Professional Documents
Culture Documents
m m
0XaBdaRWPaVT4gcaPXU0__[XRPQ[T
=4F34;78CD4B30HB4?C4<14A !'!! *?064B !C"
CB8251D
B1:1CD81>
2I'G93;5DC
!"C@?BD
fffSPX[h_X^]TTaR^\
D4d]R^dRcSZecRcjTYR_XV .LVDQ%KDUDW%DQGK5RDG
Z_?66EdaVTZR]Zejdj]]RSfd UDLOZD\WUDIILFJULQGVWRKDOW ?=BQ =4F34;78270=3860A7
$XWKRULWLHVFDQ¶W
;D2:=>F:>;:0C0
MXVWLILFDWLRQ6&
blocked highways and dis-
rupted railway traffic at many
places across the country.
?=BQ =4F34;78 The 10-hour bandh called
by farmers’ body Samyukta
IonnCentre,
a stinging snub to the
the Supreme Court
Monday warned that it may
Kisan Morcha (SKM) hit nor-
mal life in Punjab and Haryana
as 50 trains were cancelled,
pass strictures if it is not satis- highways and key roads
fied with justification for the blocked. Flow of traffic at
last-minute changes to the Delhi’s borders with Uttar
NEET Super Speciality Pradesh and Haryana was
Examination 2021 syllabus. affected, but shops and busi-
The court also asked the Centre nesses remained open.
not to treat “young doctors as The impact of bandh was
football in the game of power.” A bench of Justices DY “But as per the notification felt the most around Delhi, 5Pa\TabQ[^RZcWTaPX[fPhcaPRZbSdaX]VcWTXa³1WPaPc1P]SW´PVPX]bc2T]caP[6^eTa]\T]c´bcWaTTUPa\aTU^a\[PfbPc3TeX3Pbb
Asserting that it will not Chandrachud and BV issued on August 31 for mod- Punjab, Haryana and western ?daP^]cWT^dcbZXacb^U0\aXcbPa^]<^]SPh ?C8
allow these young doctors to be Nagarathna asked Additional ifying the pattern of examina- Uttar Pradesh and also in large
placed in the hands of some
insensitive bureaucrats, the
Solicitor General Aishwarya
Bhati, appearing for the Centre,
tion, 100 per cent marks will
now be given on questions
pockets of Kerala, Bihar,
Jharkhand, West Bengal and
no discussions
happening.”
are
8<?02C>5270::090<
court asked the Ministry of to hold a meeting with the from general medicines,” they Odisha. The massive jams pre- The SKM termed it a his-
Health and Family Welfare other two authorities within a said. vented the cross border move- toric bandh as there was an \] 0Q^dc$caPX]bRP]RT[[TS
(MoHFW), National Medical week. Senior advocate Shyam ment of commuters as well as unprecedented response from \] 8]3T[WX\PaZTcbaT\PX]TS^_T]QdcQdbX]TbbPRcXeXcXTbfTaT
Commission (NMC) and “Better come with some Divan, who represented the trucks carrying essentials. The every part of the country. [PaVT[hd]PUUTRcTScW^dVW\PbbXeTcaPUUXRb]Pa[bfTaTfXc]TbbTSX]
National Board of Examination strong reasons, and if we are doctors, said that there is blockade was lifted at 4 pm. “Crores of farmers came Q^aSTaPaTPbSdTc^a^PSQ[^RZPSTb
(NBE) to “put their house in not satisfied, we will pass stric- insensitive bureaucrats,” it urgency in the matter and they Bharatiya Kisan Union together in a show of unity and \] CWTQP]SWWXc]^a\P[[XUTX]?d]YPQP]S7PahP]PPb_a^cTbcTab
order”. tures,” it said. added. have filed a written submission (BKU) leader Rakesh Tikait solidarity,” it said. Q[^RZTSWXVWfPhbP]Sb`dPccTS^]aPX[fPhcaPRZbPc\P]h_[PRTbX]
The court was hearing a “Don’t treat these young In their plea, the doctors also in the matter. said, “Our Bharat Bandh was The Delhi-NCR region, cWTcf^]^acWTa]BcPcTb
plea from 41 postgraduate doc- doctors as footballs in the pointed out as per the prevail- Advocate Gaurav Sharma, successful. We had the full including the satellite towns of
tors who have challenged the game of power. Hold the meet- ing pattern of examination, 60 appearing for NMC, said he support of farmers…We can’t Gurgaon, Ghaziabad and \] =^a\P[[XUTfPbPUUTRcTSX]1XWPa9WPaZWP]S FTbc1T]VP[
last-minute changes made to ing and put your house in per cent marks are given on would like to file reply in the seal down everything as we Noida, was particularly hit as >SXbWP:TaP[P2WWPccXbVPaW?dSdRWTaahCP\X[=PSd
the syllabus after the notifica- order. We will not allow the questions from super speciali- matter and sought adjourn- have to facilitate the movement cross-border movement was \] CWTQP]SWUPX[TSc^Te^ZTP]haTb_^]bTX]0ad]PRWP[?aPSTbW
tion for examination was lives of these young doctors to ty courses while 40 per cent on ment of one week. of people. We are ready for badly crippled. 0bbP\fWX[TXcWPS[dZTfPa\aTb_^]bTX]<PSWhP?aPSTbW6^P
issued. be placed in the hands of some questions from other courses. Continued on Page 2 talks with the Government but Continued on Page 2 :Pa]PcPZP0]SWaP?aPSTbW
20?BD;4
3>?4C4BCB>=5;867C
2A4F5A><!!!)3620
=Tf3T[WX) 5^acWTUXabccX\TX]
3XVXcP[83bP]Tf_WPbT 8]SXPX\_^acP]c_[PhTaX] De`aSja`]]d
UV^R_Ud5Z]Za
^UWTP[cWUPRX[XcXTb) <^SX8]S^?PRXUXR)6Ta\P]4]e^h
8]SXPcWT3XaTRc^aPcT6T]TaP[^U
2XeX[0eXPcX^]3620
P]]^d]RTS^]<^]SPhPad[T 8Y`dYRWeVc
cWPc_X[^cbRaTf\T\QTabP]S
PXacaPUUXRR^]ca^[[Tab0C2>b
µ?Vh3Vc]Z_8`ge E>4ReeRT\
fX[[UPRTaP]S^\S^_TcTbcb
A>]Rf_TYVd5ZXZeR]
Ua^\9P]dPah" !!!CWT
]Tfad[TbaT`dXaTcWPcPc[TPbc e`T`_eZ_fVe` B0D60AB4=6D?C0Q :>;:0C0
9VR]eY>ZddZ`_
^UcWTbT_Tab^]]T[X]cWT
^aVP]XbPcX^]QTcTbcTSP]]dP[[h YRgVdec`_XeZVd B JP national vice-president
Dilip Ghosh on Monday
?=BQ =4F34;78 demanded countermanding of
4G6>02<50;48A>
A4B86=B5A><2>=6 rime Minister Narendra
hZeY?Vh5V]YZ¶ the election process at
Bhawanipore after an alleged
?P]PYX) 5^a\Ta2<^U6^PP]S
2^]VaTbbeTcTaP];dXiX]W^
P Modi on Monday launched
the Pradhan Mantri Digital
?=BQ =4F34;78 gang of Trinamool Congress
men attacked him and BJP
5P[TXa^aTbXV]TSPbP]<;0P]S Health Mission (PM-DHM) ith the Quad emerging as workers wounding two of them
P_aX\Pah\T\QTa^UcWT_Pach
R[PX\X]VcWTBcPcT_Pachd]XcXb
which will ensure that every cit-
izen in India has a separate
?aX\T<X]XbcTa=PaT]SaP<^SXPSSaTbbTbPccWT[Pd]RW^UcWT0hdbW\P]1WPaPc W a major grouping amid
China’s growing assertiveness
seriously.
Ghosh, who was heckled
3XVXcP[<XbbX^]cWa^dVWeXST^R^]UTaT]RX]VX]=Tf3T[WX^]<^]SPh ?C8
ad]QhP°R^cTaXT±^U[TPSTab health ID containing all in the Indo-Pacific region, by the crowd too, escaped
TeT]PbWT_aPXbTSC<2RWXTU health details. Germany on Monday said unhurt after his security per-
<P\PcP1P]TaYTT While launching the (Ayushman Bharat Digital laid down in the form of Jan India is becoming an important 6Ta\P]0\QPbbPS^aFP[cTa9;X]S]Ta 5X[T_W^c^ sonnel pulled out guns and
Ayushman Bharat digital mis- Mission) from the ramparts of Dhan, Aadhaar and Mobile player in that region, and the escorted him to safety. Ghosh
<0=F0=C438=34;78 sion, Modi said, “The drive to the Red Fort. (JAM) trinity, and other digi- next coalition Government in likely to continue. announced that she will not had gone to Bhawanipore to
A8>CB20B4B74;3 strengthen the health facilities Union Health Minister tal initiatives of the Berlin is expected to continue “None of the global issues seek a fresh term at the helm of campaign for party candidate
=Tf3T[WX) 0!(hTPa^[S\P] of the country, in the last 7 Mansukh Madaviya, who was Government, PM-DHM will strong ties with New Delhi. can be solved without India, be the country. According to Priyanka Tibrewal who is con-
fP]cTSX]bTeTaP[RPbTbaT[PcTS years, is entering a new phase present on the occasion, said, create a seamless online plat- These remarks by German it climate change, global warm- reports, Social Democrats testing against Chief Minister
c^[PbchTPa³b=^acWTPbc3T[WX today. This is not an ordinary “I believe that this will bring a form through the provision of envoy to India Walter J Lindner ing, trade issues, Covid-19 vac- (SPD) was ahead of the ruling Mamata Banerjee who is seek-
aX^cbWPbQTT]PaaTbcTSUa^\ phase. This is an revolutionary change in the a wide range of data, informa- came as a new coalition cination and terrorism...India conservative bloc of Merkel in ing election to the Assembly.
1d[P]SbWPWaX]DccPa?aPSTbW extraordinary phase.” health sector.” tion, and infrastructure ser- Government is expected to is important for us,” he told the federal elections. Mamata, who contested
The nationwide rollout of Currently, over one lakh vices, duly leveraging open, assume charge in his country reporters. “The Indo-Pacific is from Nandigram Assembly
8=380C4BCB³0:0B7 PM-DHM coincides with the unique health IDs have been interoperable, standards-based soon. His comments came as the becoming more and more constituency was defeated by
?A8<4´<8BB8;4 National Health Authority created under the National digital systems while ensuring The German envoy said federal elections in Germany important and India has BJP’s Suvendu Adhikari in the
=Tf3T[WX) 0]TfeTabX^]^U (NHA) celebrating the third Digital Health Mission the security, confidentiality, relations between India and marked the end of Angela emerged as a major player in April-May elections by a mar-
cWT0ZPbW<XbbX[T¯ ²0ZPbW anniversary of Ayushman (NDHM), which was initially and privacy of health-related Germany saw a significant Merkel’s 16-year tenure as the the region,” the German envoy gin of 1,900 votes, needs get
?aX\T³fPbbdRRTbbUd[[hcTbcTS Bharat Pradhan Mantri Jan launched across six States and personal information, said a upswing, including in areas of Chancellor, a period that saw said. On Afghanistan, he said elected to the Assembly with-
Ua^\cWT8]cTVaPcTSCTbcAP]VT Arogya Yojana (AB PM-JAY). Union Territories on a senior official from the Union trade and investment, in the significant expansion of India- there was a need to address the in six months of swearing in as
Pc>SXbWP³b2WP]SX_da^] On August 15, 2020, Modi pilot basis. Health Ministry. last over one decade and that Germany ties. need for humanitarian assis- the Chief Minister.
<^]SPhPcPa^d]S#)"_\ had announced the mission Based on the foundations Continued on Page 2 the upward trajectory in ties is Merkel has already tance in the country. Continued on Page 2
XbbdTSP]h
From Page 1
The key components of $PD]RQ
CAIT chief Praveen
Khandelwal said. In its state-
ment Amazon also highlight-
al.” Asked about the comments
of the RSS, Pawan Khera said,
“What the RSS says about
RcSZecRcj last minute change?”
Singh said that change in
syllabus was in the offing for
PM-DHM include a health ed its export program, which it Amazon is irrelevant because From Page 1 From Page 1 quite some time and prepara-
QP[P]RTbWTTcU^a ID-unique — 14-digit health
identification — for every cit-
From Page 1
CAIT said it “greatly appre-
said had helped over 70,000
Indian businesses -- many from
there is a duet going on
between the RSS and the BJP.
Speaking to the media
Ghosh said, “Today when I was
The bench asked him, “Mr
Sharma, what is the NMC
tion was on since 2018 and the
authorities concerned have
[Pbc%Hab)6d_cP
izen that will also work as their ciated” the cover story and that smaller cities and towns -- sell We have seen that duet and campaigning in parts of doing? We are dealing with the tried to take care of the diffi-
health account. The national it “corroborated” the group’s “made in India” products they stand exposed in the Bhawanipore constituency with lives of young doctors who will culties.
Health ID will be a repository claims that Amazon and across the world. “Amazon’s farmers’ agitation. We have four men scores of TMC peo- pursue super speciality cours- “Kindly give us one week,
of all health-related informa- Flipkart are “trying to become exports program is witnessing seen the dubious role played by ple collected in the area in fact es. You have issued the notifi- we will explain everything,” he
BC055A4?>AC4AQ =4F34;78 tion of a person. The health ID second edition of East India rapid momentum... today there the Bharatiya Kisan Sangh as it they were following us from the cation for examination on July said.
will enable access and exchange Company in India”. are 70,000+ exporters from has not come in support of the beginning, they started raising 23 and then changed the syl- The bench told the senior
he Delhi Bhartiya Janata of longitudinal health records “This is exactly what East metros as well as Tier II, III and farmers even for one day in the slogans against us and then labus on August 31. What is counsel, “We are ready to hear
T Party (BJP) president,
Adesh Gupta, on Monday
of citizens with their consent.
This health account will
India Company did... both IV cities, selling crores of ‘made last 10 months.” attacked me. I was pushed
around my security personnel
this? They are to sit for exam-
inations on November 13 and
you but tell the authorities
that we are unsatisfied with the
alleged that in the past six years, contain details of every test, were beaten and two-three of 14.” way the last minute changes
ruling Aam Aadmi Party
(AAP) has made Delhi Jal
every disease, the doctors vis-
ited, the medicines taken, and
.LVDQ%KDUDW Noida Direct (DND) flyway
also witnessed massive traffic
the bandh period, while shops
and other commercial estab-
our workers were thrown to the
ground and beaten up merci-
Senior advocate Maninder
Singh, appearing for NBE, said
were made. We are putting you
on notice in advance that if we
Board (DJB), Public Works
Department (PWD) and Flood
the diagnosis, said the official.
This information will be %DQGK5RDG congestion. Hundreds of peo-
ple had to spend restless hours
lishments remained shut at
most places. National and
lessly. One of them has been
hospitalised in a serious con-
they be given time to file the
reply till next Monday, as there
don’t agree with your justifica-
tion, we will pass strictures and
Department tools of corrup- very useful as it is portable and in their stranded vehicles as State highways in several dis- dition. This cannot go on the were suitable reasons for doing we will deal with you”. “Just
tion. easily accessible even if the From Page 1 chaos reigned on the busiest tricts, including Amritsar, Election Commission owes a the changes and authorities because someone has the
The BJP leader, Gupta said patient shifts to the new place Delhi itself was mostly roads connecting the national Rupnagar, Jalandhar, responsibility and I will ask were well aware of the diffi- authority to wield power does
that the Jal Board’s nonperfor- and visits a new doctor, he unaffected as markets Capital and neighbouring Pathankot, Sangrur, Mohali, them to countermand the polls culties of the students and they not mean that he can wield
mance and corruption are at added. The Health ID is creat- remained open and business States and rail traffic was dis- Ludhiana, Ferozepur, Bathinda, which is turning out to be a made changes after approvals power without application of
peak as since 2015, DJB has ed by using a person’s basic activities were largely unaf- rupted. were blocked by the protesters. farce because none of our men of the three authorities con- mind. When you yourself
taken loan worth C60,000 details and mobile number or fected, but there was chaos at In both Punjab and Delhi-Amritsar National or leaders are being allowed to cerned. issued notification for exami-
crores in past seven to eight Aadhaar number. Personal its borders with traffic as vehi- Haryana, national highways, Highway was blocked at campaign from the day go.” The bench said, “Why the nation in July, then what was
years but has not given any util- health records can be linked cles entering the national State highways, link road and Shahabad in Har yana’s Party MP Arjun Singh too notification for examination the need to rock the boat in
ity account for it. “The situation and viewed with the help of a Capital were checked by Delhi railway tracks were severally Kurukshetra. The protesters was heckled at a different place was issued Mr Singh? Why August? Please talk to MoHFW
is so bad that recently Delhi mobile application, a Police and paramilitary jawans. blocked, bringing road and also blocked highways in Sirsa, and was forced to return with- cannot it happen next year? and NMC and put your house
High Court took note of it and Healthcare Professionals Delhi-Gurugram border rail traffic to a halt. Fatehabad, Panipat, Hisar, out campaigning he said. You see, students start prepar- in order,” the Court said.
asked DJB about its missing Registr y (HPR), and witnessed a massive 1.5 km The shutdown was almost Charkhi Dadri, Karnal, Kaithal,
accounts,” Gupta said. Healthcare Facilities Registries traffic jam in the morning due complete in Punjab with trans- Rohtak, Jhajjar and Panchkula
(HFR). to police barricades. The Delhi port services suspended during districts. In nearby Patiala in was no promise at all. We only payment?”
Punjab, too, members of the
BKU-Ugrahan sat on the tracks
to register their protest.
72bcPhb said please follow the statement
of the Prime Minister. We said
to the landlords (that) do not
The senior counsel
responded saying “only if the
situation so demanded”.
^aSTaPbZX]V coerce tenants to pay rent..And
even if, to some extent, the
Lawyer Gaurav Jain, repre-
senting the petitioners -- daily
3T[WX
poor do not find the means to wagers and workers who
pay, the Government will look sought to enforce the promise
into it,” he stated. before the single judge,
Taking note of his submis- opposed the grant of any order
sion, the bench said “so you of stay. He said his clients have
From Page 1 have no intention to make the no means to pay the rent
Accordingly to me, there payment? Even five per cent amount.
4`gZUTRfdVU 3T[WX6^ec[Pd]RWTb
²3TZW^<TaX3X[[X³
SZXXVde P__c^Q^^bc
From Page 1
The greatest reduction
c^daXb\X]2P_XcP[
was that of American men,
whose life expectancy declined BC055A4?>AC4AQ =4F34;78
by 2.2 years compared to 2019.
Overall, in 15 countries, iming to promote tourism
the life expectancy of men was
reduced by a year, while the
A in Delhi, the city
Government on Monday
same happened for women in launched ‘Dekho Meri Dilli’, a
11 countries. A stark difference mobile app where users will
highlighted by the study was have all details about popular
that in the US, the deaths of tourist destinations, hotels,
working-age people and of restaurants, food joints and
those under 60 contributed heritage sites.
most to high mortality rates, During the launch, Chief
while in Europe, the deaths of Minister Arvind Kejriwal said
people aged over 60 were on that the Delhi government is
the higher side. putting its best foot forward to
promote tourism and the app
will prove to be a game-chang-
er. “Delhi Government will
take tourism to a never-imag-
ined height in Delhi and peo-
ple will want to stay for longer
and spend more on the busi-
nesses of Delhiites.”
“Congratulations to every-
one as we dedicate this unique
app to the people to celebrate
the World Tourism Day.
This app will turn out to
be extremely useful to all the
people who come to Delhi
from all over the world.
Delhi is a historical but a
very modern city in itself. If
anyone wants to understand
the history of this country,
they can not do it without com-
ing to Delhi.
$OWKRXJKHYHU\SRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHO\IRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULW\RIRUELQGLQJLQDQ\ZD\RQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQ\UHVSRQVLELOLW\IRUDQ\
GDPDJHRUORVVWRDQ\SHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQ\DFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO\5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULI\DQGVHHNDSSURSULDWHDGYLFHWRVDWLVI\WKHPVHOYHVDERXWWKHYHUDFLW\RIDQ\NLQGRIDGYHUWLVHPHQWEHIRUH
UHVSRQGLQJWRDQ\FRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQ\HPSOR\HHRIWKH3LRQHHU*URXS·VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQ\NLQGRIFODLPPDGHE\WKHDGYHUWLVHUVRIWKHSURGXFWV VHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQ\NLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV
',36KDEGDUWKG
=4F34;78kCD4B30H kB4?C4<14A!'!! ]PcX^]#
@aaYV]ad3YRcRe3R_UYZ_<VcR]R @b_dUSdYTU^dYdYUcY^@?C8SQcUc*83
:D<0A274;;0??0=Q :>278 extended weekend. “Had it eration in making the shut Bundh calls by political parties
C=A067D=0C70Q <D<108 to protect the identities of the
parties from disclosure, even
cate Abha Singh.
“This order, setting out a
referred to by their names but
only as Plaintiff, Defendant No.1
been held on Tuesday or on down a success. was made by G Vijaya he Bombay High Court has accidental disclosure, in these working protocol for future etc” The HC has restricted all
7PaSTT_BX]VW?daX 3XSXXbUPRTPVPX]bc<^SX)3TQ
[Pd]RWTb²BfPRWRWW PUcTaQTR^\X]VC<2 AB<?
BdaeTZbWP]!!! B0D60AB4=6D?C0 Q :>;:0C0
<PWPAB Qh_^[[b)APYP]X\PhQTT[TRcTSd]^__^bTS
C=A067D=0C70Q <D<108 from the RS by-poll fray, date for the RS by-polls, ahead family, especially party presi-
Maharashtra BJP president of Rajeev’s widow Pradnya dent Sonia Gandhi.
ongress’ former MP and Chandrakant Patil said: Satav, who had lobbied with the After the state Congress
C AICC general secretary
Rajani Patil on Monday
“Keeping in view the request
made by the Congress leaders
party leadership for nomina-
tion, veteran party leader
leaders Patole and Thorat met
Fadnavis and requested the
appeared poised to get elected and tradition followed in the Sushilkumar Shinde, party gen- latter to withdraw his party’s
unopposed to the Rajya Sabha elections held after the death of eral secretary Mukul Wasnik candidate to ensure the election
in the elections scheduled for a sitting member, we withdrew himself, former Rajasthan state of Rajani Patil unopposed,
October 4 after the Opposition our candidate Sanjay Upadhyay in charge Avinash Pande, for- there was intense speculation in
BJP responded to the ruling from the RS poll fray”. mer MP Rajiv Shukla and for- the media that the BJP had
party’s call and withdrew its The October 4 by-election mer union minister Milind reportedly offered to support to
candidate Sanjay Upadhyay to one RS seat from Deora. the Congress candidate on a
keeping in view with the polit- Maharashtra has been necessi- Sixty-two-year-old condition that in lieu of its sup-
ical traditions followed in the tated by the untimely demise of Rajanitai – as she is known in port, the MVA Government
state sitting Congress member the state political circles -- is withdraw the suspension of 12
The BJP’s decision to with- Rajeev Satav who died because currently the All India of its MLAs who were acted
draw its candidate from RS poll of Covid-19 complications on Congress Committee (AICC) against when they “abused”
fray came four days after May 16 this year. in-charge for Jammu and and “misbehaved” with the
State Congress president On its part, the BJP had Kashmir. She was elected unop- presiding officer inside and
Nana Patole and senior state earlier said that in the first place posed to the Rajya Sabha in outside the State Assembly in
Congress minister Balasaheb it would not have fielded a can- 2013. In 1996, Patil had won July this year.
Thorat met former chief min- didate if the Congress were to the Beed Lok Sabha seat in It may be recalled that on
ister and current leader of the put up a candidate from Satav’s Maharashtra for the Congress. July 5, as many as 12 BJP
Opposition Devendra Fadnavis family member and that the She had replaced AICC gener- MLAs were suspended from
at the latter’s Mumbai residence ruling party had instead nom- al secretar y and former the Maharashtra Assembly on
and requested him to ensure inated a former MP for the seat. Maharashtra chief minister Monday for a period of one
the election of their party can- The Congress high com- Shushil Kumar Shinde as the year “abusing” and “misbehav-
didate Rajani Patil unopposed. mand has chosen Rajani Patil, in-charge for Himachal in ing” with the presiding officer
Announcing the with- who is a Gandhi-Nehru fami- September, 2018 Patil enjoys inside and outside the
drawal of his party’s candidate ly loyalist, as the party candi- close rapport with the Gandhi House.
=4F34;78kCD4B30H kB4?C4<14A!'!!
%
gggTQY\i`Y_^UUbS_]
7KHKLVWRU\RIWKH
UPRTQ^^ZR^\SPX[h_X^]TTak /CWT3PX[h?X^]TTak X]bcPVaP\R^\SPX[h_X^]TTa
A2A6CH:E9A2DD:@?
:_Yf^R_V
'DOLWVLQ,QGLDOLYHLQDVRUU\VWDWH
ZKHWKHULWLVVSRNHQDERXWRUQRW $VVDPSUREOHP @B16E<<6>A0380
,
QWKHVWFHQWXU\ZKLOH,QGLDSODQVWRUHDFKWKH0RRQDQG0DUV'DOLWVFDQQRWDIIRUG
WRJRDKXQGUHG\DUGVULGLQJDKRUVH,QDFRXQWU\WKDWWKH*RYHUQPHQWZDQWVWR
PDNHVHOIUHOLDQWDVDZD\RXWRILWVHFRQRPLFPRUDVV'DOLWVGDUHQRWPDNHWKHP
CWTcP[T^UX[[TVP[\XVaP]cbX]c^0bbP\Xb^[Sc^[SQhP[[^QbTaeTabQdc
VHOYHV´DDWPDQLUEKDUµ:KDWLVDPRUHXQQHUYLQJDVSHFWRIRXUXOWUDPRGHUQVRFLHW\
LVWKHLQJORULRXVIDFWWKDWWKH*RYHUQPHQWDXWKRULWLHVDUHDVZHVSHDNIRUPDOO\VHDUFK
bfT_cd]STacWTRPa_TcQhcWT2^]VaTbbP]SXcb<db[X\bd__^acTab
LQJIRUKDPOHWVDQGYLOODJHVZKHUHXQWRXFKDELOLW\LVVWLOOSUDFWLVHGZLWKWZRKRRWVWR hat happened in
WKHODZ7KHVHDUFKIROORZVWZRTXLFNLQFLGHQWVRIXQWRXFKDELOLW\UHSRUWHGIURPWKH
.RSSDOGLVWULFWRI.DUQDWDNDZLWKLQDIRUWQLJKW,QWKHILUVWLQVWDQFHD'DOLWIDPLO\ZDV
ILQHGCE\XSSHUFDVWHYLOODJHHOGHUVEHFDXVHWKHLUWKUHH\HDUROGFKLOGHQWHUHG
DWHPSOH'DOLWVDUHEDQQHGIURPHQWHULQJWKHWHPSOHLQWKDWYLOODJH,QWKHVHFRQGLQFL
W Darrang district a
few days ago, where-
by two alleged infil-
trators were killed, was sad but
reflected the historic agony of the
GHQWD'DOLW\RXWKZDVDVNHGWRSD\CIRUHQWHULQJDWHPSOHLQDQRWKHUYLOODJH Assamese people. Under the
Government of India Act of 1935,
7KHILQHZRXOGEHXVHGWRSXULI\WKHWHPSOHWKHXSSHU provincial governments were
FDVWHYLOODJHUVWROGKLP7KHVHLQFLGHQWVDUHQRWQHZ formed by political parties. Soon
7KH\KDSSHQGLPHDGR]HQLQPRVW,QGLDQ6WDWHV enough, a Sir Mohammed
'DOLWVKDYHQRULJKWWRZRUVKLSEHOLHYHFHOHEUDWHRU Saadulla of the Muslim League
became the Premier. In the 1937
FUHPDWHWKHLUGHDGRQSXEOLFSURSHUW\EHFDXVHWKH elections, the League led by MA
XSSHUFDVWHVWUHDWDOOSXEOLFSURSHUW\DVILHIDQGWKH Jinnah was disappointed with its
'DOLWVKDYHQRQHLQWKHLUQDPHV meagre winnings in UP, the largest
+RZHYHUZKDWLVVWDUWOLQJLVWKH.RSSDODGPLQ province. Talk of a distinctly sep-
arate Muslim holy land began in
LVWUDWLRQWHOOLQJWKHPHGLDWKDWXQWRXFKDELOLW\LVVWLOO seriousness.
SUDFWLVHGLQYLOODJHVLQWKDWGLVWULFW7KHYHU\ The idea was first concretely
DGPLVVLRQ RI VXFK D IDFW LV YLRODWLYH RI WKH mooted by the poet Iqbal who
&RQVWLWXWLRQEXWDOOWKDWWKHDGPLQLVWUDWLRQDQGWKH presided over the 1930 League ses-
sion at Allahabad. A few years
SROLFHDUHZLOOLQJWRGRLVVHDUFKIRUWKRVHYLOODJHV2EYLRXVO\WKH\DUHQRWJRLQJWR later, Cambridge University schol-
ILQGWKHPEHFDXVHQRERG\ZLOODGPLWWRSUDFWLVLQJXQWRXFKDELOLW\:KDWLVVFDU\LV ar Chaudhry Rehmat Ali worked
WKHURXWLQLVDWLRQRIWKH,QGLDQFDVWHLVWVRFLDORUGHULPPXQHWRWKH&RQVWLWXWLRQHYHQ out a theoretical note and innovat- who openly expressed the view is in Assam and once again rep- Government in collaboration
ed the name Pakistan, the land of that without Assam, the econ- resents migration from with Assam CM Hiteswar
DVWKHVRFLHW\FODLPVWRHPEUDFHPRGHUQLW\7KH'DOLWLVVRXQWRXFKDEOHVKHFDQJHW the devout. Jinnah’s idea was that omy of East Pakistan could not Mymensingh and east Bengal Saikia suppressed the people of
NLOOHGIRUWRXFKLQJDQDQLPDO$\RXWKZDVKDFNHGWRGHDWKLQ*XMDUDWLQEHFDXVH five provinces should form the be complete. generally.” This policy of coloni- Assam and their sentiments.
KHURGHDKRUVH,QD'DOLWJURRP·VIDPLO\ZDVVRFLDOO\ER\FRWWHGEHFDXVHKH holy land including Assam, The entire episode is heart sation of Assam by the Muslims They continued to protest and
VDWRQDKRUVHDJDLQLQ*XMDUDW,QD'DOLW\RXWKIRXQGRXWEHLQJDQDUP\MDZDQ Bengal, North-West Frontier, rending for those who care for of Bengal was continued under agitate but to no avail. As if to
Punjab and Sindh. Balochistan Assam. The writer has often the joint auspices of the Muslim rub salt on their wounds, the
GRHVQRWPDNHKLPLPPXQHWRXSSHUFDVWHWDXQWVDVKHZDVIRUFHGGRZQIURPKLV came in later. From the Muslim visited the state and seen all its League ministries of Sir Central Government passed
KRUVHDOVRLQ*XMDUDW$IWHUGR]HQVRIVLPLODUFDVHVZHUHUHSRUWHGLQ8WWDU3UDGHVK majority angle, Assam appeared tea growing sub-districts. He Saadullah in Assam and Sir the pernicious Illegal Migrants
D'DOLWJURRPLQ0HHUXWPDQDJHGWRUHDFKWKHEULGH·VKRPHRQKLVKRUVHEHFDXVHRI touch and go to Jinnah although was there for some ten days Nazimuddin in Bengal, as the (Determination by Tribunals)
SROLFHSURWHFWLRQ7KHRQO\FRQVRODWLRQIRUWKHSRRU'DOLWVLVWKDWHYHQSURVSHURXV the Hindu impression was that during the 1983 elections, following Bengal Government Act in 1983. Hereby, in Assam
they had a clear majority. Premier which were boycotted by those communique published in the the onus of proving that a par-
'DOLWVVXIIHUWKHVDPHLQVXOWV<RXQJ'DOLWVJHWDWDVWHRIWKHGLVFULPLQDWLRQTXLWHHDUO\ Saadulla got down to the business who loved Assam. In many of 0F78B?4A8=6 press, in the last week of ticular person is an infiltrator
GXULQJPLGGD\PHDOVLQVFKRROV:KRPFDQ'DOLWVWXUQWRVHHNHTXDOLW\DVKXPDQ
EHLQJVLQHYHU\GD\OLIHDQGQRWEHEHDWHQRUNLOOHGIRUZHDULQJQHZFORWKHVRUZDON
of facilitating as many east Bengali
Muslims to come across and set-
the assembly constituencies,
the voting was pathetically low 20<?086=F0B October 1944, shows. It goes on
to quote the Census Report of
rested with his complainant or
the Government of Assam,
LQJRQDSDYHGVWUHHWRUGULQNLQJZDWHUIURPDSXEOLFWDS" tle in Assam. A whispering cam- although the Hiteswar Saikia BC0AC43C70CC74 1941: “The Government of not on the suspect. The
Government had ensured per- Assam in their resolution dated Foreigners Act of 1946, where-
paign was started that the Adivasis
were not really Hindus but wor- fect law and order. Most of the 038E0B8BF4A4 the 21st June 1940 prohibited by the onus of proving his bona
?82D1<; shipped animals or were electoral officers in the heart- =>CA40;;H settlement of land with persons fides is on the suspect, contin-
Christian. There was thus a race land constituencies and the coming from outside the ued to apply to all other States
to somehow prove that there were booths therein were manned by 78=3DB1DC province after the 1st January, in India. The only exception
more Muslims in Assam than
Hindus.
men flown in from other States.
Nevertheless, for five days, the
F>AB78??43 1938 — The Bengal Legislative
Council went on to appeal to
made was Assam to help out
the illegal migrants. When
In the course of a discussion Assamese districts seemed as 0=8<0;B>AF4A4 the Governor to ask for the travelling from Guwahati to
at Shillong in 1945, Viceroy Lord
Wavell noted in his diary that
dead as graveyards.
Quoting from the 27A8BC80=C74A4 Viceroy’s intervention in Assam.
Dr Prasad quoted a retired
Shillong, one does not sponta-
neously realise when one has
while the reason for the encour- Hindustan Standard, a well F0BC7DB0A024 SP Desai (ICS) writing in crossed from Assam to
patronized Kolkata daily of Hindustan Standard of Meghalaya. Yet in the latter
agement of this migration was
officially justified as being to those days, Rajendra Prasad in C>B><47>F December 1944: “Every day, State, the Central law was the
grow more food, the real object his book India Divided, stated:
“It is sad but by no means
?A>E4C70C new bamboo sheds and tempo-
rary huts are springing up in
old 1946 Act! Such was the dis-
crimination against the
was to increase Mohammadans
(as recorded by BK Nehru in his improbable that in another 30 C74A4F4A4 the reserves. I found that the Assamese people.
book Nice Guys Finish Second).
The tale of illegal migrants into
years Sibsagar district will be
the only part of Assam in
<>A4<DB;8<B immigrants absolutely ignore
the local officers.” The few
(This is part of an ongoing
series on India making multi-
Assam is an old one told by all which an Assamese will find 8=0BB0< Nepali graziers and Assamese dimensional advancement
himself at home.” Pamuas finding no protection across States and nations).
observers but swept under the car-
pet by the Congress and its The Census Report of 1941 C70=78=3DB from anywhere give ‘dohai’ in (The writer is a well-known
Muslim supporters. Other distin- completes the story with a the name of the King Emperor. columnist, an author and a for-
guished Muslims like Sheikh short but significant sentence, Verily, the cup of humiliation mer member of the Rajya
Mujibur Rahman and late quoted: “The most noticeable for the Assamese was full. Sabha. The views expressed
Pakistan PM Zulfikar Ali Bhutto, rise in the Muslim population Thus the Indira Gandhi are personal.)
C^daXbcb_PaPV[XSX]VPcB^[P]VEP[[Th]TPa<P]P[X ?C8
;4CC4AB C>C
C74438C>A SOUNDBITE
CWTUPa\Tab]^]
61B=5BCµ281B1D21>48
CUfU^iUQbcY^_bRYd eX^[T]c²bPchPVaPWP³
9ZXYeZ^V
Sir — It is uncharitable to say that the
XbX]cPRcc^SPhQdc
Bharat Bandh called by farmer unions has
caused ‘disruption’, ’inconvenience’ and Xc^a cWT b_PRTRaPUc P]S Xcb bRXT]cXUXR X]bcad cWTTg_[^XcXeT
‘hardships’ for the public when it is a life- \T]cbVXeX]VcWTbRXT]cXbcbT]^dVWcX\Tc^ 6^eTa]\T]cS^Tb
and-death struggle for them. It is impor- P]P[hbTP]SbcdShcWTbcaT]VcWbP]ScWTV[XcRW ]c[XZTXcP]ScWPcXbfWh
,W¶VWLPHWRWDNHDOHDIRXWRI.HUDOD¶VERRN tant that we keep a sense of proportion. The Tbb^cWPccWTbTR^d[SQT\PSTdbTUd[X]UdcdaT 1WPaPcXb²QP]SW³
b_PRT\XbbX^]bCWT[^]VTeXch^UcWT<><
WRWDNHVWHSVWRQXUWXUHRXUQH[WJHQHUDWLRQ do-or-die spirit with which the farmers are
protesting reveals their deep disquiet over WPbaPXbTScWTR^]UXST]RT^U8BA>bRXT]cXbcb °2^]VaTbb[TPSTa
&
the three farm laws enacted to pave the way <P]VP[hPP]bbdRRTbbX]cWTaTS_[P]Tcb APWd[6P]SWX
RPH1RYHPEHUDQGVFKRROVDQGFROOHJHVLQ.HUDODZRXOGUHRSHQDIWHUD for the dismantling of the MSP system, ^aQXcXbbdaTc^QTP]X\_TcdbX]8BA>bP\QX
PRQWKKLDWXVFDXVHGE\&29,'1RYHPEHUDVVXPHVVLJQLILFDQFHDVLWZDV takeover of the agriculture sector by big cX^dbb_PRTTg_[^aX]V_[P]b[XZT[Pd]RWX]V =^fXbcWTcX\T
8
RQWKLVGD\LQWKDWWKH6WDWHFDPHLQWRH[LVWHQFHIROORZLQJWKHPHUJHURI corporate houses and the eventual loss of cbcad[hST[XVWcUd[P]SP\PccTa^U_aXSTc^ Xcb^f]b_PRTbcPcX^]cWT2WP]SaPhPP]\Xb c^T[X\X]PcT
7UDYDQFRUH.RFKLDQG0DODEDU7KLVLVWKHORQJHVWHYHUFORVHGRZQVHHQLQWKHHGXFD agricultural land. It is futile to try and triv- Z]^fcWPc8]SXP³b<Pab^aQXcTaWPbR^\_[Tc bX^]0SXchP; cWT\XbbX^]c^Tg_[^aTcWT ]dR[TPafTP_^]b
ialise the farm protests and show them in TSbTeT]hTPabX]Xcb^aQXcfT[[QTh^]SXcb Bd]bR^a^]PP]Sb^^]CWTQXVVTbcPSeP] Ua^\^daf^a[SP]S
WLRQDOVHFWRURIWKH6WDWHNQRZQPRUHIRULWVPLOLWDQWWUDGHXQLRQLVPDQGVWXGHQWDJLWD a negative light, given the rightness of their STbXV]TS\XbbX^][XUT^UbXg\^]cWbCWT<Pab cPVTXbcWPc^cWTa]PcX^]bWPeTQTVd]c^ZTT] dbWTaX]P]TfTaP
WLRQ7KH/')*RYHUQPHQWOHGE\&KLHI0LQLVWHU3LQDUD\L cause and the mass support for them. >aQXcTa <XbbX^] <>< P[b^ RP[[TS [h ^QbTaeT ^da [^f R^bc b_PRT cTRW]^[^Vh ^USXP[^VdTcadbcP]S_TPRT
9LMD\DQKDVEHHQGRXEO\FDXWLRXVDERXWDQQRXQFLQJ The support extended by the <P]VP[hPP]fPbcWT\PXST]X]cTa_[P]TcPah FWX[TcWTSTeT[^_TSR^d]caXTbb_T]SQX[[X^]b U^aP[[_T^_[T
WKHOLIWLQJRIORFNGRZQLQVFKRROVDQGFROOHJHVEHFDXVH Opposition parties to the ongoing protests \XbbX^] ^U cWT 8]SXP] B_PRT ATbTPaRW ^]b_PRT\XbbX^]b8]SXPWPbQTT]PQ[Tc^S^
is not ‘pandering’ to the farmers when elec- >aVP]XbPcX^] 8BA> 8c fPb [Pd]RWTS X] cWTbP\T^]P[^fQdSVTcQdc_aTRXbT[hP]S °D=BTRaTcPah6T]TaP[
RIWKH¶RQFHELWWHQWZLFHVK\·V\QGURPHH[SHULHQFHG tions in several States are around the cor- =^eT\QTa! "P]ScWT_a^QTfPbbdRRTbb U[Pf[Tbb[h8cbcP]SbcTbcX\^]hc^^daPRR^\ 0]c^]X^6dcTaaTb
E\WKH6WDWH9LMD\DQKDGGHFODUHGRQ0D\ ner. To say that the farmers are ‘egged on’ Ud[[hX]bTacTSX]c^<PacXP]^aQXcX]BT_cT\QTa _[XbW\T]c X] b_PRT Tg_[^aPcX^] cWPc \P]h
WKDW .HUDOD KDG EHFRPH &29,'IUHH WKDQNV WR WKH by the Opposition is an insult to the ! #X]XcbUXabcPccT\_cCWTbdRRTbbUd[bda ]PcX^]baT[h^]8BA>U^a[Pd]RWX]VcWTXabPcT[ 6PX]X]V!ZVX]bXg
6WDWH·VZHOOIXQFWLRQLQJKHDOWKVHFWRU+RZHYHUZLWK integrity of both the farmers and the eXeP[^UcWT<P]VP[hPP]SdaX]VP[[cWTbThTPab [XcTbX]c^b_PRTdbX]V^daa^RZTcb \^]cWbP]S[^bX]VXc
Opposition. The ruling party can easily WPbT]PQ[TScWT8BA>c^R^]cX]d^db[h\^] <?aPShd| :P]_da
LQ ZHHNV WKH SDQGHPLF UHWXUQHG ZLWK UHQHZHG P[[fXcWX]bXg\^]cWb
outsmart the Opposition by repealing the
cWPcc^^X]\hcWXacXTb
SRWHQF\DQGFDXVHGGHYDVWDWLQJKDYRFE\FODLPLQJ three farm laws. The attempt to pit the super-luxury stay of MLAs in costly five- and machinery and launched an evacua- \TbbTSd_\P]h
QHDUO\OLYHV7KLVWLPHURXQGWKH6WDWHDGPLQ protesting farmers against ‘common citi- starred resorts and hotels for immoral ways tion drive in seven identified districts in
cWX]VbX]\hQ^Sh
zens’ is eminently avoidable. Farmers are of toppling or saving Governments. Tax- the southern parts of the State.
LVWUDWLRQLVOHDYLQJQRVWRQHXQWXUQHGWRHQVXUHVWX a part of social organisms; they are ordi- °0Rc^a
exemptions in respect of political parties Over the next three days, the sea con-
GHQW VDIHW\ 7KH ELREXEEOH VFKHPH XQGHU WKH nary, decent, hard working people for any- are also heavily misused by an ever-increas- dition will be rough to severe and fisher- :P]VP]PAP]Pdc
*RYHUQPHQW·VFRQVLGHUDWLRQHQYLVDJHVWKUHHRIIOLQHFODVVHVDQGDQHTXDOQXPEHURI one to speak ill of them or attempt to trash ing number of registered political parties men in Odisha, West Bengal and Andhra
RQOLQHFODVVHVIRUHDFKEDWFKRIVWXGHQWV2QO\WKRVHSDUHQWVZKRDUHFRQILGHQWRIWKH their reputation. with most of them not having contested Pradesh have been asked to not venture 8cXbSXUUXRd[c
G David Milton | Maruthancode any election. Considering massive misuse into east-central and adjoining northeast H^dWPeTQTT]
FOHDQOLQHVVRIWKHVFKRROVQHHGVHQGWKHLUZDUGVIRUSK\VLFDOFODVVHV7KHUHVWFRXOG of tax-free agricultural income by super Bay of Bengal. It is understandable to issue _[PhX]VCTbcRaXRZTc
FRQWLQXHZLWKWKHRQOLQHVHVVLRQVZKLFKDUHLQYRJXHQRZ 12?<9C8=9CEC545H5=@D9?>C rich celebrities and heavy spending on on- a cyclone warning by raising the red flag U^aUXeT\^]cWb
$QRWKHU*RYHUQPHQWLQLWLDWLYHLVWKHGHDGGLFWLRQFHQWUHVSODQQHGDFURVVWKH6WDWH Sir — The Central Board of Direct Taxes going farmers-agitation, agricultural in coastal areas of these two States. P]SbdSST][hh^d
WRHQVXUHWKDWVWXGHQWVGRQRWIDOOWRGUXJV1DUFRWLFVVPXJJOHUVDUHRXWLQWKHRSHQ (CBDT) should widen the scope of Form income should also be taxed by having a A visual storm warning signage is per- WPeTc^R^\TP]S_[Ph
26AS of Income Tax Act by auto-inclusion basic exemption-limit of C5 lakh with var- manently hoisted at the mast of ports to fWXcTQP[[RaXRZTc
DFURVVWKH6WDWHDQGVFKRROVDQGFROOHJHVDUHRQWKHLUWDUJHW6LQFHWKHORFNGRZQZDV of allowable deductions like investment in ious deductible investments or spending alert ships of the weather condition in the
VODSSHGLQWKH6WDWHDQRWKHUVRFLDOHYLOLQWKHQDPHRIRQOLQHJDPHVKDVKLW.HUDOD Public Provident Fund, LIC policies, clubbed together for maximum rupees two ports they approach, that is the common ¯2WT]]PXBd_Ta:X]VbQPccTa
7KLVKDVUHVXOWHGLQVXLFLGHVE\VWXGHQWVDQGSDUHQWVZKRZHUHOHIWLQILQDQFLDOGLV Government-securities, mutual funds etc. lakhs. practice. While certain countries hoist flags, APeX]SaP9PSTYP
WUHVV9LMD\DQVDLGWKDWDOOSROLFHLQVSHFWRUVKDYHEHHQLQVWUXFWHGWRHVWDEOLVKFORVH Insurance companies should be directed Subhash Chandra Agrawal | Delhi India uses distinct signs for day and night.
to compulsorily put PAN number and Day signals are a combination of cylinders 4[TRcX^]bPaTR[^bT
UDSSRUWZLWKKHDGPDVWHUVDQGSDUHQWWHDFKHUV·DVVRFLDWLRQVWRVDYHVWXGHQWVIURP Aadhar number on policies. The outdat- and cones, while night signals are red and P]S8fT[R^\TP[[
D853I3<?>5>1=54´7E<12µ
GUXJSXVKHUVDQGRQOLQHJDPLQJRSHUDWRUV7KH6WDWHDOVRVDZVRPHVWXGHQWVUHVRUW ed Income Tax Act, 1961, with so many Sir — The cyclonic storm ‘Gulab’ is likely white lamps. Deep depression intensifies ZX]Sb^Uc^daXb\b^
LQJWRWKHH[WUHPHPHDVXUHRIVXLFLGHEHFDXVHRIPHQWDODJRQ\DULVLQJRXWRIWKHDEVHQFH amendments should be replaced by an alto- to move nearly westwards and cross north and it is indeed a dangerous signal for the cWPcP[[\h6^P]
RISHHUFRPSDQ\7KHSDUWLDORSHQLQJRIVFKRROVLVH[SHFWHGWRJRDORQJZD\LQUHVROY gether new and simplified Act as repeat- Andhra Pradesh-south Odisha coasts coastal areas. Qa^cWTabP]SbXbcTab
edly assured by the Government. MR Jayanthi | Mumbai WPeTPRRTbbc^P]Tf
LQJWKHLVVXHZKLOHWKHVWXGHQWVKDYHWREHWUDLQHGWRIDFHWKHFKDQJHGOLIHVW\OHDVWKH\ Our political parties are rich enough
between Kalingapatnam and Gopalpur
QdbX]TbbX]6^P
around Sunday evening, the Cyclone
HPHUJHIURP&29,'/LIHZLOOQRWEHWKHVDPHDQ\ZKHUHLQ,QGLDDQG*HQ1H[WVKRXOG to spend heavily for their political purpos- Warning Division revealed. The Odisha BT]Shh^daUUTTSQPRZcc^) °6^P2WXTU<X]XbcTa
EHZDUQHGDERXWWKHJURXQGUHDOLW\7KLVVWHSVKRXOGEHUHSOLFDWHGDFURVV,QGLD es which regrettably also includes costly Government has already mobilised men [TccTabc^_X^]TTa/V\PX[R^\ ?aP\^SBPfP]c
=4F34;78kCD4B30H kB4?C4<14A!'!!
&
gggTQY\i`Y_^UUbS_] UPRTQ^^ZR^\SPX[h_X^]TTak /CWT3PX[h?X^]TTak X]bcPVaP\R^\SPX[h_X^]TTa
FIRSTCOLUMN
49:=525G6CD:EJ
%DQNV¶EDLORXW²
2?549C@?:4A2:?
8cXb]TRTbbPahc^d]STabcP]SfWPc[X]Zb
TPa[h[XUTPSeTabXchc^_^^aPSd[cWTP[cW
0DNHLWWUDQVSDUHQW EDD1=6D?C0
7KHSURSRVHGµEDGEDQN
VFKHPHE\WKH*RYHUQPHQWLVPHUHO\DQ
DWWHPSWDWXVLQJWD[SD\HUV
PRQH\IRUEDLOLQJRXW13$DIIOLFWHGEDQNV
n the Union Budget for 2021-22,
7
D9=70;4
KHUH LV D ZLGHO\ KHOG EHOLHIWKDWRXUKHDOWKLVODUJHO\SUHRU
GDLQHGE\WKHJHQHVZHLQKHULWIURPRXUSDUHQWV,QGHHGWKLV
ORWWHU\RILQKHULWDQFHSOD\VDQLQVWUXPHQWDOUROHLQVRPHKHDOWK
I Finance Minister Nirmala
Sitharaman had proposed setting up
of a bad bank. Crafted as National
Asset Reconstruction Company Limited
(NARCL), it will bundle up all the non-
RXWFRPHV(DUO\RQVHWGLDEHWHVLVDQH[DPSOHRIDQLQKHULWHGGLV performing assets (NPAs) of banks and
HDVHZKLFKDOWKRXJKGHELOLWDWLQJLVUHODWLYHO\XQFRPPRQZLWKRQO\ sell them to investors such as private
WKUHHQHZFDVHVSHUFKLOGUHQLQ,QGLD/DWHRQVHWGLDEHWHV equity funds, alternative investment
LVPXFKPRUHFRPPRQDIIOLFWLQJSHUFHQWLQXUEDQSRSXODWLRQV funds (AIFs) and so on, by putting a turn-
around plan in place. On September 16,
DQGOLNHPRVWSUHGRPLQDQWGLVHDVHVODFNVDFOHDUSDWWHUQRILQKHU 2021, she announced the broad contours
LWDQFH7KHHYLGHQFHVXJJHVWVDJUHDWHUUROHIRUQXUWXUHHQYLURQ of the action plan.
PHQWUDWKHUWKDQQDWXUHJHQHVLQPDLQWDLQLQJZHOOEHLQJ7KDWLV Under it, the NARCL will purchase
JRRGQHZVEHFDXVHZHFDQLPSURYHWKHHQYLURQPHQW&KURQLFSDLQ NPAs from banks under 15:85 structure,
SDLQWKDWODVWVORQJHUWKDQWKUHHPRQWKVLVDQRWKHUGHELOLWDWLQJFRQ wherein it will pay up to 15 per cent of
the agreed or discounted value of the
loans in cash and issue Security Receipts
(SRs) for the rest. The Government will
provide sovereign guarantee - valid for
a period of 5 years - for the SRs issued
by NARCL. The guarantee would be
invoked to cover the loss being the dif-
ference between the realized value (res-
olution/liquidation) and face value of SRs.
A provision of C30,600 crore has been C74=>=
made for this purpose. ?4A5>A<8=6
The Indian Banks’ Association (IBA) 0BB4CB70E4
has already started the process with 144=70D=C8=6
incorporation of the NARCL and applied C74<>38
to the Reserve Bank of India (RBI) for a recovered over C500,000 crore. However, in the present case, this for bailing out NPAs afflicted
license as an Asset Reconstruction 6>E4A=<4=C The NPAs ought to have gone will not work as the bank would banks. Put simply, of the C
Company (ARC) with a capital base of B8=24! # down by this much but the decline play safe by giving asset to NARCL 200,000 crore, the Union
C6,000-crore. The public sector banks 8=! %8C is only about C200,000 crore and whose SRs enjoy sovereign guar- Government will give C30,600
(PSBs) will have 51 per cent ownership 4=02C43C74 the difference of C300,000 crore is antee. crore by way of sovereign guar-
GLWLRQWKDWODFNVFOHDUJHQHWLFRULJLQV,WLVPXFKPRUHFRPPRQWKDQ in the NARCL.The remaining sharehold- due to fresh slippages. This figure- As for the remaining anteeand the rest (sans a tiny sum
DOOIRUPVRIGLDEHWHVHVWLPDWHGWRDIIHFWDSSUR[LPDWHO\SHUFHQW 8=B>;E4=2H0=3
ing will vest in 16 entities including pri- excludes the Covid period — C110,000 crore for which a lower of C5400 crore)as direct bud-
RIDGXOWVLQ,QGLD$UHSRUWWKLV\HDUUHYHDOVWKDWSDLQRIWKHORZHU vate banks and non-bank finance com- 10=:AD?C2H March 1, 2020 to March 24, 2021 provision has been made and the getary support.
EDFNDQGH[WUHPLWLHVDIIOLFWHGSHUFHQWRIDQDGXOWSRSXODWLRQLQ panies. 2>34812 — during which banks were not chances of recovery are better, the The Government should stop
UXUDO*DGFKLUROLLQ0DKDUDVKWUDLQDSHULRGRIRQH\HDUOHDGLQJWR The NARCL is intended to resolve C70C4=01;4B allowed to recognize bad loans. bank could have reason to offer taking recourse to disingenuous
ORVWZRUNGD\VSHUVWXG\SDUWLFLSDQW stressed loan assets above C500 crore each ;4=34AB0=3 On their inclusion,we could get lower discount on the face value. methods. Instead of following a
amounting to about C200,000 crore. In 10=:BC>3A06 back to March 31, 2018 level. This is provided transfer happens circuitous route, making things
,QDGGLWLRQWRXQTXDQWLILDEOHSHUVRQDOVXIIHULQJWKHHVWLPDWHG phase I, it will take over fully provisioned Much lower yield than expect- fast. If, this is delayed and default non-transparent, setting up new
HFRQRPLFFRVWVRIORVWZRUNDQGPHGLFDWLRQDUHVWDJJHULQJHDFK assets of about C90,000 crore while the 3450D;C8=6 ed from the IBC mechanism has period increases even exceeding institutions, adding to adminis-
SHUVRQZLWKSDLQORVWSHUFHQWRIWKHDQQXDOSHUFDSLWDUHJLRQ remaining assets would be transferred in 1>AA>F4ABC> a lot to do with a revised RBI cir- three years, the fate of these trative and overhead costs and so
DOLQFRPH(YHQDVPDOOUHGXFWLRQLQWKHSUHYDOHQFHRIFKURQLFSDLQ phase II. 09D38280; cular dated June 7, 2019 — issued loans too will be no different on, it should candidly accept the
ZRXOG EH H[FHSWLRQDOO\ EHQHILFLDO 8QIRUWXQDWHO\ SDLQ WUHDWPHQW High NPAs have been haunting the 0DC7>A8CH8C under Supreme Court orders - from those in the first lot. dire need to inject that much cap-
RSWLRQVKDYHOLPLWHGHIILFDF\DQGIRUPDQ\UHFXULQJFKURQLFSDLQ Modi Government ever since it took 0;B>0<4=343 which took away powers from the In short, the entire bad loan ital in to the banks and give it
EHFRPHVDZD\RIOLIH+RZHYHUQRWDOODGXOWVOLYLQJLQVLPLODUFLU charge in 2014. In 2016, it enacted the banking regulator and gave too book on offer (read: C200,000 from the Budget. During the last
Insolvency and Bankruptcy Code (IBC), C7410=:8=6 much of flexibility to the latter in crore) would be available to the four years, it gave them C300,000
FXPVWDQFHVDUHYXOQHUDEOHWRFKURQLFSDLQ6RPHDUHUHPDUNDEO\ an overarching law that gives lenders and A46D;0C8>=02C working out the resolution plan. ‘bad bank’ at heavy discount to crore to deal with their NPAs; it
UHVLOLHQW,IWKLVLVQRWEHFDXVHRIJHQHWLFVWKHQZK\DUHVRPHYXO banks the power to drag defaulting bor- 68E8=6C74A18 Effectively, it rendered the IBC the face value. What if this is fixed can give a further C200,000 crore.
QHUDEOHDQGRWKHUVUHVLOLHQW"7KHDQVZHUPD\OLHLQH[SRVXUHWRFKLOG rowers to a judicial authority. It also C74?>F4ABC> process dysfunctional. at say 18 per cent? At the same time, to recover
KRRGDGYHUVLW\$GYHUVHFKLOGKRRGH[SHULHQFHVLQFOXGHSK\VLFDORU amended the Banking Regulation Act 5>A2410=:B Now, the Government wants In absolute terms, this works bad loans and stem their prolif-
HPRWLRQDODEXVHQHJOHFWDQGGRPHVWLFYLROHQFH7KH:RUOG+HDOWK giving RBI powers to force banks to act the ‘bad bank’ do the trick. Look out to C36,000 crore. Of this, eration, first, it should revi-
within strict timelines. C>02CF8C78= at the first lot of C90,000 crore. NARCL pays 15 per cent or talisethe IBC mechanism by
2UJDQLVDWLRQGHVFULEHVDGYHUVHFKLOGKRRGH[SHULHQFHVDVWKHPRVW
As per RBI circular dated February BCA82CC8<4;8=4B These loans being in default for C5400 crore in cash to the banks restoring the February 12, 2018
FRPPRQDQGLQWHQVHFKLOGKRRGVWUHVVRUV0DQ\RIXVH[SHULHQFH
12, 2018, for accounts with aggregate over 3 years, the banks have and for the balance C30,600 crore, circular and strengthening the
DWOHDVWRQHDQGFKLOGUHQH[SRVHGWRVHYHUDODGYHUVHHYHQWVDUHOLNH exposure of over C2,000 crore, as soon as already made a full provision and it will issue SRs. To redeem them, NCLT; secondly, expeditious dis-
O\WRKDYHPRUHIUHTXHQWDQGVHYHUHKHDOWKSUREOHPVODWHULQOLIH there was a default in the account with captured in the profit and loss fig- the former must realize at least posal of challenges to NCLT
LQFOXGLQJFKURQLFSDLQ)XUWKHUPRUHFKLOGKRRGDGYHUVLW\LVHPHUJ any lender, all lenders - singly or jointly ures. There is no compulsion on C30,600 crore from selling orders in High Courts and SC;
LQJDVDOHDGLQJFRQWULEXWRUWRKHDOWKGLVSDULWLHVGLVSURSRUWLRQDWH - shall initiate steps to cure the default by them to recover this money. They theNPAs to investors. If, the thirdly, stepping up ‘tracking’
O\DIIHFWLQJWKHSRRUHVWLQVRFLHW\7KHUHLVDVWURQJUHODWLRQVKLS preparing a resolution plan. The plan had will not object to NARCL paying NARCL doesnot realize even one and ‘surveillance’ within banks
EHWZHHQH[SRVXUHWRFKLOGKRRGDGYHUVLWLHVDQGVRFLDOGHSULYD to be readied within 6 months from the a very low price. rupee, then also it need not for early detection of bad loans
WLRQ+RZHYHUWKHUHLVDODFNRIVFUHHQLQJIRUH[SRVXUHWRFKLOG default date. If not, proceedings under However, what prevents other worry as SRs valued up to including frauds (at present, it
IBC would be initiated by referring the asset reconstruction companies C30,600 crore being guaranteed takes years for them to report)
KRRGDGYHUVLW\ZKLFKPLJKWRWKHUZLVHHQDEOHWDUJHWHGKHDOWKLQWHU case to National Company Law Tribunal (ARCs) from bidding for a high- by the Union Government, the and lastly, stem corruption and
YHQWLRQV5HDVRQVIRUWKLVLQFOXGHLQFRQVLVWHQWVFUHHQLQJPHWK (NCLT) which would get six months to er price. Indeed, the proposed latter will pay for it in full. nepotism.
RGVDQGSRRUXQGHUVWDQGLQJRIIDFWRUVWKDWPD\FRQWULEXWHWRYXO resolve. (The writer is a policy mechanism requires NARCL to go Short of jargon and high- Sans these harsh steps, the
QHUDELOLWLHV IROORZLQJ H[SRVXUH 7KH &RQVRU WLXP $JDLQVW 3DLQ According to a statement in parlia- analyst. The views for the “Swiss Challenge” auction sounding phraseology, the pro- tide of NPAs will not stop forc-
,QHTXDOLW\&$3(OHGE\WKH8QLYHUVLW\RI'XQGHHVHHNVWRRYHU ment by Minister of State for Finance expressed are personal.) wherein other ARCs will be invit- posed ‘bad bank’ is merely an ing the Government to repeated-
FRPHWKHVHGHILFLHQFLHVLQXQGHUVWDQGLQJ&$3(ZLOOGHYHORSD Bhagwat K Karad, PSBs alone have ed to better the offer made by it. attempt to use tax payers’ money ly bail them out.
FRPSUHKHQVLYHWRROIRUVFUHHQLQJH[SRVXUHDQGHVWDEOLVKPHFK
DQLVPVOLQNLQJHDUO\OLIHDGYHUVLW\WRFKURQLFSDLQLQDGXOWKRRG
%\ XQGHUVWDQGLQJ ZKDW OLQNV HDUO\ OLIH DGYHUVLW\ WR SRRU
DGXOWKHDOWKZHKRSHWRDGGUHVVSDLQLQHTXDOLW\E\LGHQWLI\LQJWK
POINTCOUNTERPOINT
RVHDWJUHDWHVWULVNDQGSURYLGLQJWDLORUHGLQWHUYHQWLRQV%\UDLV C7419?383=>C;4C38380CC4=3C74 =>?>;8C820;;4034A8=C742>D=CAH;4C
LQJDZDUHQHVVRIWKHORQJWHUPLPSDFWRIFKLOGKRRGDGYHUVLW\ZH A><4?4024<44C8=60BB748B 0;>=43838<0C274B?<<>380178B74:
ZLOOSURPRWHHIIRU WVWRLPSURYHFKLOGKRRGDQGDGXOWZHOOEHLQJ <>A4?>?D;0AC70=<>38 B7>D;3F08C5>A!!#
7KHZULWHULV3URIHVVRURI$QDHVWKHVLDDQG3ULQFLSDO
°C<264=4A0;B42A4C0AH °19?;4034A
,QYHVWLJDWRURIWKH&RQVRUWLXP$JDLQVW3DLQ,QHTXDOLWLHVDWWKH
8QLYHUVLW\RI'XQGHH8.7KHYLHZVH[SUHVVHGDUHSHUVRQDO 0178B74:10=4A944 BDE4=3D0378:0A8
86FRUSSOHGJHHOXVLYHEDGEDQNLVH[SHQVLYH
+IUTUSOIJK\KRUVSKTZOYGIUSVRK^SGZZKX:NK-U\KXTSKTZGRUTKIGTTUZSGQKOZNGVVKTH[ZTKKJYZNKOT\UR\KSKTZULGRR¥H[YOTKYYKYGTJZNKV[HROI
he visit of Prime in measures to strengthen strategic cooperation. capacity of the individual to ment on its own cannot make are apprehensions that asset
T Minister Narendra
Modi to the US has
tried to kindle hopes in an
innovation ecosystem.
General Atomics, which
opened its first office in India
There may be gains in the
future. As of now, there are
only expectations amid not-a
ride through a crisis like the
COVID-19 pandemic situa-
tion. At 42 per cent plus var-
it happen. It needs the involve-
ment of all — businesses and
the public in their various
buyers may resort to harsh
unethical methods.
In a difficult situation,
economy that needs invest- in 2018, is making significant so-good domestic economic ious cesses, India has the spheres of activity. The coun- new methods are inevitably
ment but the American com- contributions to deepen situation. The country’s non- highest tax rates. The gestures try needs to ponder how the tried out but it has to be
panies have not yet given any India-US defence and securi- performing assets have by foreign countries would not entire system is revamped. remembered that all Euro-US
firm commitment to him. C89F1:9B0A:0A ty cooperation. It is working increased. Steps like taming be enough to bring that con- The new ARC or the bad models of capital market
He held meetings with five with both governments to inflation, the Insolvency and fidence back. It would be wel- bank with the limited govern- should not be copied as the
global CEOs for potential provide India with the latest played a key role in launching Bankruptcy Act, Real Estate come even now to cut the ment guarantee will remove financial literacy is poor here.
investments. defence systems. India’s first real estate invest- Regulatory Act, and GST did income tax rates. It would C22.14 lakh crore ($30 billion) Moreover, Indian society is far
India has taken many Investments in real estate ment trust (REIT) along with not add to the desired growth. boost the individual's capabil- of NPAs from the system. more complex and heteroge-
steps to bring in reforms too are always lucrative. its partner Embassy Group in These have shaken the system ities and benefit the whole Since now it will be now neous. A complicated system
through an asset reconstruc- Blackstone has so far invest- 2019 and has since then and market confidence. The economy as the individual under one entity resolution may not be a proper solution.
tion construction company ed $15 billion in real estate, launched two REITs in the rules are more stringent and consumes more. would be easier, it is being said. Hiving off bad assets may be
(ARC) or the bad bank, lower private equity, real estate, country. do not help the people. The The lower interest rate is Bad bank is not all virtue. practical but settling or
interest rates, networked busi- education, fashion, packaging The Quad is a symbolic foreign investors though keen playing havoc along with tax The world experience reselling those for realization
nesses and chain of roads. and housing finance. It would multilateral body. It provides to invest may also have appre- deductions on deposit hedg- with bad banks is that they of dues is not easy and would
Companies like Qualcomm continue to do so as per the a platform to seek cooperation hensions, which the scrapping ing against inflation that inter- have excessive and hidden have many complications as
have investments in wireless assurance of its CEO Stephen from like-minded countries of the retrospective taxation est accrual does. It affects the fees, bouncing cheques, each of the cases are different.
modem, digital media net- Schwarzman. on issues like ensuring respect may partially help resolve. developmental process. To expensive debits, big banking True, the nation will chart out
working, dairy transporta- Blackstone Real Estate for territorial integrity, sover- Corporate tax rates were accelerate development, the errors and failure to honour its course. Setting the new
tion and defence. Now Modi (The writer is a senior Fund is said to be the largest eignty and peaceful resolution cut but it ignored the pivot the interest rates must be lowered. promises. It can create a new course is not easy and none as
has suggested to them to journalist. The views owner of commercial real of disputes. Quad leaders individual. His taxes peaked Economic development is a kind of market in dealing of now has a clear idea how it
invest in hi-tech sectors and expressed are personal.) estate in India. The company agreed to scale up collective during 2019. It hit the basic complex matter. The govern- with stressed loans but there would function.
=4F34;78kCD4B30H kB4?C4<14A!'!!
f^a[S'
2WXYR_ZdeR_>jR_^Rc ,PSRUWDQWWRLQFHQWLYLVH
7DOLEDQVRWKDWWKH\
@b_cUSed_b B^RXP[3T\^RaPcb]Paa^f[hQTPc
cUU[cd_ <TaZT[bQ[^RX]6Ta\P]e^cT
hZ]]_`eRUUcVddF?82
United Nations: Afghanistan which was scheduled for today”. Tun has been dismissed and
IXOILOSURPLVHV3DN30
Islamabad: Pakistan Prime rorism.
bUce]U933
`b_RUY^1V G
0?Q 14A;8=
constituencies showed the
Social Democrats received
ermany's center-left Social 25.9% of the vote, ahead of
Democrats won the biggest 24.1% for the Union bloc. No
share of the vote in a national winning party in a German
and Myanmar “withdrew" their Grayley said Myanmar they want Aung Thurein to Minister Imran Khan has said it “Taliban leaders will have The Hague: The chief prosecu- election Sunday, narrowly beat- national election had previ-
participation from the General withdrew its participation “some replace him. is important to incentivise the greater reason and ability to stick tor of the International Criminal ing outgoing Chancellor ously taken less than 31% of the
Debate of the high-level 76th time back and Afghanistan over Given that the current dis- Taliban so that the new rulers of to their promises if they are Court sought urgent clearance Angela Merkel 's center-right vote.
session of the UN General the weekend, when we heard of pensation in both Myanmar and Afghanistan fulfil the promises assured of the consistent human- on Monday from the court's Union bloc in a closely fought Armin Laschet, the gover-
Assembly, a spokesperson for it.” Afghanistan nominated their they made after they seized itarian and development assis- judges to resume investigations race that will determine who nor of North Rhine-Westphalia
the President of the 193-mem- On Friday, spokesperson own envoys to the UN, while power in Kabul last month. tance they need to run the gov- of war crimes and crimes against succeeds the long-time leader state who outmaneuvered a
ber world body said. for the Secretary-General, the Permanent Representatives The Taliban are yet to get ernment effectively,” he said. humanity in Afghanistan, saying at the helm of Europe's biggest more popular rival to secure
According to the latest list Stephane Dujarric had said that of the toppled Governments international recognition. The Khan said providing incen- that under the country's new economy. the nomination of Merkel's
of speakers for the last day of the “as for now, the Afghanistan continued to be stationed here, heavily armed group have tives would also give the outside Taliban rulers “there is no longer The Social Democrats' can- Union bloc, had struggled to
General Debate on Monday, representative inscribed on the the decision of who represents promised an inclusive govern- world additional leverage to the prospect of genuine and didate Olaf Scholz, the outgo- motivate the party's base and
Afghanistan and Myanmar are list for Monday is H.E. Mr. the two countries at the United ment, a more moderate form of continue persuading the Taliban effective domestic investiga- ing vice chancellor and finance suffered a series of missteps.
not listed to address the session, Ghulam M. Isaczai,” the Nations fell to the UN Islamic rule than that of their to honour their commitments. tions” in the country. minister who pulled his party “Of course, this is a loss of
even as previous provisional P e r m a n e n t Credentials Committee. previous regime from 1996 to “If we do this right, we could Judges at the global court out of a years-long slump, said votes that isn't pretty,” Laschet
speakers' lists had the countries' Representative. On September 20, on the 2001, including respecting achieve what the Doha peace authorised an investigation by the outcome was “a very clear said of results that looked set to
diplomats listed to speak at the Last week, the Taliban had eve of the commencement of women's rights. However, their process aimed at all along: an Prosecutor Karim Khan's pre- mandate to ensure now that we undercut by some measure the
General Debate. written to UN Secretary- the high-level UN General recent moves indicate that they Afghanistan that is no longer a decessor, Fatou Bensouda, in put together a good, pragmat- Union's previous worst show-
When asked why General Antonio Guterres nom- Debate, the Secretary-General are returning to their repressive threat to the world, where March last year. The probe cov- ic Government for ing of 31% in 1949. But he
Afghanistan and Myanmar are inating their spokesman Suhail had received a communication policies, particularly toward Afghans can finally dream of ers offences allegedly committed Germany.” added that with Merkel depart-
not listed as speakers for the Shaheen as Afghanistan's with the letterhead “Islamic women. peace after four decades of con- by Afghan Government forces, Despite getting its worst- ing after 16 years in power, “no
final day of the General Debate, ambassador to the UN and had Emirate of Afghanistan, According to an official flict,” he said. the Taliban, American troops ever result in a federal contest, one had an incumbent bonus
Monica Grayley, Spokesperson asked to participate in the high- Ministry of Foreign Affairs” statement, Khan in an article The Prime Minister said and US foreign intelligence the Union bloc said it too in this election.”
to the President of the 76th ses- level dated September 20, 2021, published in US-based The abandoning Afghanistan as tried operatives dating back to 2002. would reach out to smaller par- Laschet told supporters
sion of the UN General 76th session of the UN signed by “Ameer Khan Washington Post newspaper on before would lead to a melt- The decision to investigate ties to discuss forming a gov- that “we will do everything we
Assembly Abdulla Shahid, con- General Assembly. Muttaqi” as “Minister of Foreign Monday said the world desired down. “Chaos, mass migration Americans led to the Trump ernment, while Merkel stays on can to form a government
firmed to PTI that: “we have Following the coup in Affairs”, requesting to participate an inclusive Afghan govern- and a revived of international administration slapping sanc- in a caretaker role until a suc- under the Union's leadership,
received information that the Myanmar, its military rulers in the “76th session of the UN ment, respect for the rights, and terrorwill be natural corollaries. tions on Bensouda, who left cessor is sworn in. because Germany now needs a
Member State withdrew its par- have said the country's General Assembly on commitments that Afghan soil Avoiding this must surely be our office over the summer at the Election officials said early coalition for the future that
ticipation in the General Debate Ambassador at UN Kyaw Moe September 21-27 2021”. PTI shall never again be used for ter- global imperative,” he said. PTI end of her nine-year term. AP Monday that a count of all 299 modernizes our country.”
86RIILFLDOV%LGHQDLGH 8.
V-RKQVRQILQDOO\ Bca^]V`dPZTWXcb
WRPHHW6DXGL&URZQ DJUHHVWRPHHW 6aTTZXb[P]S^U
3ULQFHRQ<HPHQ &RYLGEHUHDYHGJURXS 2aTcT* STPS(Wdac
Athens: An earthquake with a pre-
Washington: President Joe largely steered clear of the London: British Prime Minister Boris Johnson will on liminary magnitude of at least 5.8
Biden's national security advis- crown prince since making Tuesday finally meet with members of the Covid-19 struck the Greek island of Crete on
er Jake Sullivan is traveling to public in February a CIA report Bereaved Families for Justice campaigning group, who for Monday, killing one person and injur-
Saudi Arabia on Monday to that showed MBS likely more than a year have sharply criticized his handling of ing several others, while damaging
meet with Crown Prince approved the killing of the coronavirus pandemic. homes and churches and causing
Mohammed bin Salman as the Washington Post columnist and Johnson's Downing Street office confirmed Monday rock slides near the country's fourth-
US tries to press the kingdom to Saudi critic Jamal Khashoggi in that the prime minister will hold a “private meeting” with largest city.
move toward a cease-fire in its a 2018 operation at the king- members of the group. The quake sent people fleeing into
yearslong war with Houthi dom's consulate in Istanbul. At the meeting, the group said family members will the streets in the city of Heraklion, and
rebels in Yemen. But the White House has tell the stories of how their loved ones caught the virus schools were evacuated. Repeated
Sullivan will be the highest- resolved that bringing an end to and reiterate their calls for a statutory inquiry into the aftershocks rattled the area, adding to
ranking Biden administration perhaps the world's most com- pandemic to start soon. damage in villages near the epicentre.
official to visit Saudi Arabia. plex conflict can't be done with- The group, which has requested a meeting with “The earthquake was strong and
Besides seeing the crown prince, out engaging with the most Johnson on at least eight occasions, has asked for it to take was long in duration,” Heraklion
often referred to by his initials, senior Saudi officials face to face, place outside and that social distancing is observed — even mayor Vassilis Lambrinos told private
MBS, Sullivan is expected to one senior administration offi- though all restrictions on social contact have been lift- Antenna television. The Athens
meet with deputy defense min- cial said. ed. “It has been over a year since the prime min- Geodynamic Institute, which gave
ster Khalid bin Salman, a broth- National Security Council ister first said he would meet us and in that time over the 5.8 magnitude, said the quake
er to the crown prince, accord- spokesperson Emily Horne con- 100,000 people across the country have lost their lives with struck at 9:17 am (0617 GMT), with
ing to two senior administration firmed to The Associated Press Covid-19 ," said Jo Goodman, co-founder of the group. an epicentre 246 kilometres (153
officials. that Sullivan was traveling to “One of the hardest parts of the pandemic for us has miles) south southeast of the Greek
The officials were not Riyadh on Monday and would been seeing new families join each week with the same capital, Athens.
authorized to comment publicly also visit the United Arab pain and grief that we've experienced and distressingly “This is not an event that
and spoke on the condition of Emirates, a Saudi ally in the war, similar stories to our own,” she added. occurred without warning. We have
anonymity. but did not provide additional The UK has recorded the world's eighth-highest virus- seen activity in this region for sever-
The Biden White House has detail. AP related death tolls with more than 136,000 deaths, accord- al months. This was a strong earth-
ing to figures compiled by Johns Hopkins University. quake, it was not under sea but under
Johnson and his Conservative government have faced land and affecting populated areas,”
!2P]PSXP]bX] D:bdb_T]Sb an array of criticisms from Covid-19 Bereaved Families
for Justice since it was formed in May 2020, including
seismologist Gerasimos Papadopoulos
said on Greece's state broadcaster
_aXb^]TabfP_ R^\_TcXcX^][Pf
delaying lockdowns, a too-lax travel policy and a short-
age of crucial personal protective equipment.
ERT.
The European-Mediterranean
UaTTSU^aWTP[cW c^Rdc_Tca^[
Covid-19 Bereaved Families for Justice, which has
around 4,000 members, have been calling for a public
Seismological Centre and the US
Geological Survey put the preliminary
aTPb^]bX]2WX]P bcPcX^]`dTdTb
inquiry into the government's handling of the pandem-
ic so lessons can be learned to limit future virus-related
magnitude of 6.0, with an epicentre
seven kilometers (four miles) north of
Taipei: Two Canadians deaths. After months of deflecting calls, Johnson con- the village of Thrapsano. It is common
detained in late 2019 who were firmed in May that a public inquiry will start to hear evi- for different seismological institutes to
allowed to return to Canada in ?C8Q ;>=3>= dence next year. However, Covid-19 Bereaved Families give varying magnitudes for an earth-
a prisoner swap were released for Justice thinks that's too late and that the delay could quake in the initial hours and days
on bail for health reasons, he UK Government on lead to many more people dying with the virus. AP after an event. AP
China's Foreign Ministry said
Monday.
T Monday temporarily sus-
pended rules under its
A Ministry spokesperson Competition Act to allow fuel
made the comment as Beijing companies to address a supply
sought to downplay the con- crisis, which has led to long
nection between their release queues at several petrol stations
and the return to China of a across the country.
long-detained executive of Known as the Downstream
Huawei Technologies. Oil Protocol, the step will allow
Canadians Michael Spavor the government to work with
and Michael Kovrig were fuel producers, suppliers,
detained in December 2019, hauliers and retailers to ensure
days after Huawei's chief finan- that disruption is minimised as
cial officer, Meng Wanzhou, far as possible.
was arrested in Canada at the The measure will make it
request of US authorities. easier for the fuel industry to
Many countries labelled share information so that they
China's action “hostage poli- can more easily prioritise the
tics”, while China accused delivery of fuel to the parts of
Ottawa of arbitrary detention. the country and strategic loca-
The two Canadians were jailed tions that are most in need.
for more than 1,000 days. “We have long-standing
Meng fought the US contingency plans in place to
demand for extradition from work with industry so that
Canada. She landed in China fuel supplies can be main-
on Saturday after reaching a tained and deliveries can still be
deal with the US Justice made in the event of a serious
Department that led to a pris- disruption,” said UK Business ETcTaX]PaXP]bP]SRPaTcPZTabX]2^_T]WPVT]I^^[^VXRP[6PaST]_^bTfXcW^]T^UcWTU^da[X^]RdQbX]2^_T]WPVT]^]
oner swap. AP Secretary Kwasi Kwarteng. <^]SPh ?C8
=4F34;78kCD4B30H kB4?C4<14A!'!! \^]Th(
he Centre on Monday
statement said.
Out of these 11 mines, six
are fully explored and five are
f^aZcaX_b)BcdSh
80=BQ =4F34;78
3>2H0A3 CONTRACEPTION
0RR^aSX]Vc^cWTF^a[S7TP[cW
3A?0=:09=BDA0=64
>aVP]XbPcX^]8]SXPPRR^d]cbU^a^]TUXUcW DURING COVID
0DQDJLQJ'LUHFWRUDQG &RQWUDFHSWLRQ
&(2 ^UcWTc^cP[STPcWb^RRdaaX]VUa^\bca^ZT LVDQLPSRUWDQW
FRPSRQHQWRI
P]SXbRWPT\XRWTPacSXbTPbTTb_TRXP[[hX] UHSURGXFWLYH
8?B28=380
h^d]VPSd[cb3A70A8=34A:10;8 KHDOWK
'5/29/((1$
bWPaTbb^\TfPhbc^_aTeT]cWTPac 1$',5 WHOOV
\RXKRZ
PX[\T]cbX]h^d]V8]SXP]b FRQWUDFHSWLYHV
*HWULGRI
FDQEHKHOSIXOLQ
SUHYHQWLQJFDVHV
>_d c_
RIXQZDQWHGSUHJQDQF\DQG
PLVFDUULDJH
i_e^WQd
venting many sexually transmitted dis-
eases. World Contraception Day is
observed every year on 26th September.
8UQbd
Even during the pandemic, our focus
has been to ensure availability of high
quality contraceptive options to the peo-
ple, thereby ensuring the right health of
the mother and reducing the number of
premature deaths.
Every person should choose the
option of contraception according to
his/her need and choice. In general, con-
traceptive options are divided into two
categories, reversible and permanent.
Awareness about fertility (calendar
method, birth control app, withdrawal
method), barrier method (condom,
diaphragm, cervical cap, contraceptive
ndia accounts for one-fifth of the total deaths urban and rural areas. Hypertension eventual- sponge, spermicidal jelly), intrauterine
C
hronic pain – defined as any persistent pain lasting more
than three months – is rapidly emerging as a significant
healthcare challenge in India that is going to extract a
I occurring from stroke and ischaemic heart
disease especially in younger adults accord-
ing to the World Health Organisation.
Cardiovascular diseases affect Indians a decade
earlier than their western counterparts and near-
ly escalates the risk of developing high blood
pressure and diabetes.
Diabetes
There’s been an exponential rise in the num-
ber of people diagnosed with type 2 diabetes
device, hormonal pills, transdermal patch
etc. fall under the reversible category. At
the same time, sterilization in men and
tubal ligation in women are kept in the
permanent category of contraception.
heavy toll on the social and health infrastructure of the coun- ly 3 million people die of stroke and heart attack over the last 30 years in India which has signif- In this time of the corona epidemic,
try in the coming years. This was said by pain specialists of every year. The most unfortunate part is that forty icantly contributed to the world burden as well. counseling regarding contraception is a
Interventional Pain and Spine Centre (IPSC), a chain of single- per cent of those who suffering a heart attack are In India, people under the age of 25 are mandatory step. Now, while choosing
specialty centres offering state-of-the-art spine care and chron- below the age of 55. The rising trend of smok- increasingly at risk of type-2 diabetes and life- long-term reversible contraception, such
ic pain management with less invasive techniques. More than ing among young adults can be contributed to threatening complications like heart diseases. as intrauterine devices etc provisions
19% of Indian adult population today suffers from chronic pain different factors like lack of sleep, diabetes, exces- Ways to Prevent Heart Ailments in Young related to the corona pandemic such as
of some kind, with prevalence being higher in females (25%). sive stress, alcohol intake, drug abuse, unsafe and Indians social distancing, wearing of masks etc.
The prevalence increases steeply beyond the age of 65 years, unnecessary supplements, over-exercise and In the present society, young adults are should be taken care of.
according to a survey. This may be the tip of the iceberg as slimming pills. With the incidences of heart dis- under constant mental and physical stress Permanent contraception procedures
Indians usually understate their health issues and would rather ease deaths rising in India by 34% over the last from intense work demands, family issues, job like bilateral tubal ligation are done at the
not reveal their pain problems to others. 26 years, it is time to be aware of this serious issue security and much more. Increased periods of time of cesarean section /normal deliv-
Chronic pain will take a huge social and economic toll in and take necessary steps to reduce the burden stress is often associated with high blood pres- ery for those who opt for it. Advice is
the next two decades with significant spending on surgical treat- of cardiovascular disease in the country. sure and diabetes. The concerning fact is that given on correct use of lactational amen-
ment and hospitalisation. It has a serious impact on work, with Major Risk Factors: young adults often fall prey to smoking and orrhea (some patients do not have peri-
increasing loss of workdays associated with chronic pain, espe- Being informed about the risk factors can excessive alcohol consumption to deal with the od at the time of breastfeeding). The
cially low back pain. It also interferes with one’s social life, daily help people to manage their symptoms early and CWTR^]RTa]X]VUPRc overburdening stress. Lifestyle modifications are option of user-controlled contraceptives
routine like walking or exercising, taking care of oneself and the avoid the chances of a sudden heart attack. These the key to reduce these risk and prevent prema- is also given to lactating and non-lactat-
family, and leading an independent lifestyle. Many patients start are some of the significant risk factors that one XbcWPch^d]VPSd[cb ture heart attacks. ing women. Postpartum contraception is
suffering from depression, anxiety and sleeping problems. should be aware of: ^UcT]UP[[_aThc^ Young people must engage in regular peri- advised to patients immediately after
Chronic pain does not occur in isolation. There are often a vari- Smoking ods of moderate to intense exercises like jogging, delivery before hospital discharge.
ety of mental and physical health problems behind it. India has the second-largest number of b\^ZX]VP]STgRTbbXeT cycling, brisk walking, yoga, aerobics, weight All methods of contraception are safe
There has been a gradual rise in the number of older peo- smokers in the world, second only to China. P[R^W^[R^]bd\_cX^]c^ training and swimming to prevent the onset of even in this time of pandemic. Due to
ple in the society due to rising life expectancy. This is driving Reports state that 34.6 of adults in India are diabetes as well as keep blood pressure and limited movement in hospitals, user
an increase in the incidence of chronic pain. The younger pop- smokers and India is home to 12 per cent of the STP[fXcWcWTX]RaTPbX]V weight in check. Also, one should stay away from controlled reversible options should be
ulation too is getting affected, mainly due to leading a seden- world’s smokers. Smoking can increase heart bcaTbb;XUTbch[T excessive alcohol consumption and smoking. adopted. Condoms, fertility awareness
tary and physically inactive lifestyle. The commonest types of rate, lead to irregular heart rhythm and tight- \^SXUXRPcX^]bPaTcWT A proper balanced diet is another require- methods & lactational, amenorrhea
chronic pain faced by people include spinal pain, joint pain and en the arteries. This can make the heart work ment for healthy heart health. Instead of methods (for exclusive breastfeeding
migraine. Arthritis, degenerative conditions of the spine, and harder and eventually result in stroke or heart ZThc^aTSdRTcWTbT munching on junk foods, young people should mothers) are good contraceptive options
cancer are the most common contributors to chronic pain. attack. aXbZbP]S_aTeT]c look for healthy alternatives like fruits, juices, for self-care.
In the West, pain medicine has been a super-specialty for Obesity soya products and nuts. It is also equally Condoms also protect against sexual-
the last three to four decades. In India, it is only 15-20 years old. The high burden of obesity in India is a _aT\PcdaTWTPac important to avoid trans-fatty acids and include ly transmitted infections and are used cor-
Several hospitals in the country major challenge to mitigate the growing inci- PccPRZbH^d]V_T^_[T plenty of fresh, green vegetables in the diet rich rectly & consistently. If hospitalization is
Ch_Tb^URWa^]XR now offer pain management as
a separate discipline. Till five
dences of cardiovascular diseases among the
population. India has the highest number of \dbcT]VPVTX]aTVd[Pa in minerals and calcium. Apart from what is on
the plate, it is also vital that proper attention is
not possible due to restrictions on move-
ment, do not be concerned about delays
_PX]^UcT]UPRTS years ago, Western protocols overweight and obese children who, as adults, _TaX^Sb^U\^STaPcTc^ paid to the time of the meals. Late lunch and in the implant or removal of an intrauter-
X]R[dSTb_X]P[ were being used to manage are likely to contribute further to a higher bur- X]cT]bTTgTaRXbTbP]S dinner is a strict no for those who wish to keep ine contraceptive device. There are no
Indian patients of chronic pain. den of cardiovascular disease morbidity and good care of their overall health. medical problems caused by delayed
_PX]Y^X]c_PX] However, now India-specific mortality. Obese people are more likely to suf- \PX]cPX]P_a^_Ta It has been observed that if a person had a removal of IUDs or implants. There is no
P]S\XVaPX]T protocols have been developed fer from high blood pressure which is one of the QP[P]RTSSXTc heart attack at a younger age, it increases the like- harm in contraceptive options even if a
0acWaXcXb for better outcomes.
For most cases of chronic
biggest causes of heart attacks.
Hypertension °3A70A8=34A:10;8
lihood of another heart attack or stroke during
the later stages of life. Spreading awareness about
person is corona positive. However, the use
of hormonal drugs etc. should be avoid-
STVT]TaPcXeT pain, less invasive and target- A Harvard University study revealed that early detection and prevention is the most crit- ed. Instead of combined hormonal con-
R^]SXcX^]b^U specific interventions (called
interventional pain manage-
hypertension among young adults in India is
higher than that of Central and Eastern Europe,
ical step in the successful prevention and man-
agement of this condition. Young adults should
traceptives, progesterone-only pills or
non-hormonal methods may be used.
cWTb_X]TP]S ment) are better alternatives the region that previously had the highest num- also get their cardiac evaluation done every year After complete recovery, combined hor-
RP]RTaPaTP[b^ compared to open surgical
methods, as these involve less
bers for this group. Hypertension contributes to
10.8% of all deaths in India and it has been on
to stay safe and healthy.
CWTfaXcTaXb2WPXa\P]2PaSXPRBRXT]RTb?PaPb
monal contraceptive options can be used.
CWTfaXcTaXbBT]X^a2^]bd[cP]c>16H=Pc
aTb_^]bXQ[T risk and trauma to patient. a steep rise over the last three decades both in 7^b_XcP[b?P]RWZd[P A^bTfP[Z7^b_XcP[
They are also much safer and
.QRZUHDVRQIRUFDUGLDFIDLOXUH
don’t require hospital admission.
Since most of these non-surgical procedures can be done in a
day care setting, they cost almost half compared to convention- 8=1A845
=PcX^]P[B]PZTQXcT
al surgeries. Patients can go back home the same day. Early inter-
ventions not only relieve pain, but also reduce morbidity and
improve quality of life. We currently have Indian protocols for
$FFRUGLQJWRWKH1DWLRQDO&HQWHUIRU%LRWHFKQRORJ\,QIRUPDWLRQ1&%,WKHDQQXDOQXPEHURIGHDWKV
all interventional procedures for pain management, which is a
big step forward. IURPFDUGLDFGLVHDVHVLVPLOOLRQ'5%%&+$1$1$VKDUHVKRZHDUO\GLDJQRVLVFDQEHRIJUHDWKHOS 0fPaT]TbbBd\\Xc
A 2018 survey of 20,000 patients of back pain from Indian ublic health experts, policymakers and
metro cities estimated that 46% of Bengaluru’s population in the
younger age group suffers from spinal problems. This is among T he term heart failure doesn’t
indicate that the heart has
proper blood circulation. With
time it becomes difficult to pump
valves and the heart chambers
aren’t developed correctly, the
of your condition. From lifestyle
habits to managing the pumping
P administrators gathered at the maiden
National Snakebite Awareness Summit, organ-
the highest incidence in the country. About 43% of patients completely stopped working. In the blood and makes the heart healthier portions of the heart of the heart through angiotensin- ised by the leading health awareness institution
neglect their pain for more than 7 weeks, leading to delayed treat- simple terms, heart failure is the muscles too weak to function. must work harder for it to function converting-enzyme inhibitor Integrated Health & Wellbeing (IHW) Council,
ment and increased risk of surgery. heart’s inability to pump enough to Q Diabetes causes abnormal blood properly. With heart defects, the (ACE) drugs, there are various have underlined the need to spread awareness
With better understanding of chronic pain and technolog- meet the body’s need. The heart sugar levels in the body. High chances of heart failure increase. treatment options available today. on means to prevent attacks by snakes as well
ical advancement, pain physicians can now control chronic pain pumps the blood at a slower rate sugar levels in the blood cause Q Obesity can make it difficult for Patients with increased complica- as gather adequate data to formulate the right
adequately and cure it in most cases. However, it is the respon- which increases the pressure on damage to the blood vessels and the heart to pump blood proper- tions or delayed detection, and better ways to treat the cases at the prima-
sibility of the doctors to treat acute stages of pain promptly to the heart. nerves. People with diabetes may ly. Obesity causes the buildup of advanced palliative care is the ry health centers.
prevent patients from sliding into chronic pain. Some common signs and develop other conditions like high fats and cholesterol inside the solution. Depending upon the Dr Tamilisai Soundararajan, Governor of
symptoms of heart failure are blood pressure which increases the arteries, elevates blood pressure rhythmic patterns, a doctor can Telangana and Lieutenant Governor of
6800(5&22/(5
shortness of breath, fatigue, dizzi- risk of heart failure. and increases the risk of diabetes, also advise patients to undergo a Puducherry; Ms Vinita Srivastava, Advisor for
ness, irregular heartbeat, nausea, Q Cardiomyopathy is a condition all of these are linked to heart fail- cardiac resynchronization thera- Tribal Health Cell, Ministry of Tribal Affairs,
bloating, swollen ankles and weak- in which the muscles of the heart ure. Besides this, the chances of py defibrillator (CRT-D). CRT-D Government of India; Mr. Vishwanath
A08B8=B) Historically used ailments like food ness during an activity. Generally, make it difficult to pump blood. It developing cardiomyopathy is a special device for heart fail- Swarup, COO, Bharat Serums & Vaccines
as currency and awards, poisoning. Raisins are full heart failure develops if a person may be a genetic condition in some increase. ure patients. It functions like a Limited; Dr Priyanka Kadam, President,
raisins are dried grapes of nutrients and can make has or had one or more conditions cases or might develop due to These underlying conditions pacemaker and implantable car- Founder, Snakebite Healing and Education
with an ample number of for a great snack option. described below. blood pressure conditions or any can cause the ‘wear and tear’ of the dioverter-defibrillator (ICD) to Society along with others were the key
benefits. It can reduce the Although it does not Q Coronary artery disease is a other infection in the heart. heart which leads to heart failure. treat heart rhythms. A CRT-D speakers.
risk of heart have the water disease in which the arteries sup- Q Abnormal heart valves can be Q Early diagnosis can help in device delivers electrical impuls- “There is an inadequacy of antivenom
disease by content of plying oxygen and blood to the the result of infections, certain dis- timely treatment for heart failure. es to the left and right ventricles, supply and we need expertise in administer-
maintaining regular grapes heart get blocked and the heart eases or a birth defect. Due to A physical examination and elec- helping the heart to pump effi- ing antivenom – following the protocol is
b l o o d which makes receives insufficient oxygen. improper functioning of the heart trocardiogram (ECG) testing can ciently. important but we may need protocols accord-
pressure and them less Plaque builds up due to cholesterol valves, the muscles of the heart help in determining potential With technological advance- ing to the region.Availability of dialysis facil-
blood sugar. filling than and fats on the walls of the arter- have to work harder for the blood chances of heart failure. Some ments, come greater responsibil- ity and antivenoms are important as much as
The fiber in whole fruit and ies, causing them to narrow, this is to keep circulating at normal rates. lifestyle changes that make an ity of educating people about ambulance facility to take the affected person
raisins lowers it becomes easy known as atherosclerosis. When the pressure on the heart impact on heart health are avoid- them along with symptoms and to the healthcare provider,” says
LDL (bad) to munch on. Q High blood pressure is a major increases, heart failure can occur. ing high cholesterol food, getting preventive measures of dealing Soundararajan. She adds, “Walking in accu-
cholesterol, which reduces Sticking to small portions risk factor for causing heart failure. Q Congenital heart defects are good sleep, giving up smoking and with heart failure. mulated rainwater can be dangerous. We have
strain on the heart. would work wonders as it When the pressure in the arteries the defects present from birth limiting alcohol consumption. CWTfaXcTaXbBT]X^a8]cTaeT]cX^]P[ seen a lot of cases where people dealing with
It is also a good source of would not add much is high, it causes the heart to pump and can cause deformities in the Q Treatment options for heart 2PaSX^[^VXbc7>3<PWPaPYP0VaPbT] snake carcasses were poisoned through the
potassium and treats calories to your diet. the blood harder than normal for development of the heart. If the failure depend upon the severity 7^b_XcP[=Tf3T[WX teeth of dead snakes.”
=4F34;78kCD4B30H kB4?C4<14A!'!!
Wcc_b)fffSPX[h_X^]TTaR^\eXePRXch
jane.
‘Ki hawaon si hoti hain ladkiyan,
Unhe behne me maza aata hai,
Unhe manzoor nahi unhe bewajah roka 5a^\R^d]cahbXSTc^cWTRXch
(Girls are becoming like the wind, 27A8BCH E0A674B4 V[X\_bTbX]c^PacXbcA09D10A08H0³b_Tab_TRcXeT
They delight in frolicking freely
They cannot accept being stopped for PVPX]bccWTQPRZSa^_^UWXbb^[^bW^fB^RXP[6PcWTaX]V
no reason.)
The chants of ‘Azadi’ wouldn’t sound
the same anymore. Ever. The weekend
brought heartbreak as the news that Kamla
Bhasin, the renowned women's rights
activist, author and poet, had passed away
at 75, or maybe finally found freedom from
cancer. Even as the cry that she raised , as
a part of the feminist movement, contin-
ues to reverberate as it is yet to find its log-
ical conclusion.
Born in Shahidanwali village of
Pakistan, Bhasin grew up in a rather prog-
gresive household. She rode bikes and
played with boys. Having said that, Bhasin
expressed sadness for all her female friends
who were never allowed to play with boys
or even outside, for that matter. The dis-
crimination against men and women was
ever since then embedded in her system
C@JH:==:2>D@? µ&RQWHQW¶0RHHQ$OL
UHWLUHVIURP7HVWFULFNHW
DE2C :? DC9¶D (H:4<6E H:? @G6C CC ?C8Q ;>=3>=
Bc^_RdabX]V8]SXPU^a 7TPehaPX]RhR[^]TP[TacU^aRTb1228c^ST[PhbcPac^US^\TbcXRbTPb^]
:XfXb4]V[P]S_d[[^dcb
New Delhi: The start of India’s domestic and U19 Girls One-Day tournament was cyclone alert issued by MET, the BCCI is
season has been delayed by two days with scheduled to begin on Tuesday across seven compelled to postpone the start of the
the Under-19 events for boys and girls venues. Heavy rain is expected in group stage from 28.09.2021 to
1228^UUXRXP[c^?PZXbcP]
pushed back to September 30 due to a Hyderabad and Bhubaneshwar, that are 30.09.2021,” wrote Dhiraj Malhotra, BCCI
cyclone alert in south Odisha and north among host cities for the matches along with General Manager — Game Development
Andhra Pradesh coasts. Indore, Vizag, Surat, Rajkot and Nagpur. — in his letter to the seven host associa-
The U19 Boys Vinoo Mankad Trophy “Owing to the incessant rain and the tions. PTI
80=BQ =4F34;78 name in all their ‘big or small
news’ that too without any
0abT]P[Wd\X[XPcTbB_dabbTPb^]bWTPSX]^__^bXcTSXaTRcX^] 0810F>A;31>G8=62´B78?B
0?Q ;>=3>= Spurs haven’t won at
Arsenal in the league since
to give away the ball inside
Tottenham’s half to Thomas
C>0;;>FB?42C0C>AB
owever bad things have 2010, and they did everything Partey that led to Arsenal scor- ?C8Q =4F34;78
H seemed for Arsenal over
the last decade, beating
to ensure that dismal run
wouldn’t end.
ing again on the break.
Kane did try to recover the pectators will be allowed at
Tottenham at the Emirates
Stadium can usually
Just look at how much
space was gifted to Arsenal to
situation as Arsenal advanced,
but his tackle on Saka could not
Sboxing
next month’s men’s world
championships in Serbia,
be relied on. launch the attack that ended in prevent him from getting the the International Boxing
Just not usually as the opening goal in the 12th shot away to add the third. Association (AIBA) announced
emphatically as Sunday’s north minute. Although Son Heung-min on Monday, making it the first
London derby triumph — a 3- Smith Rowe wasn’t tracked turned in a cross from Sergio major event in the sport to wel-
1 victory helping to clear the by the visitors as he found Reguilon in the 79th, there come back fans since the start of
early-season gloom for Mikel space in the penalty area to get would be no late Tottenham the COVID-19 pandemic.
Arteta’s side. on the end of Saka’s cross, evad- comeback. Especially not after The AIBA, in a statement,
Never before in the ing a futile late tackle by Lucas Moura had a strike said that tickets have gone on
Premier League has Arsenal Davinson Sanchez to net. tipped onto the crossbar by sale for the October 24 to
scored three goals as quickly in “I’ve always wanted to goalkeeper Aaron Ramsdale. November 6 showpiece, where
a derby.The goals inside the score against Tottenham in a “It is one of the nicest India will be represented by a
opening 34 minutes from derby,” the 21-year-old acade- things I have experienced in full-strength 13-strong squad 270<?8>=B78?BB2743D;4
Emile Smith Rowe, Pierre- my graduate said. “It’s just the this stadium,” said Arteta, who featuring Asian medal-winners >Rc^QTa!#) >_T]X]V2TaT\^]h
Emerick Aubameyang and best feeling ever.”Arteta will be has finished eighth in like Deepak Kumar (51kg), >Rc^QTa!$=^eT\QTa!) ?aT[X\X]PaXTb
Bukayo Saka rattled Tottenham feeling relieved. both of his seasons in charge of Shiva Thapa (63.5kg) and
and gave Arsenal fans an after- “He just tells us to keep Arsenal. Sanjeet (92kg). =^eT\QTa") ATbc3Ph
noon of gloating in the late calm,” Smith Rowe said, “and It was at Arsenal in “Spectators are allowed at =^eT\QTa#) BT\XUX]P[b
September sun. he encourages us.” November 2020 that Raúl the 2021 AIBA men’s World
“It’s quite easy when you A couple of months into Jiménez suffered a head injury Boxing Championships at Stark =^eT\QTa$%) 5X]P[b
have boys like this — they 0abT]P[´b1dZPh^BPZPRT]caTRT[TQaPcTbPUcTabR^aX]VWXbbXST´bcWXaSV^P[SdaX]V the job, Tottenham manager from a clash with David Luiz Arena in Belgrade, Serbia.
always listen, always ready to cWT4]V[XbW?aT\XTa;TPVdTb^RRTa\PcRWQTcfTT]0abT]P[P]SC^ccT]WP\7^cb_da Nuno Espirito Santo was that might have ended the Tickets for the main AIBA event globe to attend AIBA World For the first time in AIBA’s
learn,” Aubameyang said. PccWT4\XaPcTbbcPSXd\X];^]S^]Bd]SPh 0? unable to have any impact in Wolverhampton striker’s career. went on sale via official tickets Boxing Championships,” 75-year history, the medal win-
“They feel free when preventing this humiliation. He’s back this season and partner eFinity on the website Kremlev said. ners at the championships will
they play. That’s why they’re The captain wanted to put three in each. Arsenal, mean- “I am very honest,” he said. now scoring again. It was a efinity.Rs,” the AIBA said. “For us, it will be the first be rewarded with significant
doing amazing.” things right. while, has won all three games “If the game plan moment of magic that clinched AIBA President Umar major event with spectators prize money.
It was a month ago as “After the game after City, since the international break. didn’t work out the way you a 1-0 victory over winless Kremlev said he is eager to see after the start of the pandemic. The prize money fund has
August was drawing to a close we needed to have a chat But in a sign of recent infe- wanted, it’s because you didn’t Southampton. fans back in the arena after We are happy to welcome every- been set at USD 2.6 million.
that Arsenal had opened the between players,” Aubameyang riority for the neighbors, they decide it well.” Wearing protective head COVID-19 health safety proto- one in Belgrade at Stark Arena. The prize for first place is
season with three losses — said. “We’re doing really well aren’t challenging at Not even Harry Kane, gear, the Mexican breezed cols forced many sporting events I expect tough fights, beautiful USD 100,000. The silver-medal-
including at defending cham- right now.”The only thing con- the top but midtable with stopped from joining through the defense in the to become made for television in victories and bright emotions lists will receive USD 50,000 and
pion Manchester City — with- sistent this month for Arsenal 10th on goal difference Manchester City, could come to 61st minute before striking the last year and half. from the tournament. Our box- both bronzes in each weight cat-
out scoring while Tottenham Tottenham has been losing all and Tottenham 11th in the the rescue. past goalkeeper Alex “We are waiting for boxing ers will deliver a great show for egory will walk away with USD
was top with a perfect start. three games and conceding standings. In fact, the striker managed McCarthy. fans from Serbia and around the everyone,” he added. 25,000.