Profiling yeast cell surface proteins of S. cerevisae by magnetic Profiling yeast cell surface proteins of S.
. cerevisae by magnetic Profiling yeast cell surface proteins of S. cerevisae by magnetic
nanoparticles based covalent labeling of amine groups nanoparticles based covalent labeling of amine groups Ujwal S. Patil 1 ; ParisaPirani; YangCai 1,3 Ujwal S. Patil 1 ; ParisaPirani; YangCai 1,3 ; Matthew A. Tarr 1,2 1 Department of Chemistry, University of New Orleans, New Orleans, Louisiana, 70148, USA 1 Department of Chemistry, University of New Orleans, New Orleans, Louisiana, 70148, USA 2 Advanced Materials Research Institute,University of New Orleans, New Orleans, Louisiana 70148, USA 2 Advanced Materials Research Institute,University of New Orleans, New Orleans, Louisiana 70148, USA 3 The Research Institute for Children, Childrens Hospital, New Orleans, LA, USA 3 The Research Institute for Children, Childrens Hospital, New Orleans, LA, USA Overview of the project LabelingCSPs of S. cerevisaeusingsulfo-NHSester modified Fluorometriccharacterization of sulfo-NHSester coated Overview of the project LabelingCSPs of S. cerevisaeusingsulfo-NHSester modified FeO@SiO NPs Fluorometriccharacterization of sulfo-NHSester coated Fe 3 O 4 @SiO 2 NPs Overview of the project Synthesisand characterization of sulfo-N-hydrosuccinimidyl (NHS) b Fe 3 O 4 @SiO 2 NPs Fe 3 O 4 @SiO 2 NPs Synthesisand characterization of sulfo-N-hydrosuccinimidyl (NHS) ester conjugated magnetic nanoparticles a b ester conjugated magnetic nanoparticles Quantification of free amine reactive groupspresent on the surface a Quantification of free amine reactive groupspresent on the surface of magnetic nanoparticles of magnetic nanoparticles Confirmingcell surface attachment of magnetic nanoparticlesusing TEM TEM Labelingamine groupsof yeast cell surface proteinsusingsulfo-NHS Fluorescenceimagesof a) Dansylcadaverineconjugatedsulfo-NHSester Labelingamine groupsof yeast cell surface proteinsusingsulfo-NHS ester modified Fe 3 O 4 @SiO 2 NPs Fluorescenceimagesof a) Dansylcadaverineconjugatedsulfo-NHSester modifiedFe 3 O 4 @SiO 2 NPsb) NPsafter removal of dansylcadaverinevia Introduction modifiedFe 3 O 4 @SiO 2 NPsb) NPsafter removal of dansylcadaverinevia disulfide cleavage. Dansylcadaverine was covalenlty conjugated to sulfo-NHSester NPs andafter imaging, danylcadaverinewasremoved Cell surfacelabelingwasperformedinaqueousenvironment at 3C. Upon Introduction Theexposedportionsofcell Surfaceproteins(CSPs)playmajorroles sulfo-NHSester NPs andafter imaging, danylcadaverinewasremoved by disulfide bond cleavage resulting into disappearance of green Cell surfacelabelingwasperformedinaqueousenvironment at 3C. Upon labeling, CSPs conjugated to NPs were magnetically separated and Theexposedportionsofcell Surfaceproteins(CSPs)playmajorroles incell-cell communicationandattachmenttohost. by disulfide bond cleavage resulting into disappearance of green fluorescenceofdanylcadaverine( ex of335nmand em of512nm). labeling, CSPs conjugated to NPs were magnetically separated and subjected to SDS wash and tryptic digestion. The last step involved incell-cell communicationandattachmenttohost. The popular biotinylation agent available to target free amine fluorescenceofdanylcadaverine( ex of335nmand em of512nm). TEM of S. cerevisaecells labeled by sulfoNHSester subjected to SDS wash and tryptic digestion. The last step involved magnetic separation of tryptic peptides conjugated to NPs followed by cleavageof disulfidebond. Labelingbysulfo-NHSester NPsadded201.28 The popular biotinylation agent available to target free amine residues of CSPs, sulfo-NHS-LCbiotin have shown some drawbacks includingpoorrecoveryof biotinconjugatedproteinsandnonspecific TEM of S. cerevisaecells labeled by sulfoNHSester coated Fe 3 O 4 @SiO 2 NPs cleavageof disulfidebond. Labelingbysulfo-NHSester NPsadded201.28 DaonlysineresiduesofCSPs.The labeledpeptidemixturewasanalyzedby includingpoorrecoveryof biotinconjugatedproteinsandnonspecific bindingofproteinstoavidin. coated Fe 3 O 4 @SiO 2 NPs DaonlysineresiduesofCSPs.The labeledpeptidemixturewasanalyzedby LC-MS/MSand SEQUEST database was performed for peptide sequence bindingofproteinstoavidin. Magnetic nanoparticles functionalized with amine reactive groups LC-MS/MSand SEQUEST database was performed for peptide sequence andlabeledsiteidentification The S. Cerevisae cells were manually Magnetic nanoparticles functionalized with amine reactive groups couldserve as a potential tool to label the surface exposedamine groupsofCSPs. Results The S. Cerevisae cells were manually fixed for imaging. Cell surface groupsofCSPs. Inourlab, wehavedevelopeddisulfidelinkedN-hydrosuccininimdyl Results fixed for imaging. Cell surface conjugation can be clearly seen in the Inourlab, wehavedevelopeddisulfidelinkedN-hydrosuccininimdyl (NHS) ester/sulfo-NHSester silicacoatedironoxide(Fe 3 O 4 @SiO 2 ) to Results conjugation can be clearly seen in the image. Characterization of FeO@SiO NPs and thiol coated (NHS) ester/sulfo-NHSester silicacoatedironoxide(Fe 3 O 4 @SiO 2 ) to covalentlylabel aminegroupsofpeptides/proteins. Modifiedcell surfacepeptideswereanalyzedbyLC-MS/MSfollowed Characterization of Fe 3 O 4 @SiO 2 NPs and thiol coated FeO@SiO NPs Modifiedcell surfacepeptideswereanalyzedbyLC-MS/MSfollowed bySEQUESTdatabasesearchtodeterminethelabeledsites. Methods 3 4 2 Fe 3 O 4 @SiO 2 NPs An exposed peptide segment of S. cerevisae protein bySEQUESTdatabasesearchtodeterminethelabeledsites. Methods MVRVAINGFGRIGRLVMRIALSRPNVEVVANDPFITNDYAAYMFKYDSTHGRYAGEVSHDDKHIIVDGKKIATYQER An exposed peptide segment of S. cerevisae protein 1200 a b MVRVAINGFGRIGRLVMRIALSRPNVEVVANDPFITNDYAAYMFKYDSTHGRYAGEVSHDDKHIIVDGKKIATYQER DPANLPWGSSNVDIAIDSTGVFKELDTAQKHIDAGAKKVVITAPSSTAPMFVMGVNEEKYTSDLKIVSNASCTTNCL APLAKVINDAFGIEEGLMTTVHSLTATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVLPELQGKLTGMAFR Synthesis of sulfo-NHSester modified Fe 3 O 4 @SiO 2 NPs 1200 Si a b APLAKVINDAFGIEEGLMTTVHSLTATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVLPELQGKLTGMAFR VPTVDVSVVDLTVKLNKETTYDEIKKVVKAAAEGKLKGVLGYTEDAVVSSDFLGDSHSSIFDASAGIQLSPKFVKLVS WYDNEYGYSTVVDLVEHVAKA Synthesis of sulfo-NHSester modified Fe 3 O 4 @SiO 2 NPs 1000 O WYDNEYGYSTVVDLVEHVAKA SEQUEST database search yielded few proteins with modified lysine 800 Counts Fe O SEQUEST database search yielded few proteins with modified lysine residues. One of the labeled protein is shown above which is 600 Counts residues. One of the labeled protein is shown above which is glyceraldehyde-3- phosphate dehydrogenase (Accession: SGDID:S000003424), lysineresidue(K)islabeledbysulfo-NHSestertag. 400 SGDID:S000003424), lysineresidue(K)islabeledbysulfo-NHSestertag. Conclusion 200 Conclusion 0 200 Fe S Cu Sulfo-NHSester groupswerecovalentlyconjugatedtothesurfaceof Fe 3 O 4 @SiO 2 NPsviathiol-disulfideexchangereaction. 500 1000 0 Energy(keV) NPsviathiol-disulfideexchangereaction. TEMimagingconfirmedthe cell surface attachment of sulfo-NHSester NPs to S cerevisae. Energy(keV) (a) TEMimageof FeO@SiO NPs.(Averagesize: 150nm). TEManalysisof cerevisae. LC-MS/MSanalysisconfirmedlabelingof exposedcell surfacelysineresiduesby (a) TEMimageof Fe 3 O 4 @SiO 2 NPs.(Averagesize: 150nm). TEManalysisof Fe 3 O 4 confirmedtheouter silicacoating. TheFe 3 O 4 @SiO 2 NPswerenearly LC-MS/MSanalysisconfirmedlabelingof exposedcell surfacelysineresiduesby Sulfo-NHSestermodifiedFe 3 O 4 @SiO 2 NPs. Protocol forsynthesisof sulfo-NHSestermodifiedFe 3 O 4 @SiO 2 NPs. 1) Synthesisof ironcore(FeO)byhydrothermal method2)Preparation Fe 3 O 4 confirmedtheouter silicacoating. TheFe 3 O 4 @SiO 2 NPswerenearly uniform, monodisperseandstableinaqueoussolvents(c)TEM-EDXof thiol coated FeO@SiO NPs showing the peak of sulfur to confirmMPTMS Acknowledgements 3 4 2 Synthesisof ironcore(Fe 3 O 4 )byhydrothermal method2)Preparation of FeO@SiO NPsbysol-gel approach3)Introductionof thiol groups coated Fe 3 O 4 @SiO 2 NPs showing the peak of sulfur to confirmMPTMS conjugationtoFeO@SiO NPs. ThisworkwassupportedbytheLouisianaBoardof RegentsgrantLEQSF(2007-12)-ENH-PKSFI-PRS- Acknowledgements of Fe 3 O 4 @SiO 2 NPsbysol-gel approach3)Introductionof thiol groups onthesurfaceof Fe 3 O 4 @SiO 2 NPs4) Conjugationof sulfo-NHSester conjugationtoFe 3 O 4 @SiO 2 NPs. ThisworkwassupportedbytheLouisianaBoardof RegentsgrantLEQSF(2007-12)-ENH-PKSFI-PRS- 04toMAT, theResearchInstituteforChildren, ChildrensHospital NewOrleans, NIHgrant P01HL076100, Intramural fundfromRICandChildrensHospital toYC onthesurfaceof Fe 3 O 4 @SiO 2 NPs4) Conjugationof sulfo-NHSester group to thiol coated Fe 3 O 4 @SiO 2 NPs by thiol-disulfide exchange reaction. P01HL076100, Intramural fundfromRICandChildrensHospital toYC 3 4 2 reaction.
Structure and Function of Membrane Proteins: Proceedings of the International Symposium on Structure and Function of Membrane Proteins Held in Selva Di Fasano (Italy), May 23-26, 1983
Biochemical Factors Concerned in the Functional Activity of the Nervous System: First International Meeting of the International Society for Neurochemistry, Strasbourg, 1967
Tumor Suppressor APC Blocks DNA Polymerase - Dependent Strand Displacement Synthesis During Long Patch But Not Short Patch Base Excision Repair and Increases Sensitivity To Methylmethane Sulfonate