index 0, ID = NP_002728.

2, lenght 672, with 34 features

ID: NP_002728.2
Name: NP_002728
Description: protein kinase C alpha type [Homo sapiens]
Number of features: 34
/topology=linear
/data_file_division=PRI
/date=31-DEC-2019
/accessions=['NP_002728']
/sequence_version=2
/keywords=['RefSeq', 'MANE Select']
/source=Homo sapiens (human)
/organism=Homo sapiens
/taxonomy=['Eukaryota', 'Metazoa', 'Chordata', 'Craniata', 'Vertebrata',
'Euteleostomi', 'Mammalia', 'Eutheria', 'Euarchontoglires', 'Primates',
'Haplorrhini', 'Catarrhini', 'Hominidae', 'Homo']
/references=[Reference(title='PKCalpha promotes insulin secretion via TRPC1
phosphorylation in INS-1E cells', ...), Reference(title='Kinase activity of casein
kinase 1 delta (CK1delta) is modulated by protein kinase C alpha (PKCalpha) by
site-specific phosphorylation within the kinase domain of CK1delta', ...),
Reference(title='Mapping phospho-catalytic dependencies of therapy-resistant
tumours reveals actionable vulnerabilities', ...), Reference(title='Protein Kinase
C Quality Control by Phosphatase PHLPP1 Unveils Loss-of-Function Mechanism in
Cancer', ...), Reference(title='Fine-scale haplotype mapping of MUT, AACS, SLC6A15
and PRKCA genes indicates association with insulin resistance of metabolic syndrome
and relationship with branched chain amino acid metabolism or regulation', ...),
Reference(title='FGF inactivates myogenic helix-loop-helix proteins through
phosphorylation of a conserved protein kinase C site in their DNA-binding domains',
...), Reference(title='The two forms of bovine heart 6-phosphofructo-2-
kinase/fructose-2,6-bisphosphatase result from alternative splicing', ...),
Reference(title='Identification of the cAMP-dependent protein kinase and protein
kinase C phosphorylation sites within the major intracellular domains of the beta
1, gamma 2S, and gamma 2L subunits of the gamma-aminobutyric acid type A receptor',
...), Reference(title='Nitric oxide synthase regulatory sites. Phosphorylation by
cyclic AMP-dependent protein kinase, protein kinase C, and calcium/calmodulin
protein kinase; identification of flavin and calmodulin binding sites', ...),
Reference(title='PKC epsilon-related kinase associates with and phosphorylates
cytokeratin 8 and 18', ...)]
/comment=REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AC009452.21, AC006263.1,
AC006947.2, AC005918.13 and AC005988.1.
On Nov 23, 2018 this sequence version replaced NP_002728.1.
Summary: Protein kinase C (PKC) is a family of serine- and
threonine-specific protein kinases that can be activated by calcium
and the second messenger diacylglycerol. PKC family members
phosphorylate a wide variety of protein targets and are known to be
involved in diverse cellular signaling pathways. PKC family members
also serve as major receptors for phorbol esters, a class of tumor
promoters. Each member of the PKC family has a specific expression
profile and is believed to play a distinct role in cells. The
protein encoded by this gene is one of the PKC family members. This
kinase has been reported to play roles in many different cellular
processes, such as cell adhesion, cell transformation, cell cycle
checkpoint, and cell volume control. Knockout studies in mice
suggest that this kinase may be a fundamental regulator of cardiac
contractility and Ca(2+) handling in myocytes. [provided by RefSeq,
Jul 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
/structured_comment=OrderedDict([('Evidence-Data', OrderedDict([('Transcript exon
combination', 'SRR1660805.10531.1, SRR1660807.61550.1 [ECO:0000332]'), ('RNAseq
introns', 'single sample supports all introns SAMEA1965299, SAMEA1966682
[ECO:0000348]')])), ('RefSeq-Attributes', OrderedDict([('MANE Ensembl match',
'ENST00000413366.8/ ENSP00000408695.3'), ('RefSeq Select criteria', 'based on
conservation, expression, longest protein')]))])
Seq('MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCT...SAV', IUPACProtein())
Features CDS
1