedure, from the viewpoint of the operator, the ceiling stand first moves into
the left tomo starting position and runs through the tomo procedure to the right.
Tomography from the right:
During the tomo procedure, from the viewpoint of the operator, the ceiling stand first
moves into the right starting position and runs through the tomo procedure to the left.

S42/43 Safety Limit Switches (with Tomo only) 2
• Install the switch strike plate (1/Fig. 19) for the S42 head-end safety limit switch on the
longitudinal rail as shown in Fig. 19. Torque: 2 Nm
• Install the switch strike plate (2/Fig. 19) for the S43 foot-end safety limit switch on the
longitudinal rail as shown in Fig. 19. Torque: 2 Nm
• Check the function of the switches by move into strike plates. Both switches must
positively actuate in the particular position and may not scrape at any place along the
movement path of the transverse bridge. If needed, the position of the switch mount can
be corrected inside the mounting screws on the transverse bridge.

1
1
4
4
3 3
2
5
5
Fig. 20 Fig. 21
NOTICE Handle the 10-turn potentiometer carefully, do not over-turn it.
R40 ACSS Sensor, Longitudinal 2
• Move the transverse bridge to the left to the head-end stop.

• Adjustment of the R40 longitudinal potentiometer (1/Fig. 20) is carried out with the
service software. Select the following routine per the SSW:
- Adjustments: Calibration
- Adjustments: Adjustment of the stand longitudinal potentiometer
- Carry out the adjustment of the longitudinal potentiometers per the SSW.
• Hook the coil spring (2/Fig. 20) onto the potentiometer assembly (3/Fig. 20) and onto the
shaft (4/Fig. 20). Mesh the pinion for the potentiometer assembly into the toothed belt in
the longitudinal rail.
R16 ACSS Sensor, Transverse 2
• Move the telescope forward until the it is up against the operator’s side stop.
• Reinstall the R15 potentiometer (1/Fig. 21):
- Remove the snap ring (2/Fig. 21) from the shaft;
- Place the potentiometer on the shaft;
- Place the snap ring back on the shaft.

Fig. 22 Fig. 23
• Adjustment of the R15 transverse potentiometer (1/Fig. 21) is carried out with the service
software. Select the following routine per the SSW:
- Adjustments: Calibration
- Adjustments: Adjustment of the stand transverse potentiometer
- Carry out the adjustment of the transverse potentiometer per the SSW.
M1 Telescope Carriage 2
Adjustment of Potentiometer R10 2
(SID sensor, vertical)
CAUTION If the potentiometer R10 is defected, the vertical ACSS sensor has
to be replaced as a complete unit. To do this, the SID sensor cable
has to be disengaged in the telescope.
Adjustment of the R10 is not necessary since the ACSS vertical
sensor comes as a spare part with the potentiometer already
adjusted.
Zero Adjustment
• Move the telescope down slightly from the top stop until the value is within the tolerance
(+/-2); then a signal sounds on the SPC.
• Verify the value ok.
NOTICE After replacing the component, the reference SID must be repro-
grammed.

Adjustment of the SG10 Absolute Value Sensor 2
(SID sensor, vertical -- only for stands with tracking)
Zero Adjustment
• Move the telescope all the way up against the top mechanical stop.
• Loosen the two set screws on the grabber block for the shaft.
• Loosen the absolute value sensor.
• Turn the shaft of the absolute value sensor using an open-end (9 mm) until a value that is
within tolerance (+/- 100) is obtained, then a signal sounds on the SPC.
• Verify the value with ok and tighten the two set screws.
• As a check, move the telescope down to the stop.
- If the adjustment of SG10 is correct, a value of approx. 7500, +/-100 is displayed.
- Display of the value for the SG10 (because of higher accuracy) is with four places.
NOTICE After replacing the component, the reference SID must be repro-
grammed.
Adjusting the Y13 Lift Brake 2
The Y13 lift brake (1/Fig. 22) must drop approx. 1, ± 0.2 mm when the brake is released.
Adjustment is made using the plastic screw (2/Fig. 22).
• Adjust the Y13 lift brake (1/Fig. 22):
- Loosen the counter nut (3/Fig. 22)
- Turn the plastic screw (2/Fig. 22) all the way in.
- Turn back the plastic screw (2/Fig. 22) approx. 1.5 turns and counter it.
• Check the function of the Y13 lift brake (1/Fig. 22).
Adjusting the Weight Compensation with the Extension Spring 2
All cover panels and any options must be installed on the support arm to adjust the weight
compensation.
• Adjust the spring force by turning the worm gear (1/Fig. 23); when doing so, take note of
the + / - marks:
- Worm gear (1/Fig. 23) turned in + direction ➪ spring force increased
- Worm gear (1/Fig. 23) turned in - direction ➪ spring force reduced

Fig. 24
• Adjust a slight buoyancy with the extension spring.
WARNING When replacing the extension spring, do not open the spring car-
tridge!
Adjusting the Telescope Sections 2
• Check to make sure that the front of the individual telescope sections are even and
parallel to each other when the telescope is compressed (see magnified view/Fig. 24);
(magnified view is simplified and does not include the support arm).
• If necessary, adjust the 3 telescope elements with 1 Allen screw for each (1/Fig. 24)
(Allen wrench, 2/Fig. 24).
• Check the telescope for easy movement and for any scraping noises.

Adjusting the Vertical Reference SID for the 3 D TOP ACSS / ACSS P 2
• Insert any cassette (e.g. 43 cm x 35 cm) into the catapult Bucky and do not completely
insert the cassette tray.
• Using the tape measure in the collimator, adjust the reference SID to the top surface of
the cassette per the service software (see Fig. 25). To do this, select the following routine
per the SSW:
- Adjustment - Calibration
- Adjustments: Adjustment of Reference SID
- Carry out the adjustment of the reference SID per the SSW; when doing so,
acknowledge the 1st mask with “ok”.
• Completely insert the cassette tray -> the SID set is displayed.
Measuring edge
for tape measure
Fig. 25

1
1
2
Fig. 26 Fig. 27
Adjusting the Vertical Reference SID for the 3 D TOP manual 2
NOTICE Position the tube unit for the following two SID adjustments so
that "whole" cm values can be read on the tape measure because
the display (1/Fig. 26) only displays whole cm steps.
• Select the MULTIX workstation at the generator and move the table into the middle
position.
• Insert a 35 cm x 43 cm cassette into the cassette Bucky and do not move the cassette
Bucky all the way in.
• Position the tube unit just above the tabletop as shown in Fig. 26.
• Using the tape measure in the collimator, measure the distance to the top surface of the
cassette and make a note of the value (see also Fig. 25).
• Remove the cover panel (1/Fig. 27) on the command arm.
• Adjust the offset potentiometer (R1) through the top opening (2/Fig. 27) so that the SID
value noted appears in the display.
• Move the tube unit all the way up.
• Using the tape measure in the collimator, measure the distance to the top surface of the
cassette and make a note of the value.
• Adjust the gain potentiometer (steepness, R2) through the bottom opening (3/Fig. 27) so
that the SID value noted appears in the display.
• Check the adjustment at both SID values.
- If there is a difference of ≥ 1 cm, repeat the adjustment.
NOTICE The SID display is active only in the middle height position in the
manual system.

2 2
2 1
2 2
Fig. 28 Fig. 29
Adjusting the M3 Support Arm 2
Adjusting the Rotation Brake for the Tube Unit 2
• Adjust an air gap of 0.3, ± 0.1mm on the rotation brake (1/Fig. 28) using a spacer gauge:
- Remove the cover panel on the support arm.
- Rotate the tube unit so that the Allen-head set screws (2/Fig. 28) are accessible.
- Loosen the Allen-head set screws approx. 1 turn, adjust the air gap.
- Check this adjustment at the other two openings of the air gap; if needed, make a
correction (parallelism).
- Retighten the Allen-head set screws.
- Check the air gap of 0.3, ± 0.1 mm at all 3 accessible openings.
Leveling the Support Arm 2
• Check the position of the support arm by placing a spirit level on the support arm housing
in the longitudinal and transverse directions.
• To make a correction, slightly loosen the mounting screws (1/Fig. 29).
• Adjust the support arm position using the two tension screws (with the counternut) (2/
Fig. 29) so that the position of the support arm is changed.
• Retighten the mounting screws and check the correction with the spirit level.
• To obtain exact adjustment in both directions, the steps may have to be repeated several
times.
• Remove the mounting screws, one at a time, apply Loctite 221 and retighten them to a
torque of 10 Nm.

Fig. 30
DVA Stop 2
• Remove the cover panel, cable holder (1/Fig. 31) and outlet piece.
• Temporarily reinstall the cable holder (1/Fig. 30) using 2 countersunk Allen-head screws.
• Loosen the eccentric using a 4 mm Allen wrench (1/Fig. 30).
• Change the position of the stop accordingly using a 17 mm open-end wrench. When
doing so, press and hold the brake key.
• After the adjustment has been completed, secure the position by tightening the
eccentric.
• Move into the position several times from both directions and check the result of the
adjustment.
• If necessary, repeat the adjustment.

Fig. 31
DHA Stop 2
• Remove the cover panel, cable holder (1/Fig. 31) and outlet piece.
• Temporarily reinstall the cable holder (1/Fig. 31) using 2 countersunk Allen-head screws.
• Place a spirit level on the high voltage connectors.
• Loosen the eccentric (2/Fig. 31) (4 mm Allen wrench).
• Turn the eccentric stud with an open-end wrench (17 mm) so that the tube unit is
horizontal (to do this, release the brake at the keyboard).
• Retighten the eccentric (4 mm Allen wrench).
• After the adjustment has been completed, move into the stop position from both
directions and check the position in the stop position.
• Position the tube unit vertically to the min. SID and switch on the light localizer.
• Mark the light field (collimator centering cross) in the transverse direction.
• Move the tube unit into the max. SID.
• The drift measured my not exceed 5 mm. If necessary, repeat the adjustment.
• Reinstall the cover panels, the outlet piece and the cable holder by following the above
directions in the reverse order.

1 2
Fig. 32 Fig. 33
Adjusting the R30 Potentiometer for Tube Unit Rotation 2
• Remove the cover panel, cable holder and outlet piece on the support arm housing.
• Temporarily reinstall the cable holder using 2 Allen-head countersunk screws.
• Move the support arm into the 0o position (DVA).
• Select the following routine in the SSW:
- Adjustment – Calibration
- Adjustments: Tube rotation potentiometer
• The display of the reference value must be 0, ± 2.
• Loosen the set screws (2) on the R30 pinion gear (1/Fig. 32) and turn the potentiometer
shaft at the disk until the zero adjustment is reached with a tolerance of ± 2.
• When the value is within the tolerance, a signal sounds at the SPC.
• Resecure the potentiometer shaft with the screw.
• Check the result of the adjustment by moving into the 0o position several times. If
needed, repeat the adjustments.
Fine Adjustment of the Angle Display 2
• Pivot the tube unit into the 90° left position and the 90° right position and check the angle
display in the control panel display.
• If the display is not symmetric (e.g. 89° and 91°) the display can be readjusted by turning
the R30 potentiometer to the particular direction.
• Check the display in the opposite direction and, if needed, repeat the adjustment.

Rotation Origin and R31 Potentiometer 2
• The rotation brake must be in the reference position. For this, rotate the tube unit in the
uncontrolled mode so that the cable outlet (2/Fig. 33) is on the rotation brake (brake
assembly) on the bottom, in the middle of the marked position.
• Check the setting of the R31 potentiometer and, if needed, correct it.
• To do this, select the following routine per the SSW:
- Adjustment – Calibration
- Adjustments: Rotation Origin Potentiometer
• The SSW display value must be 0, ± 2.
• If needed, loosen the set screws on the pinion gear (drive side) and turn the pinion
(potentiometer shaft) until the zero adjustment is reached with a tolerance of ± 2.
• When the value is within tolerance, a signal sounds from the SPC.
• Resecure the pinion gear on the drive with the screw.

1
1
Fig. 34 Fig. 35
Adjusting the Central Beam 2
Checking and Adjusting the Central Beam in the Transverse Direction 2
• Adjusting the central beam in the transverse direction:

- Remove the cover panel (1/Fig. 34); two 32 mm paneling screws.
- Remove the cable holder (2/Fig. 34); two M6 x 16 mm Allen screws.
- Remove the tube unit cover panel (3/Fig. 34); two 18 mm paneling screws.
- Loosen the two securing rings with the 2 Allen screws (1/Fig. 35).
- Loosen the two set screws (2/Fig. 35).
- Rotate the tube unit around the longitudinal axis.
- Retighten the securing rings and set screws.
- Reinstall the tube unit cover panel (3/Fig. 34), the cable holder (2/Fig. 34) and the
cover panel (1/Fig. 34).
• Checking the central beam in the transverse direction:
- Position the tube unit vertically to the min. SID and switch on the light localizer.
- Mark the light field on the floor (collimator centering cross) in the longitudinal direction.
- Move the tube unit to the max. SID.
- Measure the drift.
• The drift must be ≤ 5 mm.

1 3
1
2
4 3 2
Fig. 36 Fig. 37
Checking and Adjusting the Central Beam in the Longitudinal Direction 2
• Adjust the central beam in the longitudinal direction:

- Remove the cover (1/Fig. 36), cable holder (2/Fig. 36) and outlet piece (3/Fig. 36).
- Temporarily reinstall the cable holder (2/Fig. 36) using 2 countersunk Allen-head
screws.
- Pace a spirit level on the high voltage connectors.
- Loosen the eccentric bearing (3/Fig. 37) (4 mm Allen wrench).
- Turn the eccentric bearing studs (2/Fig. 37) with an open-end wrench (17 mm) so that
the tube unit is horizontal (to do this, release the brake at the keyboard).
- Retighten the eccentric bearing (3/Fig. 37) (4 mm Allen wrench).
- After the adjustment has been completed, move into the stop position from both
directions and check the position in the stop position.
• Check the central beam in the longitudinal direction:
- Position the tube unit vertically to the min. SID and switch on the light localizer.
- Mark the light field on the floor (collimator centering cross) in the transverse direction.
- Move the tube unit to the max. SID.
• The drift must be ≤ 5 mm. If necessary, repeat the adjustment.
• Reinstall the cover panels, the outlet piece and the cable holder in the reverse order of
the directions above.
• If necessary, the direction can still be correctly slightly in the tube flange mount.

Section
6
MULTIX TOP
Maintenance
Instructions

08/7,;723
$;
Also applicable for VERTIX Solitaire
Maintenance
0DLQWHQDQFH,QVWUXFWLRQV
The Maintenance Protocol © Sie mens AG 1998

RXB1-150.105.01.04.02 use of this document or its contents
is required for these Instructions liable for damages. All rights,

English
Print No.: RXB1-150.101.01.04.02 Doc. Gen. Date: 08.99
Replaces: RXB1-150.101.01.03.02
5HYLVLRQ
&KDSWHU 3DJH 5HYLVLRQ

all all 01
all all 02
all all 03
all all 04

Maintenance Rev. 04 08.99 TD SD 21 Medical Engineering
&RQWHQWV
Page
BBBBBBB*HQHUDO5HPDUNV BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
Manufacturer’s Note . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1- 1

Required Documents . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1- 1
Required Aids . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1- 1
Safety Information . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1-2
Radiation Safety . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1- 2
Protection Against Laser Radiation . . . . . . . . . . . . . . . . . . . . . . . . .1-2
Remarks Regarding Maintenance. . . . . . . . . . . . . . . . . . . . . . . . . . . .1- 2
Explanation of the Abbreviations in the Maintenance Protocol . . . . . . . . . . .1- 3
Maximum Torque Values (Table) . . . . . . . . . . . . . . . . . . . . . . . . . .1- 3
Lubricants . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1-4
Cleaning . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1-4
Paint Colors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1- 4
Abbreviations Used in these Maintenance Instructions . . . . . . . . . . . . . . .1- 4
Remarks Regarding Working with the Service Software . . . . . . . . . . . . . .1- 4
MULTIX TOP Wearable Parts . . . . . . . . . . . . . . . . . . . . . . . . . . . .1- 5
Special Symbols. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1-5
BBBBBBB&HLOLQJ6WDQG BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
Longitudinal Carriage . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2- 1

M4 Transverse Bridge . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2- 2
S42/S43 Safety Limit Switches (Tomo) . . . . . . . . . . . . . . . . . . . . . . .2- 5
Tomo Drive . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2- 5
M1 Telescope Carriage . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2- 6
Brake Assembly, Brake Lining. . . . . . . . . . . . . . . . . . . . . . . . . . . .2- 7
Y13 Lift Brake . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2-7
Spring Tension of the Weight Compensation . . . . . . . . . . . . . . . . . . . .2- 8
Condition of the Support and Safety Steel Cables . . . . . . . . . . . . . . . . .2- 9
M3 Support Arm . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 - 10
Z66 Collimator . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 - 12
BBBBBBB07DEOH BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
Patient Table. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .3- 1

Emergency Stop Switch . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .3- 2
Bucky . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .3- 3
Lift Drive . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .3- 4
Unit Movements . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .3-5
Floor Mounting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .3- 5
BBBBBBB9(57,;352723 BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
Catapult Bucky . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 - 4
BBBBBBB(PHUJHQF\2II BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
Emergency Off Switch . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 - 1

Medical Engineering Rev. 04 08.99 TD SD 21 Maintenance
&RQWHQWV
Page
BBBBBB *URXQG:LUH0HDVXUHPHQWBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBB ,PDJH4XDOLW\ BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBB &KDQJHVWR3UHYLRXV9HUVLRQ BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

*HQHUDO5HPDUNV
*HQHUDO5HPDUNV
0DQXIDFWXUHU¶V1RWH
This document was originally written in German.
5HTXLUHG'RFXPHQWV
• Maintenance Protocol RXB1-150.101.01...
• Adjustment Instructions RXB1-150.071.01...
• TI 236 Safety Information On microfilm and paper
• ARTD Laser Radiation ARTD-002.731.03.
5HTXLUHG$LGV
127,&( $OOWRROVWHVWHTXLSPHQWDQGDLGVZLWKWKHH[FHSWLRQRIWKH
VWDQGDUGLQVWDOODWLRQWRRONLWDUHOLVWHGDQGVSHFLILHGLQ$57'
3DUW
• Standard installation tool kit

• ESD equipment, Type 8501-3M 37 02 606 Y3121
• Spacer gauge
• Ground wire test instrument 44 15 898 RV090
• Torque wrench up to 100 Nm (20-100 Nm) 44 30 906 RH090
• Torque wrench, 2 - 12 Nm 34 30 063
• Spring balance, 100 N 44 29 122 NH029
• Service PC with appropriate software
• Torque wrench attachment 56 60 852 G6019

*HQHUDO5HPDUNV
6DIHW\,QIRUPDWLRQ
&$87,21 :KHQFDUU\LQJRXWWKHZRUNDQGWHVWVWKHSURGXFWVSHFLILFVDIHW\
LQIRUPDWLRQFRQWDLQHGLQWKHGRFXPHQWVDVZHOODVWKHJHQHUDO
VDIHW\LQIRUPDWLRQFRQWDLQHGLQ5HJLVWHURIWKH7,ELQGHUPXVW
EHREVHUYHG
5DGLDWLRQ6DIHW\
&$87,21 &KHFNVRUDGMXVWPHQWVWKDWPXVWEHFDUULHGRXWZLWKUDGLDWLRQ
VZLWFKHGRQDUHODEHOHGZLWKWKHUDGLDWLRQZDUQLQJV\PERO
:KLOHSHUIRUPLQJWKHZRUNVWHSODEHOHGLQWKLVZD\UDGLDWLRQSUR
WHFWLYHFORWKLQJPXVWEHZRUQ
3URWHFWLRQ$JDLQVW/DVHU5DGLDWLRQ
• This system contains a Class 2 laser.
• When working on the laser light localizer, do not look directly into the laser beam.
See also ARTD Part 2 "Laser Radiation".
5HPDUNV5HJDUGLQJ0DLQWHQDQFH
127,&( :KHQSHUIRUPLQJPDLQWHQDQFHRQWKH08/7,;723LQVSHFWLRQ
DQGPDLQWHQDQFHRIWKHFRPSRQHQWVJHQHUDWRU9(57,;HWF
PXVWDOVREHFDUULHGRXW
The required documents must be obtained in accordance with the system.

Damaged or worn parts may only be replaced with original parts.
The Maintenance Protocol must be filled out and signed by the maintenance technician.
Repair work and work steps which are not listed in the checklists must be listed sepa-
rately.

*HQHUDO5HPDUNV
([SODQDWLRQRIWKH$EEUHYLDWLRQVLQWKH0DLQWHQDQFH3URWRFRO
Abbreviation Explanation
SI Safety inspection
SIE Electrical safety
SIM Mechanical safety
PM Preventive maintenance
PMP Periodic preventive maintenance
PMA Maintenance, preventive adjustment
PMF Preventive check of operating values and functions
Q System quality, image quality
QIQ Image quality
QSQ System quality
SW Software maintenance
FSE Field Service Engineer (customer service technician)
KSK-No. Customer-specific code
IVK Installed volume component
WE Maintenance unit
0D[LPXP7RUTXH9DOXHV7DEOH
Nominal thread Screw material Steel per DIN 267 Brass

diameter CuZn
alloy
Hardness rating 4.6 4.8 5.8 8.8 10.9 12.9
M3 0.5 0.67 0.83 1.3 1.9 2.2 0.62
M 3.5 0.76 1.0 1.3 2.0 2.8 3.4 0.95
M4 1.1 1.5 1.9 3.0 4.2 5.1 1.4
M5 2.2 3.0 3.7 6.0 8.4 10.1 2.8
M6 3.8 5.1 6.4 10.2 14.4 17.3 4.8
M8 9.5 12.6 15.8 25.3 35.6 42.7 11.9
M 10 18.7 24.8 31.1 49.8 70.0 84.0 23.3
M 12 32.9 43.8 54.8 87.6 123.3 147.9 41.1
When checking tightness, use the corresponding torque values for hardness rating 8.8.
127,&( $WROHUDQFHRI±LVDGPLVVLEOHIRUWRUTXHYDOXHV

*HQHUDO5HPDUNV
/XEULFDQWV
• Klüberplex GE11-680 100ml 55 07 608
• Contact spray 28 70 061 RE008 (as rust protection for rails)
• Viscogen KL 300 73 95 353 RH090 (for steel cables)
• Longtime PD2 20 g 34 91 271; 1 kg 73 95 449
&OHDQLQJ
Soiling that is not accessible to the customer’s cleaning personnel must be removed using
a concentrated cleaning liquid during maintenance work.
Soften contrast medium with water and remove.
After completing the maintenance work, remove coarse soiling on painted parts only with
alcohol or a concentrated cleaning liquid.
• Hakapur 96 60 648 RH999
• Alcohol
3DLQW&RORUV
• White (textured) 4146
• White (spray can) 84 27 734 RE999
• White (paint stick) 34 44 403
$EEUHYLDWLRQV8VHGLQWKHVH0DLQWHQDQFH,QVWUXFWLRQV
FFA = Film-focus distance (SID)
ISK = Allen screw
RWG = Bucky wall stand
TB = collimator
DVM = Digital voltmeter
RL = Bucky
DHA = Rotation around the horizontal axis
DVA = Rotation around the vertical axis
SSW = Service software
5HPDUNV5HJDUGLQJ:RUNLQJZLWKWKH6HUYLFH6RIWZDUH
A help text is available for the individual masks. The help texts contain details about the
individual work steps.
Start the help text: Press "F1" key
Exit the help text: Press "Esc" key

*HQHUDO5HPDUNV
08/7,;723:HDUDEOH3DUWV
Replace Replace if
Component Designation Quantity Part No. every 3 damaged
years
3D TOP Cable, E-TL set 1 30 71 219 G6019 X

Ceiling stand Brake lining 2 30 70 815 G6019 X
Collimator Pilot lamp 1 83 75 545 G2107 X
Roller bearings 4 04 75 111 G050G X
Table Rubber bumpers, 04 73 637 G050G
4 X
transv.
VERTIX PRO Steel cable 1 12 92 031 GE072 X
Steel cable 1 12 92 031 GE072 X
Steel cable 1 12 92 338 GE072 X
VERTIX TOP
Connection steel 12 92 213 GE072
1 X
cable
6SHFLDO6\PEROV
- Symbol for working with radiation.
- Symbol for working with dangerous voltage.
- Symbol for torque value.
- Symbol for working with laser radiation.

*HQHUDO5HPDUNV

&HLOLQJ6WDQG
&HLOLQJ6WDQG
/RQJLWXGLQDO&DUULDJH
6,0 &KHFNLQJWKH&RQGLWLRQDQG0RXQWLQJ

Fig. 1
Longitudinal rail ceiling mounting (M10 Allen screws): 50 Nm
127,&( )RUWKHVFUHZVWKURXJKWKHSLQLRQUDFNWKDWDUHQRWDFFHVVLEOHLW
LVDEVROXWHO\QHFHVVDU\WRXVHWKH³7RUTXHZUHQFKDWWDFKPHQW
´2WKHUZLVHWKHVFUHZKHDGVFDQEHGDPDJHG
• Pinion rack
127,&( 7KHSLQLRQUDFNPRXQWLQJVKRXOGEHVHFXUHGZLWK/2&7,7(ZKHQ
ILUVWLQVWDOOHG,QWKLVLQVWDQFH12FKHFNLVUHTXLUHG$VDFKHFN
UHPRYHRQHVFUHZWRGHWHUPLQHZKHWKHU/2&7,7(KDVEHHQXVHG
IRUVHFXULQJWKHQUHLQVHUWWKHVFUHZZLWK/2&7,7(,I/2&7,7(
KDVQRWEHHQXVHGIRUVHFXULQJWKHVFUHZDOOVFUHZVLQWKHSLQLRQ
UDFNPXVWEHVHFXUHGZLWK/2&7,7(
• Clamp connection of the switch strike plates (6/Fig.1) for the S42/43 safety limit switches
(M4 Allen screws): 1P
• End stops and rubber bumpers (4/Fig.1)
• M6 set screws (5/Fig.1) for the stop detents, longitudinal (SID), 1P

&HLOLQJ6WDQG
303 &OHDQLQJ
• Contact surfaces for roller bearings and lateral guide bearings in the transverse bridge.
Fig. 2
07UDQVYHUVH%ULGJH
6,0 &KHFNLQJWKH0RXQWLQJ
Fig. 3
• Roller bearings, lateral guide bearings (2/Fig.3)

• M8 set screws (1/Fig.3) to secure the roller bearings,1P

&HLOLQJ6WDQG
6,( &KHFNLQJWKH&RQGLWLRQ
• Check cable conduits, corrugated hose and cables for damage.

Fig. 4
• Check the mounting points for the cable guides.

• Check the stops and rubber bumpers (3/Fig.4).
• Check the M6 set screws (2/Fig.4) of the SID stop detents, transverse, 1P.
• Check the mounting screws for the tomo drive (two M8 Allen screws), 1P.
• Check the cover panels on the tomo drive.
• Check any optional parts.
303 &OHDQLQJ
• Roller bearings
• Lateral guide bearings
• Contact surfaces

&HLOLQJ6WDQG
30$ %UDNH$VVHPEO\%UDNH/LQLQJ
Fig. 5
• Check the condition of the brake linings (1/Fig.5).

• Check to assure the braking and movement forces per the Adjustment Instructions are
maintained.
• No friction may be detected when the transverse bridge is moved.

&HLOLQJ6WDQG
666DIHW\/LPLW6ZLWFKHV7RPR

6,( &KHFNLQJWKH)XQFWLRQRIWKH6DIHW\/LPLW6ZLWFKHV
Fig. 6
• Select the tomo mode.

• Move up to each limit switch. The switches must be positively actuated, the safety
breaker must deenergize and the red lamp on the left side of the table (safety circuit)
must go on.
7RPR'ULYH
Fig. 7
• Check the spacing between the pinion gear and rack (per the Adjustment Instructions).
• Check the function of the lift magnets.
• Check for maintenance of the longitudinal braking and movement forces per the
Adjustment Instructions.

&HLOLQJ6WDQG
07HOHVFRSH&DUULDJH
6,( &KHFNLQJWKH&RQGLWLRQRIWKH&RUUXJDWHG+RVHDQG&DEOHV
• Check for good condition.
Fig. 8
• Check the mounting points for the cables guides.

• Check the roller bearings, lateral guide bearings.
• Check the set screws to secure the roller bearings (1/Fig.8), 1P.
• Check the cover panels.
• Check any optional parts.
303 &OHDQLQJ
• Roller bearings
• Lateral guide bearings
• Contact surfaces

&HLOLQJ6WDQG
%UDNH$VVHPEO\%UDNH/LQLQJ
30$ &KHFNLQJWKH&RQGLWLRQRIWKH%UDNH/LQLQJDQG0RXQWLQJ
Fig. 9
• Check the adjustment (1/Fig. 9).

• Check for maintenance of the braking and movement forces per the Adjustment
Instructions.
• No friction may be detected when the transverse bridge is moved.
</LIW%UDNH
30) &KHFNLQJWKH)XQFWLRQRIWKH/LIW0DJQHWV
Fig. 10
• Brake (1/Fig. 10) must release when the key is pressed and when the key is released,
it must audibly engage.

&HLOLQJ6WDQG
6SULQJ7HQVLRQRIWKH:HLJKW&RPSHQVDWLRQ
6,0 &KHFNLQJWKH:HLJKW&RPSHQVDWLRQ
Fig. 11
The stand must be adjusted so that it is slightly buoyant (range: 0.3-1 kg or per the cus-
tomer’s request). Readjust the weight compensation using a 17 mm attachment on the
wrench at the adjustment screw (1/Fig. 11) on the telescope. When doing so, take note of
the arrow on the cast metal housing for the spring mechanism and of the +/- rotation
direction of the pinion gear.
127,&( ,IWKHWHQVLRQVSULQJLVH[SDQGHGIUHTXHQWO\LQDEULHIWLPHSHULRG
DQGRULIDUHGXFWLRQRIWKHPD[LPXPH[SDQVLRQOHQJWKLVGHWHU
PLQHGUHSODFHWKHWHQVLRQVSULQJ
&$87,21 :KHQUHSODFLQJWKHVSULQJPHFKDQLVPWKHVSULQJKRXVLQJPD\
QRWEHRSHQHGULVNRILQMXU\

&HLOLQJ6WDQG
&RQGLWLRQRIWKH6XSSRUWDQG6DIHW\6WHHO&DEOHV
6,0 &KHFNLQJWKH6WHHO&DEOHVIRU%URNHQ6WUDQGVSHULRGLFHYHU\PRQWKV
Fig. 12
• To do this, let the steel cables run through a cleaning cloth as shown Fig. 12, broken
strands and cable damage are indicated by any caught fibers.
• Relubricate the steel cables with VISCOGEN KL300.
127,&( ,IEURNHQVWUDQGVDUHIRXQGDOZD\VUHSODFHERWKVWHHOFDEOHV
• Check for maintenance of the braking and movement forces in the transverse and
vertical directions per the Adjustment Instructions.

&HLOLQJ6WDQG
06XSSRUW$UP
30$ 5RWDWLRQ0RYHPHQWV
Fig. 13 Fig. 14
• Check rotation around the horizontal axis (DHA) (1/Fig.13)

• Check the stop positions and check the alignment of the central beam to the table and to
the VERTIX per the Adjustment Instructions.
• Check rotation around the vertical axis (DVA) (1/Fig.14).
• Check the stop positions and the alignment of the central beam to the table and to the
VERTIX per the Adjustment Instructions.

&HLOLQJ6WDQG
6,0 0RXQWLQJRQWKH7HOHVFRSH
Fig. 15
• Check the condition and mounting (six M6 Allen screws) of the support arm (1/Fig. 15),
1P.
• Check the condition of the end stop (2/Fig.15) for wear and its mounting.
6,0 3OD\LQWKH6XSSRUW$UP'+$
Fig. 16
• Check the 3 mounting screws (1/Fig.16) to make sure they are tight on the rotation axis.

&HLOLQJ6WDQG
=&ROOLPDWRU
6,0 $GMXVWLQJWKH5RWDWLRQ)ODQJH
Fig. 17
• Check the adjustment of the rotation flange function.

• Check for easy rotation movement. The force on the spring balance as shown in Fig.17
must be 60 - 70 N (see Adjustment Instructions).
• If needed, remove the collimator, clean the flange and collimator ring and relubricate with
PD2 Longtime.
• Adjust the tightness of the mounting screws (1/Fig. 17) per the Adjustment Instructions.

(PHUJHQF\2II
(PHUJHQF\2II
(PHUJHQF\2II6ZLWFK
127,&( $QHPHUJHQF\RIIVZLWFKPXVWEHLQVWDOOHGRQHYHU\V\VWHP
3RZHUFDQEHVZLWFKHGRIIIURPWKHSRZHUVRXUFHWRWKHHQWLUH
V\VWHPE\PHDQVRIWKHHPHUJHQF\RIIVZLWFK
6,( &KHFNLQJWKH)XQFWLRQ
• When the system breaker is switched off, power is switched off from the power source to
the entire system.

(PHUJHQF\2II

*URXQG:LUH0HDVXUHPHQW
6,( &KHFNLQJ*URXQG:LUH5HVLVWDQFH
Ground wire test instrument

Unit
Table/Tabletop
Monitor
Cabinets
Transformers
Consoles
I.I.
Tube assembly
2KP Collimator
Generator etc.
Test instrument: Ground wire test meter

Measurement max. 0.2 Ohm (observe country-specific regulations)
value:
(current: 10 A, voltage drop: max. 2 V)
Test procedure: Measure between all conductible parts of the system that can be
touched and the ground wire rail in the generator.
Conditions: Ground wire resistance, max. 0.2 Ohm
• If greater, increase the ground wire cross section
• Lower transfer resistance (e.g. tighten screws)
)LQDOZRUNVWHSV
• Reinstall all cover panels.


,PDJH4XDOLW\
,PDJH4XDOLW\
Length
Light field
Marker
Side marker
Fig. 1
4,4 &KHFNRIWKH/LJKW)LHOG5DGLDWLRQ)LHOGDQG)RUPDW&ROOLPDWLRQ
• Position the central beam so it is vertical.
• Place a 20 cm x 30 cm (10”x12”) cassette on the MULTIX TOP tabletop.
• Set a vertical SID of 115 cm.
- Use the tape measure in the collimator to measure to the top surface o the cassette.
• Use the knobs on the collimator to H[DFWset a display of 18 cm x 24 cm or
8” x 10” (the exposure is also used for the check of the manual format collimation).
• Switch on the light localizer.
• Place a radio-opaque marker (e.g. washer, coin) on the cassette as shown in Fig. 1.
• Place on a washer as a side marker.
• Trigger an exposure: ( ; 50 kV; 5 mAs) and develop the film.
• Use a waterproof felt pen to make a note of the following data on the developed film:
- Set SID
- Focus size
- Film size
- Radiation field size

,PDJH4XDOLW\
Y1
Film
Light field
X2 X1
Radiation field
Y2
Fig. 2
(YDOXDWLRQ&RLQFLGHQFHRI/LJKW)LHOGWR5DGLDWLRQ)LHOG
• Calculate the total difference in the X and Y directions (without regard to the
mathematical sign in front).
- The difference in width X and the difference in length Y may not exceed 1.4 cm
at an SID of 115 cm.
(YDOXDWLRQ0DQXDO)RUPDW&ROOLPDWLRQ
• Calculate the difference in length and width between the size of the radiation field and
the set format.
- The difference in both directions (length and width) may each not exceed 1.4 cm.

,PDJH4XDOLW\
4,4 &HQWHULQJ%XFN\$ 08/7,;7DEOH
Film format
Radiation field
∆
Metal washer
Center of cassette
Side marker
Fig. 3
• Check the coincidence of the radiation field center and film center (Bucky A MULTIX
table).
3URFHGXUH
• Position the central beam so it is vertical, center the tube assembly over the cassette tray
marker and set an SID of 115 cm.
• Move the tube assembly in the transverse direction into the middle position stop.
• Mark the 24 cm x 30 cm (10”x12”) cassette with a center marker (tape on a metal
washer) and place on a second marker as a side marker (Fig. 3).
• Load the marked cassette with film, insert it into the cassette tray and slide the tray in all
the way to stop.
• Use the knobs on the collimator to set a format of 18 cm x 24 cm (8” x 10”) per the scale
(SID = 115 cm).
• Trigger an exposure ( ; 50 kV; 5 mAs) and develop the film.
(YDOXDWLRQ
• Evaluate the center deviation ∆as shown in Fig. 3.
- The difference may not exceed 17 mm at an SID of 115 cm.

,PDJH4XDOLW\
4,4 &HQWHULQJ9(57,;352723
Film format
Radiation field
∆
Metal washer
Center of cassette
Side marker
Fig. 4
• Check the coincidence of the radiation field and film center to the
VERTIX PRO/TOP (if configured)
D+RUL]RQWDOEHDPGLUHFWLRQ
3UHSDUDWLRQ
• With a 24 cm x 30 cm or 10” x 12” cassette, mark the center of the cassette by taping on a
washer and place on a second washer as a side marker.
3URFHGXUH
• At the generator, select the workstation for the VERTIX.
• Pivot the tube assembly into the horizontal beam direction.
• Move the tube assembly in the transverse direction into the middle stop to the VERTIX.
• Set the min. SID.
• Insert a 24 cm x 30 cm or 10” x 12” cassette with a center marker into the cassette tray
and slide the tray all the way in to stop.
• Center the line light localizer to the center marker of the cassette tray.
• Use the knobs on the collimator to set a format of 18 cm x 24 cm or 8” x 10”.
• Trigger an exposure ( ; 50 kV; 4 mAs).

,PDJH4XDOLW\
• Develop the film, determine the center of the radiation field and evaluate the film per
Fig.4.
The max. center deviation ∆ may QRW exceed the following values:
PD['LIIHUHQFH
6,' (corresponds to 1.0% of
the SID)
1.00 m 1.00 cm
1.15 m 1.15 cm
1.50 m 1.50 cm
2.00 m 2.00 cm
3.00 m 3.00 cm
36” 0.91 cm
40” 1.01 cm
48” 1.21 cm
72” 1.82 cm
E9HUWLFDOEHDPGLUHFWLRQRQO\ZLWK9(57,;723
3UHSDUDWLRQ
• Mark the center of the cassette with a 24 cm x 30 cm or 10”x12” cassette by taping on a
washer and place on a second washer as a side marker.
3URFHGXUH
• Pivot the tube assembly into the vertical beam direction.
• Pivot the table out to face the Bucky wall stand.
• Center the tube assembly to the catapult Bucky (move into the stop detents in the long.
and transverse directions).
• Set the SID to 115 cm or 40”.
• Insert a 24 cm x 30 cm or 10”x12” cassette with the center marker into the cassette tray
and slide the tray all the way in to stop.
• Use the knobs on the collimator to set a format of 18 cm x 24 cm or 8”x10”.
• Trigger an exposure ( ; 50KV; 4mAs).
• Develop the film, determine the center of the radiation field and evaluate the film as
indicated in Fig. 4.
The max. center deviation ∆ may QRW exceed the following values.
PD['LIIHUHQFH
6,'
FRUUHVSRQGVWRRI6,'
1.15 m 1.15 cm
40” 1.01cm

,PDJH4XDOLW\
4,4 $FFXUDF\RI$XWRPDWLF)RUPDWLQJIRU&DVVHWWH)RUPDWV
127,&( &KHFNWKHFROOLPDWLRQDFFXUDF\ZLWKDXWRPDWLFIRUPDWLQJZLWK
IRUPDWVIRUHDFK%XFN\DQGGRFXPHQWWKHUHVXOWV&KHFNWKH
IRUPDWVE\JHQHUDWLQJDWHVWILOP
%XFN\$08/7,;7DEOH
• Select the MULTIX.
• Move the tube assembly in the transverse direction into the middle position, set SID =
115 cm.
• Center the line light localizer on the centering mark of the cassette tray.
• Place a 35 cm x 43 cm or 14” x 17” cassette with film so it is centered to the light localizer
on the tabletop.
• If possible, use the three formats 13 cm x18 cm (5” x 7”), 18 cm x 24 cm (8” x 10”) and
24 cm x 30 cm (10” x 12”) for the test. If fewer formats are used at this workstation, check
only those.
• At the generator, select (, approx. 40 kV, 5 mAs (with the universal screen).
The exposure should produce a density of about 0.7 over base fog.
• Then, one after the other, beginning with the smallest format, insert three cassettes
without film into the catapult Bucky, allow it to format automatically, and trigger an
exposure for each.
• After inserting the cassettes into the catapult Bucky, check whether the inserted cassette
format is displayed on the collimator.
The maximum admissible difference between the display and the cassette format is
± 0.3 cm.
(YDOXDWLRQ
The 3 exposures are made on the 35 cm x 43 cm or 14” x 17” cassette on the tabletop,
one on top of the other; evaluation is possible by observing the different density of the
individual formats (see Fig. 35).
• Develop the film and label it.
The 3 format sizes to

Film
be checked
Fig. 5

,PDJH4XDOLW\
4,4 &KHFNRIWKH7RPR([SRVXUHV
• Select the Bucky mode (key).
• Position the stand in the longitudinal and transverse stops, the corresponding LED next
to the key lights up.
• Set the SID to 115 cm or 102 cm.
• Prepare the tomo test block and position it on the tabletop so it is centered to the light
localizer. One line test must be positioned on the anode side, the other must be pointing
to the tomo height line light localizer (test per the Adjustment Instructions).
• Load a 18 cm x 24 cm (8” x 10”) cassette with the high resolution screen (S ≤ 200) with
film and insert it into the catapult Bucky.
• Trigger a Bucky exposure:
- Exposure data: 81kV, small focus , 80% power, middle measuring field
1.2 mm Cu filter.
• A basic density of D = 1...1.4 should result. Depending on the screen type, set a different
mAs value.
• If necessary, repeat the first exposure with modified exposure data.
• Once more make sure that the notches of the two line tests are at the same height above
the tabletop; exactly measure this dimension (115 mm, ±1mm).
• Select the 40o; 2 sec tomo program. The longitudinal brake automatically releases and
the catapult Bucky centers itself automatically to the central beam.
• Select the tomo height so that the displayed tomo height exactly matches the measured
”notch height”.
• Make 2 tomo exposures: 40°; 2 sec. and 20°; 0.6 sec.
- Exposure data:
81kV and to achieve the same density for the tomo exposure as for the Bucky
exposure, increase the mAs value by one mAs point:
- Exactly label all exposures:
81 kV, mAs, 1.2 mm Cu, SHa = 115 mm, 40o; 2 sec., linear.

,PDJH4XDOLW\
$FFXUDF\RIWKH7RPR+HLJKW'LVSOD\
The hole in the focus test that appears sharply focused is in the tomo plane.
If the hole next to the notch is sharply focused, the numerically selected tomo height SHa
matches the actual tomo height SH; i.e. ∆ SHa = 0.
• If there are differences, determine the difference in height ∆ SHa in mm between the
sharply focused hole and notch; there is a difference in height of 2 mm from hole to hole.
- If the actual tomo height is above the notch, ∆ SHa is positive.
- If the actual tomo height is below the notch, ∆ SHa is negative.
Determine the actual tomo height. 6+ 6+a + ∆6+a

• Calculate the difference in height ∆6+L between the actual tomo height and the line light
height: ∆6+L = 6+L - 6+
The difference between ∆6+a and 6+L may be max. ≤ PP.
2SWLFDO5HVROXWLRQ
Evaluation of the resolution of the tomo exposures is made by comparing them to an
exposure made with the Bucky under comparable conditions. In this way, all influences
which determine the resolution of a radiographic exposure (focal spot size, screen type,
film, geometric relationships, exposure data, etc.) are taken out of consideration and it is
possible to make a clear statement about the quality of the tomo device.
• Determine the maximum optical resolution of the tomo exposures and record the results
(min. 6x magnifier).
• Determine the maximum optical resolution of the Bucky exposure.
The difference in the maximum optical resolution between the Bucky exposure and the
tomo exposures may not be more than one line group. The resolution for the Bucky expo-
sure should result in at least 2.8 Lp/mm (depending on the film-screen system).
If there is more than one line group difference, there intolerable movement problems in
the tomo device; it can no longer be said that there is even movement of the tomo device.
127,&( ,IWKHGLIIHUHQFHLQSDUDOOHOLVPEHWZHHQWDEOHVWDQGLVPRUHWKDQ
PPRYHUWKHFRPSOHWHWDEOHOHQJWKIRFXVZLOOEHDIIHFWHG
• The resolution of the tomo exposures must be at least 2 Lp/mm.

,PDJH4XDOLW\
7RPRILJXUHDQGHYHQPRYHPHQWRIWKHWRPRGHYLFH
With a linear layer, the blur patterns of the holes to the left and right of the notch must be
parallel; if they are not, the focus plane and film plane are not parallel. This also results in
reduced resolution in the line test in a longitudinal direction to the tomo device.
If the blur patterns are jagged (jumpy, wavy lines), there are unsynchronous oscillations in
the tomo system (loose or jamming locations, etc.). This also results in reduced resolu-
tion.
The blur patterns of the holes should have about the same density over the entire length.
When the blur patterns are dotted, there is uneven tomo movement (usually of the cata-
pult Bucky). If there is a continuous change in density of the blur patterns, there is uneven
movement speed or there is an uneven dose rate.
Uneven tomo movement can also be recognized in that the edges of the line test plates
do not have a continuous change in density, but are visible as “steps”.
2YHUDOOHYDOXDWLRQRIWKHWRPRGHYLFH
6KDSHDQGPRYHPHQWRIWKHWRPRILJXUH
The blur pattern of the holes in the line test show the form and movement of the tomo fig-
ure. If one example is not sufficient for an evaluation, also make a pin-hole exposure as
described on Page 6-10 for the particular tomo figure.
good /LQHDUOD\HU
The blur patterns of the holes are even and are

parallel on both sides of the notch.
satisfactory
/LQHDUOD\HU
The blur patterns are slightly unparallel or

slightly curved.
unsatisfactory /LQHDUOD\HU
The blur patterns are not parallel or strongly

curved and/or very wavy.
The parallelism of table-stand must be
improved.

,PDJH4XDOLW\
(YHQQHVVRIEOXUULQJ
good The blur patterns of the holes and edges are

continuous and are not dotted or stepped or
dotting and stepping is scarcely visible.
satisfactory
The blur patterns show several (4 and more)

clearly visible dots or steps.
unsatisfactory
The blur patterns show few (2 to 3) clearly

visible dots or steps, so that the "tomo expo-
sure" is comprised virtually of only 2 to 3
oblique exposures made at different beam
angles.

&KDQJHVWR3UHYLRXV9HUVLRQ
&RYHUVKHHW
VERTIX Solitaire added.
&KDSWHU3DJH
Notice added.

TD PS 21 / Conrad, Tropia

Section
7
OVERHEAD SUPPORT
3D TOP
Parts Lists
OVERHEAD SUPPORT 3D TOP G6019
Overview
for SIRESKOP SX TOP
for MULTIX TOP / FD

for VERTIX TOP / FD
R71-020.081.05.
RX74-020.081.10 .
R71-020.081.05.
VERTIX SOLITAIRE RX74-020.081.10 .

Electronic Section
RXB1-260.081.10.
Siemens AG 28.07.1999 Picture for Page: 45

Medical Solutions RX22-040.081.01.03
Sub Components Product Number
(03070013) G6019 SN 01001/Man.
(03070021) G6019 SN 01001/ACSS /
TOMO.
(03070039) G6019 SN 01001/ACSS /
TOMO. Mot.
Longitudinal and Transverse Bridge Man. / ACSS
Longitudinal and Transverse Bridge ' Tomo ' (Toothed Belt) -> 30 70 021
G6019 / 01199
Tomographic Drive (Toothed Belt) -> 30 70 021 G6019 / 01199
Longitudinal and Transverse Bridge ' Tomo ' (Steering Rack) 30 70 021
G6019 / 01200 ->
Tomographic Drive (Steering Rack) 30 70 021 G6019 / 01200 ->
Telescope Carriage
Telescope Carriage, Mot. / Follow-up Control
Cover and Telescopic Column
Support Arm ' MULTIX-Man. ' 30 72 456 G6019
Support Arm ' MULTIX-ACSS ' 30 72 464 G6019
Support Arm ' MULTIX-Tomo. ' 30 73 900 G6019
Support Arm ' MULTIX-Tomo. Mot. / Follow-up Control ' 30 73 918 G6019
Support Arm ' SIRESKOP SX-Man. ' 30 72 472 G6019
Support Arm ' SIRESKOP SX-ACSS ' 30 72 480 G6019
Support Arm ' SIRESKOP SX-Tomo. ' 30 72 498 G6019
Corrugated Hoses, cpl., Cables and Connector Parts
Installation Material 87 63 872 G2122
Siemens AG 28.07.1999 Page: 45

6 4
4 1 3
2B 2A
2
2C
2D
33 2E
33 26 24
22 23
25 7 2F
20A
10
9
20 1 3
27
12 33
33
31
32
11 11A
11D
15A 31 11B 11C
15C
32
15B
26 4
6
25
15
5

ID Part-No. Type Description Comment Weight NSI TC
1 03074502 G6019 Ceiling rail + Accessory pack CPL. 40KG 3
2 03074510 G6019 Mounting accessories FOR LONGITUDINAL 6,1KG 3
2A 08766586 G2122 CAP 0,04KG 3
2B 03074650 G6019 Colored cover strip GREEN 1005MM 0,012KG 3
2C 07277163 G5148 Shim 50 X 75 X 1 MM 0,03KG 3
2D 07277155 G5148 Spacer plate 50 X 75 X 3 MM 0,075KG 3
2E 08764953 G2122 Rubber bumper 0,05KG 2
2F 03073959 G6019 Tab 125 X 75 X 5 MM 0,14KG 3
3 03074536 G6019 Rail extension # 3D-T CPL. 5KG x 3
4 03074585 G6019 Replacement stop, cpl. CPL. 0,4KG 3
08764953 G2122 Rubber bumper 0,05KG 2
5 03074668 G6019 Colored cover strip ORANGE 1005MM 0,21KG 3
6 04951596 G5422 END CONNECTOR E 1,4KG 3
7 08764011 G2122 Threaded block 0,08KG 3
9 05660928 G6019 Screw-down mechanism 0,7KG 3
10 05660969 G6019 Allenkey 0,15KG 3
11 03070757 G6019 BRAKE STOP ASSEMBLY, CPL. CPL. 4,255KG 2
01000124 B0104 MICROSWITCH S1-3 0,03KG 1
03101953 B0104 Actuator VAB-VE FOR S1,2 0,04KG 1
11A 01413335 G2002 FLAT PIECE 0,003KG 1
11B 03070815 G6019 BRAKE PAD 0,05KG 2
11C 04699534 F2010 LATCH MAGNET Y1 1,2KG 2
11D 04699526 F2010 LIFT MAGNET Y2 0,56KG 2
12 03070963 G6019 THREADED PLATE 0,06KG 2
15 03071151 G6019 Additional latches #3D-T CPL. 0,11KG 3
15A 03070906 G6019 Stop detent 0,09KG 3
15B 01995976 G0923 Distance markers 0,003KG 3
15C 03421484 THREADED PIN M6X10 DIN916-A2-70 0,011KG
20 03074551 G6019 Set of parking switches (SET OF PARKING CPL. 0,7KG 3
07717515 B0103 ROCKER SWITCH S11,41 0,04KG 2
20A 08766206 G2122 CAM 0,04KG 2
22 03073587 G6019 ACSS Sensor M4/R40 1,46KG 2
07755531 B0616 Potentiometer R40 1K 1,5W 0,04KG 1
23 01265214 G0900 EXPANSION SPRING 0,04KG 2
24 03073546 G6019 Stud 0,024KG 2
25 05508689 Tooth belt T2,5/6MM 10M T2,5/6MM METERWARE 0,01KG 2
26 02040103 adhesive tape 6 SRN828- 6M / METERWARE 1,34KG 2
27 05508986 cable channel 2M / METERWARE 0,058KG 3
31 08772394 G2122 Eccentric roller bearing 0,06KG 2
32 08772378 G2122 Roller bearing 0,065KG 2
33 03071268 G6019 Replacement support, cpl. 0,68KG 2

85 90
84 89
86
92
81 80 88
83 82
97
96
95
98
95
98
27
96
97
95
95

80 03072670 G6019 end connector Tomo (Endverbinder) x 2
81 03072654 G6019 soil x 3
82 03072662 G6019 cover x 3
83 04125043 N2001 Cover screw M4 x 12 M4X12 0,002KG 3
84 08949836 G5334 ENCODER BOARD ESD D16 0,156KG 1
85 07038243 F0128 SPACER RETAINER 0,01KG 3
86 REP 05660506 G6019 Tomographic drive, cpl. M40 20,78KG 2
88 03144235 F2010 COUPLING Y41 2,15KG 1
89 03178027 B2228-3 DIODE 30S1 100V 3A GR.6. V41 100V 3A 0,011KG 2
90 03355781 PIN STRIP X3 A4 SRN46000 0,05KG 2
92 07056047 F0705 belt AT5 L= 305 B= 25 Z= 61 0,03KG 3
95 03072688 G6019 smooth ring (Schleifring) 0,004KG 3
96 05508747 belt AT5/25MM SRN5059-POLYURETHAN 5M AT5/25MM METERWARE 0,085KG 3
97 03072829 G6019 E-TL.belt press, right 1,4KG 3
98 03072837 G6019 E-TL.belt press, left 1,4KG 3

Longitudinal and Transverse Bridge ' Tomo ' (Steering Rack) 30 70
021 G6019 / 01200 ->
For MULTIX FD / VERTIX FD
21A see view : DETAIL
21 70
4
1 3
2 2B
2A
34 2C
2D
35 26 2E
25 22 23 24
2F
7
20A
10
9
20 1 3
27
35
12
34 31
11A 32
11D
15A 31 11 11B 11C
15C
32
15B
26 4
25 6
15
5

DETAIL for MULTIX FD / VERTIX FD
70C
70B
70D
70E
70A
70
72
71

021 G6019 / 01200 ->
1 03074502 G6019 Ceiling rail + Accessory pack CPL. 40KG 3
2 03074510 G6019 Mounting accessories FOR LONGITUDINAL 6,1KG 3
2A 08766586 G2122 CAP 0,04KG 3
2B 03074650 G6019 Colored cover strip GREEN 1005MM 0,012KG 3
2C 07277163 G5148 Shim 50 X 75 X 1 MM 0,03KG 3
2D 07277155 G5148 Spacer plate 50 X 75 X 3 MM 0,075KG 3
2E 08764953 G2122 Rubber bumper 0,05KG 2
2F 03073959 G6019 Tab 125 X 75 X 5 MM 0,14KG 3
3 03074536 G6019 Rail extension # 3D-T CPL. 5KG x 3
4 03074585 G6019 Replacement stop, cpl. CPL. 0,4KG 3
08764953 G2122 Rubber bumper 0,05KG 2
5 03074668 G6019 Colored cover strip ORANGE 1005MM 0,21KG 3
6 04951596 G5422 END CONNECTOR E 1,4KG 3
7 08764011 G2122 Threaded block 0,08KG 3
9 05660928 G6019 Screw-down mechanism 0,7KG 3
10 05660969 G6019 Allenkey 0,15KG 3
11A 01413335 G2002 FLAT PIECE 0,003KG 1
11B 03070815 G6019 BRAKE PAD 0,05KG 2
12 03070963 G6019 THREADED PLATE 0,06KG 2
15 03071151 G6019 Additional latches #3D-T CPL. 0,11KG 3
15A 03070906 G6019 Stop detent 0,09KG 3
15B 01995976 G0923 Distance markers 0,003KG 3
15C 03421484 THREADED PIN M6X10 DIN916-A2-70 0,011KG
20 03074551 G6019 Set of parking switches (SET OF PARKING CPL. 0,7KG 3
20A 08766206 G2122 CAM 0,04KG 2
21 03074254 G6019 Safety limit switch CPL. 1KG 2
21A 08766206 G2122 CAM 0,04KG 2
24 03073546 G6019 Stud 0,024KG 2

021 G6019 / 01200 ->
34 03072803 G6019 Repl.support LV,RH 0,7KG 2
35 03072811 G6019 Repl.support LV,RH 0,7KG 2
70 03072175 G6019 ABSOLUTE VALUE GIVER, CPL. 0,7KG 1
70A 03066941 B3404 Rotation Encoder RA58-S 0,48KG 2
70B 07056815 F0705 TOOTH BELT T= 2,5 L= 265 B= 6 Z= 106 0,02KG 3
70C 05887687 G6019 TOOTH BELT WHEEL, SMALL SMALL 0,2KG x 3
70D 05887554 G6019 TOOTH BELT WHEEL, GREAT GREAT x 3
70E 03073587 G6019 ACSS Sensor 1,46KG 2
07755531 B0616 Potentiometer R40 0,04KG 1
71 05887455 G6019 COVER 1KG x 3
72 05887695 G6019 ANGLE SUPPORT FD 0,8KG x 3

117 85
129 124
84
125 123 119
113 118
112
111 110
83
128
121
123
122
120
27

27 05508986 cable channel 2 M / METERWARE 0,058KG 3
110 REP 05660506 G6019 Tomographic drive, cpl. M40 CPL. 20,78KG 2
111 05660787 G6019 casing, soil 1KG x 3
112 05660829 G6019 BOLT 0,07KG 3
113 05660720 G6019 casing 1KG x 3
117 03065380 F2010 PERMANENT MAG.MOTOR GEAR 30V- 7, M40 7,5KG 2
5A 194U/
118 05660761 G6019 gear wheel 2 0,55KG 2
119 01445220 G0934 SPRING 0,4KG 2
120 03143492 B0104 MICROSWITCH S11 0,03KG 1
121 01000124 B0104 MICROSWITCH S12 0,03KG 1
122 01413335 G2002 FLAT PIECE 0,003KG 1
123 04699526 F2010 LIFT MAGNET Y11,12 0,56KG 2
124 07049687 F0507 ROLLER 10 X 28 X 8 R=500 10X28X8 0,023KG 2
125 05660795 G6019 clip part cpl. CPL. 1,2KG 3
128 05660696 G6019 Steering rack 2 METER 9KG 3
129 05660852 G6019 TORQUE WRENCH ATTACHEMENT 8 MM 0,1KG
F. CEILING RAIL MOUNTING

Telecope Carriage, Mot. / Follow-up Control
11A
176 11D 11C
140
20 11B
20A
176
142 11
33
150
149
33 148 32
31 33
176
32
160
26
25
22
23
156A
24 156
176 175C
156A
131 156
1031 175B
175C
132 176
1033
170
33
83
165
141
139
175A
175
ID Part-No. Type Description Comment Weight TC
11A 01413335 G2002 FLAT PIECE 0,003KG 1
11B 03070815 G6019 BRAKE PAD 0,05KG 2
20 03074551 G6019 Set of parking switches (SET OF CPL. 0,7KG 3
PARKING
20A 08766206 G2122 CAM 0,04KG 2
24 03073546 G6019 Stud 0,024KG 2
33 03071268 G6019 Replacement support, cpl. 0,68KG 2
131 03071979 G6019 Spare part D14, cpl. D14, cpl. included D14 - 3073736G6023 3,5KG 2
+D14/J107 - 3074387G6023
+ D1 - 5649509P8100, only f.Follow-up Control !
1031 05649509 P8100 Add on board only for Follow-up Control ! 0,3KG 1
132 03074387 G6023 D14/J107 PAL VA00A D14/J107 VA00A 0,04KG 2
1033 03074304 G6023 BOOT & APPL.SW LIFT.D14J41 D14/J41 VA03A only for Follow-up Control ! 0,05KG 1
VA03A
139 05887422 G6019 GEAR RIM 1,12KG 2
140 05887471 G6019 STEP MOTOR, CPL. M16/Y16 2,65KG 2
141 04664066 B2221 METALLOXID VARISTOR R16,17 0,04KG 2
142 05887646 G6019 REPL.BRAKE MAGNET,CPL. Y17-19 KIT, CPL. 0,88KG 2
148 03071680 G6019 Spring pulley cpl. E SDL WITHOUT STEEL CABLE 37,778KG 2
149 03071219 G6019 SPAR E PART SET ROPES E 0,4KG 3
150 03071672 G6019 SUPPORT FOR ROPE PULLEY, 0,54KG 2
CPL
156 03071201 G6019 SPAR E PART DEFLECTOR SID, Assy,cpl. 0,05KG 2
CPL.
156A 03070393 G6019 SID Bracket 0,04KG
160 03071292 G6019 REPL.CABLE HOLDER, CPL. WITH SCREWS 0,32KG 3
165 03070351 G6019 SUPPORT COLLAR E FOR RSO 0,65KG 3
170 03074353 APPLICATION SW VA03A
175 05887489 G6019 LIFT ACQUISITION 4,18KG 2
175A 03066941 B3404 Rotation Encoder RA58-S SG10 0,48KG 2
175B 05887596 G6019 Spare part, encoder, cpl. E10 with Toothed belt, cpl. 0,32KG 1
175C 05887638 G6019 REPL.STEEL CABLE+SPRING 0,68KG 2
176 03074023 G6019 CABLE SET D14X31-SG10/E10 1KG 2
"D14X20-X1

220 220B 221
220F 220A
220D 160 228 227
226
220E
232 221
220H
225
220C
220H
203
220G
231 204 205
230
199
160
235
234
165
233
201 83 191
200
198
199
197 210
196 195
165 03070351 G6019 SUPPORT COLLAR E FOR RSO 0,65KG 3
191 03070146 G6019 TELESCOPE TUBE, CPL. E 39KG 3
195 03070302 G6019 1 E 0,36KG 3
196 03070310 G6019 LID 2 E 0,55KG 3
197 03070328 G6019 LID 3 E 0,7KG 3
198 03070336 G6019 LID 4 E 0,81KG 3
199 07045776 F0310 RUBBER BUFFER D 15MM D X 8MM M4 0,011KG 2
200 03071235 G6019 Repl.set, cable tensioner 0,19KG 3
201 03071227 G6019 SPAR E PART SET AUSGL.-SEILE 0,35KG 3
203 03070286 G6019 BALL-BEARING,CPL. E 3070278/3070294 BEZ 0,03KG 2
204 03070708 G6019 CAM BEARING, CPL. E 3070294/3070690 BE 0,042KG 2
205 03071243 G6019 SPAR E PART LASTSEILAUFHG.KPL. 0,7KG 3
210 03071003 G6019 Telescopic extension 20CM3D-T 20 CM 1KG x
04125043 N2001 Cover screw M4 x 12 M4X12 0,002KG 3
220 03071334 G6019 set telescope casing CPL. 8KG 3
220A 01995976 G0923 Distance markers 0,003KG 3
220B 03071094 G6019 ADJUSTING GAUGE 0,07KG 2
220C 03070906 G6019 Stop detent 0,09KG 3
220D 08767485 G2122 POINTER 0,001KG 3
220E 08767477 G2122 POINTER 0,008KG 3
220F 03071342 G6019 fastening 0,05KG 3
220G 03071318 G6019 connector 0,04KG 3
220H 04870804 G5125 Cover screw M4x17 M4X20 0,004KG 3
221 03072290 G6019 SET OF SLIDE VALVES 4 PIECES 0,05KG 3
225 03073330 G6019 SWIVEL ARM, SPEED E 3073413 G6019 BEZ 1,6KG 3
226 08766800 G2122 SUPPORT 0,06KG 3
227 03380300 P2091 SCREW M5X16 SN60110 0,001KG 3
228 03073439 G6019 TENSION SPRING E SDL 0,018KG 3
230 08536518 G2111 Cable holder 0,3KG 3
231 03073322 G6019 CABLE HOLDER 2 E FOR DEE 0,09KG 3
232 03071474 G6019 Wall inlet CPL. 1,4KG 3
03071292 G6019 REPL.CABLE HOLDER, CPL. WITH SCREWS 0,32KG 3
233 03072845 G6019 CABLE GUIDE FOR SIRESKOP ONLY FOR SIRESKOP SX 0,43KG 3
234 08768517 G2122 Cable guide 0,32KG 3
235 03073348 G6019 Bolt 0,1KG 2

335
334
332 301
300
333
160 221
331 329
325
319
318
313
See:
316 AX X-Ray / X-Ray Tubes
361B
361A 361
349
316A 348
347
341
See:
89
AX X-Ray / Collimators
362
363
321
320
371
375
89 376 New Model !

89 03178027 B2228-3 DIODE 30S1 100V 3A GR.6. V1,2 100V 3A 0,011KG 2
300 REP 03072456 G6019 SUPPORT ARM, MANUAL # 3D-T/M-T 15KG 2
301 REP 01290456 GE888 SWIVEL ARM,MANUAL E 3D-T/MULTIX 2
TOP
313 03071557 G6019 CONTROL UNIT MAN. D21 HKA D21 0,83KG 1
316 03072704 G6019 Spare part, handles with switch, cpl. Set=2 Pcs. incl. switches, cpl. 1,26KG 2
316A 04683439 B0103 toggle switch 1U 6A 250V BK LOET S34,35 0,03KG 2
318 03073850 G6019 TUBE ASSY.HOUSING 0,85KG 3
319 04870804 G5125 Cover screw M4x17 M4X20 0,004KG 3
320 03072423 G6019 AXIS COVER E FOR HB2 x 3
321 08588865 G5294 PANELLING SCREW, M4x35 M4X35 0,003KG 3
325 08394801 X1122 SUPPORT FLANGE 1,9KG 1
329 03072324 G6019 COVER (2TL,MX,KZ) FOR FR6 1,72KG x 3
331 03070641 G6019 COVER E FOR RSO SCALE 0,018KG 3
332 03073421 G6019 CABLE HOLDER E FOR FR6 0,22KG 3
333 03073272 G6019 CABLE HOLDER, OPER. E FOR FR6 0,28KG 3
334 03520566 screw M4X60/A DIN85-5.8 6980 M4X60/A DIN85 0,1KG 3
335 04819876 G0912 CAP 0,011KG 2
341 03103090 F2010 MAGNETIC BRAKE Y30 1,68KG 1
347 03072134 G6019 Switch striker 0,004KG 2
348 04698650 B0104 MICRO SWITCH 1U 5A 250V DB1C-A1AA S33 0,01KG 2
349 03070666 G6019 INSULATING PLATE 0,002KG 2
361 03071276 G6019 SPARE PART, LEVER CPL. E CPL. 0,23KG 2
361A 03071102 G6019 TRACTION SPRING 0,01KG 2
361B 07045776 F0310 RUBBER BUFFER D 15MM D X 8MM M4 0,011KG 2
362 03070930 G6019 STOP E 0,73KG 2
363 03434453 pressure 2X10X26.5 DIN2098 0,005KG 2
spring2X10X26.5DIN2098-SORTD865
371 03072852 G6019 Repl. Stop, cpl. 0,5KG 2
375 03071284 G6019 Support arm bearing Y32 4,26KG 2
376 03070419 G6019 Stop 0,111KG 2

335
334
332 303
302
333
160 221
331 329
325
319
318
314
See:
AX X-Ray / X-Ray Tubes
316
361B
361A 361
316A 344
See:
341
AX X-Ray / Collimators 89
350
351
362
363
321
320
371
375 New Model !
89 376
302 REP 03072464 G6019 SUPPORT ARM, ACSS # 3D-T/M-T 15KG 2
303 REP 01290464 GE888 SWIVEL ARM,ACSS E 3D-T/MULTIX TOP 34,5KG 2
314 03071649 G6019 CONTROL UNIT D23(ACSS) HKA D23 0,8KG 1
329 03072324 G6019 COVER (2TL,MX,KZ) FOR FR6 1,72KG x 3
335 04819876 G0912 CAP 0,011KG 2
344 03072282 G6019 POTENTIOMETER; KPL. E R30 0,04KG 2
350 07055841 F0705 TOOTHED BELT 0,06KG 1
351 03072076 G6019 BELT 0,01KG 2
362 03070930 G6019 STOP E 0,73KG 2
371 03072852 G6019 Repl. Stop, cpl. 0,5KG 2
376 03070419 G6019 Stop 0,111KG 2

335
334
305
332 304
333
160 221
331 330
325
319
318
315
See:
316
361B
361A 361
316A 346
See:
341
360A 350
360
351
362
342
363
321
320
371
85
375 New Model !
89 84
376
89 03178027 B2228-3 DIODE 30S1 100V 3A GR.6. V1,2,31,32 100V 3A 0,011KG 2
304 REP 03073900 G6019 SUPPORT ARM, TOMOGRAPHY # 20KG 2
3D-T/M-T
305 REP 01290472 GE888 SWIVEL ARM,TOMO E 3D-T/MULTIX TOP 60KG 2
315 03071599 G6019 CONTROL UNIT D22(TOMO) HKA D22 0,74KG 1
330 03072308 G6019 COVER (2TL,MX,LG) FOR FR6 2KG x 3
335 04819876 G0912 CAP 0,011KG 2
340 00474940 G6019 DRIVE MECHANISM M30 CPL. 4,2KG 1
340A 03071250 G6019 E-TL potentiometer drive R31 CPL. 0,093KG 2
342 03070922 G6019 SWITCH PLATE E S30 0,02KG 2
346 03072100 G6019 POTENTIOMETER,CPL. R30 0,32KG 1
350 07055841 F0705 TOOTHED BELT 0,06KG 1
351 03072076 G6019 BELT 0,01KG 2
360 03072035 G6019 GRID MOTOR M31/S31/32, CPL. 0,7KG 1
360A 03072027 G6019 REPL.SWITCH ASSY. S31/32 0,02KG 1
362 03070930 G6019 STOP E 0,73KG 2
371 03072852 G6019 Repl. Stop, cpl. 0,5KG 2
376 03070419 G6019 Stop 0,111KG 2

Support Arm ' MULTIX-Tomo. Mot. / Follow-up Control ' 30 73 918
G6019
335
334
332 306
333
160 221
331 330
325
319
318
315
See:
316
361B
361A 361
316A 346
See:
341
360A 350
360
351
342
321
320
371
85
375
89 84
376
Support Arm ' MULTIX-Tomo. Mot. / Follow-up Control ' 30 73 918
G6019
89 03178027 B2228-3 DIODE 30S1 100V 3A GR.6. V1,2,31,32 100V 3A 0,011KG 2
306 REP 01290498 GE888 SWIVEL ARM, TOMO MOT. E 43,5KG
3D-T/MULTIX TOP
312 03071581 G6019 CONTR.CONSOLE D24 D24 0,73KG 1
330 03072308 G6019 COVER (2TL,MX,LG) FOR FR6 2KG x 3
335 04819876 G0912 CAP 0,011KG 2
340 00474940 G6019 DRIVE MECHANISM M30 CPL. 4,2KG 1
340A 03071250 G6019 E-TL potentiometer drive R31 CPL. 0,093KG 2
342 03070922 G6019 SWITCH PLATE E S30 0,02KG 2
346 03072100 G6019 POTENTIOMETER,CPL. R30 0,32KG 1
350 07055841 F0705 TOOTHED BELT 0,06KG 1
351 03072076 G6019 BELT 0,01KG 2
360 03072035 G6019 GRID MOTOR M31/S31/32, CPL. 0,7KG 1
360A 03072027 G6019 REPL.SWITCH ASSY. S31/32 0,02KG 1
371 03072852 G6019 Repl. Stop, cpl. 0,5KG 2
376 03070419 G6019 Stop 0,111KG 2

331 332 333 335 325
334
160
532
531
319
501
221 500
525
83
516
See:
AX X-Ray / 313
X-Ray Tubes 83
530 519 364
517 349
319 518 348
See: 362
AX X-Ray / Collimators
347
376 361B
361
375
89
361A
371
341
New Model ! 89 519
313 03071557 G6019 CONTROL UNIT MAN. D21 HKA D21 0,83KG 1
335 04819876 G0912 CAP 0,011KG 2
347 03072134 G6019 Switch striker 0,004KG 2
348 04698650 B0104 MICRO SWITCH 1U 5A 250V DB1C-A1AA S33 0,01KG 2
349 03070666 G6019 INSULATING PLATE 0,002KG 2
362 03070930 G6019 STOP E 0,73KG 2
364 03434776 COMPRESSION SPRING 1.25X10.0X44.5 1,25X10,0X44,5 DIN2098 0,003KG 2
DIN209
371 03072852 G6019 Repl. Stop, cpl. 0,5KG 2
376 03070419 G6019 Stop 0,111KG 2
500 REP 03072472 G6019 SUPPORT ARM, MANUAL # 3D-T/S. 15KG 2
501 REP 01290506 GE888 SWIVEL ARM,MAN E 3D-T/SIRESKOP SX 2
516 03071433 G6019 Spare part, short handles, cpl. Set=2 Pcs. 0,6KG 2
517 03073868 G6019 FRONT FRAME E FOR HZM 0,3KG 3
518 03073827 G6019 CONTROL BOX E 2,12KG 3
519 04816518 F0707 TENSIONING ELEMENTS 40X 45 RFN 8006 0,01KG 2
525 03072316 G6019 COVER (2-PIECE;KZ) FOR FR6 1,69KG x 3
530 03072142 G6019 TUBE COVER-SET 3 PARTS FOR FR6 2,29KG x 3
531 03072639 G6019 tube casing 1KG x 3
532 03072647 G6019 FASTENING ANGLE 0,18KG 3


Pos.909 . . . Pos.967 without Drawing !

ID Part-No. Type Description Comment Weight
909 03073777 G6019 CORRUG.HOSE,ASSEMBLED, CPL. WITH CABLES 64KG
MAN. MULTIX/SIRESKOP SX MAN.
ACSS MULTIX/SIRESKOP SX ACSS
TOMO MULTIX/SIRESKOP SX TOMO
MULTIX/SIR.SX TOMO.MOT.
920 03467958 VACUFLEX HOSE NW 60 METERWARE 1,139KG
926 04466488 RH098 High-voltage cable, 24 M 24 M 13,3KG
930 03753493 G5440 Stator cable kit 30m 4,8KG
931 05569798 Y0388 Connecting cable, Diamentor 30 M 1,7KG
(A30A) 30m
932 03121386 G2136 CABLE,OIL PRESS.SWITCH 1,5KG
933 04674842 B0999 CABLE 350MM FOR ENCODER 0,01KG
934 01588339 CABLE LIYCY4X0,50 4X0,5 METERWARE 0,071KG
SRN7804-
936 03471331 CABLE LIYCY3X0,25 3X0,25 METERWARE 0,036KG
SRN7804-
937 01591143 CABLE LIY(FA)Y2X2X0,22 2X2X0,22 METERWARE 0,051KG
SRN7804-
938 03447034 CABLE L-YCY4X1 SRN7804- 4X1 METERWARE 0,087KG
"MOTOR
950 03163946 B1940-16 CASING 2X5POL MOD4 RV 2X5POL. 0,001KG
O.RG 7 GE
951 07737539 B1940 FEM.CONNECT.HOUSING 2X5POL. 0,01KG
952 07737547 B1940 FEM.CONNECT.HOUSING 2X8POL. 0,002KG
953 03107307 B1940 CONNECTOR BUSHING AU MOD4 0,2-0,56 0,01KG
954 03040664 B1945 BUSHING HOUSING 16POL. 0,013KG
955 01039825 B1940-3 CONNECTOR BUSHING AU III+ 0,2-0,56 0,002KG
956 03150869 B1940 CONNECTOR BUSHING AU III+ 0,75-1,52 0,001KG
957 03136504 B1940-76 HOUSING F EB OFH 2POL. 0,03KG
958 03136769 B1940 HOUSING OPEN,HG 3POL. 0,003KG
959 03136777 B1940 HOUSING,F EB OFH 3POL. 0,02KG
960 06822829 B1940-76 BUSH HOUSING 6 POL 6POL. 0,007KG
961 03138682 B1940 HOUSING,OPEN HG 6POL. 0,005KG
962 06849897 B1940-76 HOUSING,OPEN HG 12POL. 1KG
963 06849905 B1940-76 CASING F EB OFH 12POL 12POL. 0,012KG
MNL RV MKS E27*2
964 07752355 B1940 CONNECTOR BUSHING 0,2-0,8 0,008KG
965 06888515 B1940-76 CONNECTOR BUSHING 0,5-2,1 0,011KG
966 06919542 B1940-76 CONNECTOR PIN 0,5-2,1 0,012KG
967 03074163 G6019 CABLE SET FD, along FOR MULTIX FD/VERTIX FD INCL.CABLE F.PAT.-DISPLAY 1,08KG

Installation Material 87 63 872 G2122 + ABSOLUTE VALUE GIVER
4M
990
990
990
991

Installation Material 87 63 872 G2122 + ABSOLUTE VALUE GIVER
4M
990 08763872 G2122 INSTALLATION MATERIAL 111KG 3
08767311 G2122 POINTER 0,021KG 3
05201827 TWIST DRILL 12 DIN338 0,12KG 3
08765489 G2122 BORING TEMPLATE 1,4KG 3
08768319 G2122 STEP DRILL 0,6KG 3
07047079 F1612 HOIST 500 KG 500KG 9,2KG 3
991 03072217 G6019 ABSOLUTE VALUE GIVER, CPL. 4 METER 20KG 3


Toshiba T Rad Plus CMT Installation and Service Manual

Uploaded by

Document Information

Original Title

Copyright

Available Formats

Share this document

Share or Embed Document

Sharing Options

Did you find this document useful?

Is this content inappropriate?

Copyright:

Available Formats

Toshiba T Rad Plus CMT Installation and Service Manual

Uploaded by

Copyright:

Available Formats

Model RS-580 Series

“CMT” Ceiling Mounted

Installation and Service Manual

Manual Part No. DC30-019 Revision E

Copyright© 2003 By QMI

Quantum Medical Imaging, LLC

REVISION DATE TYPE OF MODIFICATION

A 12/15/00 Initial Release.

B 9/17/02 Added Trunnion Ring installation sheet, Hi-

C 11/8/02 Added brake adjustment instructions, PS-6,

D 2/6/03 Made operating instructions separte manual

E 5/1/03 Replaced trunnion install procedure, added

SECTION 1 3D TOP Ceiling Stand Planning Guide

SECTION 2 3D-TOP Overhead Support Installation Instructions

SECTION 3 Hi Voltage Cable Installation Instructions

SECTION 4 Quantum Medical Imaging CMT RS-580 Interconnection Diagram

SECTION 5 MULTIX TOP Adjustment Instructions

SECTION 6 MULTIX TOP Maintenance Instructions

SECTION 7 Overhead Support 3D TOP Parts Lists

NOTE: The following pages contain planning, installation, startup,

THIS PAGE INTENTIONALLY LEFT BLANK

3D TOP Ceiling Stand

Chapter Page Revision

3D TOP Ceiling Stand RX22-040.021.01 Page 2 of 4 Siemens AG

2 _______Room Planning ________________________________________________ 2 - 1

Dimensions of 3D TOP for MULTIX . . . . . . . . . . . . . . . . . . . . . . . . . . .2 - 1

4 _______System Connections ____________________________________________ 4 - 1

Notes on cable run . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .4 -1

5 _______Technical Data _________________________________________________ 5 - 1

Siemens AG RX22-040.021.01 Page 3 of 4 Ceiling stand 3D TOP

7 ______ Changes to Previous Version _____________________________________7 - 1

Ceiling stand 3D TOP RX22-040.021.01 Page 4 of 4 Siemens AG

- Unless otherwise specified, all dimensions are indicated in "mm".

- This symbol indicates a change (see revision status).

Hotline + 49 (9191) 18 - 8080

Siemens AG RX22-040.021.01 Page 1 of 2 Ceiling stand 3D TOP

- The system has been developed according to EN60601 - 1.

- Basic imperviousness to electromagnetic interference.

Ceiling stand 3D TOP RX22-040.021.01 Page 2 of 2 Siemens AG

Corrugated hose Cable outlet

Ceiling stand 3D TOP

Upper edge of spacer

Ceiling stand 3D TOP

Focus Support arm Transverse

*1 When configured with a telescope

Useful range of 3D TOP for MULTIX 2

Siemens AG RX22-040.021.01 Page 3 of 12 Ceiling stand 3D TOP

Useful range of 3D TOP for MULTIX 2

with 3 m transverse carriage

Ceiling stand 3D TOP RX22-040.021.01 Page 4 of 12 Siemens AG

Useful range of 3D TOP for MULTIX 2

Siemens AG RX22-040.021.01 Page 5 of 12 Ceiling stand 3D TOP

Useful range of 3D TOP for MULTIX 2

with 4 m transverse carriage

Operator Transverse bridge

Ceiling stand 3D TOP RX22-040.021.01 Page 6 of 12 Siemens AG

Dimensions of 3D TOP for MULTIX 2

with Tomo Device

Transverse Corrugated hose

Upper edge of spacer

Film plane Catapult Bucky

Siemens AG RX22-040.021.01 Page 7 of 12 Ceiling stand 3D TOP

Useful range of 3D TOP for SIRESKOP SX 2

2 _Room Planning __________________________________________ 2 - 1

4 _System Connections ______________________________________ 4 - 1

5 _Technical Data ___________________________________________ 5 - 1

7 Changes to Previous Version _______________________________7 - 1