Proteins

Cấu trúc của Proteins

Protein
 Có nhiều cấu trúc và chức năng khác nhau
 Chức năng
 enzymes (pepsin, DNA polymerase)
 Cấu trúc (keratin, collagen)
 Vận chuyển(hemoglobin)
 Thông tin tế bào
 Tín hiệu (insulin và các hormon khác)

 receptors

 Bảo vệ (antibodies)
 Vận động (actin & myosin)
 Dự trữ (protein hạt)
Proteins
 Cấu trúc H2O

 monomer = amino acids

 Có 20 amino acid khác nhau
 polymer = polypeptide
 protein có thể có một hoặc nhiều chuỗi
polypeptide gấp cuộn lại với nhau
 Trọng lượng phân tử lớn

hemoglobin

Rubisco growth
hormones
Amino acids
 Cấu trúc
H O
H | ||
 Carbontrung tâm
—N—
—C— C—OH
 Nhóm amino
H |
 Nhóm carboxyl (acid)
 Nhóm R (chuỗi bên)
R
 Nhóm có thể thay đổi
amino = NH2
 Sự khác nhau của amino acid acid = COOH
Ảnh hưởng của các nhóm R:
amino acid không phân cực
 Nhóm không phân cực và tính kỵ nước
Ảnh hưởng của nhóm R:
amino acids phân cực
 Phân cực hoặc tích điện và háo nước
Ionizing in cellular waters H+ donors
 H+ acceptors
Ionizing in cellular waters
Nhóm amino acid có nhóm Sulfur
 Hình thành cấu nối disulfide
 Liênkết cộng hóa trị giữa sulfhydryls
 Ổn định cấu trúc không gian peptide và protein

H-S – S-H

Mùi trứng thối?

Proteins
 Liên kết peptide
 Liên kết cộng hóa trị hình thành giữa NH2
(amine) của một amino acid & COOH
(carboxyl)
của nhóm khác

H2O
dehydration synthesis

peptide
bond
Cấu trúc và chức năng của Protein
 Chức năng phụ thuộc cấu trúc
 Cấu trúc không gian
 Có hình dạng xoắn, nếp gấp, cuộn

pepsin

hemoglobin

collagen
Cấu trúc bậc 1 (Primary (1°) structure)
 Trình tự amino acids trong chuỗi
 Trình tự amino acid được xác định
bởi gen (DNA)
 Sự thay đổi trình tự amino acid ảnh
hưởng đến chức năng và cấu trúc
protein

lysozyme: enzyme
có trong nước mắt &
màng nhầy
Genes mã hóa Proteins…
Fig. 3.20

Cấu trúc bậc 1 của protein thể hiện trình tự sắp xếp của
các acid amin trên mạch polypeptid

Trình tự Amino acid của Ubiquitin

MQIFVKTLTGKTIALEVEPSDTIENVKAKIQDKEGIPPDQQ
RLIFAGKQLEEGRTLSDYNIQKESTLHLVLRLRGG
Bệnh thiếu máu hồng cầu hình lưỡi liềm

Just 1
out of 146
amino acids!

Háo nước! Kỵ nước!

Cấu trúc bậc 2 (Secondary)
 “Vùng gấp”
 Hìnhthành cấu trúc không gian chuỗi
polypeptide
 H bonds
 Liên kết yếu giữa các
nhóm R
 Hình
thành cấu trúc
không gian
 Xoắn 
 Nếp gấp 
Typical bond lengths within a peptide unit
Sự hình thành cấu trúc xoắn của
chuổi polypeptid: xoắn gốc f và y
Xoắn 
 Tính chất:
 f = -57o
 y = -47o 3.6 a.a. 0.54 nm
Per turn
 Cấu tạo xoắn
được hình
thành giữa


 Các gốc R đều

hướng ra
ngoài
 Xoắn 
 Xoắn a có 2 dạng:
xoắn phải, trái
 Proline làm “bẽ
cong xoắn”
 Xoắn α trong
protein ~ 26%
 Chiều dài của xoắn
α từ 4 – 40 acid
amin, trung bình
~12

Fig. 4.11
 Cấu trúc xoắn 
I X X X (F) X X L

Ưa nước

Kỵ nước

Figs. 4.12, 4.13

Cấu trúc xoắn -helices trên màng
tế bào

Transmembrane domain
Top view

Hydrophilic face Hydrophobic face

Leucine zippers! Part of
GCN4 –
 Motif: Leu ở a txn factor

vị trí (LX6L)

Fig. 4.14 DNA

Nếp gấp 

Phiến  song song: f = -119o, y = 113o

Nếp gấp 

Phiến  đối song song : f = -139o, y = 135o

 Nếp gấp 
 Các gốc bên nằm bên trên và bên
dưới mặt phẳng của nếp gấp

anti-parallel -sheet

Fig. 4.16
 Phiến 
 Phiến  có
thể hình Phần ưa nước
(hydrophilic)
thành lớp
đôi

Phần kỵ nước
(hydrophobic)

Fig. 4.17
Loops and turns
 Kết nối xoắn  và sợi  hình thành sợi
polypeptid liên kết chặt chẻ
 Loops are > 5 residues
 Turns are 5 or less residues
Dạng vòng  (-turns)
 Gắn chặt sợi 
đối song song
 Kết quả cấu trúc
quay đột ngột
180o
 Thường có nhóm
Pro và Gly
Cấu trúc
motifs
 Gồm 2 hay
nhiều cấu trúc
bậc hai liên
kết nhau
Cấu trúc bậc 3 (Tertiary structure)
 “Whole molecule folding”
 Tương tác của các amino acids nằm xa
nhau
 Tương tác kị nước
 Liên kết H và liên kết
ionic
 Cầu nối disulfua
 Liên kết cộng hóa trị của
nhóm sulfurs trong
sulfhydryls (S–H)
 Giữ chặt hình dạng
không gian
Christian Anfinsen placed the enzyme ribonuclease, which degrades RNA, in a solution
containing urea and β-mercaptoethanol. Urea destroyed all noncovalent bonds, while
the β-mercaptoethanol destroyed the disulfide bonds. The ribonuclease was
denatured. The enzyme displayed no enzymatic activity and existed only as a random
coil.
When the urea and β-mercaptoethanol were slowly removed,
the enzyme regained its structure and its activity.
Ribonuclease was renatured and attained its normal or native
state.

These results demonstrated that the information required for a

polypeptide chain to fold into a functional protein with a defined three-
dimensional structure is inherent in the primary structure.
 Proteins Fold by the Progressive Stabilization of
Intermediates Rather Than by Random Search

A monkey randomly poking at a key board could type a sentence from

Shakespeare in a few thousand keystrokes if the correct letters are
retained, a process called cumulative selection.

Protein folding also occurs by cumulative selection. Partly correct

folding intermediates are retained because they are slightly more
stable than unfolded regions.
Proteins Fold by the Progressive Stabilization of
Intermediates Rather Than by Random Search

Protein folding is often represented as a folding funnel. The

protein has maximum entropy and minimal structure at the top of
the funnel. The folded protein exists at the bottom of the funnel.
Some Proteins Are Inherently Unstructured and Can
Exist in Multiple Conformations
Intrinsically unstructured proteins (IUP) do not have a defined
structure under physiological conditions until they interact with other
molecules.

Metamorphic proteins exist in an ensemble of structures of

approximately equal energies that are in equilibrium.
Amyloidoses are diseases that result from the formation of
protein aggregates, called amyloid fibrils or plaques.

Alzheimer disease is an example of an amyloidosis.

Some infectious neurological diseases are caused by infectious proteins called
prions. Prions exist in two states, one α-helix rich (PrP) and the other β-sheet
rich (PrPSC).

PrPSC forms aggregates that disrupt cell function.

Mối liên hệ giữa cấu trúc và chức
năng của Protein
Collagen
 Phong phú
 Cấu trúc sợi
 Sức căng lớn

Collagen ở da
http://www.rcsb.org/pdb/molecules/molecule_list.html
 Collagen – cấu trúc cơ bản
 Cấu trúc sơ cấp
 Cấu trúc lặp Gly-X-Y; X thường
là Pro và Y thường là hydroxy-
Pro
 ~1000 nhóm
 Cấu trúc bậc hai
 Xoắn trái
 3 nhóm/vòng

 0.9 nm/vòng

 Không có liên kết H nội mạch

 Cấu trúc bậc 3, 4

3 chuỗi kéo dài và xoắn phải
cuộn với nhau (supercoil)
Fig. 4.36
What gives Collagen its strength?
 Liên kết hydro nội mạch bao gồm
Hydroxy-Pro
 Cách bối trí thành khối xoắn hình thành tơ
collagen
 Liên kết ngang nội mạch có liên kết cộng
hóa trị
Sự biến đổi hình thành collagen
Figs. 4.34, 4.37,4.38

hydroxyproline

hydroxylysine
Collagen liên kết ngang được hình thành giữa
lysines, allysines và dẫn xuất hydroxy

Allys-Lys

Fig. 4.38 Allys-Allys

 Liên kết hydrogen nội mạch

 Amide hydrogen của

glycine trong một
chuỗi hình thành liên
kết hydrogen với
nhóm carbonyl
oxygen của một
chuỗi khác

Fig. 4.35
 Myoglobin và Hemoglobin
 Reversibly bind
oxygen
Myoglobin giúp
khuyếch tán oxygen
trong cơ
Hemoglobin vận
chuyển oxygen
trong máu
 Myoglobin và
hemoglobin có màu đỏ
Fig. 4.41 Red blood cells
Myoglobin là monomer:
Hemoglobin là tetramer
 Cấu trúc bậc 4 làm cho O2 liên kết với
hemoglobin

Sperm whale oxymyoglobin Oxyhemoglobin người

2 tiểu đơn vị -globin
2 tiểu đơn vị -globin
Cấu trúc bậc 3 của
Hydrophobic pocket
oxygenated myoglobin ~80 interactions

và - và -globins
between 18 residues

 Cấu trúc tương

đồng
 Được phân ra
cách đây 350
triệu năm
 Heme bị che ở
-Globin (blue)
phần kỵ nước
-Globin (purple)
Myoglobin (green)
 Chúng ta thấy màu đỏ bởi heme
trong myoglobin and hemoglobin
 Nhóm Prosthetic
 Chelates iron
 Có màu đỏ sáng
 Four of six Fe(II)
coordination sites
are occupied by
the protoporphyrin
ring
 Heme is partially buried in a
hydrophobic cleft
 O2 được nối giữa heme
Fe(II) và His 64 His 64

 His 93 cũng kết hợp

với Fe(II)
 cleft prevents
irreversible oxidation
of Fe(II) allowing
reversible binding of
His 93 O2
O2
Sperm whale myoglobin
Fig. 4.40
Oxygen liên kết với nhóm heme
 Myoglobin và hemoglobin liên kết với
O2 với mức độ khác nhau
 Myoglobin
 Có ái lực cao hơn với O2
(thấp với P50)
 Hyperbolic binding
 O2:Mb 1:1 Hyperbolic

 Liên kết với O2 trong mô

Sigmoidal
 Hemoglobin
 Có ái lực với O2 thấp hơn
(cao với P50)
 sigmoidal binding
 O2:Hb 4:1
 Liên kết O2 trong phổi giải
phóng trong mô
Fig. 4.46
Hemoglobin có 2 hình dạng

 Trạng thái T
 Taut
 Áilực thấp
 Loại bỏ Oxy-

 Trạng thái R
 Relaxed
 Áilực cao
 Oxy-
Molecular explanation for sigmoidal
binding curve of hemoglobin
 Binding of O2 to first
subunit
 Locks it in R state
 induces neighboring
subunits to shift toward
R state
 Increase in binding
affinity progresses as
more and more
subunits bind O2 (up
to 500 fold) Oxyhemoglobin
Deoxyhemoglobin
Allosterism
 Allosteric effectors bind to a site other than
the active site of an enzyme altering its
activity
 Activators stabilize the R state
 Inhibitors stabilize the T state

 Hemoglobin, though not an enyme,

demonstrates allosterism relative to its O2
binding
 2,3BPG là một chất ức chế
allosteric của hemoglobin
 Raises the P50 for
deoxy-Hb from
12 to 26 torr
 Hiện diện trong
RBCs ở tỉ lệ 1:1
với Hb

2,3BPG

Fig. 4.49 heme

Regulation of Hemoglobin by CO2
 Nồng độ CO2 thấp trong
phổi và cao ở trong mô
 Bohr effect
 Sự tăng CO2 làm giảm pH
 Giảm pH tăng P50 của Hb
 N-termini của Hb
reversibly react with CO2
to form carbamate
adducts in tissues –
released in lungs

Fig. 4.50
 Kháng thể
 Là một phần của hệ thống bảo vệ
 Được sản xuất bởi lymphocytes
 Nhận biết và liên kết kháng nguyên antigens

Fig. 4.52 IgG

 Cấu trúc kháng thể (Antibody)
 Immunoglobulin G
(IgG)
 Most common
class
 2 chuổi nặng
 2 chuổi nhẹ
 Liên kết Disulfided
 Glycoproteins

Fig. 4.52
The immunoglobulin fold Hypervariable
region

 Basic domain
structure of
Immunoglobulins
 110 nhóm
 Có nhiều domains
 Loops on outer
surface make up the
hypervariable region
 Complementary to
antigen surface
 Specific high affinity
binding to antigen