The Okhotsk and Bering Seas High Resolut

Received 28 Jan 2006
IODP Proposal Cover Sheet

477-Add6
New Reviced Addendum
Please fill out information in all gray boxes Above For Official Use Only
Title: The Okhotsk and Bering Seas: High Resolution Plio-Pleistocene

Evolution of the Glacial/Interglacial Changes in the Marginal Seas
Proponent(s): Kozo Takahashi, Vladivir Bezverkhny, Sergei A. Gorbarenko, Koichi Iijima, Minoru Ikehara, Yukari Kido, Itaru Koizumi,
Makoto Okada, Ana Christina Ravelo, Andrey Rezanov, Tatsuhiko Sakamoto, David W. Scholl, Uko Suzuki,
Ralf Tiedemann, Hidekazu Tokuyama, Testuro Tsuru, Fujio Yamamoto
Keywords: Gateway, North Pacific Intermediate Water, sea-ice, glacial- The Okhotsk and
Area:
(5 or less) interglacial cycles, Northern Hemisphere glaciation Bering Seas
Contact Information:
Contact Person: Kozo Takahashi
Department: Department of Earth & Planetary Sciences, Graduate School of Sciences
Organization: Kyushu University
Address Hakozaki 6-10-1, Higashi-ku, Fukuoka 812-8581, JAPAN
Tel.: 81-92-642-2656 Fax: 81-92-642-2686
E-mail: kozo@geo.kyushu-u.ac.jp
Permission to post abstract on IODP-MI Sapporo Web site: X Yes No
Abstract: (400 words or less)
We propose to drill sediments appropriate for a detailed study of the Plio-Pleistocene evolution
of millennial to Milanktovitch scale climatic oscillations in the Okhotsk and Bering Seas. Biological,
chemical and physical oceanography as well as adjacent continental climate of the Okhotsk and Bearing
Seas are highly sensitive to global climate conditions, and are recorded by variations in the sedimentary
composition of diatom and other microfossil groups, as well as many other paleoclimatic indicators.
These marginal seas of the north Pacific are also source regions of North Pacific Intermediate Water
(NPIW). Since the production of NPIW is thought to be tied to global climate change and to Pacific
ocean circulation and nutrient distributions, investigating the evolution of conditions in these regions of
NPIW formation is critical to the development of an integrated in-depth understanding of Pacific
paleoceanography during the transition from the warmer climate of the Early Pliocene and into the
colder climate of the late Pliocene and Pleistocene. This investigation will include the documentation of
the effect of changes in the Bering Strait Gateway region. The Bering Strait is the gateway through
which communication between the Atlantic and Pacific, via the Arctic Ocean, occurs today. Thus, its
evolution is critical to an understanding of transitions in global ocean heat and nutrient budgets. Detailed
high resolution paleoenvironmental reconstructions from these marginal seas has not been achieved,
although there was some reconnaissance work during DSDP Leg 19 in the Bering Sea. Therefore, most
of the prospective drilling, especially since triple HPC holes can provide continuous sedimentary
records, will result in new information to link the history of these marginal seas with open Pacific and
global changes during the past approximately 5 Ma.
This addendum includes update information of relocation according to the comments from the
last EPSP meeting (December 12-14, 2005 at Honolulu, Hawaii).
477-Add6
Scientific Objectives: (250 words or less)
Major objectives of this proposed drilling in the Okhotsk and Bering Seas are:
1. To elucidate detailed evolutional history of climate and surface ocean conditions since the earliest
Pliocene in the Okhotsk and Bering Seas where amplified high resolution changes of climatic signals are
recorded.
2. To shed light on temporal changes in the origin and intensity of North Pacific Intermediate Water and
possibly deeper water mass formation in the Okhotsk and Bering Seas.
3. To characterize the history of continental glaciation, river discharges, and sea-ice formation, in order to
investigate the link between continental and oceanic conditions of the Okhotsk and Bering Seas and
adjacent land areas.
4. To investigate linkages, through comparison to pelagic records, between ocean/climate processes that
occur in the more sensitive marginal sea environment and processes that occur in the north Pacific and/or
globally. This objective includes an evaluation of how the history of ocean/climate of the Bering Strait
gateway region may have had an effect on north Pacific and global conditions.
All of these scientific objectives will focus both on the longer term ocean and climate history, as well as the
evolution of higher frequency glacial-interglacial to millennial scale oscillations through the Plio-
Pleistocene.
Please describe below any non-standard measurements technology needed to achieve the proposed scientific objectives.
Proposed Sites:
Water Penetration (m)
Site Name Position Depth Brief Site-specific Objectives
(m) Sed Bsm Total
ASR-3B 48°58.7’N, 150°26.4’E 1422 700 0 700 Sea-ice, intermediate water
ASR-1C 49°09.7’N, 150°30.5’E 1317 245 0 245 Sea-ice, intermediate water
COP-2E 51°59.0’N, 147°10.4’E 1320 745 0 745 Sea-ice, water circulation
COP-2F 52°03.1’N, 147°01.4’E 1345 200 0 200 Sea-ice, water circulation
PGR-2A 47°52.9’N, 147°13.7’E 2544 445 0 445 Sea-ice, water circulation
KAM-2B 52°14.2’N, 153°02.3’E 610 200 0 200 Sea-ice, water circulation
SAK-2B 51°19.5’N, 145°55.5’E 970 200 0 200 Sea-ice, water circulation
SHR-3B 56°26.1’N, 170°37.2’E 2232 200 0 200 Water circulation, sea ice
SHR-1B 57°19.0’N, 170°06.4’E 963 200 0 200 Water circulation, sea ice
BOW-12B 53°24.0’N, 179°31.3’W 1313 745 0 745 Water circulation
BOW-14B 54°02.0’N, 179°00.5’E 2166 600 0 600 Water circulation
BOW-15A 54°49.7’N, 176°55.0’E 837 165 0 165 Water circulation
GAT-3C 59°03.0’N, 179°12.2’W 3209 745 0 745 Bering/Arctic gateway, sea-ice
GAT-4C 57°33.4’N, 175°49.0’W 1975 745 0 745 Bering/Arctic gateway, sea-ice
UMK-4D 54°40.2’N, 169°58.9’W 1900 200 0 200 Pacific water entrance
UMK-3B 54°25.1’N, 170°14.6’W 1898 200 0 200 Pacific water entrance
KST-1B 55°55.6’N, 164°54.9’W 3435 200 0 200 Pacific water entrance
Proposal ID 477-Full4
Proposal Name Othotsk/Bering Plio-Pleistocene
Summary
ISP Objective Deep Biosphere & Environmental Change
1. To elucidate detailed evolutionary history of climate and surface ocean conditions since the earliest Pliocene in the
Okhotsk and Bering Seas where amplified high resolution changes of climatic signals are recorded.
2. To shed light on temporal changes in the origin and intensity of North Pacific Intermediate Water and possibly
deeper water mass formation in the Okhotsk and Bering Seas.
3. To characterize the history of continental glaciation, river discharges, and sea-ice formation, to investigate the link
Scientifc Purpose(s)
between continental and oceanic conditions of the Okhotsk and Bering Seas and adjacent land areas.
4. To investigate linkages, through comparison to pelagic records, between ocean/climate processes that occur in the
more sensitive marginal sea environment and processes that occur in the north Pacific and/or globally. This objective
includes an evaluation of how the history of ocean/climate of the Bering Strait gateway region may have had an effect
on north Pacific and global conditions.
Water Depth 675-3300 m
Max Drill Depth 700 m
Vessel riserless
Operation Time Estimate 56 days (IO estimate - transit, port and operations = 90 days)
Lithology Siliceous clay
Operational Risks Ice
Environmental Constraints June - Sept preferred weather window (ice, ice bergs and typhoons)
Drilling/Coring Triple APC to refusal, XCB and RCB if needed
Logging N/A
Limitations / Assumptions Poor quality navigation, accuracy of site locations
Special Considerations Weather Observer, Russian Clearance, Emergency Evacuation
Technical Issues
Status of Technical Issues
3rd Party Requirements
CORK description (if app) NA
Costs scale
Milestones
Forwarded to SPC May 04
Forwarded to OTF Jun 04
SSP Classification Feb 06
EPSP Site Approval
OTF Scheduled Jul 07
SPC Approval of schedule
FULL2
Oct-01 ADD2
iSSEPs Nov-01 Forward to iPC
iPC Mar-02 Not ready for ranking
iSSEPs May-03 Submit revised Full Proposal
iSSP Jul-03 Sites classified as 2A, 2C, and 3A
Apr-03 FULL3
Oct-03 FULL4
SSEP Nov-03 Sent out for external review
SSEP May-04 477-Full4 forwarded to SPC
SPC Jun-04 Committee decided to include 477-Full4 in the pool for global ranking (ranked 4th) to be forwarded to OTF.
EPSP Jun-04 Named challenges/issues with 477-Full4 are: Hydrates and penetration up to 700m
SPC Motion 04-10-34 (Excerpt): Model 3 (including 477-Full4) designated as backup plan for the potential FY2005
drilling schedule
SPC Consensus 04-10-36 The SPC recommends for the remainder of FY2006 following Proposal 482-Full3 Wilkes
Land Margin with appropriate non-riser drilling components of Proposals 603A-Full2 NanTroSEIZE Reference Sites
SPC Oct-04 and 603B-Full2 NanTroSEIZE Mega-Splay Faults, then Proposal 477-Full4 Okhotsk and Bering Seas
Paleoceanography,
Part 1. The committee also recommends the remainder of Proposal 545-Full3 Juan de Fuca Flank Hydrogeology or
Proposal 553-Full2 Cascadia Margin Hydrates as a backup for Proposal 477-Full4 Okhotsk and Bering Seas
Paleoceanography, Part 1.
SSP Feb-05 477-Full4 remains with the OTF with newly submitted site survey data
From SPC Consensus 0503-15: Full4 should remain with the OTF for them to consider in developing drilling schedule
SPC Mar-05 scenarios for FY2006 and beyond.
Several prospective candidates for potential co-chief scientists were nominated for 477-Full4
Recommendation: Proponents are asked to provide new latitude/longitudes for all repositioned sites including GAT-
3B (relocated GAT-3A), ASR-1B relocated ASR-1A), ASR-2B (relocated ASR-2A), and COP-2D (relocated COP-2C).
The panel requests a new location be presented for PGR-1A. In addition, the panel requests that all seismic data and
maps for an individual location be presented at the same display scales. The panel has requested that the proponents
EPSP Jun-05 provide information on the length of the streamer used to collect the data associated with COP-2C.The dataset
presented for the site-by-site review was, in general, not satisfactory for a meaningful safety assessment by the panel.
Many of the sites could not be approved as proposed nor could they be relocated by EPSP with the available data. It
was suggested that seismic data could be acquired prior to drilling by the drillship for the necessary safety assessment
and that a real-time evaluation would need to be made.
SSP Sep-05 Site characterization completeness 2A-2C.
Katz reported that the EPSP reviewed 477-Full4 and that the safety package only proved sufficient to approve five of
SPC Oct-05 the eighteen sites. The increasing need for third-party assessments of shallow hazards would impact the timing of
when the EPSP can approve drilling sites
Recommendation: In order to obtain final approvals proponents have been asked to provide new latitudes and
longitudes and completed safety sheets to the EPSP Chair, USIO-TAMU, and IODP-MI for sites GAT-3C, GAT-4C,
EPSP Dec-05 UMK-4D, and ASR-1C. Proponents are also asked to re-confirm what spheroid was used and insure that the all data
are consistent. Provide this confirmation to the panel chair, TAMU (Jack Baldauf), and IODP-MI. EPSP watchdog for
Proposal 477 is Sumito Morita.
From EPSP meeting, 477-Full4 is currently being reviewed by SSEP with the new data; uncertainty over the spheroid
remains a concern.
SSP Feb-06
Site characterization completeness and data adequacy summary: BOW, UMK, GAT, KST, ASR, KAM, SHR,
COP, PRG: 1Ca (all sites do not have crossing lines; data image target adequately, no science concerns)
SPC Consensus 06-03-29: The SPC approves the revised FY2007-09 operations schedule of the U.S. scientific ocean
drilling vessel (SODV) as proposed in Model 1B of the Operations Task Force (OTF). The recommended expeditions
SPC Mar-06 would begin in August 2007 and proceed through March 2009 (477-Full4 is 5th in the schedule)
Inadequate data presentation to EPSP in June 05 kept 477-Full4 off schedule but the situation as improved and aside
from clearance issues and the weather window the 477-Full4 is ready for immediate scheduling
Bering Sea Portion of 477-Full4 scheduled in the 2008/2009 drilling schedule. Scheduled as 4th expedition occurring
OTF Jun-06 May-July.
From SPC Consensus 06-08-03: SPC approves the science plan and operations schedule for Fy2008 and early 2009
SPC Aug-06 which included 477-Full4, fourth in the schedule. If the SODV is delayed, the schedule may shift due to weather
windows on the Bering Sea and Juan de Fuca expeditions.
SPC Consensus 0703-15: The SPC accepts the adjustments recommended by the Operations Task Force (OTF) to
the FY2008-2009 U.S. Scientific Ocean Drilling Vessel (SODV) science operations schedule in response to National
Science Foundation (NSF) budgetary guidance for FY2008 and other logistical factors. After a 1 January 2008 start
date to international operations and a short transit, the approved schedule would include the following sequence:
- NanTroSEIZE Stage 1 coring (Proposals 603A-Full2, 603C-Full; subduction inputs and site NT3-01)
- Equatorial Pacific Paleogene Transect I (Proposal 626-Full2)
SPC Mar-07 - Equatorial Pacific Paleogene Transect II, ending with remedial cementing of two Juan de Fuca CORKs installed on
Expedition 301
- Bering Sea Pliocene/Pleistocene Paleoceanography (Proposal 477-Full4)
- Spanning the FY transition, a transit to the Southern Oceans with undetermined potential for brief additional science
operations
- Canterbury Basin Sea Level (Proposal 600-Full)
- Wilkes Land Paleoceanography (Proposals 478-Full3, 638-APL2)
OTF Jul-07 No change. Still on July to September time frame.
iSAS/IODP Proposal Cover Sheet
New Revised Addendum
482-Full3
Above For Official Use Only
Please fill out information in all gray boxes
Title: Cenozoic East Antarctic Ice Sheet History from the

Wilkes Land Sediments
Proponent(s): C. Escutia C., A.K. Cooper, S.L. Eittreim, M. Tanahashi, T. Ishihara, L. DeSantis, P.
O Brien
Keywords: Cenozoic, Antarctica, Ice sheet, Paleoclimate, Area: S. Ocean
(5 or less) Sedimentary sequences
Contact Carlota Escutia
Person:
Department: Science Services
Organization: Ocean Drilling Program
Address 1000 Discovery Drive, College Station, TX-77845
Tel.: 979-845 0506 Fax.: 979-845 0876
E-mail: Escutia@odpemail.tamu.edu
Permission to post abstract on iSAS Web site: Yes No
This is a revision of proposal 482-Full2 which includes preliminary results from the WEGA cruise as recommended
by the ODP panels. Drilling the Wilkes Land margin is designed to provide a long-term record of Antarctic glaciation
and its relationship with global sea level, paleoclimate and paleoceanographic changes. The primary goals are: 1) to
obtain the nature and the timing of the Cenozoic onset of grounded ice from the continental shelf and rise deposits
(shelf Sites WLSHE-07A, WLSHE-09A and rise Site WLRIS-02A), and 2) to obtain a high-resolution late Neogene-
Quaternary glacial/interglacial record of glaciation from the rise deposits (Sites WLRIS-01A and WLRIS— 03A). An
additional objective is to identify and date large fluctuations in the extent of the East Antarctic Ice Sheet possibly
throughout much of the Miocene (shelf Site WLSHE-08A).
Drilling the Wilkes Land margin has the unique advantage that is the only known margin around Antarctica
where the unconformity (referred to as WL2), inferred to separate pre-glacial strata below from glacial strata above
in the continental shelf, can be traced to the continental rise deposits, allowing sequences to be linked from shelf to
rise. Because strata below and above the "glacial onset" unconformity can be sampled at relatively shallow depths,
the record of the onset of glaciation can be obtained during a single drilling leg from two depositional environments,
the shelf foreset (Sites WLSHE-07A and WLSHE—09A) and the rise hemipelagic (Site WLRIS-02A) strata. The shelf
foreset section provides a direct record of first occurrence of grounded ice but one that is less continuous and harder
to date. The rise hemipelagic section provides an indirect record of glaciation but one that is more continuous and
easier to date.
The proposed 37 day drilling program will constrain the age, nature and paleoenvironment of deposition
of the Wilkes Land sedimentary sequences. The chronostratigraphy from drilling the Wilkes Land margin, at present
non-existent, is necessary to ground-truth the existing glacial- stratigraphic and ice-sheet volume models. Ice sheet
models show that the Wilkes Land margin became glaciated in the later stages of East Antarctic glaciation, after
Prydz Bay and the Weddell Sea and is thus more sensitive to future temperature changes. The results from drilling
the Wilkes Land can be compared with results from the Antarctic Peninsula (Leg 178), Prydz Bay (Leg 188), and
Cape Roberts Project drilling (1997-1999) to determine Antarctic Ice Sheet history, glacial processes and facies
482-Full3
We propose to core sediments deposited on the Wilkes Land margin with the following
objectives:
1. to obtain the onset of glaciation (Eocene or older) by drilling strata across the glacial
onset reflector (regional unconformity WL2) in two depositional environments, shelf
progradational wedge foreset (Sites WLSHE-07A or alternate WLSHE-09A) and lower
continental rise/abyssal plain hemipelagic strata (Sites WLRIS-02A);
2. to obtain a high-resolution Neogene-Quaternary record of glacial/interglacial cycles from
continental rise mounded deposits (Sites WLRIS-01A);
3. to date major changes in shelf prograded wedge geometry (below and above the regional
WL1 unconformity) that document large fluctuations in the glacial regime, possibly
through much of the Miocene (Site WLSHE-08A);
4. to help assess the main controls on sediment transport and deposition on ice-dominated
continental shelves and rises in order to test present architectural models of glacial
processes and facies for high-latitude margins; and
5. to constrain the timing and the nature of changes in glacial regime and paleoceanography
that result in the development of large mounded deposits (i.e. up to 700 m relief), and large
upper-fan channel-levee complexes (i.e. 900 m relief) on the continental rise.
Proposed Sites:
Brief Site-specific
Site Name Position Depth Bs
Sed Total Objectives
(m) m
WLSHE-07A 66°03 S/143°08 E 600 510 0 510 Onset of glaciation
WLSHE-09A 66°20 S/142°40 E 525 200 0 200 Onset of glaciation
WLRIS-02A 64°00 S/139°49 E 3712 1000 0 1000 Onset of glaciation
WLRIS-01A 64°54 S/145°59 E 3345 700 0 700 Late Neogene and

WLRIS-03A* 64°51 S/144°46 E 3225 700 0 700 Quaternary high-
resolution record
WLSHE-08A 66°00 S/143°18 E 525 250 0 250 Miocene fluctuations

in glacial regime
received 6-February-2006
482-Add5
Title: Cenozoic East Antarctic Ice Sheet History from Wilkes Land Sediments
Proponent(s): Escutia, C., Cooper, A.K., Eittreim, S.L., Tanahashi, M., Ishihara, T., De Santis, L., O’Brien, P., and
Domack, E.
Keywords: Cenozoic, Ice sheet evolution, East Antarctica

Area:
(5 or less)
Contact Person: Carlota Escutia
Department: Instituto Andaluz de Ciencias de la Tierra
Organization: Consejo Superior de Investigaciones Científicas (CSIC)
Address Fuentenueva s/n
Tel.: (34) 958 24 0504 Fax: (34) 958 24 3384
E-mail: cescutia@ugr.es
Permission to post abstract on IODP-MI Sapporo Web site: Yes No
During the December 2005 meeting of the Environmental and Safety Panel (EPSP) in Honolulu Hawaii,
Carlota Escutia, lead proponent of IODP proposal #482-Full3, was asked to present the Safety Package
for the Wilkes Land Proposal (#482-Full3) and a site-by-site review was conducted for the proposed sites
WLSHE-09A, WLSHE-07A, WLSHE-08A, WLRIS-03A, WLRIS-04A, and WLRIS-02A. These sites
received approval by the EPSP panel. Additionally, C. Escutia seeked approval for three additional sites
located offset from the crossing lines where proposed sites WLSHE-09A, WLSHE-07A and
WLSHE-08A are located and where targeted objectives can be reached at shallower depths. The EPSP
also approved the three new sites
In this addendum, we provide all the updated information (including site forms) regarding the approved
sites for Wilkes Drilling after the EPSP meeting. Because the EPSP granted approval for three sites on the
continental shelf, not previously proposed, we also provided in this addendum new drilling priorities and
a new drilling strategy.
482-Add5
The overarching scientific objective for drilling the Wilkes Land margin continues to be to obtain the record of
Antarctic glaciation and its relationships with global sea-level, paleoclimate and paleoceanographic changes. This
record includes critical periods in Earth climate evolution when the cryosphere formed and evolved to assume its
present day configuration. Specific scientific objectives of the proposed drilling are:
• To obtain the timing and nature of the first arrival of ice to the Wilkes Land margin (early Oligocene?)
• Characteriza the nature and age of large fluctuations in the glacial regime (Miocene?)
• To obtain the record of Antarctic climate variability during the late Neogene and Quaternary
Proposed Sites:
(m) Sed Bsm Total
WLSHE-09A 66º20’S, 142º40’E 469 330 0 330 Onset of glaciation from shelf
WLSHE-09B 66º24’S, 142º47’E 525 165 0 165 Onset of glaciation from shelf
WLSHE-07A 66º03’S, 143º08’E 563 770 0 770 Onset of glaciation from shelf
WLSHE-07B 66º10’S, 143º06’E 570 715 0 715 Onset of glaciation from shelf
WLSHE-08A 66º00’S, 143º18’E 525 220 0 220 Fluctuations in glacial regime

(?Miocene)
WLSHE-08B 66º05’S, 143º22’E 525 138 0 138 Fluctuations in glacial regime
(?Miocene)
WLRIS-03A 64º40’S, 144º00’E 3140 947 0 947 Cimate variability during late
Neogene-Quaternary
WL-RIS-04A 64º50’S, 144º03’E 3075 994 0 994 Cimate variability during late
Neogene-Quaternary
WLRIS-02A 64º00’S, 139º49’E 3705 1000 0 1000 Onset of glaciation from rise
Proposal ID 482 - Full3
Proposal Name Wilkes Land
Summary
ISP Objective Environmental Change
To provide a long-term record of Antarctic glaciation and its relationship with global sea level, paleoclimate and
paleoceanographic changes. The primary goals are: 1) to obtain the nature and the timing of the Cenozoic onset of
grounded ice from the continental shelf and rise deposits, and 2) to obtain a high-resolution late Neogene-Quaternary
glacial/interglacial record of glaciation from the rise deposit.
Water Depth 525 - 3712 m
Vessel Riserless
Operation Time Estimate 58 days (including transit and port call)
Alternating diamicton and thin diatomaceous mud in shelf sites, deeper sites consist of hemipelagic biogenic and distal
Lithology
turbidites and contourites
Operational Risks hole stability, core recovery
Environmental Constraints Limited weather window (February), Ice, ice-bergs, shallow water
Drilling/Coring RCB at shallow sites. Triple APC to refusal, XCB and RCB at deep-water sites
Logging Standard + WST tool in at least one shelf site and one rise site
Limitations / Assumptions Availability of LWD tools
Special Considerations Antarctic treaty, Emergency evacuation strategy, marine mammals (WST)
Technical Issues
CORK description (if app) N/A
Costs scale Standard costs if NO LWD
Milestones
Forwarded to SPC Nov 01
Forwarded to OTF: rank Jun 04
EPSP Site Approval
OTF Scheduled Oct 05
SPC Approval of schedule Mar06
SAS / OTF History
Jun-01 FULL3
iPC Mar-02 Ready for ranking
SPC Sep-03 Ranked 8th out of 16 (top 5 were forwarded on)
SPC Jun-04 Forwarded to OTF in Group 1. Ranked 5th out of 15.
EPSP Jun-04 Challenges identified include: penetration of up to 1000m
SPC Consensus 0410-36: The SPC recommends for the remainder of FY2006 following Proposal 482-Full3 Wilkes Land
Margin with appropriate non-riser drilling components of Proposals 603A-Full2 NanTroSEIZE Reference Sites and 603B-
SPC Oct-04 Full2 NanTroSEIZE Mega-Splay Faults, then Proposal 477-Full4 Okhotsk and Bering Seas Paleoceanography, Part 1. The
committee also recommends the remainder of Proposal 545-Full3 Juan de Fuca Flank Hydrogeology or Proposal 553-
Full2 Cascadia Margin Hydrates as a backup for Proposal 477-Full4 Okhotsk and Bering Seas Paleoceanography, Part 1.
SSP Feb-05 All sites classified as 1A or 1B
SPC Consensus 0503-15: The SPC recommends that all fully or partially unscheduled proposals forwarded previously to
SPC Mar-05 the Operations Task Force as part of the highest priority Group I should remain for now with the Operations Task Force for
them to consider in developing drilling schedule scenarios for FY2006 and beyond. This group includes: 482-Full3
SPC members nominated several or more prospective candidates as potential co-chief scientists
Weather window Feb - Mar
Included in Models 1A and 1B, 3, 5A and 5B
Wilkes is not ideal to be the leadoff expedition because of the remote location and the significant transit penalty associated
OTF Jun-05
with the operations
It is critical that the vessel operations occur in the Wilkes region during February. All models containing this program will
be adjusted to target this weather window.
Implementation of a simple expedition at the start of USIO phase 2 operations is by far the best way forward. This would
suggest effort should be focused on the Equatorial Pacific, NanTroSEIZE, Canterbury or Wilkes as the preferred options.
No change on issues that need to be addressed from the June 2005 OTF meeting
OTF Oct-05 scheduling Wilkes as the first expedition provides no flexibility for changes in the SODV schedule given the narrow
weather window available for operations in the Wilkes region.
There are several possible options following the proposed Wilkes expedition. The preferred option would be to return to
Superfast as this would provide the best option for maximum science delivery and minimal (if any) waiting on weather.
SPC Motion 0510-23: In addition, the committee intends to schedule further non-riser drilling operations in the Southern
SPC Oct-05 Ocean (i.e., Proposals 600-Full Canterbury Basin and 482-Full3 Wilkes Land Margin) and the Indian Ocean in the following
fiscal year (Fy2008-09).
In order to obtain final approval proponents have been asked to provide latitudes and longitudes, depth conversions, and
EPSP Dec-05 completed safety sheets for sites WLSHE-09B, WLSHE-07B, and WLSHE-08B to the EPSP Chair, USIOTAMU, and IODP-
MI.
SPC Consensus 0603-29: The SPC approves the revised FY2007-09 operations schedule of the U.S. scientific ocean
drilling vessel (SODV) as proposed in Model 1B of the Operations Task Force (OTF) ending with Wilkes Land Margin
(Proposals 482-Full3, 638-APL2) The SPC recognizes this scenario as a preferred model subject to significant change,
especially pending further knowledge about the actual SODV drydock location and starting date for IODP operations. The
SPC Mar-06 committee thus encourages the OTF to explore further possibilities of revising the FY2007-09 operations schedule before
the August 2006 SPC meeting.
The committee strongly supported this APL associated with Proposal 482-Full3 Wilkes Land Margin and recognized its
potential to give the highest resolution paleoclimate record in the Southern Hemisphere.
Model B1 puts Wilkes into a bad weather window; but if preferred, a number of options are possible to move Wilkes into a
OTF Jun-06 proper weather window:
SPC Consensus 0703-15: The SPC accepts the adjustments recommended by the Operations Task Force (OTF) to the
FY2008-2009 U.S. Scientific Ocean Drilling Vessel (SODV) science operations schedule in response to National Science
Foundation (NSF) budgetary guidance for FY2008 and other logistical factors. After a 1 January 2008 start date to
international operations and a short transit, the approved schedule would include the following sequence:
Expedition 301
operations
After successful Canterbury shallow hazards survey review, Canterbury/Wilkes southern ocean option was confirmed by
OTF Jul-07 OTF for early FY09.
Received 1-October-2003
505-Full5
Title: Mariana Convergent Margin: Geochemical, Tectonic, and Biological Processes at

Intermediate Depths of an Active Subduction Factory
Proponent(s): Patricia Fryer, Michael Mottl, both at: SOEST, University of Hawaii, 1680 East-West Rd., Honolulu HI,
96822, Geoff Wheat, MBARI, P.O. Box 475, Moss Landing, CA 95039, Craig Moyer, Western Washington
University, Greg Moore, Andrew Goodliffe, both at: SOEST, University of Hawaii, 1680 East-West Rd.,
Honolulu HI, 96822 Julie Morris, George Washington University, St. Louis, MO, Andrew Fisher,
University of California, Santa Cruz, CA, Hirokazu Maekawa, Department of Earth and Life Sciences,
College of Integrated Arts and Sciences, Osaka Prefecture University, Teruaki Ishii Ocean Research Institute
University of Tokyo, Fumio Inagaki, Ken Takai, Japan Marine Science & Technology Center (JAMSTEC),
2-15 Natsushima-cho, Yokosuka 237-0061, JAPAN, Kenneth H. Nealson, Department of Earth Sciences,
University of Southern California, Los Angels, CA, Kevin Brown, Scripps Institution of Oceanography,
University of California, San Diego CA, Jonathan Martin, University of Florida, Tampa FL, Steven Phipps,
University of Pennsylvania, Philadelphia PA
Keywords: Serpentine, mud volcano, subduction, peridotite, blueschist Mariana Forearc
Area:
(5 or less)
Contact Person: Patricia Fryer
Department: SOEST/Planetary Geosciences, POST 504
Organization: Univ. Hawaii
Address 1680 East-West Rd. Honolulu HI 96822
Tel.: 808-956-3146 Fax: 808-956-6322
E-mail: pfryer@hawaii.edu
Permission to post abstract on iSAS Web site: Yes

We propose to drill at four serpentinite mud volcanoes on the forearc of the Mariana system, a nonaccretionary
convergent plate margin in the western Pacific. Both summit and the flank sites are targeted. The summit siteswill
penetrate serpentinite mud ascending within the conduit region of the mud volcano and will sample deep-slab
fluids rising within the ascending mud. The flank sites will provide stratigraphy essential for understanding the
history of the eruptive process. Two active serpentinite mud volcanoes have been sampled previously by drilling:
Conical Seamount on Leg 125 and S. Chamorro Seamount on Leg 195. Both of these legs succeeded in sampling
deep slab-derived fluids and associated serpentinite muds and blueschist-facies metabasites. These two seamounts
are about the same distance behind the Mariana trench (85-90 km) and above the subducting slab (26.5-29 km), so
we have yet to fully document the expected variation with depth-to-slab across the forearc. Pore waters from both
seamounts indicate that the down-going slab beneath them has experienced both dehydration and carbonate
dissolution. Gravity cores from seamounts closer to the trench (shallower depth to slab) sampled slab fluids that
show only dehydration. These different seamounts also show markedly different mineralogy, associated chimney
deposits and differences in microfauna and macrofauna communities at summit seeps. The summit drilling we
propose will permit a 3-D view of forearc processes of fluid/rock interaction in the supra-subduction zone and the
formation of serpentinite mud volcanoes. By drilling the flanks we will trace the temporal variability of the
serpentinite mudflow sources and date the flow lobes. The scientific outcomes will advance our understanding of
nonaccretionary forearcs, the nature of geochemical cycling within them, their structure, tectonic evolution, and
the various active processes (thermal, hydrologic, metamorphic, biological) involved in the formation of the mud
volcanoes, and pave the way for monitoring in real-time intermediate-depth processes within the “subduction
factory.” We now know that serpentinite mud volcanism at convergent margins is not merely a local curiosity of
the Mariana system, as deposits formed by such processes occur worldwide. The formation of serpentinite
méanges in numerous subaerial exposures may have occurred by processes active on the Mariana forearc today.
505-Full5
(1) to understand mass transport and geochemical cycling in subduction zones of nonaccretionary
forearcs at convergent margins; (2) to ascertain spatial and temporal variability of slab-related
fluids in the forearc environment to trace dehydration, carbonate dissolution, and water/rock
reactions in the subduction zone; (3) to understand physical properties of the subduction zone as
controls over dehydration reactions and seismicity; (4) to study spatial and temporal variability in
metamorphic and tectonic processes and the history of these processes in nonaccretionary forearc
regions; and (5) to investigate controls over biological activity associated with these mud volcano
processes.
Casing to 100 m for 8 holes and CORK for 3 holes
Proposed Sites:
(m) Sed Bsm Total
MAF-2B 19° 10.6’ N, 147° 03.6’ E 3560 150 0 150 To examine serpentinite muds and pore
fluids at an active protrusion/spring site
(Cerulean Springs)
To examine serpentinite muds and pore

MAF-3B 19° 11.5’ N, 147° 03.5’ E 3850 300 0 300 fluids above an active fault

MAF-11A 18° 06.4’ N, 147° 05.9’ E 1260 150 0 150 fluids at an active protrusion/spring site
MAF-12B 18° 05.67’ N, 147° 06’ E 1400 250 0 250 To examine serpentinite muds and pore
fluids on upper flank

MAF-13A 18° 03.09’ N, 147° 06’ E 2200 250 0 250 fluids on mid-flank for stratigraphy age
and compositional variability
MAF-14A 17° 59.53’ N, 147° 06’ E 3300 250 0 250 To examine serpentinite muds and pore
fluids on lower flank for stratigraphy
age and compositional variability

MAF-9B 16° 32.25’ N, 147° 13.25’ E 2000 150 0 150

MAF-10B 16° 27.6’ N, 147° 10.35’ E 3200 250 0 250 fluids on lower flank for stratigraphy
age and compositional variability
MAF-15A 15° 42.57’ N, 147° 10.6’ E 3666 100 0 100 To examine serpentinite muds and pore

MAF-16A 15° 42.12’ N, 147° 8.49’ E 4500 250 0 250 fluids on mid-flank for stratigraphy age
and compositional variability
Proposal Name Mariana Convergent Margin
Summary
ISP Objective Deep Biosphere
(1) to understand mass transport and geochemical cycling in subduction zones of nonaccretionary forearcs at convergent
margins; (2) to ascertain spatial and temporal variability of slab-related fluids in the forearc environment to trace
dehydration, carbonate dissolution, and water/rock reactions in the subduction zone; (3) to understand physical properties
Scientifc Purpose of the subduction zone as controls over dehydration reactions and seismicity; (4) to study spatial and temporal variability in
metamorphic and tectonic processes and the history of these processes in nonaccretionary forearc regions; and (5) to
investigate controls over biological activity associated with these mud volcano
processes.
Max Drill Depth 300 m (within sediment)
Vessel Riserless
Operation Time Estimate 52 days
Serpentinite mud flows of clay to sand-sized serpentine containing pebbles to boulders of serpentinized ultramafic rock
Lithology
and metabasalt underlain by forearc vitric silt and siltstone
Operational Risks None Identified
Environmental Constraints Apr - July (oustide this timeframe are typhoon and high wind seasons)
Drill and Core 10 holes using APC/XCB to refusal, followed by RCB if necessary; RCB is preferred because of drilling
Drilling/Coring
disturbance and low recovery. 100 m of casing used in 8 of the holes.
None. Experience on Legs 125 or 195 proved no holes in these serpentinite muds will stay open long enough to permit
Logging
even standard logging runs
Limitations / Assumptions
Special Considerations
Plan to instrument the cased, CORKed borehole and eventually link the site to a seafloor cable that will monitor activity in
Technical Issues
real time
CORK description (if app) Casing to 100 m for 8 holes and CORK for 3 holes
Costs scale 3 Observatories with 100m of casing in 8 holes
Milestones
Forwarded to SPC Nov04
Forwarded to OTF: rank Mar06: 9th out of 17
SSP Classification Feb04 - 2A and 2C
EPSP Site Approval
Proposal Name Mariana Convergent Margin
OTF Scheduled
SAS / OTF History
FULL4
iSSEPs Nov-01 Submit revised proposal
iSSEPs Nov-02 Submit revised Full proposal
The letter to the proponents should include in the Introduction a Boiler Plate statement regarding “raising the bar”
iSSP Feb-03 regarding digital data format submission and what kinds of data are expected etc. Including the definition of the site
readiness classifications of 1A, 1B, 2A, 2B, 2C, 3A, and 3B.
Apr-03 ADD3
iSSEPs May-03 Submit revised Full proposal
iSSP Jul-03 Sites classified at 2A
Oct-03 FULL5
SSP Feb-04 Sites MAF-9B and NAF-11A classified as 2A, others as 2C
SSEP May-04 Sent out for external review
SSP Aug-04 MAF-9B and NAF-11A classified as 2A, others 2C
SSEP Nov-04 Unlikely for FY2005, possible for later ; Forwarded to SPC
MAF-9B and MAF-11A (summits of Celestial and Big Blue): 2A (MCS is missing) MAF-2B, MAF-3B (Pacman), MAF-15A
SSP Feb-05 (Blue Moon): 2C (no seismic lines) MAF-10B (flank of Celestial), MAF-12B, MAF-13A, MAF-14A (flanks of Big Blue) and
MAF-16A (Blue Moon): 2C (no crossing lines)
SPC Mar-05 Ranked #7. Top 3 were forwarded on.
SPC Mar-06 Ranked 9th out of 17 to forward to the OTF in Group II. (SPC Motion 0603-21)
Following the SODV excursion into the Southern Ocean in early FY09, SODV operations could either move to the Indian
Ocean (per the Kyoto SPC Motion 0510-23) to conduct some combination of operations at Murray Ridge, Indus Fan
OTF Jun-06 and/or Bengal Fan or the SODV could move directly back into the Pacific Ocean to address highly ranked proposals such
as Mariana, CRISP, Asian Monsoon, and Cascadia.
SPC Consensus 0703-13: The SPC forwards the top twelve of the fifteen ranked proposals in two groups to the
SPC Mar-07 Operations Task Force (OTF), for developing schedule options for FY2009 and
beyond. 505-Full5 ranked #1
Received 27-March-2002
519-Add2
Title: “ The last deglacial sea-level rise in the south Pacific : offshore drilling in Tahiti
(French Polynesia) and on the Australian Great Barrier Reef ”
Proponent(s): Gilbert F. Camoin, Peter J. Davies, Edouard Bard and Bruno Hamelin
Keywords: Sea level change, paleoclimates, Quaternary, coral reefs, South South Pacific
Area:
(5 or less) Pacific
Contact Person: Dr Gilbert F. Camoin
Department: CEREGE
Organization: Centre National de la Recherche Scientifique
UMR 6635, Europôle Méditerranéen de l’Arbois, B.P. 80, F-13545 Aix-en-Provence cedex
Address
4 (France)
Tel.: + 33-4-42-97-15-14 Fax: + 33-4-42-97-15-95
E-mail: gcamoin@cerege.fr
Permission to post abstract on iSAS Web site: No

Yes
The history of sea-level and sea surface temperature variation associated with the last deglaciation
is of prime interest to understand the dynamics of large ice sheets and their effects on Earth's isostasy. So
far, the only sea-level record that encompasses the whole deglaciation is based on offshore drilling of
Barbados coral reefs which overlie an active subduction zone, implying that the apparent sea-level record
may be biased by tectonic movements.
This proposal seeks to establish the course of the last deglacial sea level rise and to identify short-
term paleoclimatic/paleoceanographic changes that are thought to have punctuated the transitional
period between present-day climatic conditions following the Last Glacial Maximum.
Two reef settings developed in tectonically inactive areas at sites located far away from glaciated
regions are considered : Tahiti (French Polynesia) and the Australian Great Barrier Reef.
At each site, it is proposed to realize a transect of several offshore shallow penetration drill holes
at 20 to 300 m water depth using a Mission Specific Platform. The drilling targets include both the
successive reef terraces and relict reefs, from 20 to 90 m water depth, and the slope that extends
seawards of the prominent cliff occurring between 90-100m and 150m water depth in both regions.
These transects will be complemented by deeper water sites with 100m holes in the sediments
forming the terraces immediately in front of the reef wall. This drilling strategy will allow :
- the reconstruction of the complete stratigraphy of the Late Pleistocene to Holocene post-
glacial carbonate depositional sequence ;
- the recovery of massive coral colonies in specific time windows to be used to characterize
thermal fluctuations at a subseasonal resolution ;
- the identification of the nature of the substrate.
In this addendum we explain how the scientific objectives of this proposal mesh with those of the
IODP Long-Range Plan, we provide new data acquired on existing drill cores carried out throughout the
modern reefs, we update the status of existing seismic and bathymetric data on both sites, and we
describe the objectives of upcoming cruises scheduled in September and October 2002 in both regions.
519-Add2
The study will have three major objectives :
1. To reconstruct the deglaciation curve for the period 20,000 to 10,000 yrs BP in order to establish the
minimum sea-level during the Last Glacial Maximum (LGM), to test predictions based on different ice and
rheological models, and to assess the validity, the timing and amplitude of meltwater pulses (so-called MWP-1A and
MWP-1B events; c. 13,800 and 11,300 cal. yr BP) which are thought to have disturbed the general thermohaline
oceanic circulation and, hence, global climate.
2. To identify and to establish patterns of short-term paleoclimatic changes that are thought to have punctuated
the transitional period between present-day climatic conditions following the LGM. It is proposed to quantify the
variations of sea surface temperatures based on high-resolution isotopic and trace element analyses on massive coral
colonies. When possible, we will try to identify specific climatic phenomena such as El Nino-Southern Oscillation
(ENSO) in the time frame prior to 10,000 yrs BP and try to get a better knowledge of the global variation and
relative timing of post glacial climate change in the southern and northern hemisphere.
3. To analyse the impact of sea-level changes on reef growth, geometry and biological makeup, especially during
reef drowning events ; this approach will help improving the modeling of reef development and the morphological
and sedimentological evolution of the foreslopes (highstand vs lowstand processes).
Proposed Sites: (Only High Priority Sites are listed here.)

(m) Sed Bsm Total
6 holes (transect) -Recovery of
TAH-01A 17.31S – 149.35E 20/300 50/100 10 440 Holocene and Pleistocene
depositional reef sequences.
Volcanic basement.
6 holes (transect) -Recovery of

TAH-02A 17.35S – 149.20E 20/300 50/100 10 440 Holocene and Pleistocene
Volcanic basement.
TAH-03A 17.45S – 149.35E 20/300 50/100 10 440 6 holes (transect) -Recovery of

Holocene and Pleistocene
Volcanic basement.
RIB-01A 15.30S– 145.40E 25/250 30/100 10 330 5 holes (transect) - Recovery

of Holocene and Pleistocene
Limestone basement.
HYD-01A 18.40S - 147.40E 40/250 50/100 10 400 6 holes (transect) - Recovery

of Holocene and Pleistocene
Limestone basement
Alternate site 6 holes (transect) - Recovery

16.50S – 145.50E 25/250 30/100 10 330 of Holocene and Pleistocene
BOW-01 depositional reef sequences.
Limestone basement
Proposal Name Great Barrier Reef
Summary
1. To reconstruct the deglaciation curve for the period 20,000-10,000 years BP in order to establish the minimum sealevel
during the Last Glacial Maximum (LGM), and to assess the validity, timing and amplitude of meltwater pulses.
2. To establish the SST variations accompanying the transgression at each transect.
3. To identify and establish patterns of short-term paleoclimatic changes that are thought to have punctuated the
Scientifc Purpose transitional period between present-day climatic conditions following the LGM.
Vessel MSP
Operation Time Estimate 11 - 15 days (logging and drilling estimate)
Lithology limestones and unconsolidated sand
Operational Risks None
Environmental Constraints Weather window between May and September
Drilling/Coring Drill 10 holes along 2 transects using PROD
Logging Standard logging + borehole televiewer and temperature and pressure measurements
Technical Issues
3rd Party Requirements USE of Portable Remote Operated Drill (PROD),
Specialty Tools Borehole televiewer, borehole temperature and pressure measurements, VSP only if small diameter tool available
Costs scale
Milestones
Forwarded to SPC Jun 02
Forwarded to OTF: rank Sep 03
SSP Classification Jul 06
EPSP Site Approval Jun 04
OTF Scheduled Jun 06
SPC Approval of schedule Aug 06
SAS / OTF History
Apr-02 ADD2
Jun-02
iSSEPs Forward to iPC
iSSP Jul-02 Sites classified as 2C
iPC Aug-02 Ranked #2 and forwarded to OTF
Oct-02 FULL2
The panel requested that the following be included as part of the final iPPSP review package:
· A map showing the distribution of live reefs and man-made objects relative to the proposed drillsites.
· High resolution back-scatter imagery/maps.
· An assessment as to how drilling might impact hydrologic conditions and ultimately impact existing reefs. Comments on
iPPSP Dec-02 proposed abandonment/completion procedures should be included.
· The type of drilling platform needs to be identified. If a jack-up is decided on foundation issues exist, which will need to be
included in the safety package.
This could require a site specific geotechnical survey. The panel also noted that hydrocarbon monitoring will not be
required and that drilling restrictions imposed by Australia (which are more stringent) should be applied in Tahiti was well.
iSSP Feb-03 Sites classified as 2B
SPC Motion 03-09-36: The SPC recommends that the ECORD develop an operational plan
as soon as feasible for Proposals 519-Full2 South Pacific Sea Level and 564-Full New Jersey
SPC Sep-03 Shelf, in light of their respective global rankings of #1 and #4 at this meeting.
SPC Motion 03-09-37: Ranked 1st out of 16 and forwarded to OTF.
SPC Consensus 04-03-13: The SPC recommends that the OPCOM split Proposal 519-Full2 South Pacific Sea Level into
two MSP expeditions. The Tahiti component should be considered for scheduling in FY2005.
SPC Mar-04 committee nominated 10 candidates for co-chief consideration
SPC Consensus 0406-9: The SPC applauds the initiative represented by Proposal 650-APL and in particular the potential
for a productive interaction among the proponents, the scientific party of the Tahiti component of Proposal 519-Full2 (the
expected FY2005 MSP project), and industry. However, the committee cannot yet fully assess the operational,
SPC Jun-04 environmental, and fiscal impacts of operations associated with the proposed imaging experiments, and in particular the
need to install and remove PVC liners from a subset of the holes proposed for the TAH-02A transect. The SPC therefore
requests that OPCOM consider Proposal 650-APL at its September 2004 meeting, with input from the proponents and the
ECORD Science Operator as appropriate, and provide a report and a recommendation at the October 2004 SPC meeting.
The panel approved the proposed sites as detailed. The panel requests that an ROV be used to survey the proposed
drilling locations before and after the drilling operations. In addition, if an anchored vessel is used for drilling the anchor
EPSP Jun-04 points should be visually examined before and during anchor placement.
Challenges identified include: reef drilling in a marine park
SSP Aug-04 Tahiti sites classified as 1A. Great Barrier Reef sites as 2B.
SPC Consensus 0410-32: The SPC reaffirms SPC Consensus 0403-13, including scheduling of the Tahiti component of
SPC Oct-04 Proposal 519-Full2 South Pacific Sea Level in FY2005, as approved by SPPOC Motion 0407-4.
SPC Consensus 0410-33: The SPC reaffirms SPC Consensus 0406-9.
SPC Mar-06 Becker mentioned the recent and planned site-survey activity to support the remaining Great Barrier Reef component of
this proposal. He suggested leaving it with the OTF for scheduling after the proponents complete the site surveys.
the only viable FY08 MSP program at OTF for consideration is the Great Barrier Reef component of the South Pacific Sea
Level Program. This program has not previously been scheduled due to a lack of site surveys. The OTF was informed that
OTF Jun-06 some site surveys had been conducted this year and more were to be conducted in mid 2007. Whether this timing would
be sufficient for EPSP review at its next meeting (January, 2008) is unknown. If EPSP could review (and approve) the sites
at its next meeting, the proposed operations would most likely span the F08/089 boundary. However the funding would be
considered FY08 funding so there would be funds for an FY09 MSP operation.
Primary Sites RIB-01A 1Bc,d / HYD-01A 2Bd
SSP Jul-06 Alternate Site BOW-01 3A
SPC Consensus 0608-05: The SPC approves the mission-specific platform operations for the Great Barrier Reef
component of Proposal 519-Full2 South Pacific Sea Level in FY2008-09, provided that (a) the proponents complete the
SPC Aug-06 proposed site surveys and submit the sitesurvey data in a timely and satisfactory manner and that (b) a successful EPSP
review is completed in a timely manner as defined by the Operations Task Force (OTF).
OTF Jul-07 Schedule pushed back to FY09 due to delay in New Jersey.
Received 24 July 2006
SAS/IODP Proposal Cover Sheet

522-Add2
Title: Neogene and late Paleogene record of Himalayan orogeny and climate: a transect
across the Middle Bengal Fan.
Proponent(s): Christian France-Lanord1, Volkhard Spiess2, Tilmann Schwenk2, Peter Molnar3
and Joseph R Curray4
1: CRPG-CNRS, 15 rue Notre Dame des Pauvre, 54501 Vandoeuvre, France, cfl@crpg.cnrs-nancy.fr
2: Dept. of Earth Science, Bremen University Klagenfurter Str., 28359 Bremen, Germany vspiess@uni-bremen.de
3, Dept. Geological Sci. CIRES-UC Boulder Campus Box 399 Boulder, CO80309 USA molnar@terra.colorado.edu
4, Scripps Institution of Oceanography, La Jolla, CA 92093-0220 - USA jcurray@ucsd.edu
Keywords: Turbidites , Monsoon, Channel levee, Source to Sink Area: Bay of Bengal
(5 or less)
Contact Person: Christian France-Lanord
Department: CRPG
Organization: CNRS
Address 15 rue Notre Dame des Pauvres BP 20, 54501 Vandœuvre les Nancy - FRANCE
Tel.: 33 (0) 83 59 42 20 Fax.: 33 (0) 83 51 17 98
E-mail: cfl@crpg.cnrs-nancy.fr
Permission to post abstract on SAS Web site: Yes No
We propose drilling a transect of holes in the Bay of Bengal to address interactions among the growth of the
Himalaya and Tibet, the development of the Asian monsoon, and processes affecting the carbon cycle and global
climate. Because sedimentation in the Bengal Fan responds to both climate and tectonic processes, its terrigenous
sediment records the past evolution of both the Himalaya and regional climate. The histories of the Himalaya/
Tibetan system and the Asian monsoon require sampling different periods of time with different levels of precision.
Accordingly, we propose a transect of six holes in the fan at 8°N with two complementary objectives :
(1) The early stages of Himalayan erosion, which will bear on the India-Eurasia collision and the development of
the Himalaya and Tibet as topographic features. We propose a deep hole (MBF-3A ~1500m) in the west flank of
the Ninetyeast Ridge where a reflector interpreted as a Paleocene-Eocene unconformity could be reached at a
reasonable depth.
(2) The Neogene development of the Asian monsoon and its impact on sediment supply and flux. We propose an
east-west transect at 8°N composed of MBF-3A plus two drill sites, each of ~900 m penetration (MBF-1A and 2A),
to reach sediment at least as old as 10-12 million years. Records from the Arabian Sea and the Indian subcontinent
suggest that at ~7-8 Ma the intensity of the monsoon increased and C4 plants expanded. Moreover, they appear to
be linked to changes in the erosional regime as recorded by Leg 116, and possibly to the tectonic evolution of
southeast Asia. This transect will allow the study of the extent to which a strengthening of the monsoon encom-
passed the Bay of Bengal, where increased rainfall, not strengthened wind characterize the monsoon, and will allow
quantitative studies of the interrelations of climate change and sediment accumulation.
In addition three Sites (MBF-4A to -6A) will allow to determine, how the depocenter migrates across this transect
during the last million year and to ensure complete recovery of channel-derived terrigenous material through this
time interval.
This addendum presents new site survey carried out during R/V Sonne Cruise SO188-1 in June-July 2006 including
crossing lines to each of the proposed drill sites MBF-2A to 6A. The full dataset includes multichannel seismics,
swath bathymetry and sub-bottom profiling.
522-Add2
This proposal addresses the general objective to understand how the Himalayan-Tibet orogenesis interacts with
the earth climate. This includes forcing of the climate due to paleogeographic evolution and atmospheric CO2
uptake as well as retroaction of the monsoon climate on the tectonic via erosion. Because the Bengal Fan has
accumulated most of the Himalayan erosion flux since the continental collision, it represents the most complete
record of both the uplift and erosion history of the Himalaya and of the monsoon climate. Sediments will
document (1) uplift history through erosional flux and deposition patterns and detailed geochronology of
minerals, (2) Himalayan evolution from isotopic tracing of particle origin and age, and (3) environmental and
climate conditions through sediment grain size distribution, mineralogy and geochemistry, organic matter
composition and 18O of microfossils. A reliable quantification of erosional fluxes over the Neogene is essential
to assess the role of the Himalayan erosion on the global carbon cycle. The Leg 116 in the distal fan has shown
major variations of these proxies over the Neogene and the proposed Leg should allow to test their regional
representativeness. The proposed transect at 8°N will allow to construct a complete record of the Neogene
Himalayan erosion and monsoon and to complete the present record of Himalayan erosion beyond the Miocene.
Proposed Sites:
(m) Sed Bsm Total
MBF-1A 8°N 0.42 / 86°E17.00 3745 900 0 900 Neogene history

Depocenter migration
MBF-2A 8°N 0.42 / 87°E 40.25 3671 900 0 900 Neogene history
MBF-3A 8°N 0.42 / 88°E 44.5 3618 1500 0 1500 Neogene history
Early fan history
MBF-4A 8°N 0.42 / 86°E 47.9 3694 300 0 300 Depocenter migration
Proposal Name Superfast Spreading Crust
Summary
ISP Objective Solid Earth Cycles
1) Deepen Hole 1256D as far as technically possible (>500 m) into gabbro to complete sampling of a complete section
of upper oceanic crust
2) Test models of mid-ocean ridge crustal accretion in particular the formation of the lower crust by the recrystallization
and subsidence of a high level magma chamber (gabbro glacier) versus
Scientifc Purpose(s) crustal accretion by intrusion of sills through out the lower crust.
3) Establish magmatic, hydrothermal, tectonic processes and interactions. Is the plutonic crust cooled by conduction or
hydrothermal circulation?
4) Determine the geological nature of layer 3 and the layer 2/3 boundary at Site 1256
5) Determine the magnetic contribution of the lower crust.
Max Drill Depth >2000 m
Vessel Riserless
Operation Time Estimate
Lithology Gabbros, dikes, cumulate gabbros, layered gabbros, basaltic lavas
Operational Risks High Temperatures
Environmental Constraints
Drilling/Coring
GUATB-3C - deepen by 500 mbsf with RCB. Other three sites are drilled and cored using RCB to bit destruction.
At GUATB-3C: Standard + borehole televiewer, geochemical, formation fluid sampling, borehole temperature and
Logging pressure,a dn borehole seismic, VSI, BGR gyromagnetometer. Run BHTV to check hole condition: VSP at the end of
drilling. Other 3 sites use standard logging tools.
Mud control and special tools, Basement depths will be greater than typical (to >2000 mbsf). Leave hole open for re-
Technical Issues
entry
Costs scale additional tools and mud control equipment may increase costs
Milestones
Forwarded to SPC Jan 03
SSP Classification Oct 05
OTF Scheduled
SAS / OTF History
Oct-03 FULL3
SSEP Jan-03 Forwarded to SPC
SSP Feb-04 Sites classified as 1B
SPC Jun-04 Globally ranked #1 to be forwarded to OTF.
EPSP Jun-04 no challenges/issues identified
SPC Motion 0410-34: After considering the scientific priorities previously determined by the SPC and the potential
SPC Oct-04 drilling schedules for FY2005 as presented by OPCOM, the SPC recommends Model 1 (…including Proposal 522-Full3
Superfast Spreading Crust) as the preferred option…
SPC Motion 0410-35: The SPC recommends following Model 1 in the beginning of FY2006 with a transit to the
Southern Ocean to complete Proposals 600-Full Canterbury Basin and 482-Full3 Wilkes Land Margin. If Model 3 is
SPC Oct-04 executed in FY2005, however, the committee recommends following it with Proposals 522-Full3 Superfast Spreading
Crust and 621-Full Monterey Bay Observatory.
An additional scenario is to place additional Superfast operations or Deep Biosphere (if SPC forwards it in March 06 to
OTF Jun-05 OTF) at the beginning of mid-year FY07 operations. This latter option is not presented in Figure 4 below but could be
considered after the March 06 SPC ranking meeting.
Revised SODV model for SPC consideration include coninuing efforts at superfast, pending SPC approval. Returning
to superfast maximizes science delivery and minimizes waiting on weather. It is unclear if current expedition would
OTF Oct-05 leave the hole clean and if the current expedition will recover gabbros. If expedition objectives are completed a new
proposal would be required to ensure a program driven (science) process. A decision on scheduling Superfast will
await a review of the results of the expedition 312 before making a recommendation.
SPC Motion 0510-23: The SPC approves the FY2007-08 operations schedule of the U.S. scientific ocean drilling
vessel (SODV) as proposed in model 2 of the Operations Task Force. The recommended expeditions will begin in
SSP Oct-05 August 2007 and proceed as follows: …Superfast Spreading Crust IV (Proposal 522-Full3) or another expedition
identified later…
SPC Consensus 0603-19: The SPC recognizes the value of Hole 1256D as a potential site for drilling through the
ocean crust. The committee requests that the USIO identify the operational requirements (i.e., casing plan) for further
drilling in Hole 1256D and make that information available before the Mission Moho workshop planned for September
SPC Mar-06 2006. The proponents of Proposal 522-Full3 Superfast Spreading Crust should present their plans for deepening Hole
1256D at the workshop and then submit an addendum if they believe that their original objectives remain unachieved;
otherwise, they should submit a new proposal
Apr-06 FULL4
SSEP May-06 Sent back for revision
Instead of waiting for the October 1, 2007 deadline as implied in above consensus, the proponents submitted a
proposal (522-Full4 for April 1, 2007 deadline) for just one more expedition to drill 500 m deeper to fully achieve 522
objectives. In response, SSEP asked for another revised proposal that better justifies the benefits of the requested
OTF Jun-06 ~500 m additional penetration in terms of resolving magma chamber processes. They also emphasized that the revised
proposal should take into account any discussion and recommendations deriving from the September Mission Moho
workshop.
Oct-06 FULL5
SPC Mar-07 SPC Concensus 0703-13: SPC Ranked 8th out of 15 and was forwarded to the OTF in group I.
SPC Mar-07 There was discussion concerning pressure from the SPC to forward this proposal to the SPC, in part based on this site
being the best choice for drilling to the Moho. Some members felt that the proposal was not ready to be forwarded.
SSP Feb-07 1Aa and 2Cc
537B-Full4
Title: CRISP Program B: The Transition from Stable to Unstable Slip at Erosional
Convergent Plate Boundaries
Proponent(s): C. R. Ranero, C. Marone, S. Bilek., U. Barckhausen, P. Charvis, J-Y Collot, H. DeShon, G. Di Toro, T.
Dixon, L. Dorman, S. Galeotti, I. Grevemeyer, R. Harris, S. Husen, M. Kastner, M. Kinoshita, S. Kuramoto,
T. Matsumoto, K. McIntosh, J. Morgan, J. Morris, C. Mueller, S. Neben, C. Reichert, D. Scholl, S. Saito, S.
Schwartz, V. Spiess, E. Suess, P. Vannucchi, H. Villinger, S. Vinciguerra, R. von Huene, W. Wallmann.
Keywords: Seismogenic zone, fluid flow, subduction erosion Central America
Area: off Costa Rica
(5 or less)
Contact Person: César R. Ranero
Department: Marine geodynamics
Organization: IFM-GEOMAR
Address Wischhofstrasse 1-3, 24148, Kiel, Germany
Tel.: 49-431-6002279 Fax: 49-431-6002922
E-mail: cranero@ifm-geomar.de
Permission to post abstract on IODP-MI Web site: X Yes No

CRISP is designed to investigate the processes leading to seismogenesis at erosional convergent margins in 2
Programs. Each Program will involve sampling, downhole observatories, and laboratory experiments on the
recovered materials. Program A focuses on the incoming oceanic plate, the decollement at the margin’s front where
slip is aseismic, and shallow structure of the overriding plate. Program B will investigate the plate boundary in the
transition from stable slip to unstable slip by drilling and monitoring at two sites. One site is located updip, but
near, the end of the seismogenic zone, and a second site is drilled into the seismogenic zone.
At least 50% of the world’s subduction zones are erosional margins. Erosional convergent margins have a
subduction channel containing material removed from the overriding plate mixed with sediment from the incoming
plate. The nature and physical properties of this material are currently unconstrained. Similarly, the volume,
distribution and chemistry of fluids at erosional plate boundaries are poorly known.
In Program B we propose a detailed investigation of subduction earthquake processes and to sample and monitor
the plate boundary where temperatures range ~100-200°C. Previous work indicates that key processes become active
in that temperature range and control the onset of seismicity. Drilling will for the first time sample eroded material
and fluids in the subduction channel and investigate plate boundary fault mechanisms during tectonic erosion.
CRISP Program B will provide the core material for detailed laboratory experiments designed to isolate the
processes and physical conditions that control the onset of seismogenesis.
Four Major Goals of Program B Drilling, Monitoring and Laboratory Experiments are:
1) Quantify effective stress and plate boundary migration via focused investigation of fluid pressure gradient and fluid
advection across the erosional plate boundary.
2) Determine the structure and fault mechanics of an erosional convergent margin and identify the processes that
control the updip limit of seismicity.
3) Constrain how fluid-rock interaction affect seismogenesis by studying fluid chemistry and residence time,
basement alteration, diagenesis, and low grade metamorphism.
4) Obtain physical properties of a 3-D volume that spans the seismogenic zone.
The subduction zone offshore Osa Peninsula provides the tectonic setting to reach CRISP goals. The shallow
subduction angle and high temperatures bring to shallow depth processes that elsewhere occur at greater depth,
beyond the reach of drilling.
537B-Full4
CRISP Program B will sample and monitor the plate boundary environment to study physical conditions and
material properties in the transition into the seismogenic zone. The scientific objectives of Program B are to test five
main hypotheses central to understanding structure and seismogenesis at erosional plate boundaries:
1) Landward of the frontal sediment prism, the transition from stable to unstable slip parallels the transition from a
fluid-rich and broad fault zone, with distributed slip, to a narrower zone of active deformation with localized shear and
fluid compartmentalization.
2) Fluid pressure gradients and fluid advection affect the migration and coupling of erosional plate boundaries both
temporally and spatially.
3) The lithology, physical properties, and structure of eroded materials influence fault mechanics and the transition from
stable to unstable slip at subduction interfaces.
4) Fluid chemistry, P-T conditions and residence time affect the state of eroded material through basement alteration,
diagenesis and low-grade metamorphism.
5) Lateral variability in subducted plate relief, subduction channel thickness, material properties and fluid distribution
affect seismogenesis and rupture propagation.
These hypotheses will be tested by A) direct observation of the lithology, physical properties and structure of the
plate boundary and surrounding rock, B) monitoring temperature, stress, pore-fluid pressure and chemistry, and
seismicity, C) laboratory experiments on core samples, and D) dedicated geophysical surveys designed to expand
regionally the results from drilling and monitoring.
Riser drilling
Drilling at >100°C and <200°C will require development of tools.
Proposed Sites:
(m) Sed Bsm Total
CRIS-03A 84° 4.77852 W 530 700 2850 3550 Drilling and monitoring the
8° 35.23956 N plate boundary and subduction
channel in the area of transition
between aseismic and seismic
slip and temperatures between
100°-150°C, updip, but near,
the end of the seismogenic zone.
channel in the seismogenic zone
at temperatures between 150°-
<200°C.
Received 18 January 2007

537A-Add
Title: Costa RIca Seismogenesis Project CRISP Program A
SAMPLING AND QUANTIFY INPUT TO THE SEISMOGENIC ZONE AND FLUID

OUTPUT. INSTALLATION OF LONG TERM MONITORING LABORATORIES.
Proponent(s): Paola Vannucchi, Cesar Rodriguez Ranero
Keywords: Seismogenic zone, Middle America Trench, fluid flow, long-term Costa Rica
Area:
(5 or less) monitoring, fault mechanics
Contact Person: Paola Vannucchi
Department: Scienze della Terra
Organization: Università di Firenze
Address Via La Pira, 4
Tel.: 055 275 7494 Fax:
E-mail: Paola.vannucchi@unifi.it
Permission to post abstract on IODP-MI Web site: Yes No

CRISP is a project to understand the processes that control nucleation and seismic rupture of large earthquakes
at erosional subduction zones. The uniqueness of CRISP is the possibility to reach the plate boundary across the
transition from stable to unstable slip through a transect within the drilling capabilities of the Japanese riser ship
Chikyu. Typical of erosive convergent margins, that occur along at least 50% of the global subduction zones, is the
upper plate provenance of the material in the subduction channel and along the seismogenic zone. The nature and
progressive changes of properties of this material down the subduction zone is presently unconstrained.
CRISP aims to test five hypotheses related to the transition from aseismic to seismic behaviour along erosive
plate boundaries: 1): The architecture of the subduction megathrust evolves down dip and the transition from
stable to unstable slip corresponds to the transition from a fluid-rich, broad fault zone to a thinner and drier fault.
2) Fluid pressure gradient and fluid advection affect localization of faulting and locking of erosional plate
boundaries. 3) Geological, physical and structural characteristics of material in the subduction channel influence
fault mechanics, the transition from stable to unstable slip and the earthquake cycle. 4) Fluid chemistry, P-T
conditions and residence time affect the state of eroded material through upper-plate basement alteration,
diagenesis and low-grade metamorphism. 5) Variations in subducting plate relief, subduction channel thickness,
material/fluid properties and distribution affect seismogenesis and rupture propagation.
CRISP Program A is the first step toward the deep riser drilling through the seismogenic zone, and it focuses on
the characterisation of the subducting plate, lithology and fluid system, on sampling the shallow décollement, that
most likely brings fluids generated at seismogenic depth, on installing long term monitoring laboratories to record
microseismicity, monitor fluid pressure and measure the stress field evolution through the seismic cycle. A first
evaluation of the subduction channel thickness, necessary to constrain the structural environment that will be
drilled during the deep riser drilling, will be also pursued.
CRISP Program A involves drilling at five sites: two on the incoming Cocos plate; one at the slope toe; two on
the middle-upper slope. These two latter sites are the two that will be deepen to reach the aseismic-seismic plate
boundary during Program B.
537A-Add
Hypotheses will be tested through realization of goals in both Program A and B. In particular Program A will
contribute to the knowledge of the transition from stable to unstable slip through the following goals:
Goal #1: Characterize the composition, texture, and physical properties of subducting ocean sediment and oceanic
igneous basement.
Goal #2: Constrain the fluid/rock interaction, the hydrologic system and the geochemical processes (indicated by
composition and volume of fluids) active along the plate boundary and within the upper plate.
Goal #3 Estimate the composition, texture, physical properties and subduction channel thickness of the upper plate
material entering the subduction channel.
Goal #4 Measure the stress field evolution across the up-dip limit of the seismogenic zone to determine the degree of
locking.
Long-term monitoring laboratories will require CORKs, strain-meters and seismo-meters installation.
Proposed Sites:
(m) Sed Bsm Total
CRIS 1A BGR 99-7 CMP 5740 2115 120 200 320 Oceanic Reference site
08.428579 Characterize oceanic input to the
-84.157838 subduction zone
CRIS 2B BGR 99-7 CMP 4650 2000 600 200 800 Penetration of décollement at shallow
08.483674 level, fluid flow regime, oceanic crust
-84.130675
CRIS 3B BGR 99-7 CMP 2500 538 700 250 950 Long-term monitoring, Characterise
08.592356 upper-plate basement, fluid flow
-84.077177
CRIS 4A BGR 99-7 CMP 750 170 850 150 1000 Long-term monitoring, Characterise
08.680827 upper-plate basement, fluid flow
-84.033615
CRIS 5A BGR 99-9 CMP 5560 2250 150 200 350 Oceanic Reference site
08.46055 Characterize oceanic input to the
-84.12470 subduction zone
CRIS 7A BGR 99-7 CMP 5850 2120 110 200 310 Alternate Site CRIS 1A
08.423031
-84.160568
08.422611
-84.143359
CRIS 9A BGR 99-7 CMP 4550 1900 780 200 980 Alternate Site CRIS 2B
08.488790
-84.128218
CRIS 10A BGR 99-7 CMP 2350 500 550 250 800 Alternate Site CRIS 3B
08.599967
-84.073395
08.665716
-84.041104
Proposal ID 537A-Full5
Proposal Name CRISP
Summary
CRISP Program A is the first step toward the deep riser drilling through the seismogenic zone, and it focuses on the
characterisation of the subducting plate, lithology and fluid system, on sampling the shallow décollement, that most
Scientifc Purpose(s) likely brings fluids generated at seismogenic depth, on installing long term monitoring laboratories to record
microseismicity, monitor fluid pressure and measure the stress field evolution through the seismic cycle. A first
evaluation of the subduction channel thickness, necessary to constrain the structural environment that will be drilled
during the deep riser drilling, will be also pursued.
Max Drill Depth 950
Vessel Riser
Operation Time Estimate 37 days (drilling and logging estimate)
Lithology Mud, silt, breccia sediments; basaltic basement
Operational Risks No risks expected, but possible hazards include fractured zone, fault zone, and methane hydrate
Environmental Constraints No bad weather window
Drilling/Coring APC to refusal, XCB. RCB into basement
Standard logging + LWD (+ geochemical, formation fluid sampling, borehole temperature and pressure, and borehole
Logging
seismic at sites CRIS-2B, CRIS-3A, CRIS-4A)
Technical Issues Long-term monitoring laboratories will require CORKs, strain-meters and seismo-meters installation.
CORK at each of the 5 sites to monitor fluid flow, strain meter to monitor strain field transients, seismometer and/or
CORK description (if app) VPS
Costs scale Casing, LWD, CORKs will increase costs
Milestones
Forwarded to OTF Mar 06
EPSP Site Approval
OTF Scheduled
Proposal Name CRISP
SAS / OTF History
Oct-02 FULL
iSSP Feb-03 Sites classified as 2A/2C
Apr-03 FULL2
iSSEPs May-03 Submit revised Full proposal
iSSP Jul-03 Sites classified as 1B
Oct-03 FULL3
SSEP Nov-03 CRISP recognized as a complex drilling project. Forward to OTF to determine level of scoping activity
SPC Consensus 04-03-16: The SPC approves the recommendation of the SSEPs to designate Proposal 603-CDP3
Nankai Trough Seismogenic Zone (NanTroSEIZE) and Proposal 537-CDP3 Costa Rica Seismogenesis Project
(CRISP) as complex drilling projects (CDPs) and forwards them to the OPCOM to determine the required level of
SPC Mar-04 scoping activity and initiate that activity. We request a report from the OPCOM on scoping activities at the June 2004
SPC meeting. These CDP proposals should also be distributed to the SAS service panels for providing initial technical
advice to the SSEPs and the SPC.
SSEP May-04 Forwarded to SPC
The committee considered not ranking Proposal 537A-Full3 because of the critical scientific concerns raised earlier.
Members worried that the project could rank high enough to go to OPCOM even though they regarded it as not ready
for drilling. Committee ended up ranking it 15, and to decide what to send to OPCOM later. SPC Consensus 0406-
SPC Jun-04 16: The SPC recognizes the scientific potential of a complex drilling project (CDP) in the Middle America Trench off
Costa Rica. However, Proposals 537-CDP4 and 537A-Full3 entail certain scientific and balance issues that need to be
addressed before the first stage can be considered for drilling. Following the response of the proponents to the SPC
reviews of these two proposals, the committee may consider establishing a detailed planning group (DPG) to work with
the proponents on clarifying the scientific objectives of the CDP and the drilling strategy in the component proposals.
SSP Aug-04 Site CRIS 02 classified as 1C, others classified as 1B
SSEP Nov-04 Unlikely for FY2005, possible for later
Apr-05 FULL4
SSEP Nov-05 Forwarded to SPC
Proposal Name CRISP
Ranked 6th to go the OTF. (SPC Motion 0603-21) / SPC Consensus 0603-29: The SPC approves the revised
FY2007-09 operations schedule of the U.S. scientific ocean drilling vessel (SODV) as proposed in Model 1B of the
SPC Mar-06 Operations Task Force (OTF). The recommended expeditions would begin in August 2007 and proceed through March
2009 as follows: - Equatorial Pacific Paleogene Transect I (Proposal 626-Full2), - Costa Rica Seismogenesis Project
Stage 1 (Proposal 537A-Full5), …
Apr-06 FULL5
The panel found no potential issues with either of the two reference locations and most probably could approve their
drilling, where positioned, without a cross-line. The data available for the three other sites was not, however,
EPSP Jun-06 considered adequate for the review. Two issues were raised – the processing of the available data, which did not
permit an assessment, and a lack of sufficient data.
SSP Jul-06 Site CRIS-5A classified as 2C, others classified as 1Bd
Oct-06 FULL5/ADD
Final approval for CRIS-3B is contingent upon submission by the proponents of a completed set of safety sheets,
including latitude/longitudes. The panel also strongly recommended that the proponents prepare and submit a suite of
alternate and contingency locations. It was agreed that they will attempt to prepare such locations for submission to the
panel for review prior to the meeting’s adjournment. Final approval for sites CRIS-7A, CRIS-8A, CRIS-9A, CRIS-10A,
EPSP Jan-07 and CRIS-11A is contingent upon submitting the safety sheets to the EPSP chair and IODP-MI.
SSP Feb-07 Sites classified as 1Bb, 1Bd, and 2Cb
Received 7 Feb 2006
X Revised
537-CDP7
New Addendum
Title: CRISP- Costa Rica seismogenesis project: investigating convergent margin seismogenesis
Proponent(s): Baumgartner, Peter, Bilek, Susan, Brueckmann, Warner, Castillo, Pat, Clift, Peter, Deyhle,
Annette, Dixon, Tim, Fehn, Udo, Fisher, Donald, Fulthorpe, Craig, Harris, Robert, Kastner,
Miriam, Kinoshita, Masa, Lewis, Jonathan, Matsumoto, Takeshi, McIntosh, Kirk, Morgan, Jason,
Morris, Julie, Patino, Lina, Schwartz, Susan, Snyder, Glen, Ranero, Cesar, Scholl, David,
Vannucchi, Paola, von Huene, Roland
Keywords: Seismogenic zone, Subduction factory, subduction erosion Costa Rica
Area:
(5 or less)
Contact Person: Roland von Huene
Department: Geology
Organization: University of California, Davis and Geomar, Kiel
Address 2910 North Canyon Rd., Camino, California 95709
Tel.: 001 530 644 6078 Fax: 530 644 4948
E-mail: rhuene@mindspring.com

CRISP is a project to understand the initiation of large earthquakes and seismic rupture by drilling on either
side of the updip limit of seismogenesis. The shallow dip of the subduction zone off southern Costa Rica and
relatively high subducting plate temperature cause this seismogenic environment to rise to drilling depth.
Materials, temperature, lithification, fluid flow and chemical changes that occur down the subduction zone are
hypothesized to cause the transition from stable to unstable slip that ultimately results in great earthquakes. Along
the erosional convergent margin of Costa Rica the seismogenic plate interface is surrounded by eroded debris
rather than by trench sediment.
CRISP involves the only known erosional end-member of convergent margins within reach of scientific
drilling. Samples of the fault rock and observations of dynamics will be integrated with laboratory experiments to
test 5 principal hypotheses as stated below in the scientific objectives. CRISP is structured in 2 programs that
systematically lead to deep riser drilling of the seismogenic zone. The non-riser drill Program A will provide cores
to characterize lower plate igneous basement rock and its hydrology. Paleo-depth indicators will allow a first
estimation of eroded debris and trench sediment thickness input by the subduction channel into the seismogenic
zone. Instruments will be deployed in the holes to record microseismicity and monitor fluid pressure. Program B
involves 3.5-km and 6.0-km-deep holes that are engineered from results of Program A. Program B riser drilling
samples the subduction channel along the plate interface and characterizes conditions in the zone of stable slip and
then conditions in the zone of unstable slip. This provides observations to determine physical and mineralogical
transformations and dynamic changes causing unstable slip. The riser-drilling sites are in 500m and 1000m deep
water and in an area of optimum operating conditions nearly year around. Osa Peninsula provides the opportunity
to expand investigation farther down the seismogenic zone with land drilling to ~7km should that become
attractive in the future. With a low sediment supply, fast convergence rate, abundant seismicity, subduction
erosion, and a change in subducting plate relief along strike, CRISP offers excellent opportunities to learn causes
of earthquake nucleation and rupture propagation. It complements other deep fault drilling (SAFOD and
NantroSeize) and investigates the first order seismogenic processes common to most faults and those unique to
erosional margins.
537-CDP7
The proposed drilling and accompanying geophysical programs will acquire data to test 5 key hypotheses:
1) Landward of the frontal sediment prism the transition from stable to unstable slip is accomplished by
a transition from a fluid-rich broad fault-damage zone to a thinner and drier slip zone.
2) Fluid pressure gradient and fluid advection localize locking of erosional plate boundaries temporarily
and spatially
3) Fault mechanics associated with the transition from stable to unstable slip are influenced by lithology,
physical properties, and structure of eroded materials in the subduction zone
4) Fluid chemistry, P-T conditions and residence time affect the state of eroded basement material through
alteration, diagenesis, and low-grade metamorphism influencing the transition from stable to unstable slip.
5) Variability in subducted plate relief and subduction channel thickness, affect material properties
and fluid distribution triggering seismicity and controlling rupture propagation.
The deployment of observatories will provide capability to monitor any near-field precursory signals that indicate the
stage of a rupture zone in an earthquake cycle. A physical properties map along the plate interface derived from
seismic attributes and calibrated with the drill holes will indicate whether areas of locking offshore and potential
hazardous earthquake locations can be identified from remote geophysical information.
Proposed Sites:
(m) Sed Bsm Total
Proposal ID 537CDP7
Proposal Name CRISP
Summary
CRISP is a project to understand the initiation of large earthquakes and seismic rupture by drilling on either side of the
updip limit of seismogenesis.
Water Depth
Max Drill Depth
Vessel
Lithology
Operational Risks
Drilling/Coring See Program A & B for details
Logging
Technical Issues
CORK description (if app)
Costs scale Casing, LWD will increase costs
Milestones
Forwarded to OTF
EPSP Site Approval
OTF Scheduled
SAS / OTF History
Apr-02 FULL4
iSSEPs Jun-02 Submit revised proposal
Oct-02 CDP
iSSEPs May-03 Submit revised Full
iSSP Feb-03 Sites classified as 2A and 2C
Proposal ID 537CDP7
Proposal Name CRISP
Apr-03 CDP2
Oct-03 CDP3
CRISP recognized as a complex drilling project. Forward to OTF to determine level of scoping activity. Send out for
SSEP Nov-03 external review.
SPC Consensus 04-03-16: The SPC approves the recommendation of the SSEPs to designate Proposal 603-CDP3
Nankai Trough Seismogenic Zone (NanTroSEIZE) and Proposal 537-CDP3 Costa Rica Seismogenesis Project
(CRISP) as complex drilling projects (CDPs) and forwards them to the OPCOM to determine the required level of
SPC Mar-04 scoping activity and initiate that activity. We request a report from the OPCOM on scoping activities at the June 2004
SPC meeting. These CDP proposals should also be distributed to the SAS service panels for providing initial technical
advice to the SSEPs and the SPC.
Apr-04 CDP4
SPC Consensus 0406-16: The SPC recognizes the scientific potential of a complex drilling project (CDP) in the Middle
America Trench off Costa Rica. However, Proposals 537-CDP4 and 537A-Full3 entail certain scientific and balance
issues that need to be addressed before the first stage can be considered for drilling. Following the response of the
SPC Jun-04 proponents to the SPC reviews of these two proposals, the committee may consider establishing a detailed planning
group (DPG) to work with the proponents on clarifying the scientific objectives of the CDP and the drilling strategy in the
component proposals.
Oct-04 CDP5
SSEP Nov-04 Sent back for revision
SSP Feb-05 All sites classified as a 2C
Apr-05 CDP6
OTF consider a reduced CRISP program (e.g., CRISP w/ LWD only, or CRISP with LWD and reference sites only)
instead of the full proposal. SPC-OTF members felt that conducting reduced elements of CRISP was acceptable.
Inclusion of CRISP into the program has several drawbacks including a significant transit penalty to begin the
NanTroSEIZE operations, potential staffing issues, and long-lead acquisitions (i.e., casing) that cannot be
accommodated in the FY07 budget.
OTF Jun-06 The OTF recommended that scoping process for CRISP wait until the ship track for FY09/10 is better determined.
Depending on the ship track chosen (and thus when CRISP might begin and what time would be available for
operations) the scoping group will then be in a position to better assess the time available and the potential approaches
to be taken for the initial CRISP operations.
Proposal ID 537CDP7
Proposal Name CRISP
CRISP was relocated from Expedition 2 to Expedition later to (a) remove the back to back approach with NanTroSEIZE
and (b)remove the need to include the casing (about $750, 000) as a long lead item from the FY07 budget.
537B-Full4
Title: CRISP Program B: The Transition from Stable to Unstable Slip at Erosional
Convergent Plate Boundaries
Proponent(s): C. R. Ranero, C. Marone, S. Bilek., U. Barckhausen, P. Charvis, J-Y Collot, H. DeShon, G. Di Toro, T.
Dixon, L. Dorman, S. Galeotti, I. Grevemeyer, R. Harris, S. Husen, M. Kastner, M. Kinoshita, S. Kuramoto,
T. Matsumoto, K. McIntosh, J. Morgan, J. Morris, C. Mueller, S. Neben, C. Reichert, D. Scholl, S. Saito, S.
Schwartz, V. Spiess, E. Suess, P. Vannucchi, H. Villinger, S. Vinciguerra, R. von Huene, W. Wallmann.
Keywords: Seismogenic zone, fluid flow, subduction erosion Central America
Area: off Costa Rica
(5 or less)
Contact Person: César R. Ranero
Department: Marine geodynamics
Organization: IFM-GEOMAR
Address Wischhofstrasse 1-3, 24148, Kiel, Germany
Tel.: 49-431-6002279 Fax: 49-431-6002922
E-mail: cranero@ifm-geomar.de

CRISP is designed to investigate the processes leading to seismogenesis at erosional convergent margins in 2
Programs. Each Program will involve sampling, downhole observatories, and laboratory experiments on the
recovered materials. Program A focuses on the incoming oceanic plate, the decollement at the margin’s front where
slip is aseismic, and shallow structure of the overriding plate. Program B will investigate the plate boundary in the
transition from stable slip to unstable slip by drilling and monitoring at two sites. One site is located updip, but
near, the end of the seismogenic zone, and a second site is drilled into the seismogenic zone.
At least 50% of the world’s subduction zones are erosional margins. Erosional convergent margins have a
subduction channel containing material removed from the overriding plate mixed with sediment from the incoming
plate. The nature and physical properties of this material are currently unconstrained. Similarly, the volume,
distribution and chemistry of fluids at erosional plate boundaries are poorly known.
In Program B we propose a detailed investigation of subduction earthquake processes and to sample and monitor
the plate boundary where temperatures range ~100-200°C. Previous work indicates that key processes become active
in that temperature range and control the onset of seismicity. Drilling will for the first time sample eroded material
and fluids in the subduction channel and investigate plate boundary fault mechanisms during tectonic erosion.
CRISP Program B will provide the core material for detailed laboratory experiments designed to isolate the
processes and physical conditions that control the onset of seismogenesis.
Four Major Goals of Program B Drilling, Monitoring and Laboratory Experiments are:
1) Quantify effective stress and plate boundary migration via focused investigation of fluid pressure gradient and fluid
advection across the erosional plate boundary.
2) Determine the structure and fault mechanics of an erosional convergent margin and identify the processes that
control the updip limit of seismicity.
3) Constrain how fluid-rock interaction affect seismogenesis by studying fluid chemistry and residence time,
basement alteration, diagenesis, and low grade metamorphism.
4) Obtain physical properties of a 3-D volume that spans the seismogenic zone.
The subduction zone offshore Osa Peninsula provides the tectonic setting to reach CRISP goals. The shallow
subduction angle and high temperatures bring to shallow depth processes that elsewhere occur at greater depth,
beyond the reach of drilling.
537B-Full4
CRISP Program B will sample and monitor the plate boundary environment to study physical conditions and
material properties in the transition into the seismogenic zone. The scientific objectives of Program B are to test five
main hypotheses central to understanding structure and seismogenesis at erosional plate boundaries:
1) Landward of the frontal sediment prism, the transition from stable to unstable slip parallels the transition from a
fluid-rich and broad fault zone, with distributed slip, to a narrower zone of active deformation with localized shear and
fluid compartmentalization.
2) Fluid pressure gradients and fluid advection affect the migration and coupling of erosional plate boundaries both
temporally and spatially.
3) The lithology, physical properties, and structure of eroded materials influence fault mechanics and the transition from
stable to unstable slip at subduction interfaces.
4) Fluid chemistry, P-T conditions and residence time affect the state of eroded material through basement alteration,
diagenesis and low-grade metamorphism.
5) Lateral variability in subducted plate relief, subduction channel thickness, material properties and fluid distribution
affect seismogenesis and rupture propagation.
These hypotheses will be tested by A) direct observation of the lithology, physical properties and structure of the
plate boundary and surrounding rock, B) monitoring temperature, stress, pore-fluid pressure and chemistry, and
seismicity, C) laboratory experiments on core samples, and D) dedicated geophysical surveys designed to expand
regionally the results from drilling and monitoring.
Riser drilling
Drilling at >100°C and <200°C will require development of tools.
Proposed Sites:
(m) Sed Bsm Total
channel in the area of transition
between aseismic and seismic
slip and temperatures between
100°-150°C, updip, but near,
the end of the seismogenic zone.
channel in the seismogenic zone
at temperatures between 150°-
<200°C.
Proposal ID 537B-Full4
Proposal Name CRISP
Summary
CRISP Program B will provide the core material for detailed laboratory experiments designed to isolate the processes
and physical conditions that control the onset of seismogenesis.
Vessel Riser
Operation Time Estimate ~9 months
Lithology Slope sediment, basement of consolidated sediment with possible basalt flows interlayered
Operational Risks Possible hazards include: methane hydrates
Drilling/Coring APC to refusal, XCB to 500m at Hole A, RCB to TD, with several logging and casing operations at Hole B.
Standard + LWD + geochemical, formation fluid sampling, borehole temperature and pressure and borehole seismic,
Logging
VSP
Technical Issues Drilling at >100°C and <200°C will require development of tools. Riser drilling to 6000mbsf.
CORK description (if app) CORK - long-term monitoring of seismicity, temperature flux, fluid pressure flux, and fluid chemistry
Costs scale Casing, CORK LWD will increase costs
Milestones
EPSP Site Approval
OTF Scheduled
SAS / OTF History
Apr-04 Full
SSEP May-04 Sent back for revision.
Oct-04 Full2
SSEP Nov-04 Unlikely for FY2005, possible for later ; Sent out for external review
SSP Feb-05 All sites classified as a 2C
Proposal ID 537B-Full4
Proposal Name CRISP
Apr-05 Full3
Ranked 7th to go the OTF. - 7th overall, 1st in second group of proposals. (SPC Motion 0603-21) / Becker noted that
SPC Mar-06
537B would return to SPC for ranking again.
Apr-06 Full4
Oct-06 Full4/PRL3
SPC Mar-07 SPC Concensus 0703-13: SPC Ranked 7th out of 15 and in forwarded to the OTF in group I.
L6$6,2'33URSRVDO&RYHU6KHHW
1HZ 5HYLVHG $GGHQGXP
545-Add
$ERYH)RU2IILFLDO8VH2QO\
3OHDVHILOORXWLQIRUPDWLRQLQDOOJUD\ER[HV
7LWOH 7KH+\GURJHRORJLF$UFKLWHFWXUHRI%DVDOWLF2FHDQLF&UXVW
&UXVWDOVFDOH3URSHUWLHVDQG0XOWLSOH+\GURWKHUPDO6\VWHPV
RQWKH(DVWHUQ)ODQNRI-XDQGH)XFD5LGJH
3URSRQHQWV $)LVKHU('DYLV.%HFNHU00RWWO&*:KHDW6SLHVV9=KOVGRUII/
'9DQNR+(OGHUILHOG+9LOOLQJHU-&RZHQ-%DURVV06LQKD-60F&ODLQ
0+XWQDN
.H\ZRUGV +\GURWKHUPDOV\VWHPVFUXVWDOHYROXWLRQKHWHURJHQHLW\ $UHD 1RUWKHDVW 3DFLILF
RUOHVV 2FHDQ
&RQWDFW,QIRUPDWLRQ
&RQWDFW3HUVRQ $QGUHZ7)LVKHU
'HSDUWPHQW (DUWK6FLHQFHV'HSDUWPHQW
2UJDQL]DWLRQ 8QLYHUVLW\RI&DOLIRUQLD6DQWD&UX]
$GGUHVV 8&6&(DUWK6FLHQFHV'HSW+LJK6WUHHW6DQWD&UX]&$86$
7HO )D[
(PDLO DILVKHU#HVXFVFHGX
3HUPLVVLRQWRSRVWDEVWUDFWRQL6$6:HEVLWH <HV 1R
$EVWUDFWZRUGVRUOHVV
:H SURSRVH WR GHWHUPLQH WKH QDWXUH RI RFHDQLF FUXVWDO DUFKLWHFWXUH DVVRFLDWHG ZLWK IOXLGURFN LQWHUDFWLRQ
PLFURELRORJLFDODFWLYLW\ DQG ODUJHVFDOH IOXLG KHDW DQG VROXWH WUDQVSRUW ZLWKLQ RFHDQLF EDVHPHQW RQ WKH HDVWHUQ
IODQNRI-XDQGH)XFD5LGJH7KLVLVWKHLGHDODUHDIRUVXFKDQH[SHULPHQWEHFDXVHWKLFNVHGLPHQWFRYHULVRODWHV
SHUPHDEOHEDVHPHQWDOORZLQJVPDOOSUHVVXUHWUDQVLHQWVWRWUDYHOORQJODWHUDOGLVWDQFHVRXWVWDQGLQJFRYHUDJHRI
VHLVPLFKHDWIORZFRULQJJHRFKHPLFDODQGREVHUYDWRU\GDWDDOORZGHWDLOHGK\SRWKHVHVWREHSRVHGDQGWHVWHG
H[LVWLQJ2'3 GULOO KROHV DQG ORQJWHUP REVHUYDWRULHV SURYLGH FULWLFDO PRQLWRULQJ SRLQWV IRU SUH DQG SRVWGULOOLQJ
H[SHULPHQWV DV ZHOO DV QDWXUDO IRUPDWLRQ RYHUSUHVVXUHV ZKLFK ZLOO GULYH PXOWL\HDU H[SHULPHQWV D VHDIORRU
REVHUYDWRU\QHWZRUN1(3781(ZLOOIDFLOLWDWHORQJWHUPH[SHULPHQWVDQGGDWDDFFHVV7KHIRFXVRIWKLVSURSRVDO
LVGULOOLQJFRULQJDQGVDPSOLQJZLWKLQWZRKROHVGULOOHGPDQGPLQWREDVHPHQWIROORZHGE\ORJJLQJDQG
FUXVWDOVFDOHDQGFURVVKROHWHVWVDQGVDPSOLQJXVLQJQHZERUHKROHVDQGH[LVWLQJVHDIORRUREVHUYDWRULHV&URVVKROH
ORQJWHUP WHVWLQJ LV VWDQGDUG LQ DTXLIHUV DQG UHVHUYRLUV RQ ODQG EXW KDV QHYHU EHHQ DWWHPSWHG XQGHU FRQWUROOHG
FRQGLWLRQV ZLWKLQ WKH RFHDQLF FUXVW :H ZLOO FRQGXFW VLPXOWDQHRXV K\GURJHRORJLF JHRSK\VLFDO JHRFKHPLFDO DQG
PLFURELRORJLFDOH[SHULPHQWVWRGHWHUPLQHKRZWKHVHV\VWHPVUHODWHWRHDFKRWKHU 7KHVH WHVWV ZLOO EH KRXUV WR
VHYHUDO\HDUVLQGXUDWLRQFRQVLGHUDEO\ORQJHUWKDQDQ\RWKHUWHVWVDWWHPSWHGLQ'6'3 RU 2'3$OWHUQDWHVLWHVDUH
SURSRVHGZLWKLQDVKDOORZK\GURWKHUPDOXSIORZ]RQHDQGLQGHHSHUEDVHPHQWDUHDVZKHUHWKHFUXVWLVPRUHPDWXUH
6SHFLILF TXHVWLRQV WR EH DGGUHVVHG E\ WKH SURSRVHG ZRUN LQFOXGH +RZ LV K\GURWKHUPDO FLUFXODWLRQ
´FRPSDUWPHQWDOL]HGµ E\ SULPDU\ LJQHRXV FUXVWDO DUFKLWHFWXUH DQG VXEVHTXHQW WHFWRQLF PRGLILFDWLRQ RI WKH FUXVW"
+RZ FRPSUHVVLEOH DQG SHUPHDEOH LV WKH FUXVW DW D ODWHUDO VFDOH RI NLORPHWHUV" :KDW LV WKH PDJQLWXGH RI
PLFURELRORJLFDOELRPDVVDQGSK\ORJHQHWLFGLYHUVLW\ZLWKLQVKDOORZULGJHIODQNVKRZLVLWGLVWULEXWHGDQGZKDWLV
WKHWHPSHUDWXUHOLPLWRQYLDEOHPLFUREHV"+RZUHOLDEOHDUHJHRFKHPLFDOLQGLFDWRUVRIPL[LQJLQWKHFUXVW"'RHVWKH
XSSHU FUXVW VXSSRUW VXSHULPSRVHG ´FHOOXODUµ FRQYHFWLRQ DQG ODWHUDO IORZ ZLWKLQ WKH VDPH OD\HUV RU GR GLIIHUHQW
PRGHV RI FLUFXODWLRQ RFFXU LQ GLVWLQFW SHUKDSV LQWHUEHGGHG FUXVWDO OD\HUV" +RZ H[WHQVLYH LV FUXVWDO DQLVRWURS\
K\GURORJLFVHLVPLFHOHFWULFDO"'RFUXVWDOSURSHUWLHVYDU\ZLWKWKHVFDOHRIWHVWLQJRUGRDSSDUHQWVFDOHYDULDWLRQV
UHVXOW IURP GLIIHUHQFHV LQ PHWKRGV DQG DVVXPSWLRQV" +RZ FDQ SURSHUWLHV PHDVXUHG DW D VPDOO VFDOH ZLWKLQ D
KHWHURJHQHRXVV\VWHPEHXSVFDOHGWRFUXVWDOGLPHQVLRQV"
545-Add
6FLHQWLILF2EMHFWLYHVZRUGVRUOHVV
6HFRQG5LGJHILUVWSULRULW\'ULOODW6LWH65P66:RI2'36LWHZKHUHVHGLPHQWWKLFNQHVVLV

P&RUHWKURXJKFRQHLQWREDVHPHQWXSSHUEDVHPHQWDQGVHWFDVLQJWKHQSHQHWUDWHPLQWREDVHPHQW
/RJ963VDPSOHDQG&25.+ROH65$WRLVRODWHPXOWLSOHOHYHOVLQEDVHPHQW'ULOODW6LWH65P
66:RI6LWHDQGP11(RI6LWH652SHUDWLRQDOSODQLVLGHQWLFDOWRWKDWDW65H[FHSWWKDW
EDVHPHQW SHQHWUDWLRQ ZLOO EH P &RQGXFW ORQJWHUP K\GURJHRORJLF DQG WUDFHU H[SHULPHQW E\ SXPSLQJ LQWR
+ROH 65$ IRU KRXUV 0RQLWRU SUHVVXUHV DQG FKHPLVWU\ DW QHDUE\ KROHV &25. +ROH 65$ DQG DOORZ WR
HTXLOLEUDWH2SHQVHDIORRUYDOXHVSRVWGULOOLQJWRLQLWLDWHPXOWL\HDU´DTXLIHUµWHVWXVLQJQDWXUDORYHUSUHVVXUHWR
JHQHUDWHSUHVVXUHSHUWXUEDWLRQ
)LUVW 5LGJH VHFRQG SULRULW\ 'ULOO RQH WR IRXU KROHV LQWR K\GURWKHUPDO XSIORZ ]RQH ZKHUH WKH H[WHQW DQG
VLJQLILFDQFHRIEDVHPHQWDOWHUDWLRQDQGWKHOLNHO\QDWXUHRIDORQJVWULNHK\GURWKHUPDOUHFKDUJHFDQEHHYDOXDWHG
6HGLPHQWWKLFNQHVVLVPDQGEDVHPHQWSHQHWUDWLRQZLOOEHP
'HHS5LGJHVHFRQGSULRULW\'ULOOLQWRGHHSO\EXULHGEDVHPHQWULGJHVNPIURPWKHVSUHDGLQJFHQWHU
ZKHUH EDVHPHQW WHPSHUDWXUHV PD\ DSSURDFK DQG H[FHHG & WR HYDOXDWH WKH LQIOXHQFHV RI K\GURWKHUPDO
FLUFXODWLRQ RQ FUXVWDO HYROXWLRQ DQG PLFURELRORJ\ 6HGLPHQW WKLFNQHVV LV P DQG EDVHPHQW SHQHWUDWLRQ
ZLOOEHP
3URSRVHG6LWHV
:DWHU 3HQHWUDWLRQP
6LWH1DPH 3RVLWLRQ 'HSWK %ULHI6LWHVSHFLILF2EMHFWLYHV
P 6HG %VP 7RWDO
65
1
: K\GURJHRORJLFSURSHUWLHV
65
1
: GLVWULEXWLRQVDOWHUDWLRQ
FRQVWUXFWLRQOD\HULQJ
PLFURELRORJ\PFKHPLVWU\
)5
1
: QDWXUHRIDQGDOWHUDWLRQLQ
K\GURWKHUPDOXSIORZ]RQH
PLFURELRORJ\FKHPLVWU\
'5
1
: VHGLPHQWEDVHPHQWFKHPLVWU\
PLFURELRORJLFDOVDPSOLQJ
HYDOXDWHFUXVWDOHYROXWLRQ
Proposal Name Juan de Fuca
Summary
to evaluate the formation-scale hydrogeologic properties (transmission, storage) within oceanic crust; determine how fluid
Scientifc Purpose(s) pathways are distributed within an active hydrothermal system; establish linkages between fluid circulation, alteration, and
geomicrobial processes, and determine relations between seismic and hydrologic anisotropy.
Water Depth 2600 m
Vessel SODV
Operation Time Estimate 104 days *OTF from Jun05 has it as 68 days
Lithology Sediment of tubidites (clay, silt, sand) and hemipelagic mud; Basalitic basement
Operational Risks Hole stability
Environmental Constraints Ideal weather window is May to October (summer is best)
At SR-1 and SR-2, RCB coring through sediment and into basement, set cone and casing, complete logging and downhole
Drilling/Coring experiments, set multi-level CORK (A-CORK and CORK-2) to isolate distinct depth intervals. At FR-1, APC/XCB one or
more hole to 70 m, and RCB upper basement (30-40m). At DR-1 and DR-2, RCB through sediment and uppermost
basement - install cone and casing if time allows for temperature and pressure measurements
Logging Conventional logging, BHTV, VSP with ASI
Limitations / Assumptions CORK-II designs, Microbiology requirements
Special Considerations Canadian clearance required, Sailing ACORK Engineer, Cementing Plan, Marine Mammals (VSP)
Technical Issues Packer, CORK
CORK description (if app) A-CORK and CORK-2
Costs scale CORKS
Milestones
Forwarded to OTF: rank Sep 03
EPSP Site Approval Dec 03
OTF Scheduled
SAS / OTF History
Oct-01 ADD
iSSEPs Nov-01 Forward 545-Add to iPC
iPC Mar-02 Ready for ranking.
Apr-02 FULL3
Apr-03 FULL3
iSSEPs May-03 Grouped at meeting and forwarded to iPC.
iSSP Jul-03 1A (FR-1), 1B (SR-1, SR-2), 2C (DR-1, DR-2)
SPC Consensus 03-09-28: The SPC regards the first part of Proposal 545-Full3 Juan de Fuca Flank Hydrogeology as
worth scheduling on its own.
SPC Motion 03-09-34: The SPC approves the following expedition schedule for the non-riser vessel during June 2004
through May 2005. 1. 545-Full3 Juan de Fuca Flank Hydrogeology (Part I)…..The SPC also identifies the non-A-CORK
component of 553-Full2 Cascadia Margin Hydrates as an alternate first expedition in case any significant delays arise in
SPC Sep-03 the logistical planning for Proposal 545-Full3.
The choice of conducting this project either in two phases of 45 and 23 days long or as a single 65-day expedition was
presented. SPC Consensus 03-09-28: The SPC regards the first part of Proposal 545-Full3 Juan de Fuca Flank
Hydrogeology as worth scheduling on its own.
Ranked #3 in Group 1 to forwarded to OTF.
Site-by-site approval: 1026B Approved Cork replacement, 1027C Approved Cork replacement, SR-1 Approved to 860 m,
EPSP Dec-03 SR-2 47 Approved to 475 m, FR-1A,C Approved to 110 m, FR-1B Approved to 110 m, DR-1 Approved to 660 m, DR-2
Approved to 940 m.
SPC Consensus 0406-8: The SPC recognizes that the Juan de Fuca Hydrogeology expedition (301) represents the first
phase of a multi-phase effort involving installation of a CORK array across several sediment-covered ridges. To assess
properly the appropriateness of proceeding to the next phase and the utility of this array, the SPC and OPCOM must
receive a prompt report on the aforementioned expedition from the co-chief scientists and the JOI Alliance, detailing the
scientific and operational progress towards the stated objectives of Proposal 545-Full3. OPCOM should consider that
report at its next meeting (fall 2004) and forward its recommendation to the SPC in time to evaluate the next phase of Juan
de Fuca Hydrogeology studies for inclusion in the prioritized SPC groupings for FY2005 and FY2006 program planning, as
developed at this SPC meeting. The committee anticipates augmenting those groupings without re-ranking at the October
SPC Jun-04 2004 SPC meeting.
SPC Consensus 0406-15: The SPC forwards the top fourteen of fifteen ranked proposals to OPCOM in three groups as
follows. The committee requests that OPCOM propose scheduling options for FY2005 and FY2006 that honor and adhere
to these ranking groups as closely as possible. Group I includes the top seven proposals. This group equates in priority to
the Group I proposals previously forwarded to OPCOM and currently awaiting scheduling (519-Full2 South Pacific Sea
Level, 545-Full3 Juan de Fuca Flank Hydrogeology, 564-Full New Jersey Shelf, and 589-Full3 Gulf of Mexico
Overpressures). The committee recommends scheduling the Group I proposals if at all possible within operational
constraints.
EPSP Jun-04 No challenges/issues found
SPC Consensus 0410-36: The SPC recommends for the remainder of FY2006 following Proposal 482-Full3 Wilkes Land
Margin with appropriate non-riser drilling components of Proposals 603A-Full2 NanTroSEIZE Reference Sites and 603B-
SPC Oct-04 Full2 NanTroSEIZE Mega-Splay Faults, then Proposal 477-Full4 Okhotsk and Bering Seas Paleoceanography, Part 1. The
committee also recommends the remainder of Proposal 545-Full3 Juan de Fuca Flank Hydrogeology or Proposal 553-Full2
Cascadia Margin Hydrates as a backup for Proposal 477-Full4 Okhotsk and Bering Seas Paleoceanography, Part 1.
EPSP Dec-04 Hole 1027C 47o45.390'N 127o43.860'W 673 - Approved as proposed.
SSP Feb-05 Site readiness classifications - FR-1: 1A / SR-1, SR-2: 1B / DR-1, DR-2: 2C
the Operations Task Force as part of the highest priority Group I should remain for now with the Operations Task Force for
them to consider in developing drilling schedule scenarios for FY2006 and beyond. This group includes: Proposals 477-
Full4 Okhotsk/Bering Plio-Pleistocene, 482-Full3 Wilkes Land Margin, 519-Full2 South Pacific Sea Level, 545-Full3 Juan
de Fuca Flank Hydrogeology, 553-Full2 Cascadia Margin Hydrates, 564-Full New Jersey Shallow Shelf, 589-Full3 Gulf of
SPC Mar-05 Mexico Overpressures, 600-Full Canterbury Basin, 603A-Full2 NanTroSEIZE Phase 1, 603B-Full2 NanTroSEIZE Phase 2,
and 621-Full Monterey Bay Observatory.
The SPC members nominated several or more prospective candidates as potential co-chief scientists. The IODP-MI
science coordinators promised to solicit the program member offices for the CV of each candidate plus any additional
nominations and forward the information to the appropriate IOs by early June 2005.
The OTF felt that it is important to commit program resources to finishing these operations.
Operational requirements need to be finalized.
Juan de Fuca is an operationally complex expedition. Multiple CORK installations, packer testing, VSP logging, and
OTF Jun-05
remedial cementing operations (previously not undertaken) are all planned. As such, we need to err more on the
conservative side with regards to weather and sea state. June through August are by far the best months to be operating in
that area. May and September are marginal. Operations should not be attempted prior to May.
SPC Motion 0510-23: The SPC approves the FY2007-08 operations schedule of the U.S. scientific ocean drilling vessel
(SODV) as proposed in model 2 of the Operations Task Force. The recommended expeditions will begin in August 2007
and proceed as follows: - Equatorial Pacific Paleogene Transect (Proposal 626-Full2) - NanTroSEIZE Stage 1 (Proposals
SPC Oct-05 603A-Full2, 603B-Full2, 603C-Full) - NanTroSEIZE Stage 1 continued (Proposals 603A-Full2, 603B-Full2, 603C-Full) -
Superfast Spreading Crust IV (Proposal 522-Full3) or another expedition identified later - Juan de Fuca Flank
Hydrogeology III (Proposal 545-Full3)
would begin in August 2007 and proceed through March 2009 as follows: - Equatorial Pacific Paleogene Transect I
(Proposal 626-Full2) - Costa Rica Seismogenesis Project Stage 1 (Proposal 537A-Full5) - NanTroSEIZE Stage 1
(Proposals 603A-Full2, 603B-Full2, 603C-Full) - NanTroSEIZE Stage 1 continued (Proposals 603A-Full2, 603B-Full2, 603C
SPC Mar-06 Full) - Bering Sea Paleoceanography (Proposal 477-Full5) - Juan de Fuca Flank Hydrogeology III (Proposal 545-Full3) -
Equatorial Pacific Paleogene Transect II (mini expedition, Proposal 626-Full2) - Canterbury Basin (Proposal 600-Full) -
Wilkes Land Margin (Proposals 482-Full3, 638-APL2). The SPC recognizes this scenario as a preferred model subject to
significant change, especially pending further knowledge about the actual SODV drydock location and starting date for
IODP operations. The committee thus encourages the OTF to explore further possibilities of revising the FY2007-09 operati
SPC Consensus 0608-03: The SPC approves the science plan and operations schedule of the U.S. scientific ocean
drilling vessel (SODV) as recommended by the Operations Task Force for FY2008 and earliest FY2009, as well as the
readjustments required in the event of a delay in the starting date for SODV operations. The recommended expeditions will
begin in November 2007 and proceed as follows: -Equatorial Pacific Paleogene Transect I (Proposal 626-Full2) -
NanTroSEIZE Stage I (Proposals 603A-Full2, 603B-Full2, 603C-Full) -NanTroSEIZE Stage I continued -Bering Sea Plio-
SPC Aug-06 Pleistocene Paleoceanography (Proposal 477-Full4) -Juan de Fuca Flank Hydrogeology II (Proposal 545-Full3) -Equatorial
Pacific Paleogene Transect II (Proposal 626-Full2). In the event of a slight delay in the start of SODV operations, the entire
schedule should simply shift later, as long as good weather windows remain open for the Bering Sea and Juan de Fuca
expeditions. In the event of a longer SODV delay that would preclude such a simple shift, the first Equatorial Pacific
expedition would be deferred until later and the schedule would begin with NanTroSEIZE Stage I operations.
- Equatorial Pacific Paleogene Transect II, ending with remedial cementing of two Juan de Fuca CORKs installed on
SPC Mar-07 Expedition 301
operations
This adjusted schedule is as close as possible to the previously approved FY2008-2009 schedule (SPC Consensus 0608-03
OTF Jul-07 Current plan is to do remedial cementing for shallow-water corks following Eq Pac II.
548-Add3
Title: Chicxulub: Drilling the K-T Impact Crater
Proponent(s): Joanna Morgan, Richard Grieve, Sean Gulick, Jaime Urrutia-Fucugauchi, Christian Koeberl, Jay
Melosh, Charles Cockell, Takafumi Matsui, Gail Christeson, Mario Rebolledo, and Penny Barton
Keywords: Chicxulub, cratering, K-T impact Gulf of Mexico

Area:
(5 or less)
Contact Person: Dr. Joanna Morgan
Department: Earth Science and Engineering
Organization: Imperial College London
Address South Kensington Campus, SW7 2AZ
Tel.: 44 207 5946423 Fax: 44 207 5947444
E-mail: j.v.morgan@imperial.ac.uk
The Chicxulub impact crater, Mexico, is unique in the terrestrial, if not the solar system, impact
record. It is the only known impact structure that has been directly linked to a mass extinction
event. Understanding Chicxulub’s formation is, thus, critical to understanding its immediate
post-impact effects on the Earth’s environment and ecology. Chicxulub is also unique in that it
is the only known terrestrial impact structure with a demonstrable topographic peak ring. In
all other cases of large terrestrial impact structures, erosion and/or tectonism have destroyed the
evidence of the existence of a peak ring. Large peak ring craters are found on the other silicate
planetary bodies but their characterization is limited to information based on remote sensing.
At present, however, the exact nature and details of formational mechanisms of peak rings are
unknown. Chicxulub is unique, therefore, in the solar system, as the only peak ring crater,
where the nature of the peak ring can actually be determined by ground truth data. Although
Chicxulub is well preserved, it is buried by post-impact sediments. Thus, the much needed
and valued ground truth data that Chicxulub can supply to the research community can only be
accessed through a drilling campaign. The community consensus is that the critical
information can be supplied at Chicxulub by two selected drill holes: one offshore to
characterize the peak ring and its underlying structures (site Chicx-03A) and one onshore to
characterize the full sequence of impactites and penetrate the entire coherent impact melt sheet
(site to be finalized). These two sites are complementary, addressing different scientific goals,
and independent. Together, however, they will result in a step function in our knowledge of
large-scale impact cratering, in general, and Chicxulub and its effects, in particular. This, in
turn, will constrain our understanding of how large-scale impact cratering shaped planetary
surfaces and upper crusts early in solar system history. The new knowledge will also elucidate
how an individual large-scale impact can fundamentally change the course of biological
evolution on Earth, as happened, 65 Ma ago in the case of Chicxulub.
548-Add3
Chicx-03A will drill through the peak ring and underlying dipping reflector. How peak rings
form is still a key unanswered question in impact cratering, and the detailed lithological,
geochemical, and structural characteristics of peak rings are completely unknown. Drilling the
peak ring would provide fundamental advances in our understanding of large-scale crater
mechanics, which was important in the shaping the early surfaces and upper crust of planetary
bodies. Chicx-03A will determine the fundamental character of the lithologies above and below
the dipping reflector, the physical state of the material, and the cause of the reflectivity. This
will discriminate between competing models of peak ring formation. The expected lithologies of
the drillhole include ~700 m of post-impact fill, 1.4 km of impact breccia, and ~900 m of
fractured basement. If the peak ring material here has been overturned, as predicted by some
numerical models, we may pass though basement into younger sediments. A major scientific
target is dipping reflectivity imaged beneath the peak ring, which would be reached at ~2.4 km
depth and may be 300-400 m thick. Chicx-02A and Chicx-04A are contingency sites for
Chicx-03A.
Chicx-01A, proposed in IODP 548-Full2, is now considered lower priority and thus with this
addendum we propose focusing the offshore effort at Chicx-03A.
Proposed Sites:
(m) Sed Bsm Total
Chicx-03A 21 27.0846 N 17 m 3000 m 3000 m Primary hole: constrain

89 57.0648 W formational process and
lithologies of a peak ring
Chicx-02A 21 27.33 N 17 m 3000 m 3000 m Original site; now contingency

89 57.09 W hole for Chicx-03A
Chicx-04A 21 28.6578 N 17 m 1750 m 1750 m Contingency site to reach

89 57.4404 W dipping reflectivity beneath
peak ring
Chicx-01A 21 17.72 N 23 m 4100 m 4100 m Identify the thickness,

90 41.93 W composition, and character of
the pre-impact target rocks
Proposal Name Chicxulub
Summary
1. To identify the correct lithological and structural form of Chicxulub.
Scientifc Purpose(s) 2. To improve our understanding of large-scale impact cratering.
3. To use these to constrain the environmental effects of the impact.
Water Depth 20-25 m
Vessel MSP
Operation Time Estimate ~200 days (depends on vessel chosen)
Lithology Sediments of tertiary paltform carbonates, impact breccia, Mesozoic platform carbonates, dolomites and evaporites.
Basement composed of thin layer of late Jurassic/early Cretaceous red beds above Paleozoic metamorphic rocks.
Environmental Constraints Hurricane Season - July through September
Drilling/Coring APC, XCB, RCB - exact plan developed once vessel is determined
Logging Standard + borehole temperature and pressure
Technical Issues
CORK description (if app) NA
Costs scale MSP
Milestones
Forwarded to SPC
EPSP Site Approval
OTF Scheduled
SAS / OTF History
iSSEPs Jun-02 forward to iPC
Readiness: 3B, not feasible for drilling in 2004
iSSP Jul-02 Notes & iSSP Consensus: Proponents need to submit and/or coordinate with iSSP data bank to verify that
the full navigation information exists for all seismic data submitted. See minutes for more details.
Proposal Name Chicxulub
iPC Aug-02 iPC Consensus 3-12: Ranked 4 out of 5 for MSPs and forwarded to the IWG for further consideration.
Oct-02 FULL2
SPC Sep-03 Ranked 15 out of 16 (the top 11 were forwarded on)
Oct-03 ADD2
SSP Feb-04 Site readiness ranked as: 2B
SPC Consensus 0406-13: In view of recent ICDP drilling of the Chicxulub impact structure and planned geophysical
work, the SPC decides to exclude Proposal 548-Full2 from the current pool of proposals for global scientific ranking.
The committee suggests that theproponents organize a joint IODP/ICDP workshop to discuss major scientific questions
SPC Jun-04 related to the Chicxulub impact structure, once new seismic data from onshore and offshore become available. The
major goal of such a workshop should be to specify the drilling targets evolving from the latest cratering models and
recent ICDP drilling, and to locate the best sites required to test the hypotheses and fulfill the scientific objectives of
Proposal 548-Full2.
CHICX-01 & -02: 2Ab (Substantial items of required data are not in the Data Bank but are believed to exist [ velocity,
SSP Feb-06 bathymetry], data image the target adequately but there are scientific concerns of drill site location or penetration)
SPC Consensus 0603-18: The SPC notes the good progress in collecting new seismic data for Proposal 548-Full2
Chicxulub K-T Impact Crater and in organizing the joint IODP-ICDP workshop on that topic. The committee reaffirms
SPC Mar-06
SPC Consensus 0406-13 and encourages the proponents to submit a revised proposal or addendum as soon as
possible after the workshop.
SPC Consensus 0603-20: The SPC will include in the ranking pool all of the proposals reviewed at this meeting,
SPC Mar-06
except for Proposal 548-Full2 Chicxulub K-T Impact Crater.
SSP Jul-06 Sites classified as 2Ab
Oct-06 FULL2/ADD3
SSP Feb-07 CHICX - 1A, others classified as 1Aa
SPC Mar-07 SPC Consensus 0703-13: Forward to OTF ranked 10 out of 15 and in Group II
committee questions if Chicxulub would be worthwhile to complete if the onshore component of Chicxulub is not
SPC Mar-07 funded?
Received 1 April 2005
New X Revised Addendum
549-Full6
Title: Monsoonal Variability and Oxygen Minimum Intensity in the Northern Arabian Sea
Proponent(s): Andreas Lückge, Willem Jan Zachariasse, Ulrich von Rad, Ali Rashid Tabrez, Christoph Gaedicke,
Frederick Hilgen, Lucas Lourens, Gert-Jan Reichart, Carsten Rühlemann, Axel Schippers and
Hartmut Schulz
Keywords: Monsoon, Quaternary, Neogene, Climate Variability, OMZ Northern Indian
Area:
(5 or less) Ocean
Contact Person: (1) Andreas Lückge (2) Willem Jan Zachariasse
(1) Bundesanstalt fuer Geowissenschaften und Rohstoffe (BGR)
Department:
(2) Institute of Earth Sciences, University of Utrecht
Organization:
(1) Stilleweg 2, 30655 Hannover, Germany
Address
(2) NL-3508 TA Utrecht, Budapestlaan 4, The Netherlands
Tel.: (1) +49-511-6432789 (2) +31-30-2535186 Fax: (1) +49-511-6433663
E-mail: (1) a.lueckge@bgr.de (2) jwzach@geo.uu.nl
The region off Pakistan is a textbook example of a stable, expanded, open-marine oxygen minimum
zone (OMZ), whose intensity at annual to Milankovitch time scales is largely controlled by the strength
of the summer and winter monsoon. Our main aim is to recover fully intact sequences of late Neogene
hemipelagic sediments in the northern part of the Arabian Sea to study the history of the Indian
monsoon and OMZ on annual to tectonic time scales. For this purpose, we propose to drill two depth
transects across the OMZ: (1) a transect of three, about 300-525 m deep, triple-APC-cored holes into
Pliocene to Quaternary hemipelagic sediments of the Pakistan Margin (Sites POM 1-3) and (2) a
transect of four triple-APC-cored sites into Holocene to upper Miocene (~8 Ma) hemipelagic sediments
of the Murray Ridge (Sites MR1-4, MR-6, including alternates). The proposed drill sites offer a unique
opportunity to study the following objectives: (1) Late Neogene evolution of millennial-scale variations
in OMZ intensity; (2) Biogeochemical cycles; (4) Astronomical pacing of the Indian monsoon during
long-term global cooling; and (4) Tectonic-scale paleoceanographic and climate changes; (5) ‘Deep
Biosphere’.
Our main objectives match to the important targets, Environmental Changes, Processes and Effect,
Rapid Climate Change and Deep Biosphere as mentioned in the IODP Initial Science Plan and are
complementary to the recently approved IODP Proposal 595 by P. Clift et al., which focuses on the deep
riser and non-riser drilling on the Indus Fan and Murray Ridge to reconstruct the erosion history of
Tibet, western Himalaya and the Karakoram. Our proposal will offer a unique opportunity to answer
many open questions, such as: (1) Did millennial OMZ intensity changes also occur before the major
onset to northern hemisphere glaciations around 3 million years ago and did they become more
prominent during the Pleistocene full icehouse world? (2) Did the astronomical phase relations for the
strength of the Indian summer monsoon changed over the past 4 million years as suggested by Clemens
et al. (1996) or has the effect of the winter monsoon been underestimated in these reconstructions? (3)
Did the closure of the Indonesian gateway (Cane and Molnar, 2001) play a crucial role in ocean
circulation and east African aridification around 3-4 million years ago?
549-Full6
The major scientific objectives of this drilling proposal are:

• Late Neogene evolution of millennial-scale variations in OMZ intensity
• Biogeochemical cycles
• ‘Deep Biosphere’
• Astronomical pacing of the Indian monsoon during long-term global cooling
• Tectonic-scale paleoceanographic and climate changes
Proposed Sites:
(m) Sed Bsm Total
*POM-1 Indus Slope 825 400 400 Paleoclimate history of past 1.5
23°05.6'N/66°27.9'E Ma, OMZ fluctuations, deep
biosphere
*POM-2B Indus Slope 525 300 300 Paleoclimate history of past 2
biosphere
*POM-3 Indus slope 1350 525 525 Paleoclimate history of past 3.5
biosphere
*MR-1 N Murray Ridge 1840 400 400 Condensend Quat. section,
23°18.4'N/63°48.5'E Mioc. to Hol. climate and OMZ
fluctuations, deep biosphere
MR-2B S Murray Ridge 1910 300 300 see MR-1
22°15.75'N/63°20.2'E
*MR-3B S Murray R. 2385 350 350 see MR-1
22°19.7'N/63°04.8'E
*MR-4B N Murray Ridge 1200 500 500 Complete Mioc. to Hol. climate
23°29.3'N/65°21.4'E and OMZ fluctuations, deep
biosphere
MR-4C N Murray R. 1200 400 400 see MR-4A
23°30.65'N/65°22.15'E
*MR-6B N Murray R. 890 80 80 see MR-1
23°32.43'N/65°19.1'E
MR-6C N Murray R. 1020 80 80 see MR-1
23°29.4'N/65°17.5'E
*high-priority
sites
Proposal Name North Arabian Sea Monsoon
Summary
ISP Objective Environmental Change, Deep Biosphere
To study: Late Neogene evolution of millennial-scale variations in OMZ intensity, Biogeochemical cycles, Deep Biosphere,
Scientifc Purpose(s) Astronomical pacing of the Indian monsoon during long-term global cooling, and Tectonic-scale paleoceanographic and
climate changes
Vessel Riserless
Lithology Hemipelagic sediments: organic-rich clay to marl, nanno- to foram ooze/clay, silt and sand
Operational Risks Hydrocarbon potential at the Indus slope POM sites
Environmental Constraints Favorable weather window from September to May
Drilling/Coring POM sites triple APC/XCB coring.
Logging Standard logging suite
Special Considerations Hydrocarbon monitoring required at POM sites
Technical Issues
Costs scale
Milestones
Forwarded to OTF: rank Mar 06
SSP Classification Sep 05
EPSP Site Approval ?
OTF Scheduled
SAS / OTF History
Oct-01 FULL4
iPC Feb-02 Not ready for ranking
Apr-03 FULL4
iSSEPs May-03 Submit revised full proposal
Proposal Name North Arabian Sea Monsoon
Apr-04 FULL5
SSEP May-04 Revise Full5
SSP Aug-04 All sites classified as 2B
SSP Feb-05 All sites classified as 1A
Apr-05 FULL6
SSEP May-05 Send out for external review
SSP Sep-05 All sites classified as 1A
SSEP Nov-05 Forward to SPC
SPC Mar-06 SPC Motion 0603-21: Forward to OTF for scheduleling in Group I. Ranked 5th out of 17.
OTF Jun-06 Included in scenerios 1 and 2
552-Add
Title: Neogene and late Paleogene record of Himalayan orogeny and climate: a transect across the
Middle Bengal Fan.
Proponent(s): Christian France-Lanord1, Volkhard Spiess2, Peter Molnar3 and Joseph R Curray4
1: CRPG-CNRS, 15 rue Notre Dame des Pauvre, 54501 Vandoeuvre, France, cfl@crpg.cnrs-nancy.fr
2: Dept. of Earth Science, Bremen University Klagenfurter Str., 28359 Bremen, Germany a13g@uni-bremen.de
3, Dept. Geological Sci. CIRES-UC Boulder Campus Box 399 Boulder, CO80309 USA molnar@terra.colorado.edu
4, Scripps Institution of Oceanography, La Jolla, CA 92093-0220 - USA jcurray@ucsd.edu
Keywords: Turbidites , Monsoon, Channel levee, Source to Sink Bay of Bengal

Area:
(5 or less)
Contact Person: Christian France-Lanord
Department: CRPG
Organization: CNRS
Address 15 rue Notre Dame des Pauvres BP 20, 54501 Vandœuvre les Nancy - FRANCE
Tel.: 33 (0) 83 59 42 20 Fax: 33 (0) 83 51 17 98
E-mail: cfl@crpg.cnrs-nancy.fr
Proposal 552 is to drill a transect of holes in the Bay of Bengal to address interactions among the growth of the
Himalaya and Tibet, the development of the Asian monsoon, and processes affecting the carbon cycle and global
climate. Because sedimentation in the Bengal Fan responds to both climate and tectonic processes, its terrigenous
sediment records the past evolution of both the Himalaya and regional climate. The histories of the Himalaya/
Tibetan system and the Asian monsoon require sampling different periods of time with different levels of
precision. Accordingly, we propose a transect of six holes in the fan at 8°N with two complementary objectives:
(1) The early stages of Himalayan erosion, which will bear on the India-Eurasia collision and the development of
the Himalaya and Tibet as topographic features. We propose a deep hole (MBF-3A ~1500m) in the west flank of
the Ninetyeast Ridge where a reflector interpreted as a Paleocene-Eocene unconformity could be reached at a
reasonable depth.
(2) The Neogene development of the Asian monsoon and its impact on sediment supply and flux. We propose an
east-west transect at 8°N composed of MBF-3A plus two drill sites, each of ~900 m penetration (MBF-1A and
2A), to reach sediment at least as old as 10-12 million years. Records from the Arabian Sea and the Indian
subcontinent suggest that at ~7-8 Ma the intensity of the monsoon increased and C4 plants expanded. Moreover,
they appear to be linked to changes in the erosional regime as recorded by Leg 116, and possibly to the tectonic
evolution of southeast Asia. This transect will allow the study of the extent to which a strengthening of the
monsoon encompassed the Bay of Bengal, where increased rainfall, not strengthened wind characterize the
monsoon, and will allow quantitative studies of the interrelations of climate change and sediment accumulation.
In addition three Sites (MBF-4A to -6A) will allow to determine, how the depocenter migrates across this transect
during the last million year and to ensure complete recovery of channel-derived terrigenous material through this
time interval.
In this addendum we comment the status of the Site Survey data and we present new data on the modern river
system and on DSDP Site 218, which we believe support the proposed approach.
552-Add
The proposal 552 addresses the general objective to understand how the Himalayan-Tibet orogenesis interacts with
the earth climate. This includes forcing of the climate due to paleogeographic evolution and atmospheric CO2 uptake
as well as retroaction of the monsoon climate on the tectonic via erosion. Because the Bengal Fan has accumulated
most of the Himalayan erosion flux since the continental collision, it represents the most complete record of both the
uplift and erosion history of the Himalaya and of the monsoon climate. Sediments will document (1) uplift history
through erosional flux and deposition patterns and detailed geochronology of minerals, (2) Himalayan evolution from
isotopic tracing of particle origin and age, and (3) environmental and climate conditions through sediment
granulometry, mineralogy and geochemistry, organic matter composition and d18O of microfossils. A reliable
quantification of erosional fluxes over the Neogene is essential to assess the role of the Himalayan erosion on the
global carbon cycle. The Leg 116 in the distal fan has shown major variations of these proxies over the Neogene and
the proposed Leg should allow to test their regional representativeness. The proposed transect at 8°N will allow to
construct a complete record of the Neogene Himalayan erosion and monsoon and to complete the present record of
Himalayan erosion beyond the Miocene.
Proposed Sites:
(m) Sed Bsm Total
MBF-1A 8°0.42’N / 86°16.97E 3747 900 0 900 Neogene history

MBF-2A 8°0.4N / 87°38'E 3678 900 0 900 Neogene history

MBF-3A 8°0.4N / 88°41'E 3620 1500 0 1500 Neogene history

Early fan history
MBF-4A 8°0.4N / 86°47.9E 3694 300 0 300 Depocenter migration

Proposal Name Bengal Fan
Summary
To address interactions among the growth of the Himalaya and Tibet, the development of the Asian monsoon, and
processes affecting the carbon cycle and global climate.
Vessel riserless
Operation Time Estimate 50 days (including transit)
Lithology Mud turbidites
Operational Risks potential shallow gas
Environmental Constraints Monsoon season
Drilling/Coring Drill transect of 6 sites using single APC coring to 200m, XCB to 900m, RCB to termination depth.
Logging 2 logging runs at each deeper site MBF-1A to 3A with the standard tool and the FMS/Acoustic tool
Technical Issues Proponents question need for more extended logging program - Proposal asks for panel advice on this issue.
Costs scale
Milestones
EPSP Site Approval
OTF Scheduled
SAS / OTF History
Oct-01 FULL3
iSSEPs Nov-01 Submit an addendum including site survey data when available
Readiness: 3B
Notes & iSSP Consensus: Required site survey data sets are still not exist in the databank. iSSP recommends to
iSSP Jul-02 submit the available data to the databank and improve the figure in the proposal. iSSP also encourages proponents to
collect more background data including the cross seismic lines and piston cores.
Proposal Name Bengal Fan
iSSP Jul-03 Sites classified as 2A
Oct-03 FULL3/ADD
SSEP Nov-03 Send out for external review
SSP Feb-04 Site readiness ranked as: 2C
SSP Aug-04 Site readiness ranked as: 2C
Site readiness classification of: 2B (MCS crossing line for MBF3A is requested)
SSP Feb-05 (high-resolution sub-bottom profiling is recommended)
SPC Mar-05 SPC Consensus 0703-13: Ranked 4 out of 9 (top 3 were forwarded to OTF).
SSEP Mar-05 Send out for external review again
SPC Motion 0603-21: Forwarded to SPC in Group II, ranked 8 out of 17. The SPC retains hold of Proposal because
SPC Mar-06 of notable deficiencies in the site survey data.
OTF Jun-06 Included in scenerios 1 and 2 for FY09/10 operations
All sites classified as 2Ab
SSP Jul-06 Notes: Depth of deep hole not defined well, Avoid channels in other sites.
SSP Feb-07 All sites classified as 1Aa.
SPC Mar-07 SPC Consensus 0703-13: Forward to OTF ranked 4 out of 15 in Group I
Received 1-April-2003
553-Full2
Title: Gas Hydrates on the Cascadia Margin
Proponent(s): Michael Riedel, Roy D. Hyndman, Earl E. Davis, Tim S. Collett, Douglas Bartlett,
Miriam A. Kastner, George D. Spence, and Scott R. Dallimore
Keywords: Gas hydrates, fluid expulsion, accretionary prism Vancouver Island
Area:
(5 or less) Margin
Contact Person: Michael Riedel
Department: Pacific Geoscience Centre
Organization: Geological Survey of Canada
Address 9860 West Saanich Road
Tel.: 1 250 363 6451 Fax: 1 250 363 6565
E-mail: mriedel@pgc-gsc.nrcan.gc.ca
Permission to post abstract on iSAS Web site: x Yes No

This proposal is for an IODP program to constrain models for the formation of marine gas hydrate in subduction
zone accretionary prisms. The objectives include the deep origin of the methane, its upward transport, its
incorporation in gas hydrate, and its subsequent loss to the seafloor. The main attention is on the widespread
seafloor-parallel layer of dispersed hydrate located just above the base of the stability field. Such layers may make
up the largest volume of hydrate globally. In the model, methane is carried upward through regional grain-scale or
small-scale fracture permeability, driven by the tectonic consolidation of the accretionary prism. Also important is
the focusing of a portion of the upward methane flux into localized plumes or channels to form concentrations of
near-seafloor hydrate. The amount of hydrate in local concentrations near the seafloor is especially important for
understanding the response of marine hydrate to climate change. Long-term monitoring in the boreholes will assist
in determining the role of shaking in the sediment consolidation, episodic upward fluid transport, and hydrate
formation. The proposal is for drilling, downhole measurements, and long-term recording at a transect of sites
across the Northern Cascadia accretionary prism. The sites will track the history of methane in an accretionary
prism from: (1) its production by mainly microbiological processes over a thick sediment vertical extent, (2) its
upward transport through regional or locally focused fluid flow, (3) its incorporation in the regional hydrate layer
above the BSR or in local concentrations at or near the seafloor, to (4) methane loss from the hydrate by upward
diffusion, and (5) methane oxidation and incorporation in seafloor carbonate, or expulsion to the ocean.
The proposal builds on the previous Cascadia hydrate drilling of Leg 146 in the area and on more recent Leg 204 off
Oregon. Important facilities for this proposal include, (1) the now well-developed CORK downhole monitoring, (2)
Log-While-Drilling (LWD), (3) Distributed Temperature Sensors (DTS), and (4) Pressure Core Barrel sampler for
hydrate, free gas, and fluid recovery under insitu conditions.
553-Full2
The proposal follows the goals for gas hydrate drilling of the ODP Gas Hydrates Program Planning Group, i.e., (1)
Study the formation of natural gas hydrate in marine sediments; (2) Determine the mechanism of development,
nature, magnitude and global distribution of gas hydrate reservoirs; (3) Investigate the gas transport mechanism, and
migration pathways through sedimentary structures, from site of origin to reservoir; (4) Examine the effect of gas
hydrate on the physical properties of the enclosing sediments, particularly as it relates to the potential relationship
between gas hydrates and slope stability; (5) Investigate the microbiology and geochemistry associated with hydrate
formation and dissociation.
These scientific goals are an expansion of the latest achievements of ODP Leg 204, dedicated to study gas hydrates at
Southern Hydrate Ridge (Trehu et al., 2002). Leg 204 was entirely focused on the specific structure of Hydrate Ridge
and has only limited potential for applications at different continental margins.
The objectives of this proposal are to test gas hydrate formation models and constrain model parameters, especially
models of hydrate concentration through upward fluid and methane transport. These objectives require:
(1) High quality data on the vertical concentration distributions of gas hydrate and free gas, and variation landward in
the accretionary prism.
(2) Estimates of the vertical fluid and methane fluxes through the sediment section, as a function of landward distance
from the deformation front.
Proposed Sites:
(m) Sed Bsm Total
CAS-04B 048 34 N 2600 500 0 500 Site will provide important
127 10 W reference information about the
sediments that do not contain
gas and/or gas hydrate.
CAS-03B 048 37.15 N 2000 400 0 400 Characterize fluid expulsion

127 03.45 W and related hydrate formation
CAS-02B 048 38.57 N 2150 400 0 400 Characterize fluid expulsion

127 00.00 W and related hydrate formation
CAS-01B 048 41.98 N 1400 600,400, 0 600 Dual ACORK experiment

126 52.10 W 400
CAS-05B 048 46.00 N 1100 0 350 Last Site along transect,

126 43.45 W 350 shallowest BSR occurrence
CAS-06A 048 40.00 N 1400 0 350 Vent field, focused fluid flow
126 51.00 W 350 and near-seafloor hydrate
formation
CAS-07A 049 11.00 N 2600 0 600 Nootka fault, earthquake

127 52.00 W 600 induced fluid expulsion
Proposal ID 553 -Full2
Proposal Name Cascadia Hydrates (2nd Expedition)
Summary
(1) Study the formation of natural gas hydrate in marine sediments; (2) Determine the mechanism of development, nature,
magnitude and global distribution of gas hydrate reservoirs; (3) Investigate the gas transport mechanism, and migration
pathways through sedimentary structures, from site of origin to reservoir; (4) Examine the effect of gas hydrate on the
physical properties of the enclosing sediments, particularly as it relates to the potential relationship between gas hydrates
and slope stability; (5) Investigate the microbiology and geochemistry associated with hydrate formation and dissociation.
Water Depth 1100 -2600 m
Vessel Riserless
Operation Time Estimate 75 days (including port call and transit)
Lithology Interbedded clayey silts and fine to medium-grained sands
Operational Risks Hydrates, hole stability, carbonate formations on seafloor
Environmental Constraints Summer weather window
Drilling/Coring Drill 6 sites using triple APC to refusal, XCB and RCB if needed. LWD in Hole A, Coring/logs in Hole B
CAS-04B: Standard logging tools, LWD + use of the DVTP. CAS-07A: LWD and ACORK installation. Others: standard
Logging
logging, LWD, use of DVTP, PCS, MDT, VSP, and installation of permanent DTS.
Limitations / Assumptions ACORK design not well defined, cross hole testing not well defined, microbiology undefined
Canadian clearance required, Sail ACORK engineer, Marine Mammals, Modular Formation Dynamics tester requires large
diameter pipe, reconcile with Exp. 311 adjustments
Installation of DTS requires infill with low viscous mud to prevent hole-circulation - detailed technology is under
Technical Issues
development
CORK description (if app) standard ACORK
Costs scale CORKs and MWD/LWD
Milestones
SSP Classification Aug 04
EPSP Site Approval
OTF Scheduled
SAS / OTF History
FULL
Readiness: 2A
Notes & iSSP Consensus: Data from 146 and data (3D) have not yet been submitted. The consensus remains that the Leg
iSSP Jul-02 146 site survey data does not fulfill all site-survey requirements for this new proposal; a new site survey data package
should be submitted to achieve 1A status.
iPC Aug-02 iPC Consensus 3-13: not ready for ranking
iSSEPs May-03 Send out for external review
Apr-03 FULL2
SPC Motion 03-09-34: ...SPC also identifies the non-A-CORK component of 553-Full2 Cascadia Margin Hydrates
as an alternate first expedition in case any significant delays arise in the logistical planning for
Proposal 545-Full3.
SPC Sep-03
Ranked 6th out of 16 (top 5 forwarded on)
...risk of trying to conduct two challenging projects such as Juan de Fuca (545-Full3) and Cascadia in a row at the
beginning of operations.
SSP Feb-04 Sites characterized as 1A (CAS-4B, 5B, 6B), 1B (CAS-1B), and 1C (CAS-2B, 3B, 7B)
EPSP Jun-04 Challenges identified include: hydrates

Proponents to provide fully revised safety package; proponents will need to present any plans for LWD during the
expedition; Proponents should consider the selection of alternate sites beyond the required standoff distance in case the
operator is unable to secure approval from Canadian Government
SSP Aug-04 Sites characterized as 1A (CAS-2,3,4,5,6,7B), 1B (CAS-1B & CORK), and 1C (CAS-3Balt, 6Balt)
SPC Consensus 0410-36: ...The committee also recommends the remainder of Proposal 545-Full3 Juan de Fuca Flank
SPC Oct-04 Hydrogeology or Proposal 553-Full2 Cascadia Margin Hydrates as a backup for Proposal 477-Full4 Okhotsk and Bering
Seas Paleoceanography, Part 1.
Proponents to provide the latitude/longitude for the relocated drilling sites: CAS-02C at the crossing of MS89-08 and CAS-
02B-05-04; CAS-05C at the crossing of MS89-08 and CAS-05C-03. Operator will initiate the permitting process. If
permitting problems develop with the approved locations of Sites CAS-06A and CAS-06B the panel will re-visit the “cold
seep” site locations within the “blank-zone” and determine whether an acceptable site can be located.
Jack Baldauf to determine who would fund any supplemental data acquisition if required by EPSP for safety review but not
previously required for scientific review.
§ Jack Baldauf to check with the Canadian authorities if there are any environmental restrictions that might impact drilling
in the cold seep location.
§ Barry Katz will check if there are any IODP restrictions on drilling in the vicinity of seep communities.
EPSP Dec-04
§ Proponent will need to determine if the proposed location CAS-05B is outside of the currently defined munitions dump
site.
§ Proponent will need to prepare displays that show the results and a data comparison for Sites 889/890 and proposed
location CAS-01B and CAS-01C. A similar display needs to be made for Site 892 and proposed location CAS-06B.
§ Proponent needs to redisplay data used to support CAS-06B at an expanded horizontal scale.
§ As a result of poor imaging the panel has requested that the proponent complete the processing of the available multi-
channel data prior to the review.
§ Proponent will need to advise the Chair by April 15th whether the required actions can be completed in time for assembly
and distribution of the safety packages for the June PPSP meeting
1 site approved, 9 sites deferred (see action items above).
them to consider in developing drilling schedule scenarios for FY2006 and beyond. This group includes: 553-Full2....To
evaluate further the status of the unscheduled portions of Proposal 553-Full2 and 589-Full3, the SPC requests progress
reports on Expeditions 308 Gulf of Mexico Hydrogeology and 311 Cascadia Margin Gas Hydrates at the October 2005
SPC meeting.
SPC Mar-05 SPC members nominated several or more prospective candidates as potential co-chief scientists
Included in initial schedule. OTF thought it important to finish this up - it’s a high priority proposal, however, Cascadia may
not be a full expedition (depending on operations finished on previous Cascadia operations).
OTF Jun-05
Operational requirements need to be finalized.

Discussions have commenced with the lead proponent to better define the observatory requirements for Cascadia. A
specific implementation strategy is currently not available for the proposed CORKS. Costing will be based on what is
OTF Oct-05 known with assumptions identified. The preferred weather window is July – August.
finishing Cascadia may not be feasible in FY08 given the complexity (cost) of observatory operations
Becker noted that the proponents submitted a formal addendum describing what remains from the original proposal. He
SPC Mar-06 suggested leaving it with the OTF for scheduling at the earliest opportunity.
OTF considered inserting Cascadia into the program instead of Bering Sea (similar weather windows). However, this
change would result in three SODV CORK expeditions in a row (NanTroSEIZE, Cascadia, Juan de Fuca). The budgets
OTF Jun-06 would be too extensive and USIO personnel too limited to deliver three “complex” programs such as these in one Fiscal
Year. In addition, Cascadia would require a long transit after NanTroSEIZE and thus a loss of “Science”
days, whereas conducting Bering Sea operations in this time slot allows for science to be conducted as the ship moves
across the Pacific after NanTroSEIZE.
SPC Aug-06 SPC Scientific Assessment of IODP Expedition 311 Cascadia Margin Gas Hydrates was presented
Received 18 December 2005
555-Add2
Title:
Backstop hydrogeology of a wide accretionary complex south of Crete, Eastern Mediterranean Sea
Proponent(s): A. Kopf1,*A.H.F. Robertson2, E.S. Screaton3, J. Mascle1, R.J. Parkes4, J.P. Foucher5, G.J. De
Lange6, B. Stöckhert7, D. Sakellariou8
Keywords: accretionary complex, fluid flow, backstop, mud volcanism,
Area: Mediterranean
(5 or less) Mediterranean Ridge
Contact Person: Achim J. Kopf
Department: Research Centre Ocean Margins
Organization: University of Bremen,FB5
Address LeobenerStrasse
Tel.: +49 421 218 65800 Fax: +49 421 218 65805
E-mail: akopf@uni-bremen.de
We propose to drill a transect of three sites south of Crete (E. Mediterranean) from the distal part of the
Mediterranean Ridge accretionary prism across its backstop. Following geophysical surveys and analog modeling,
drilling a backstop setting is now essential to elucidate fundamental deep fluid flow processes and deformation
mechanisms in a landward accretionary prism and its backstop. This single leg approach builds on successful
campaigns at the toes of Barbados or Nankai, but addresses out-of-sequence thrusts (OOSTs) further landward
which have been demonstrated to have high fluid flux rates. The variability in fluid flow across the wedge to its
backstop strongly influences fluid budgets of the accretionary complex, and the entire subduction factory.
Specifically, dewatering along hinterland backthrusts could diminish fluid available for migration along the
accretionary décollement, and may hence affect chemical backflux into the hydrosphereas well as frictional
properties of the subduction thrust. As a backstop has never been drilled before, we aim to shed light on (1) mass
and fluid transfer at an accreting convergent margin, (2) the significance of spatial variability of fluids from
mineral dehydration and diagenetic alteration at depth, and their interaction with the rock, (3) the control of
seismicity by physical properties, and (4) deep biological activity near the up-dip limit of the seismogenic zone, to
be contrasted with study of living bacteria within more shallowly buried organic-rich sediments (sapropels) in the
same area. The area south of Crete is selected because the backstop setting is well imaged on quality seismic
profiles, accessible to drilling, and comprises lithologies of different rheology, age and origin. The existence of the
backstop is a consequence of a short-lived cycle of subduction slab breakoff, uplift and thrusting, accompanied by
normal faulting within the forearc-high (Crete) and accretion further south (Med. Ridge). Deformation processes
are accentuated due to collision of Africa with Eurasia, so that the accretionary prism is characterized by active
backthrusting, fluid venting, chemo-bioherms, and m0ud volcanism. Each of the three proposed sites will penetrate
a deep-seated fault whose fluids act as windows down to several km depth. Fluid chemistry will be indicative of
enhanced dewatering reactions (diagenesis, mineral dehydration) and deep biological processes. We envisage an
initial leg of mainly conventional drilling, with some logging, a Packer test, and one conventional CORK, the latter
of which would help define and quantify variations in fluid flow and microbial activity across the faulted backstop
through time.
555 – Add2
With drilling the distal wedge and backstop of the fast-growing Mediterranean Ridge accretionary complex, the
following hypotheses will be tested:
1. The backstop is an important area of fluid flow from deep décollement depths (c5 km), volumetrically sufficient to
affect mass balances of fluid flow in accretionary prisms;
2. Low-Cl, but otherwise geochemically mature fluids are expelled in the backstop region and provide a window to
the deep plate boundary thrust (e.g. via mud volcanoes);
3. Deep-living bacteria exist in the fluids and sediments and provide a window into life at decollement depths (c5
km);
4. Advanced dewatering and commensurate chemical and biogeochemical changes occur deep within the backstop
setting, influencing the mass/fluid wedge as a whole.
5. The backstop comprises older "non-rigid" accreted sedimentary rocks (including brine-type, upper Miocene pore
fluids!), thrust over a "rigid" basement of units correlated with the Cretan nappes onland;
6. Crustal "roll-back" (extension) is currently taking place along the northern margin of the backstop, co-existing with
compressional deformation (including backthrusts) further south, and represents a viable model to explain the
exhumation of high-pressure rocks in the Cretan forearc-high.
Proposed Sites:
(m) Sed Bsm Total
BUTT-1 34°N 18.6 2486 ~900 ~900 characterize backstop
24°E 54.3 sedimentary rock and contact to
HP/LT thrust sheets of forearc
high (Crete), and fluid flow and
deep biosphere along OOST
BUTT-2 34°N 17.1 2540 ~900 ~900 drill backthrust between

24°E 11.9 northernmost Med. Ridge
(inner ridge) and forearc high,
characterize fluid flow,
geochemistry, deep biosphere,
etc.
BUTT-3 33°N 51.3 1920 ~800 ~1200 drill active backthrust fault and
24°E 34.1 - (A) mud volcano to study fluid
2080 flow, deep biosphere, rocks in
~200 the prism (using the mud
(B, C) volcano as tectonic "window"
to the deep décollement)
Proposal Name Cretan Margin
Summary
Learn more on (1) mass and fluid transfer at an accreting convergent margin, (2) the significance of spatial variability of
Scientifc Purpose(s) fluids from mineral dehydration and diagenetic alteration at depth, and their interaction with the rock, (3) the control of
seismicity by physical properties, and (4) deep biological activity near the up-dip limit of the seismogenic zone, to be
contrasted with study of living bacteria within more shallowly buried organic-rich sediments (sapropels) in the same area.
Max Drill Depth 1200m
Vessel Riserless
Lithology PlioQuarternary hemipelagic ooze, platform carbonates, accreted clays/mudstones
Operational Risks Possible hazards include: hydrocarbons, fractured zone, fault, soft sediment, diapir and mud volcano
Environmental Constraints spring and autumn are desirable but not necessary
BUTT-1 and BUTT-2: APC to refusal, then XCB/XRB; BUTT-3: Double APC to refusal, also PCS sampling in certain
Drilling/Coring
intervals, then XCB, XRB- CORK desired at this site
Standard logging, possible packer, temperature measurements, and PCS sampling for gas/fluid geochemistyr and
Logging
biosphere
Technical Issues
CORK description (if app) One conventional CORK is desired
Costs scale *European Comission may fund the conventional CORK
Milestones
EPSP Site Approval
OTF Scheduled
Proposal Name Cretan Margin
SAS / OTF History
Apr-02 FULL3
iSSEPs Jun-02 Send in addendum
Oct-03 FULL3/ADD
SPC Consensus 0406-15: Ranked 13 out of 15 and forwarded to OTF in Group III. Group III includes the lower four
SPC Jun-04 proposals (#11-14). The committee recommends considering these proposals as alternatives only if those in Groups I and
II cannot fill the schedule.
EPSP Jun-04 Challenges identified include: Deep penetrations/mud volcanoes
SPC Mar-05 Ranked 9th out of 9.
SPC Motion 0603-21: Forwarded to OTF in Group II, ranked 12th out of 17. The SPC however holds onto 555 due to
SPC Mar-06
incomplete site survey data
OTF Jun-06 Included in scenerios 1
SPC Consensus 0703-11: The SPC defines the pool of proposals to be ranked for FY2009 and beyond as including 15 of
the 18 proposals reviewed at this meeting. The three exceptions are: 555-Full3 (Cretan Margin), 667-Full (NW Australian
Shelf Eustasy), and 535-Full5/Add2 (Atlantis Bank). The SPC excludes Proposal 555-Full3 (Cretan Margin) from this
year’s ranking pool in response to the proponents’ request to allow them to fully analyze recently acquired site survey data
SPC Mar-07
and refine site characterization. It is expected that this proposal will be ready to rank at the next SPC proposal-ranking
meeting.
555-Full3 is withheld from the ranking at the request of the proponents to allow them more time to work up recently
acquired site survey data.
Received 8 December 2005
564-Add
Title: Global Sea Level and the Architecture of Passive Margin Sediments: Shallow-Water
Drilling of the New Jersey Continental Shelf
Proponent(s): K.G. Miller, G.S. Mountain, N. Christie-Blick, J.A. Austin, C.S. Fulthorpe, P.J. Sugarman
Keywords: Sea Level, New Jersey Shelf NW Atlantic

Area:
(5 or less)
Contact Person: Gregory Mountain
Department: Geosciences
Organization: Rutgers University
Address Wright Labs, 610 Taylor Rd., Piscataway, NJ 08854 USA
Tel.: 732-445-0817 Fax: 732-445-3374
E-mail: gmtn@rci.rutgers.edu
We propose to drill three sites on the inner continental shelf of New Jersey to estimate amplitudes and
rates of Cenozoic global sea-level (eustatic) change and to evaluate the response of passive continental
margin sedimentation to such eustatic changes. These sites will provide continuous recovery of
siliciclastic sequences on a modern continental margin at locations chosen to provide definitive measures
of sea-level amplitudes and to evaluate models of sedimentation and facies distribution. This will be the
culmination of many years of effort in implementing "The New Jersey/Mid-Atlantic Sea-Level Transect"
(MAT) strategy developed and endorsed by several advisory and review bodies. Prior MAT drilling has
focused on the New Jersey slope (ODP Legs 150, 174A), outer shelf (ODP Leg 174A), and onshore
(ODP Legs 150X, 174AX). Collectively these efforts have been successful in providing ages of
sequence boundaries and tying each to the 18O proxy of glacioeustasy, yet have fallen short of the
ultimate objectives because facies that register the most sensitive record of sea-level change, the paleo
inner shelf, have not been continuously sampled. Consequently, a critical gap remains in the MAT
concerning our knowledge of global sea-level change and its imprint on the stratigraphic record. We
propose to obtain continuous cores and downhole logging measurements within crucial paleo inner shelf
facies using a mission-specific drilling platform. The sites we propose, MAT 1-3, are the most sensitive
and accessible locations of a transect of drillsites designed to measure amplitudes and test facies models.
By integrating our results with those derived from other sections in both shallow water and the deep sea,
we anticipate that coring and logging at MAT1-3 will allow us to: 1) provide estimates of eustatic
amplitudes and generate a testable record of eustatic variations; 2) evaluate the effects of eustasy,
tectonics, and sediment supply on the stratigraphic record; and 3) test models that predict the nature and
distribution of sedimentary facies in passive margin strata.
564-Add
Drilling on the New Jersey margin has shown that buildups of high latitude ice since the Oligocene drove sea-level
changes that left a significant imprint on the sedimentary record of this and other passive margins. But the existing
records are either so deep (on the continental slope) that amplitudes of these sea-level changes are impossible to
determine, or so far updip (on the coastal plain) that only the highstand interval of sedimentation is preserved. Sites
MAT1-3 will recover as nearly a complete set of late Oligocene-early Miocene sequences as possible and provide
ages, paleodepths, and porosities at crucial locations straddling clinoform geometries mapped with hi-res MCS
profiles. Two-dimensional backstripping (e.g., Watts and Steckler, 1979; Kominz et al., 1998; Steckler et al., 1999)
will build on this information to calculate amplitudes of changes in global sea level after the effects of compaction,
paleowater depth, flexural loading and tectonic subsidence have been determined. Logging, both wireline and
LWD, will provide a complete record of vertical facies successions. When coupled with our grid of hi-res MCS
profiles this will establish facies associations within clinoform geometries and allow us to evaluate the several factors
controlling siliciclastic sedimentation on passive continental margins.
Mission-specific drilling platform (e.g., jack-up rig)
Proposed Sites:
(m) Sed Bsm Total
age, facies, paleobathymetry of
surfaces correlated with the
Lon °N Lat °W following sequence boundaries:
*MAT-1A 39.634091 73.621646 32 762 0 762 m1, m4, m5, m5.2, m5.3, m5.4,
MAT-1B 39.635066 73.620800 32 762 0 762 m5.5, m5.6, m5.7, m6 and o1
MAT-1C 39.639419 73.616619 32 762 0 762
*MAT-2A 39.590003 73.541421 40 762 0 762 m1, m4, m5, m5.2, m5.3, m5.4,
MAT-2B 39.589186 73.524123 36 762 0 762 m5.5, m5.6, m5.7, m6 and o1
MAT-2C 39.582656 73.524600 37 762 0 762
*MAT-3A 39.519533 73.413238 34 762 0 762 m1, m4, m5, m5.2, m5.3, m5.4,
MAT-3B 39.514094 73.418144 34 762 0 762 m5.5, m5.6, and m5.7
MAT-3C 39.525037 73.408025 34 762 0 762
* Primary Site
Proposal Name New Jersey Sea Level
Summary
To: 1) estimate amplitudes, rates and mechanisms of global sea-level (eustatic) change; and 2) evaluate the response of
passive continental margin sedimentation to eustatic changes. MAT 1-3 represent the most sensitive and accessible
Scientifc Purpose locations for bringing the NJ Transect to a successful conclusion.
Water Depth 32-35 m
Max Drill Depth 752 m (sediment drilling)
Vessel MSP
Lithology medium to coarse sand, ± pebbles and shell fragments, sandy mudstone, mudstone, marly chalk, limestone
Operational Risks Shallow gas, soft seabed
Environmental Constraints Jun - Aug best, can be extended to Oct, however Sep - Oct is hurricane season
Drilling/Coring Push/rotary core to TD from jack-up in one hole, cased as needed.
Logging in second dedicated hole (preferred) or in cored hole if possible. LWD includes Density-Neutron, Resistivity-
Logging Gamma Ray, and Acoustic measurements
Special Considerations Mammal watcher, Vessel availability
Technical Issues
3rd Party Requirements Geotechnical Survey, MSP,
Costs scale LWD, jackup and geotechnical survey
Milestones
Forwarded to SPC Jun02
Forwarded to OTF: rank Sep03: 4th out of 16
SSP Classification Jul03
EPSP Site Approval
OTF Scheduled Jun05
Call For Staffing Deadline Feb06
Co-chiefs Selected
Project Scoping Meetings
Pre-Cruise Meetings
Scientific Prospectus
Clearance / Permits Obtained Geotechnical Survey May07
Exp. Offshore Operations
Exp. Onshore Party
Preliminary Report
Post-Cruise Sampling Party
Co-chief Exp. Synthesis Paper

Post-Cruise Editorial Review
Post-Cruise Scientific Review
Initial Results Volume
Core Storage
End of Moratorium
ORTF
Scientific Results Volume
SAS / OTF History
Jun-01 FULL
Sites MAT-1, MAT-2, MAT-3: 1B, feasible for drilling in 2004
Jul-02 Notes & iSSP Consensus: Data need to be better organized at DB, hopefully
iSSP before February 2003
A detailed shallow gas hazard survey will need to be conducted, with the interpretation provided by an independent
Dec-02 contractor. A shallow water hazard summary including sub-bottom profile and magnetometer or ROV surveys for man-
iPPSP made obstructions is also required.
Prior to the final review the panel requests that the following be made available: · An independent assessment of the
Jun-03 distribution and risk of shallow gas; Side-scan sonar over the sites to examine for possible surface hazard. If these data
are unavailable, the panel will consider granting approval with the stipulation that a visual (ROV) inspection be made prior
iPPSP to final positioning; and · A map of subsurface channel distributions with proposed site locations.
iPPSP Jun-03 Any required permitting by MMS is the responsibility of the operator.
The panel recommended that alternate sites be proposed and that the sites be located on the hazard survey line
Jun-03 crossings.
iPPSP
Proposal 564 (new Jersey Margin) is not ready at the moment but the issues are not major. The panel discussed the e-
Jul-03 mail reviews for low risk proposals. Sites classified as 1A
iSSP
SPC Motion 03-09-36: The SPC recommends that the ECORD develop an operational plan
as soon as feasible for Proposals 519-Full2 South Pacific Sea Level and 564-Full New Jersey
SPC Sep-03 Shelf, in light of their respective global rankings of #1 and #4 at this meeting.
SPC Motion 03-09-37: Ranked 4th out of 16 and forwarded to OTF.
EPSP Jun-04 Challenges identified include: shallow gas
them to consider in developing drilling schedule scenarios for FY2006 and beyond. This group includes: 564-Full
New Jersey is currently scheduled for FY06 operations. If it does not occur in FY06 it would be the prime candidate for
OTF Jun-05 FY07 MSP operations.
OTF recommends that ESO move the New Jersey program to FY07 if SPC deems that three holes are required for the
OTF Oct-05 New Jersey Margin operation and ECORD cannot secure funds in FY06 for a 3-hole program.
SPC Consensus 0510-24: The SPC reaffirms the necessity of drilling a three-site transect (MAT-1, -2 and -3) on the New
SPC Oct-05 Jersey margin as a requirement to achieve the scientific objectives of Proposal 564-Full New Jersey Shallow Shelf. The
drilling of fewer than three sites would compromise the scientific integrity of the project.
It was noted that the EPSP review did not examine geotechnical issues. The nature of the sediment could become an
issue depending on the nature of the platform selected by the operator. The operator will be responsible for making the
EPSP Dec-05 necessary assessments based on platform selection. The panel will provide comments, if necessary or requested.
In order to obtain final drilling approval proponents are required to submit to the EPSP Chair, ESO and to IODP-MI the new
latitude/longitudes, completed safety sheets, and annotated seismic data (crossing lines, and chirp data) for MAT-2D, MAT-
2E, and MAT-2F.
Apr-06 FULL2
SPC Consensus 0603-14: The SPC receives STP Consensus 0601-5 on the initial measurements plan for Expedition 313
New Jersey Shallow Shelf and reaffirms SPC Consensus 0410-20 on measuring sedimentary temperature profiles
wherever feasible on IODP expeditions.
Lovell reviewed STP Consensus 0601-5: The STP received and reviewed the initial measurements plan for the New
Jersey Transect. STP thanks the ESO for a thorough plan. Temperature measurements
SPC Mar-06 were not included in the initial plan, but need to be considered as it is an IODP minimum measurement (note action item
and recommendation above). STP accepts the measurement
plan subject to IODP minimum measurements being met.
SPC Consensus 0603-14: The SPC receives STP Consensus 0601-5 on the initial measurements plan for Expedition 313
New Jersey Shallow Shelf and reaffirms SPC Consensus 0410-20 on measuring sedimentary temperature profiles
wherever feasible on IODP expeditions.
Issues that will need to be resolved include a determination as to whether a jack-up rig will be needed (if so, a geotechnical
EPSP Jun-06 survey will need to be completed), a refined understanding of anthropogenic hazards (cables, unexploded ordinance, etc.)
will need to be made, a determination of water depth (including how water depth was determined) and currents.
The chair also recommended that ESO consider using the geotechnical cores as a means to establish the background
EPSP Jan-07 hydrocarbon level for the hydrocarbon monitoring program to be used during the New Jersey margin. Colin Graham stated
that he will provide to the panel plans on how they plan on using the “sniffer” as a hydrocarbon monitoring tool.
Lovell reported on STP Consensus 0612-03: STP recommends that ESO upgrades its currently used downhole push-in
temperature tool to an absolute accuracy of 0.01°C and a resolution of 0.001°C. This must be accomplished before the
New Jersey Expedition.
SPC Mar-07
In reply to much coversation concerning above STP Consensus 0612-03, Becker read SPC Consensus 0410-20 (“The
SPC receives SciMP Recommendation 0406-9 and recommends wherever feasible measuring the temperature profile at
each sedimentary IODP site.”), and suggested that this statement provided adequate advice for the IODP-MI to act on this
particular case.
New Jersey is delayed due to contracting issues. OTF recommendation is to reschedule in FY08. ESO is investigating
Jul-07 new contracting possibilities.
OTF
581-Full2
Title:
Latest Pleistocene drowned coralgal banks and mounds along the edge of the South
Texas and Mississippi continental shelves
Proponent(s):
André W. Droxler (Rice University) and William W. Sager (Texas A&M)
Keywords: Coralgal Reefs and Sea Level, Sea Level History, Last Northern Gulf of
Area:
(5 or less) Deglaciation, Carbonate Drowning Mexico
Contact Person: André W. Droxler
Department: Earth Science
Organization: Rice University
Address P.O. Box 1892, Houston, TX 77251-1892
Tel.: 713 348 4885 Fax: 713 248 5214
E-mail: andre@rice.edu
Southern and Baker Banks are currently drowned coralgal reefs about 40 to 50 m-thick on
the edge of the South Texas Shelf 55 km offshore Corpus Christi. They are interpreted to have
grown during the first half of the last sea level transgression on top of topographic highs
occurring along a Last Glacial Maximum lowstand siliciclastic paleo coastline.
Contemporaneous and similar coral reef establishment, growth, and demise have been reported
along the Mississippi-Alabama shelf margin.
We are proposing to drill and analyze seven 80 to 100 m - deep boreholes, an array of five
boreholes through Southern Bank and a two borehole-transect through Baker Bank and their
siliciclastic substratum. Each borehole in Southern and Baker Banks will include at least two of
the three following sedimentary packages: (1) the siliciclastic substratum of the reefal edifice,
(2) the coralgal sequence itself, and (3) the mud blanket that partially covers the reefal edifices.
In addition a two borehole-transect across similar transgressive banks observed at the edge of
Mississippi-Alabama continental shelf has been integrated to this drilling proposal.
This proposal is a slightly modified version of ODP proposal # 581, submitted in Spring
2000. An addendum to the proposal was submitted in Sept. 2000 as a response to the ESSEP
review. The proposal received three excellent external reviews out of a total of four reviews.
Based upon these reviews, a PRL was submitted a year ago in April 2001. Finally, the proposal
was discussed by SCICOM in Summer 2001.
Although this drilling proposal is submitted based upon its sole scientific merit, this
drilling program should be also considered as an exemplary scientific drilling activity in shallow
water conditions to promote alternate drilling platform as being a full part of IODP. This drilling
program could also be used as a feasibility test in using the highly maneuverable, 190-ft-long
R/V Seaprobe I or Fugro Explorer of Fugro-McClelland as an alternate drilling platform to drill
coralgal edifices in water depths shallower than 120 m.
581-Full2
The detailed description of the different lithologies and depositional environments, the borehole logs, the
geochemical analyses, and U/Th and 14C AMS dating of these nine cored sedimentary sequences will allow us to
develop the following objectives:
(a) The drilled material will shed some new light on the enigmatic findings that coralgal edifices flourished on the
edge of the South Texas and Mississippi-Alabama shelves during the first part of last deglaciation, an interval of
time when conditions of sea surface temperature were and sea surface salinity were expected to be lower in the
Gulf of Mexico, and rates of eustatic sea-level rise much faster than they are today;
(b) The drilled material will improve the resolution of the last deglacial sea-level history from late Glacial to the
Younger Dryas, including the interval of the melt-water pulse 1A, from a passive margin environment less
influenced by discontinuous tectonic activity as in the offshore Barbados,
(c) The drilled material will help us to better understand the sedimentary and biological processes involved with the
origin (initial establishment), growth, and demise of carbonate reef tracts along the edge of siliciclastic shelves.
(d) The latest Pleistocene transgressive coralgal reefs on the edge of the South Texas Shelf can bestudied as recent
analogs for reefal reservoirs buried in siliciclastic shelves.

(m) Sed Bsm Total
Southern Bank N 27 25.0, W 96 31.5
SB-1 SP 1390 MC D4 60 m 100 m 100 m Thickest part of coralgal U. III
SB-2 SP 1315 MC D4 60 m 100 m 100 m Thickest part of coralgal U. III
SB-3 SP 1690 MC D1 62 m 100 m 100 m Thick part of coralgal U. III
SB-4 SP 1510 MC D4 70 m 75 m 75 m Thick part of coralgal U. III
SB-5 SP 1360 MC S4 78 m 70 m 70 m Recover youngest Unit IV on

A back reef position
Baker Bank
BB-1 N 27 45.5, W 96 13.5 60 m 100 m 100 m Thickest part of coralgal U. III
BB-2 N 27 45.8, W 96 13.8 70 m 90 m 90 m Recover youngest Unit IV on

A back reef position
Mississippi-
Alabama
MA-1 N 29 20.205, W 87 90 m 70 m 70 m Early deglacial mound
45.072
MA-2 N 29 26.253, W 87 80 m 70 m 70 m Mid deglacial mound

34.506
Proposal Name Late Pleistocene Coralgal Banks
Summary
(a) Shed some new light on the enigmatic findings that coralgal edifices flourished on the edge of the South Texas and
Mississippi-Alabama shelves during the first part of last deglaciation, an interval of time when conditions of sea surface
temperature were and sea surface salinity were expected to be lower in the Gulf of Mexico, and rates of eustatic sea-
level rise much faster than they are today;
(b) Improve the resolution of the last deglacial sea-level history from late Glacial to the Younger Dryas, including the
interval of the melt-water pulse 1A, from a passive margin environment less
influenced by discontinuous tectonic activity as in the offshore Barbados,
(c) Help us to better understand the sedimentary and biological processes involved with the origin (initial
establishment), growth, and demise of carbonate reef tracts along the edge of siliciclastic shelves.
(d) Provide recent analogs for reefal reservoirs buried in siliciclastic shelves.
Water Depth 60-90 m
Vessel MSP
Operation Time Estimate 13.5 days (drilling and logging estimate)
Lithology Coralgal limestone, coastal sandstone, shelfal shale
Operational Risks None identified.
Environmental Constraints Hurricane season Jun to Nov.
Drilling/Coring Drill 9 boreholes from 80 - 100 mbsf using MDCB (i.e. Fugro Geotechnical System)
Logging Standard suite + borehole televiewer and formation fluid sampling
Special Considerations Need to obtain permission from MMS to drill Southern Bank.
Technical Issues
Costs scale MSP required and some speciality downhole tools requested
Milestones
EPSP Site Approval ?Jun 04
OTF Scheduled
Proposal Name Late Pleistocene Coralgal Banks
SAS / OTF History
Apr-02 FULL2
Sites SB-1, 2, 3, 4, 5: 1A, feasible for drilling in 2004: Sites BB-1, 2 and Sites
MS-1, 2: 3B, not feasible for drilling in 2004 unless a site survey is organized for those sites in the next year or so.
iSSP Jul-02 Notes & iSSP Consensus: the seismic data submitted to the data bank are sufficient for drilling on Southern Bank,
there may be environmental concerns associated with drilling a reef in the Gulf of Mexico, and we suggest the drilling
plan be forwarded to PPSP. See minutes for additional notes.
SPC Sep-03 Ranked 13 out of 16 (the top 11 were forwarded on)
SPC Consensus 0406-15: Ranked 11 out of 15, forwarded to OTF in Group III as an alternate to be scheduled only if
SPC Jun-04 Group I and II can't meet schedule requirements
committee considered limiting the scope or splitting the proposal into two pieces before ranking it
EPSP Jun-04 No challenges/issues identified
makes sense to do the whole thing as an MSP project - Evans stated this might represent the only feasible option in the
SPC Oct-04 event of a decrease in the available budget.
SPC Mar-05 SPC Consensus 0703-13: Ranked 7 out of 9 (top 3 forwarded to OTF)
Oct-06 FULL2/PRL4
iSAS/IODP Proposal Cover Sheet 589-Full3
Title:
Overpressure and Fluid Flow Processes in the Deepwater Gulf of Mexico
Proponent(s): Peter B. Flemings, Alan Huffman, James A. Thomson, Michael O. Maler, Richard E. Swarbrick,
Andrew Whittle, Charles Winker
Keywords: Overpressure, sedimentation, fluid flow, slope stability Gulf of Mexico

Area:
(5 or less)
Contact Person: Peter B. Flemings
Department: Department of Geosciences
Organization: Penn State University
Address 307 Deike Building, University Park, PA 16802
Tel.: (814) 863-7072 Fax: (814) 863-8724
E-mail: flemings@austin.emsadm.psu.edu
Passive margin continental slopes are extraordinarily active hydrodynamic systems where sedimentation, fluid
migration, and structural deformation are intimately coupled. Sea floor slumping, fluid expulsion (e.g. mud
volcanoes), vent biological communities, and near lithostatic fluid pressures are all expressions of this active system.
We propose a drilling program on the Gulf of Mexico continental slope. We will examine a normally pressured
depositional basin (Brazos- Trinity Basin 4 in order to characterize rock and fluid properties and in-situ conditions at
a range of known effective stress conditions. We will examine an overpressured location (Ursa Basin) to characterize
rock and fluid properties in shallow overpressure and to test a flow-focusing model. This model predicts that where
sand bodies are rapidly buried by overburden of varying thickness, characteristic pressure, stress, and compaction
states will result. At each location, in-situ measurements will include Logging While Drilling, piezoprobe
experiments to determine in-situ pressure and temperature in low permeability mudrocks, and wireline packer stress
measurements to determine in-situ stress conditions. Whole round cores will be taken for geotechnical analysis
(consolidation tests) to compare lab-derived pre-consolidation stresses with in-situ observations. Pore water sampling
will be used to further constrain hydrodynamic fluxes. We propose to seal one hole with a packer and CORK to
accurately determine the pressure within a permeable overpressured sand and to establish the framework for
long-term observation of fluid flow behavior. A better understanding of pressure evolution and flow focusing has the
potential to: 1) illuminate the controls on slope stability; 2) illustrate the processes driving seeps and associated
biological communities; 3) allow industry and iODP to use a predictive approach to drilling stable boreholes; 4) show
how pressure, stress and geology couple to control fluid migration on passive margins; and 5) provide extraordinary
data set to observe ponded and channelized turbidite deposits.
589-Full3
We have developed a macro-scale (km scale) model that describes how sedimentation drives compaction and fluid flow
in geologic settings where low permeability mudstones load high permeability aquifers. We will test this model by
characterizing the spatial variation in pressure, stress, and rock and fluid properties along a known flow focusing
structure (Ursa Basin). The micro-scale material behavior of the shallow sediments will be established through analysis
of two reference sites where pore pressures are normal, yet in -situ effective stresses are different (the Brazos Trinity
Basin). A core component of the study will be laboratory based geotechnical analysis of sediment properties to further
constrain material behavior. Achievement of the scientific objectives will illuminate controls on slope stability, seeps,
and large scale crustal fluid flow.
Proposed Sites: ( Only High Priority Sites are listed here.)

(m) Sed Bsm Total
BT4-1A East Breaks Block 604 1396.4 1497.0 1620.5 1666.2 Reference Site determine Rock
Gulf of Mexico and fluid properties in normal
Lat: 27°22.7’ pressure at moderate effective
Long: -94°21.2’ stress
Lat: 27°18.1 pressure at high effective stress
Long: -94°23.3’
Lat: 27°16.5’ pressure at moderate effective
Long: -94°23.9’ stress
pressure at low effective stress
Lat: 27°22.7’
Long: -94°21.2’
1051.6 1688.0 1937.6 1967.8 High Effective Stress well on
Miss. Canyon Block
URS-1B flow focusing structure. Det.
897, Gulf of Mexico
Pressure/stress.
Lat: 28°4.8’
Long: -89°8.4’
Proposal Name Gulf of Mexico
Summary
To test a flow-focusing model that predicts where sand bodies are rapidly buried by overburden of varying thickness,
characteristic pressure, stress, and compaction states by examining a normally pressured depositional basin in order to
characterize rock and fluid properties and in-situ conditions at a range of known effective stress conditions as well as
examining an overpressured location to characterize rock and fluid properties in shallow overpressure
Vessel Riserless
Operation Time Estimate 34 days (IO-reported, including port call and transit)
Hemipelagic shale are present above the Blue Sand. The Blue sand is interbedded sand and muds. Below the blue sand
Lithology
is hemipelagic mud.
Operational Risks
Shallow water flow, abnormal pressure and man-made objects. Hole stability may be a problem in drilling the Blue Sand.
Environmental Constraints Hurricane season, loop currents
Drill 4 primary and 3 alternate sites,Drill A hole using triple-APC continuous coring with in situ measurements. Hole B is a
Drilling/Coring
LWD hole.
Logging Standard logging, LWD if log suite is not aquired, run peizoprobe and HFT, and run Checkshot
Limitations / Assumptions Need to define platform and operational strategy for penetration into the Blue Unit prior to scheduling
Location in vicinity of Shell leases (including MARS platform, cables, and pipelines.) Mud capacity will need to be on board
in case of shallow pressure problems.
Technical Issues
CORK description (if app) ACORK installations at one of Ursa sites
Costs scale One CORK and 2 LWD holes. May also require mud management technology
Milestones
Forwarded to OTF Sep 03
EPSP Site Approval Jan 05
OTF Scheduled
SAS / OTF History
Oct-01 FULL2
Apr-02 FULL3
Readiness: 1B
iSSP Jul-02 Notes & iSSP Consensus: A riser-less platform is needed to achieve this proposal. The iSSP acknowledges that most of
the required data for this type of site is in DB, but must be properly organized (text and illustrations).
iPC Aug-02 iPC Consensus 3-13: ready for ranking
SPC Sep-03 SPC Motion 03-09-37: Ranked 5th out of 16 and forwarded to OTF.
PANEL REQUESTS NEEDED FOR FINAL REVIEW
1. Relative amplitude seismic displays
2. A discussion on the planned mud program, including a statement of toxicity
EPSP Dec-03 3. An independent shallow gas assessment for both study areas
4. Near well logs, highlighting whatever data are available for the shallow sections
5. Proposed drilling program, with options pending pollution and/or safety issues
SPC Consensus 0406-19: In light of a lead agency report on new possibilities for potential non-riser operations in FY2005
SPC Jun-04 and FY2006, the SPC requests that OPCOM reconsider its April 2004 decision to delay an independent evaluation of
existing hazard survey data for Proposal 589-Full3 Gulf of Mexico Overpressures. Such an evaluation should be
conducted as soon as possible to allow for potential scheduling of this highly ranked program in FY2005 or FY2006.
EPSP Jun-04 Challenges identified include: overpressure/shallow gas
SPC Motion 0410-34: After considering the scientific priorities previously determined by the SPC and the potential drilling
schedules for FY2005 as presented by OPCOM, the SPC recommends Model 1 (Proposal 573-Full2 Porcupine Basin
SPC Oct-04 Carbonate Mounds, as modified in 573-PRL5; Proposal 589-Full3 Gulf of Mexico Overpressures as modified in 589-Add;
and Proposal 522-Full3 Superfast Spreading Crust) as the preferred option and Model 3 (Proposal 477-Full4 Okhotsk and
Bering Seas Paleoceanography, Parts 1 and 2) as a backup plan.
A single depth to the top of the “Blue Sand” will need to be provided to the panel to establish the maximum drilling depth;
EPSP Dec-04 proponets to develop a risk-of-flow analysis; contingent URS drill sites may be finalized after receipt and review of the final
shallow hazards study.
EPSP Jan-05 All sites approved.
them to consider in developing drilling schedule scenarios for FY2006 and beyond. This group includes: 589-Full3....To
SPC Mar-05 evaluate further the status of the unscheduled portions of Proposal 553-Full2 and 589-Full3, the SPC requests progress
reports on Expeditions 308 Gulf of Mexico Hydrogeology and 311 Cascadia Margin Gas Hydrates at the October 2005
SPC meeting.
SPC Mar-05 SPC members nominated several or more prospective candidates as potential co-chief scientists
Becker understood that the remaining part this proposal consisted of the original proposed observatory. He suggested
SPC Mar-06 asking the OTF for an update of the possible timeline for achieving that objective.
SPC Aug-06 Scientific Assessment of IODP Expedition 308 was presented
Discussion whether or not industry could contribute to the cost of observatories for 589-Full3 was discussed. There is no
SPC Mar-07 obvious problem with this type of industry involvement but industry can't get access to the data, as the rights of access are
specified in the Memoranda of Understanding.
595-Full3
Title: Deep Riser and Non-Riser Drilling on the Indus Fan and Murray Ridge: Reconstructing
Erosion of Tibet, western Himalaya and the Karakoram from the Detrital Record
Proponent(s): Peter D. Clift, Hidekazu Tokuyama, Christoph Gaedicke, Peter Molnar, Dirk Kroon, Karen Bice,
Hans-Ulrich Schlüter, Rosemary Edwards, Yani Najman, Shahid Amjad, Muhammad Tahir, M. Asif
Khan, Peter Hildebrand, Kip V. Hodges, John Grotzinger, Eduardo Garzanti, Peter Miles, Maureen
Raymo, Mike P. Searle and Ashraf Uddin
Keywords: Tectonics, erosion, climate Area: Arabian Sea
(5 or less)
Contact Person: Peter D. Clift
Department: Department of Geology and Geophysics
Organization: Woods Hole Oceanographic Institution
Address Woods Hole, MA 02543, USA
Tel.: 1 508 289 3437 Fax.: 1 508 457 2187
E-mail: pclift@whoi.edu
Permission to post abstract on iSAS Web site: Yes
We propose to investigate the erosional record of the Indus Fan since India-Asia collision, and assess its
relationship to regional and global climate change. The detrital record in the Indus Fan allows erosion to
be quantified in a region where the Neogene paleoceanographic evolution is well documented and linked
to monsoonal strength especially at 8.5 Ma, and where the sediment source regions have also been the
focus of detailed radiometric thermochronology work. If the links between continental tectonic evolution,
oceanographic circulation, continental climate and erosion are to be understood then the history of each
of these needs to be reconstructed and correlated to one another. Drilling of the Indus Fan within the
context of a regional seismic stratigraphic framework can provide an erosion budget for the Cenozoic.
Provenance studies can reveal changes in the sediment source and uplift rate, while clay mineralogy and
geochemistry can be used to assess continental weathering regimes. We propose a two-site, two-leg
drilling program for the Murray Ridge (MU-1) and the Indus Fan (IR-1). In the first leg non-riser drilling
at MU-1 will recover 1800 m of the Oligocene missing in the foreland, while at IR-1 1500 m of
penetration will sample the Late Miocene-Recent, spanning the apparent intensification of the monsoon
at 8.5 Ma. Changes in erosion rates and weathering style triggered by this event will be determined. In the
second leg riser drilling to 5000 mbsf at IR-1 will recover the Middle and Early Miocene, while at MU-1
drilling will recover the Eocene, penetrate the fan base at ~3000 mbsf, and sample pre-fan sediment and
basement. Documenting the Mid Miocene is important to test models proposing an earlier onset to the
monsoon at that time linked to plateau uplift. Riser drilling is required for such deep penetrations,
especially in an area of potentially unstable sands, and possible hydrocarbons. The arrival of material
from north of the Indus Suture into the Arabian Sea constrains the controversial age of India-Asia
collision. Drilling will date the onset of fan sedimentation in a proximal location. Because the rate of
India-Asia convergence is known, the age of collision allows us to determine whether the volume of crust
added to Asia greatly exceeds that now in the orogen. If the volume added exceeds the present total then
lateral extrusion or crustal subduction must be invoked, in addition to horizontal compression, as a mode
of orogenic strain accommodation.
595-Full3
The objectives of the drilling are to date the initiation of the Indus Fan and to recover a clastic
record for the proximal Indus Fan from that time to the present day. Application of single grain
provenance and thermochronology techniques to the sediment grains recovered will allow the
evolving patterns and rates of exhumation to be calculated for the Indus drainage basin during
the construction of the Himalaya and Tibet. Studies of clay minerals will constrain evolving
weathering regimes over the same period. The drilling will further provide ages for the three
dimensional seismic stratigraphic framework being constructed for the Arabian Sea. This will
allow accurate estimates of sedimentation rate to be determined for the Indus system, thus
permitting the relationships between erosion, tectonics and climate to be tested in detail in the
global type area. The erosion record can be directly correlated to the existing records of
paleoceanographic evolution from the Oman margin, and to continental weathering records in
the foreland using the nannofossil biostratigraphy. Drilling below the level of the Indus Fan
will provide paleoceanographic constraints on ocean circulation patterns in a critical area
during the Paleocene-Early Eocene, a time of intense oceanographic change.
Proposed Sites:
(m) Sed Bsm Total
MU-1 Murray Ridge 1200 2900 10 2910 Recovery of Paleogene Indus

Fan detrital record, date age of
fan initiation and determine
paleoceanographic setting of
pre-fan Arabian Sea
Recovery of Neogene Indus

IR-1 Indus Fan 2473 5000 5000 Fan detrital record for
reconstruction of erosion rates
and patterns in the western
Himalaya and correlation with
existing paleoceanographic
records. Dating of seismic
stratigraphy on Indus Fan for
calculation of erosion history
and determination of its
relationship to climate change.
Proposal Name Indus Fan and Murray Ridge
Summary
ISP Objective Deep Biosphere & Environmental Change
The objectives of the drilling are to date the initiation of the Indus Fan and to recover a clastic record for the proximal
Indus Fan from that time to the present day. This will allow accurate estimates of sedimentation rate to be determined
for the Indus system, thus permitting the relationships between erosion, tectonics and climate to be tested in detail in
the global type area.
Vessel Riserless for this leg, return with riser-vessel for second leg
Operation Time Estimate 56.2 days (IO estimated 41 days total)
Lithology Siltstone, fine sandstone, shale
Operational Risks Hole stability, low probabity of gas
Environmental Constraints Monsoon season July - Sept.
Drilling/Coring 5 holes with triple APC/XCB to 350m/ drill/RCB w/ MBR, log / set reentry cone, RCB to TD, log
Logging Standard + temperature probe to determine heat flow
Technical Issues Independent pore pressure measurements
Costs scale additional in-situ pore pressure measurement services may be needed
Milestones
Forwarded to SPC 2003
EPSP Site Approval
OTF Scheduled
SAS / OTF History
Oct-01 FULL2
iSSEPs Nov-01 Submit revised proposal
Apr-02 FULL3
iSSEPs Jun-02 send an addendum
Readiness: 2C
Notes & iSSP Consensus: Substantial items of required site survey data are still not exist in the databank. iSSP
iSSP Jul-02 recommends to submit the available data to the databank with navigation information. iSSP strongly encourages
proponents to continue the effort to put their grid seismic survey plan into practice.
Apr-03 ADD
iSSEPs May-03 Send out for external review
Ranked #11. Committee decided to split the proposal into riser and non-riser components (not for ranking purposes).
SPC Sep-03 SPC Consensus 03-09-38 The SPC chair and the IMI interim program director will work with CDEX to establish an
initial project-scoping group for the riser-drilling component of Proposal 595-Full3.
Oct-03 ADD2
SPC Consensus 04-03-17 The SPC requests that the OPCOM determine the required level of scoping activity and
SPC Mar-04 initiate that activity for Proposal 595-Full3 Indus Fan and Murray Ridge.
Apr-04 FULL3
SSEP May-04 Major outcome from SPC was Consensus 04-03-17
The committee noted that Proposal 595-Full3 lacked sufficient site-survey data except for the Murray Ridge sites. The
committee decided however to follow the same precedent as above and rank the whole proposal as presented and
then advise OPCOM about splitting it if necessary.
Ranked # 8
SPC Consensus 04-06-17 The SPC supports efforts to understand the timing, rates, and impact of the uplift of the
SPC Jun-04
Himalayan-Tibetan Plateau as elucidated in Proposal 595-Full3 Indus Fan and Murray Ridge. The committee strongly
endorses the proposed idea to test the feasibility of the project in two phases, beginning with shallow drilling at the
Murray Ridge site (MU-1B). This will allow the proponents to explore how they might quantify some of the variables
involved in reconstructing sediment volumes, noting that previous Indian Ocean drilling has not yet provided a robust
erosion record even for the Neogene. For this reason, the committee requests that OPCOM form a project-scoping
group to maximize site drilling objectives and develop a drilling plan at Murray Ridge that optimizes this potential.
EPSP Jun-04 Challenges/Issues identified by EPSP: Penetration to 2910 m
SSP Aug-04 Sites MU-1B ranked as 1B, and IR-1B as 2B.
The Group II includes the next three proposals (#8-10) that are recommended as alternatives only if the Group I
proposals cannot fill the schedule. The SPC endorsed the proposed idea to test the feasibility of the project related to
the Proposal 595-Full3 Indus Fan and Murray Ridge in two phases, beginning with shallow drilling at the Murray Ridge
SSEP Nov-04 site (MU-1B), and requested that OPCOM form a project scoping group to maximize site drilling objectives and develop
a drilling plan at Murray Ridge that optimizes this potential
595-Full3 is unlikely to be scheduled for FY05 but possible for later
SSP Feb-05 Sites classified as 1A.
Ranked #2 out of 9. SPC Consensus 05-03-21 The SPC forwards the top three of nine ranked proposals, 603C-Full
NanTroSEIZE Plate Interface, 595-Full3 Indus Fan and Murray Ridge (Ranked #2), and 626-Full2 Pacific Equatorial
SPC Mar-05 Age Transect, for the Operations Task Force to consider in developing drilling schedule scenarios for FY2007 and
beyond.
Several prospective candidates for potential co-chief scientists were nominated for 595-Full3
OTF Jun-05 595-Full3 scheduled in models 1b, 2 and 4b for FY07/08
Key items requested or issues raised are: seismic data should be reprocessed or displayed to highlight potential
“bright spots”, a 3rd party assessment of shallow hazards, specifically shallow gas, will be required – Craig Shipp noted
EPSP Jun-05 that Shell has identified some shallow hazard issues in the region, drilling results (lithology, geochemistry, hydrocarbon
shows, etc.), pore pressures, and drilling programs from nearby wells, estimated pore pressures for the planned sites
(an assessment of whether over-pressure should be anticipated and if not why not)
SSP Sep-05 595-Full3 included in the SPC top three of nine ranked proposals to forward to OTF.
OTF Oct-05 595-Full3 scheduled as alternate in FY 2009 schedule
Site Characterization Completeness and Data Adequacy Classifications include: MU-1C & IR-1C: 1A*a
SSP Feb-06 (Proprietary industry data are not in the Data Bank but have been reviewed by SSP, data image the target adequately
and there are no scientific concerns of drill site location and penetration)
Becker proposed leaving this proposal with the OTF because of the potential to conduct non-riser drilling operations in
SPC Mar-06 that region in FY2009. He referred to SPC Consensus 0406-17 on forming a scoping group but noted that the OTF had
not yet done so.
OTF Jun-06 595-Full3 not included in schedule.
In response to key concerns raised, it was reported that the velocity control for the region was good and the proposed
drilling depths should be accurate. There was no evidence of shallow gas in the vicinity fo MU-1C but there is shallow
EPSP Jun-06 gas elsewhere in the region. Shell will be drilling an obligatory well about 10km from the proposed drill site and will
most probably make the data available to the lead proponent (Peter Clift). This data release should includes pore
pressure prediction.
EPSP requests that OTF work with the appropriate IO(s) to initiate a shallow hazards survey and contract for an
EPSP Jan-07 independent pore pressure prognosis.
Received 2 February 2007
600-Add2

Title: Global and Local Controls on Continental Margin Stratigraphy: Canterbury
Basin, Eastern South Island, New Zealand
Proponent(s): Craig S. Fulthorpe, Paul Mann, Hongbo Lu, Robert M. Carter, Lionel Carter,
Gregory Browne, Michelle Kominz
Keywords: Sea level, seismic stratigraphy, sediment drifts, New Zealand
(5 or less) tectonics Area:
Contact Person: Craig S. Fulthorpe
Department: Institute for Geophysics
Organization: University of Texas at Austin
Address J.J. Pickle Research Campus, Bldg. 196, 10100 Burnet Rd., Austin, TX 78758-4445, USA
Tel.: (512) 471-0459 Fax: (512) 471-0348
E-mail: craig@ig.utexas.edu
Proposal 600-Full aims to understand the relative importance of global sea level (eustasy)
versus local tectonic and sedimentary processes in controlling continental-margin
depositional cyclicity during the Oligocene to Recent period. The Canterbury Basin (eastern
margin, South Island of New Zealand) offers the opportunity for expanded study of the
complex interactions between processes responsible for the stratigraphic record of sequences,
as well as providing information on the early history of the Alpine Fault plate boundary. In
particular, currents have strongly influenced deposition in parts of the basin, locally building
large sediment drifts, which aggraded to near shelf depths, within the prograding Neogene
section.
The purpose of this second addendum is to present the rationale for changes to sites arising
from the January 2007 EPSP meeting and also to provide revised Site Summary Forms.
EPSP did not approve two sites (CB-05A and -06A), but added one new site (CB-06B). The
attached Site Summary Forms supersede earlier versions for all sites. This is because of: 1)
changes in penetrations to allow LWD, or in response to EPS concerns, 2) use of a new
velocity function to calculate revised drilling depths, and 3) provision of more precise
latitudes and longitudes. The addendum makes no changes to the drilling objectives, which
remain as stated in proposal 600-Full.
600-Add2
1) Date clinoform seismic sequence boundaries for global correlation and sample associated
facies to provide information for subsidence histories and estimation of eustatic amplitudes.
2) Determine the paleoceanographic record and sequence stratigraphic significance of the large
sediment drifts integral to the shelf/slope system.
3) Confirm the regional distribution of the Marshall Paraconformity and investigate its origin.
4) Constrain the early erosion history of the Southern Alps by dating the progradational units,
to determine sedimentation rates, and linking sediments to onshore source areas
Requires drilling at shelf water depths (minimum of 85 m). May require a mission-specific
platform, if the JOIDES Resolution replacement vessel does not have enhanced ability to drill
and recover sediment in this environment.
Proposed Sites:
(m) Sed Bsm Total
CB-01A 44º 46.1085’ S 85 780 780 Facies landward of clinoform

171º 40.4393’E breakpoints (particularly U4-
U9).
CB-01B 44º 49.2774’ S 101 1023 1023 “
171º 44.9968’E
CB-01C 44º 50.7113’ S 97 976 976 “

171º 42.7941’E
CB-02A 44º 50.8274’ S 111 800 800 Facies landward of breakpoints

171º 47.2079’E (particularly U7-U9), U6
slope.
CB-02B 44º 51.8507’ S 116 918 918
171º 48.6836’E “
CB-03A 44º 53.4453’ S 125 1318 1318 Facies landward of breakpoints

171º 50.9851’E (particularly U8-U19), U4-U7
slopes.
CB-03B 44º 53.0308’ S 121 1249 1249 “
171º 50.4059’E
2
CB-04A 44º 56.0933’ S 340 1270 1270 Slope facies.
172º 01.1532’E
CB-04B 44º 56.2443’ S 346 1913 1913 Slope facies, Marshall

172º 01.3629’E Paraconformity.
CB-05B 44º 41.6069’ S 390 1783 1783 Sediment drift D11, Marshall
172º 32.1071’E Paraconformity.
CB-05C 44º 41.5230’ S 402 1625 1625 “

172º 33.9178’E
CB-05D 44º 41.6521’ S 390 1783 1783 “

172º 32.1686’E
CB-05E 44º 41.5377’ S 389 1789 1789 “

172º 32.2100’E
CB-06B 45º 02. 2126’ S 1158 1106 1106 Marshall Paraconformity

172º 03. 7098’E (minimum penetration).
3
Proposal ID 600 - Full
Proposal Name Canterbury Basin
Summary
Understanding the relative importance of global sea level (eustasy) versus local tectonic and sedimentary processes in
Scientifc Purpose(s) controlling continental-margin depositional cyclicity. The emphasis is on Oligocene to Recent period when global sea-level
change was dominated by glacioeustasy.
Vessel SODV and possibly MSP?
Lithology Siltstone and silty mudstone with intervals of fine-grained sand and mud
Operational Risks Possible hazards include shallow gas and currents (28 - 80 cm/s), core recovery in sands, shallow water guidelines
Environmental Constraints January - February (minimum wave heights - most important at shallow sites)
Drilling/Coring APC to refusal, XCB or RCB (depeding on which works best) to total depth at 5 drill sites.
Logging Standard logging + WST check shot tool for core/seismic correlation
Limitations / Assumptions MSP may be required for swallow sites
Special Considerations New Zealand Clearance, Marine Mammals (VSP)
Technical Issues
Costs scale
Milestones
EPSP Site Approval
SPC Approval of schedule Mar06
SAS / OTF History
iSSEPs Nov-01 Develop to full proposal
Oct-03 FULL
SSEP May-04 Forward to SPC
EPSP Jun-04 Challenges identified include: Penetration up to 1825m/hydrocarbons?
SSP Aug-04 All sites classified as 1B
SPC Motion 0410-35: The SPC recommends following Model 1 in the beginning of FY2006 with a transit to the Southern
Ocean to complete Proposals 600-Full Canterbury Basin and 482-Full3 Wilkes Land Margin. If Model 3 is executed in
SPC Oct-04
FY2005, however, the committee recommends following it with Proposals 522-Full3 Superfast Spreading Crust and 621-
Full Monterey Bay Observatory.
them to consider in developing drilling schedule scenarios for FY2006 and beyond. This group includes: 600-Full
Canterbury included on 1a, 1b, 3, 5a, and 5b operational scenerios.
Canterbury operations are also hampered by a poor weather window but this, in part, could be ameliorated by conducting
some of the shallower Canterbury sites with a later MSP operation. The shallow water operations could be jeopardized by
erratic winds and freak waves which rise to the moderate frequency April through October. Tidal effects are moderate
throughout the year and this too can cause problems with shallow water operations. Wind velocities and wave heights rise
OTF Jun-05 to the moderate level April through June. Shallow water operations should be avoided during the months of April through
October.
The Canterbury program is a potential MSP operation. However, ESO considers the JOIDES Resolution (or its
replacement) to be the ideal platform for this operation. Depending on the riserless scenario chosen by SPC (e.g., Model 3
in Figure 4), there could be some portions of Canterbury that would not
be drilled by the USIO due to weather constraints and these could possibly be addressed by an MSP program.
Implementation of a simple expedition at the start of USIO phase 2 operations is by far the best way forward. This would
suggest effort should be focused on the Equatorial Pacific, NanTroSEIZE, Canterbury or Wilkes as the preferred options.
No change on issues that need to be addressed from the June 2005 OTF meeting
An alternative to dodge undesireable weather windows (Model 3) would be to continue the Canterbury program through the
OTF Oct-05 less desirable weather window knowing that this would result in a reduction in science while the vessel is waiting on
weather. The USIO will need to explore further the potential implications of this approach for Canterbury.
Adjusting Model 1 for a later start could be accommodated by either completing an abbreviated equatorial Pacific program
or by starting with Canterbury Basin.
In the “Southern Ocean” model, Canterbury operations are problematic in that there will need to be a shallow hazard
survey by the IO and review by EPSP. It is possible that not all of the proposed sites can be drilled to the proposed depths
without riser capability.
SPC Motion 0510-23: In addition, the committee intends to schedule further non-riser drilling operations in the Southern
SPC Oct-05 Ocean (i.e., Proposals 600-Full Canterbury Basin and 482-Full3 Wilkes Land Margin) and the Indian Ocean in the following
fiscal year (Fy2008-09).
EPSP has requested independent reprocessing of line 66. It is recommended that the reprocessing be completed by
December 2006 and that the final review be scheduled for June 2007. Bathymetric data would be helpful for the review
process. A generalized pore pressure prediction should be made to provide some guidance as to whether abnormal
pressure may exist. The OTF should examine which drilling platforms may become involved with the drilling plan. The
EPSP Dec-05
panel would like to review a preliminary operational protocol at it’s December 2006 meeting. A shallow hazard review will
be required prior to final review. It is recommended that this review follow a MMS standard report format. It is possible that
not all of the proposed sites can be drilled to their proposed depths without riser capability – CB-04A is proposed to a
depth of 1805 meters.
would begin in August 2007 and proceed through March 2009 as follows:
- Costa Rica Seismogenesis Project Stage 1 (Proposal 537A-Full5)
- NanTroSEIZE Stage 1 (Proposals 603A-Full2, 603B-Full2, 603C-Full)
- NanTroSEIZE Stage 1 continued (Proposals 603A-Full2, 603B-Full2, 603C-Full)
SPC Mar-06
- Bering Sea Paleoceanography (Proposal 477-Full5)
- Juan de Fuca Flank Hydrogeology III (Proposal 545-Full3)
- Equatorial Pacific Paleogene Transect II (mini expedition, Proposal 626-Full2)
- Canterbury Basin (Proposal 600-Full)
- Wilkes Land Margin (Proposals 482-Full3, 638-APL2)
The SPC recognizes this scenario as a preferred model subject to significant change, especially pending further
knowledge about the actual SODV drydock location and starting date for IODP operations. The committee thus
SPC inquired about the possibility of splitting Canterbury into two expeditions surrounding Wilkes Land. The option was not
included in these revised models as it would put the SODV back into the Pacific following the Southern Ocean expeditions.
This action would result in a significant transit penalty to get the SODV into the Indian Ocean in 2009 following the second
portion of the split Canterbury program
The Canterbury Basin program has shallow gas issues that must be addressed before the program can be firmly
scheduled. The full proposal plus addendum includes three main sites (CB-1, -2, -3 with their alternates) in water depths
OTF Jun-06 under 200 m, for which the shallow-water guidelines would mandate a full gas hazard survey by rule. It also still includes
two main sites in 200-400 m water depth with very deep penetrations, for which safe operations might also mandate a full
gas hazard survey. The hazard assessment of the scientific survey won’t be completed and presented until the winter 2006
EPSP meeting.
NOTE: Keir Becker has formed a small SPC working group to address the scientific merit of several operational
permutations to the Canterbury Program. This report will be forwarded in mid-August to the USIO and OTF so they can
explore potential options depending on the outcome of the hazard assessment.
SPC reviewed the relevant questions concerning a) whether a subset of the Canterbury Basin drilling sites could achieve a
majority of the primary objectives, b) whether to proceed as planned with drilling the deep-water sites even if the shallow-
SPC Aug-06
water sites require a hazard survey, and c) whether to proceed as planned with drilling the shallower sites if some of the
deep sites require a BOP.
Oct-06 FULL/ADD2
It should be noted that the “Shallow Hazards Guidelines” would suggest that at CB-03A and CB-03B BOP and well control
measures are required. EPSP did not recommend or require such measures be included in the drilling program. Final
EPSP Jan-07
approval for Site CB-06B is contingent upon the completion of the “safety sheet” for and its delivery to the EPSP Chair and
IODP-MI.
Expedition 301
operations
603A-Full2
Title: NanTroSEIZE Reference Sites:

Sampling and Measuring Inputs to the Seismogenic Zone
Proponent(s): Michael Underwood, Juichiro Ashi, Wonn Soh, Julia Morgan, Saneatsu Saito,
Demian Saffer, Elizabeth Screaton, Masataka Kinoshita, Gregory Moore,
Miriam Kastner, Susan Bilek, Kohtaro Ujiie
Keywords: Subduction inputs; physical and chemical hydrology; Nankai Trough,
Area:
(5 or less) lithostratigraphy; structural geology; heat flow and diagenesis Shikoku Basin
Contact Person: Michael Underwood
Department: Department of Geological Sciences
Organization: University of Missouri
Address 101 Geology Building
Tel.: 573-882-4685 Fax: 573-882-5458
E-mail: UnderwoodM@missouri.edu
Permission to post abstract on iSAS Web site: X Yes No
A foremost goal of IODP is to drill into the seismogenic zone of a plate-boundary fault. The CDP
proposal for NanTroSEIZE (Nankai Trough Seismogenic Zone Experiment) identifies several phases or
milestones in pursuit of that goal. Phase 1, the shallow reference sites, will test five fundamental
hypotheses: (1) Systematic and progressive changes in material properties and state control the onset of
seismogenic behavior and locking of subduction thrusts. (2) Subduction zone megathrusts are weak faults;
that is, they slip under conditions of low resolved shear stress. (3) Within the seismogenic zone, relative
plate motion is accommodated primarily by coseismic frictional slip in a concentrated zone. (4) Out-of-
sequence (or splay) faults develop where the plate-boundary fault is strong relative to adjacent zones
without splay faults. (5) The plate-boundary fault, near its up-dip limit of seismicity, follows the interface
between underthrust metasedimentary rocks and igneous basement.
Reference sites serve three vital roles in testing these hypotheses. First, they establish, prior to
subduction, how lithology, deformation features, hydrologic properties (porosity, permeability), variables
of state (stress, pore pressure, temperature) and in situ properties (mineral and fluid composition,
alteration, grain fabric, strain rate, microseismicity) change from a basement high (potential asperity) to a
basement plain. Second, after showing how basement topography affects stratigraphy and hydrology (and,
therefore, mechanical properties), we will separate those inherited variables from changes superimposed
by diagenesis, deformation, and fluid flow along the P-T path of subduction. Third, to track fault-zone
evolution toward stick-slip behavior, we need to begin characterizing the plate-boundary fault where it is
shallow and aseismic, then move down dip (with deep drilling) into the seismogenic zone.
Data from previous DSDP-ODP legs cannot be imported to the Kii-Kumano region because
stratigraphic, thermal, and hydrologic inputs to Nankai Trough change so much along strike. Drilling two
reference sites within the Shikoku Basin will quantify initial conditions and show how basement relief
influences the pre-subduction geometry of sedimentary facies, temperature, permeability, sediment and
basement alteration, and fluid flow. A third reference site at the toe of the accretionary prism will show
early-phase deformation and verify how strata get partitioned above and below the frontal decollement.
The prism-toe site, moreover, will add a third dimension to constraints on facies architecture,
hydrogeology, thermal structure, and reaction progress where rocks first enter the subduction zone.
603A-Full2
The overarching goal of this proposed investigation is to show how the primary geologic differences
between subducting basement plains and basement highs (potential asperities for earthquakes) modulate
the plate boundary’s mechanical properties, relative strength, and earthquake rupture properties in the
down-dip direction. To begin this assessment, we propose two reference sites seaward of the trench. This
pairing of sites in Shikoku Basin will capture the end-member cause-and-effect of sand-rich versus sand-
poor strata in the lower part of the section and show whether or not basement hydrology and alteration
history vary significantly in response to basement topography. Drilling a third site through the frontal
decollement into basement will be a challenge because total sediment thickness at the prism toe is ~1750
m. Such a site is essential, however, to verify the location of structural partitioning by the fault, as well as
to identify early products of fault-related deformation and fluid flow. The only way to document three-
dimensional heterogeneities in hydrologic, compositional, thermal, and mechanical inputs is to integrate
the following methods and tools at each site: (1) continuous coring, with penetration into at least 100 m of
igneous basement; (2) complete suites of LWD logs for core-log-seismic integration and mapping; (3) lab
tests of sediment composition, diagenesis, geotechnical properties, and hydrologic properties; (4) wireline
hydrologic tests of in situ permeability (packer, pump, etc.); (5) high-resolution borehole measurements of
temperature, pore pressure, and seismic velocity; and (6) chemical analysis of pore fluids, including fluids
extracted from igneous basement.

(m) Sed Bsm Total
NT1-01A Lat: 32° 44.8878’ N 3540 460 m 100 m 560 m Comprehensive

Long: 136° 55.0236’ E characterization of Shikoku
Basin strata and upper igneous
crust above basement high
(coring, downhole
measurements, logging)

Long: 137° 55.0236’ E characterization of Shikoku
Basin strata and upper igneous
crust above basement plain
(coring, downhole
measurements, logging)

Long: 136° 47.9485’ E characterization of deformation,
structural partitioning by
decollement, diagenesis, and
fluid flow at toe of Nankai
accretionary prism (coring,
downhole measurements,
logging)
Proposal Name NanTroSEIZE Phase 1: Reference Sites
Summary
To show how the primary geologic differences between subducting basement plains and basement highs (potential
Scientifc Purpose(s) asperities for earthquakes) modulate the plate boundary’s mechanical properties, relative strength, and earthquake
rupture properties in the down-dip direction.
Vessel Riserless
Operation Time Estimate 55 days (drilling, coring, logging est.)
Lithology silt/mud turbidites and ash layers, hemipelagic mud and mudstone sediments; basalt basement
Operational Risks
Possible hazards include strong currents, fractured zone, fault (instability of accreted trench turbidites at NT1-03A)
Environmental Constraints Kuroshio current and Typhoon season (Apr - Jul), Fisheries ban (Mar - May); Min wave heights Jan - Feb
Double APC at Hole A, RCB to TD at Hole B, LWD to TD at Hole C. Re-entry for geodetic experiment in NT1-01A Hole
Drilling/Coring
C after LWD
Standard + LWD + Borehole temperature and seismic + Packers (hydrologic tests of sediment + basement) + VSP
Logging
(core-log-seismic integration)
Special Considerations Fisheries restrictions from March to May
Technical Issues
CORK description (if app) CORK needs to be specified
Costs scale
Milestones
EPSP Site Approval
SAS / OTF History
Notes: Both a riser-less platform and the riser ship are needed to achieve this proposal. A great variety of geophysical
and geological data exists in the area. However no data has been deposited in the DB and the final sites have not
iSSP Jul-02 been selected. We recognize that this is a long-term proposal that will require major pre-drill resources. As soon as the
existing data is compiled or new data becomes available, it should be send to the DB for iSSP use and improving its
iSSP ranking.
Oct-02 FULL
iSSP Feb-03 Site classification 3A/3B
Apr-03 FULL2
iSSEPs May-03 Read for external review, but wait until B proposal is finished.
iSSP Jul-03 Site classification 2A/2C
SPC Jun-04 Forwarded to OTF, ranked #2
EPSP Jun-04 Challenges/Issues: Penetration up to 1750m
SSP Aug-04 Sites NT-1a-01a and NT-1a-02A classified as 1A; NT-1a-03A classified as a 1B.
SPC Consensus 0410-36: The SPC recommends for the remainder of FY2006 following Proposal 482-Full3 Wilkes
Land Margin with appropriate non-riser drilling components of Proposals 603A-Full2 NanTroSEIZE Reference Sites
and 603B-Full2 NanTroSEIZE Mega-Splay Faults, then Proposal 477-Full4 Okhotsk and Bering Seas
Paleoceanography, Part 1. The committee also recommends the remainder of Proposal 545-Full3 Juan de Fuca Flank
Hydrogeology or Proposal 553-Full2 Cascadia Margin Hydrates as a backup for Proposal 477-Full4 Okhotsk and
SPC Oct-04
Bering Seas Paleoceanography, Part 1.
The high costs of Proposals 603A-Full2 and 603B-Full2 and the necessity of conducting those expeditions before the
start of riser drilling in 2007 was discussed. Baldauf replied that the CORKs added significantly to the costs, and the
non-riser expeditions did not necessarily have to precede the associated riser drilling component of the project.
SSEP Nov-04 Unlikely for FY2005, possible for later.
Proponents have been asked to present to EPSP at the June 2005 meeting structure maps on the “Upper” and “Lower
Yellow” units and/or sufficient seismic data to support the structural configuration at the proposed drilling locations (i.e.,
can the absence of closure be demonstrated with a high degree of confidence). This will be used to determine whether
EPSP Dec-04 EPSP will request the acquisition of additional seismic data to support the reference site locations. If the absence of
closure cannot be demonstrated, can the absence of a viable hydrocarbon system be supported (i.e., no source,
section immature, etc.)? Brief reviews of prior DSDP and ODP sites should be prepared, summarizing items relevant to
EPSP.
Site readiness classifications - NT1-01A: 1A (no change), NT1-02A: 1A (no change), NT1-03A: 1B (no change,
SSP Feb-05 requires a crossing SCS line), NT1-04A: 1B (Needs a crossing high-resolution seismic line), NT1-05A: 1B (thrust
thickening needs addressing), NT1-06A: 1B (Needs crossing MCS and preferably high-resolution line)
SPC Consensus 0503-15: The SPC recommends that all fully or partially unscheduled proposals forwarded previously
to the Operations Task Force as part of the highest priority Group I should remain for now with the Operations Task
Force for them to consider in developing drilling schedule scenarios for FY2006 and beyond. This group includes:
Proposals 477-Full4 Okhotsk/Bering Plio-Pleistocene, 482-Full3 Wilkes Land Margin, 519-Full2 South Pacific Sea
SPC Mar-05 Level, 545-Full3 Juan de Fuca Flank Hydrogeology, 553-Full2 Cascadia Margin Hydrates, 564-Full New Jersey Shallow
Shelf, 589-Full3 Gulf of Mexico Overpressures, 600-Full Canterbury Basin, 603A-Full2 NanTroSEIZE Phase 1, 603B-
Full2 NanTroSEIZE Phase 2, and 621-Full Monterey Bay Observatory.
The SPC members nominated several or more prospective candidates as potential co-chief scientists. The IODP-MI
science coordinators promised to solicit the program member offices for the CV of each candidate plus any additional
nominations and forward the information to the appropriate IOs by early June 2005.
SPC Motion 0510-23: The SPC approves the FY2007-08 operations schedule of the U.S. scientific ocean drilling
vessel (SODV) as proposed in model 2 of the Operations Task Force. The recommended expeditions will begin in
August 2007 and proceed as follows: - Equatorial Pacific Paleogene Transect (Proposal 626-Full2) - NanTroSEIZE
Stage 1 (Proposals 603A-Full2, 603B-Full2, 603C-Full) - NanTroSEIZE Stage 1 continued (Proposals 603A-Full2, 603B-
Full2, 603C-Full) - Superfast Spreading Crust IV (Proposal 522-Full3) or another expedition identified later - Juan de
Fuca Flank Hydrogeology III (Proposal 545-Full3)
SPC Oct-05 SPC Motion 0510-21: The SPC approves the FY2007-08 operations schedule for the Chikyu as proposed by the
Operations Task Force and derived by the NanTroSEIZE Project Management Team from Proposals 603A-Full2
NanTroSEIZE Reference Sites, 603B-Full2 NanTroSEIZE Mega-Splay Faults, and 603C-Full NanTroSEIZE Phase 3:
Plate Interface. The recommended expeditions will begin in September 2007 with NanTroSEIZE Stage 1 non-riser
drilling and continue later in 2008 with NanTroSEIZE Stage 2 riser drilling following a period of annual maintenance and
further testing. The committee recognizes that these planned operational stages do not correspond directly with the
organizational scheme of the individual drilling proposals.
would begin in August 2007 and proceed through March 2009 as follows: - Equatorial Pacific Paleogene Transect I
(Proposal 626-Full2) - Costa Rica Seismogenesis Project Stage 1 (Proposal 537A-Full5) - NanTroSEIZE Stage 1
(Proposals 603A-Full2, 603B-Full2, 603C-Full) - NanTroSEIZE Stage 1 continued (Proposals 603A-Full2, 603B-Full2,
SPC Mar-06
603C-Full) - Bering Sea Paleoceanography (Proposal 477-Full5) - Juan de Fuca Flank Hydrogeology III (Proposal 545-
Full3) - Equatorial Pacific Paleogene Transect II (mini expedition, Proposal 626-Full2) - Canterbury Basin (Proposal
600-Full) - Wilkes Land Margin (Proposals 482-Full3, 638-APL2). The SPC recognizes this scenario as a preferred
model subject to significant change, especially pending further knowledge about the actual SODV drydock location and
starting date for IODP operations. The committee thus encourages the OTF to explore further possibilities of revising
readjustments required in the event of a delay in the starting date for SODV operations. The recommended expeditions
will begin in November 2007 and proceed as follows: -Equatorial Pacific Paleogene Transect I (Proposal 626-Full2) -
NanTroSEIZE Stage I (Proposals 603A-Full2, 603B-Full2, 603C-Full) -NanTroSEIZE Stage I continued -Bering Sea
Plio-Pleistocene Paleoceanography (Proposal 477-Full4) -Juan de Fuca Flank Hydrogeology II (Proposal 545-Full3) -
Equatorial Pacific Paleogene Transect II (Proposal 626-Full2). In the event of a slight delay in the start of SODV
SPC Aug-06
operations, the entire schedule should simply shift later, as long as good weather windows remain open for the Bering
Sea and Juan de Fuca expeditions. In the event of a longer SODV delay that would preclude such a simple shift, the
first Equatorial Pacific expedition would be deferred until later and the schedule would begin with NanTroSEIZE Stage I
SPC Consensus 0608-04: The SPC approves the science plan and operations schedule of the Chikyu for
NanTroSEIZE non-riser and riser operations (Proposals 603A-Full2, 603B-Full2, 603C-Full) in FY2008 and early
FY2009 as recommended by the NanTroSEIZE Project Management Team in July 2006 and the Operations Task
Force (OTF) in August 2006.
Final approval for sites NT1-03B and NT1-03C is contingent upon submitting the safety sheets to the EPSP chair and
EPSP Jan-07
IODP-MI.
Between Aug and Mar - fishing union restrictions for operations from March to May resulted in OTF eliminating one
OTF Feb-07 NanTro operation from the SODV schedule and combining coring elements of the Kumano basin and subduction inputs
expeditions into one SODV NanTro expedition.
SPC Consensus 0703-14: The SPC receives the update on minor schedule adjustments reported by
the Operations Task Force (OTF) for FY2008 Chikyu NanTroSEIZE operations and FY2008-2009
SPC Mar-07 Mission Specific Platform (MSP) operations at Great Barrier Reef, and confirms that these are fully
consistent with the August SPC consensus statements (0608-04 and 0608-05, respectively)
approving those programs for the FY2008-2009 schedules.
SPC Mar-07 date to international operations and a short transit, the approved schedule would include the following sequence: -
NanTroSEIZE Stage 1 coring (Proposals 603A-Full2, 603C-Full; subduction inputs and site
NT3-01),.......This adjusted schedule is as close as possible to the previously approved FY2008-2009 schedule (SPC
Consensus 0608-03) given the budgetary and logistical constraints, except that it does not include an initial
NanTroSEIZE observatory and the observatory-intensive second Juan de Fuca IODP expedition......
Slippage in SODV delivery date combined with fishing union restrictions resulte din OTF removing NanTroSEIZE
OTF Jul-07 operations from the SODV schedule. CHIKYU riser operations were delayed from June08 to Jan 09.
New X Revised Addendum
605-Full2
Title: Onset and evolution of millennial-scale variability of Asian monsoon and its
possible relation with Himalaya and Tibetan uplift
Proponent(s): Ryuji Tada, Takuya Itaki, Youbin Sun, Ken Ikehara, Takeshi Nakajima, Jang Jun Bahk,
Sang Hoon Lee, Hongbo Zheng, Sergey Gorbarenko
Keywords: Millennial-scale variability, East Asian monsoon, westerly jet, The Japan Sea
Area:
(5 or less) Tectonics-climate linkage, land-ocean linkage East China Sea
Contact Person: Ryuji Tada
Department: Department of Earth and Planetary Science
Organization: Graduate School of Science, University of Tokyo
Address 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-0003, Japan
Tel.: +81 3 5841-4523 Fax: +81 3 5841 8318
E-mail: ryuji@eps.s.u-tokyo.ac.jp
It is well demonstrated that Asian monsoon varied with the Dansgaard-Oeschger Cycles [DOC]. Recent studies
further suggest that such variability may have been caused by oscillations in westerly jet circulation between two
different modes of meandering. Because topographic effect of Himalaya and Tibetan Plateau [HTP] is considered
as the probable cause of different modes of the westerly jet meandering, and increasing evidences suggest final
uplift of HTP commenced during Plio-Pleistocene, it is hypothesized that Plio-Pleistocene uplift of HTP, and
consequent emergence of the two discrete modes of westerly jet meandering is the cause of the millennial-scale
variability of the Asian monsoon and amplification of the DOC.
In this project, we aim to collect the geological evidence necessary to test this hypothesis through drilling in the
Japan Sea and northern part of the East China Sea. We propose to drill two latitudinal transects in the Japan Sea to
monitor the behaviors of the westerly jet and winter monsoon. We also propose to drill at the northern part of the
East China Sea to monitor the Yangtze River discharge history that should have been reflecting variations in
summer monsoon intensity. The southern transect will be used to reconstruct the behavior of the subpolar front and
examine its relationship with the westerly jet and the sea level changes. Whereas the northern transect will be used
to identify ice-rafted debris [IRD] events and reconstruct temporal variation in its southern limit, which we
consider as winter monsoon proxies. Finally, we arrange two depth transects to reconstruct the ventilation history
of the sea. We will examine the relation between the ventilation in the sea, and the nature of the influx through the
Tsushima Strait and/or winter cooling.
Through the proposed drilling, we hope to 1) specify the onset timing of orbital and millennial-scale variabilities
of East Asian monsoon and westerly jet, and reconstruct their evolution process and spatial variation patterns, and
2) reconstruct orbital and millennial-scale paleoceanographic changes in the Japan Sea during the last 5 m.y. to
clarify the linkage between the paleoceanographic changes in the Japan Sea and variabilities of East Asian
monsoon and/or sea level changes. Comparison of the obtained results with the uplift history of HTP will enable us
to test the idea that topographic evolution of HTP was responsible for creation of bimodality in westerly jet
circulation that caused amplification of millennial-scale variability of Asian monsoon.
605-Full2
We hypothesize that there have been two quasi-stable modes of the westerly jet meandering, and oscillation between
the two modes could be the essential part of the Dansgaard-Oeschger Cycles. We further speculate that
Himalaya-Tibetan Plateau [HTP] play a role of topographic barrier that creates the two quasi-stable modes of the
westerly jet meandering and Plio-Pleistocene uplift of HTP could have triggered the onset of millennial-scale abrupt
climatic changes in northern hemisphere. In this proposal, we plan to collect paleoclimatological and
paleoceanographical constraints critical to test this hypothesis through IODP drilling of the Japan Sea and northern
part of the East China Sea. The drilling will enable us to reconstruct the history of onset and evolution of the orbital
and millennial-scale variabilities of summer monsoon, winter monsoon, westerly jet position and intensity, and
desertification in East and Central Asia during the last 5 m.y. We also propose to explore the linkage between orbital
and millennial-scale variabilities of the East Asian monsoon, discharge of the Yangtze and Yellow Rivers, and
paleoceanography in the Japan Sea.
Aims of the proposed drilling are two folds.
1) Specify the onset timing and reconstruct evolution process of orbital and millennial-scale variabilities of East
Asian monsoon
(summer monsoon, winter monsoon, and westerly jet axis), reconstruct their spatial patterns, and examine their
interrelationship.
2) Reconstruct orbital- and millennial-scale changes in surface- and deep-water circulations in the Japan Sea, and
examine their relation with variabilities of East Asian monsoon and glacio-eustatic sea level changes.
None
Proposed Sites:
(m) Sed Bsm Total
JS-1 37°02’N 134°48’E 930 400 0 400 High-resolution reconstruction of
dust flux, surface water conditions,
and etc
and etc
dust, IRD, and etc
JS-5B 43°46’N 138°50’E 3435 200 0 200 High-resolution reconstruction of
dust, IRD, deep water oxygenation,
and etc
JS-7B 40°11’N 138°14’E 2811 150 0 150 High-resolution reconstruction of
dust, IRD, deep water oxygenation,
and etc
and etc
JS-10B 35°57.6’N 134°26’E 316 500 0 500 High-resolution reconstruction of
surface water conditions, etc
surface water conditions, etc
ECS-1 31°38’N 128°57’E 746 500 0 500 High-resolution reconstruction of
the river discharge from the
Yangtze River
Proposal Name Asian Monsoon
Summary
1) Specify the onset timing and reconstruct evolution process of orbital and millennial-scale variabilities of East Asian
monsoon (summer monsoon, winter monsoon, and westerly jet axis), reconstruct their spatial patterns, and examine their
Scientifc Purpose(s) interrelationship.
2) Reconstruct orbital- and millennial-scale changes in surface- and deep-water circulations in the Japan Sea, and
examine their relation with variabilities of East Asian monsoon and glacio-eustatic sea level changes.
Vessel Riserless
Lithology Diatomaceous clay to silt
Operational Risks
Environmental Constraints June to October is Typhoon season
Drilling/Coring Triple APC to 100m depth, double APC to 200m, XCB to termination depth
Logging Standard logging suite
Special Considerations Clearance required
Technical Issues
Costs scale
Milestones
Forwarded to SPC ?
OTF Scheduled
SAS / OTF History
Oct-01 PRE
Oct-03 FULL
Proposal Name Asian Monsoon
SSEP Nov-03 Revise Full
Apr-05 FULL2
SPC Mar-06 SPC Motion 0603-21: Forward to OTF for scheduleling in Group I. Ranked 4th out of 17.
SPC-OTF members also felt that if the SODV became available August 207 (and time allowed for a model like “A1”) they
would prefer to conduct Asian Monsoon operations rather than add another NanTroSEIZE expedition. SPC-OTF members
OTF Jun-06 felt that adding another NanTroSEIZE expedition (that would start into Stage 2 operations) would generate even more
staffing-related issues and, more importantly, they thought it was a better idea to digest Stage 1 data before advancing
immediately g into more Stage 2 operations q p p
Weather windows are also a major issue for the Asian Monsoon expedition, with the potential for significant lost
OTF Jun-06
operational time. Finally, if the Asian Monsoon soon model is selected it implies that the Equatorial Pacific program would
OTF Jun-06 Input from one of the lead proponents (contacted during the OTF meeting) suggested that the science of the program
would be severely decimated if any of the sites were eliminated to accommodate for a slide in the schedule.
Chikyu FY09 operations could include some western Pacific riserless programs (e.g., Asian Monsoon) and then move into
OTF Jun-06 the Indian Ocean to conduct operations at Murray Ridge.
OTF Jun-06 The Asian Monsoon program could be considered a potential FY09 Chikyu operation with possibly 3-4 months of additional
time available for other Western Pacific operations (dependent on the available pool of programs at OTF in June 2007).
SSP Jul-06 Sites JS05B: 2Ac,d. Remaining sites classified as 3A
SSP Feb-07 3A (JS-11A, JS-10B, ECS-1A), 2A (JS-1A, JS-7B, JS-9A), 1Aa (JS-3A, JS-4a, JS-5B)

X Addendum
612-Add
New Revise
Title: Paleoclimatic and Orbital Modulation of the Earth's Magnetic Field: A Possible External Energy
Source of the Geodynamo
Proponent(s): Toshitsugu Yamazaki, Toshiya Kanamatsu, Hirokuni Oda, Yukiko Yokoyama, and Tadahiro
Hatakeyama, David W. Lea, Tomohisa Irino, Sang-Min Hyun, Yukio Yanagisawa, Eddy Z. Gaffar
Keywords: paleomagnetism, orbital modulation, paleoclimate, paleointensity,
Area:
(5 or less) geodynamo
Contact Person: Toshitsugu Yamazaki
Department: Institute of Geology and Geoinformation
Organization: Geological Survey of Japan, AIST
Address Central 7, 1-1-1 Higashi, Tsukuba 305-8567, Japan
Tel.: 81-29-861-2414 Fax: 81-29-861-3589
E-mail: toshi-yamazaki@aist.go.jp
The origin of the Earth’s magnetic field is a fundamental problem in Earth and planetary sciences. The
geodynamo has been thought to be a self-sustained system within the core, and maintained by heat and
gravitational energies from the cooling Earth. Recently, however, external energy sources of the
geodynamo, orbital forcing and/or paleoclimate changes, have been suggested from possible existence
of the Milankovitch orbital frequencies in variations of geomagnetic-field strength (paleointensity) and
direction (inclination) during the last 2 to 3 m.y. recovered from marine sediments. We here propose a
coring program to obtain long-term secular variation records of the geomagnetic field in both intensity
and inclination back to ca. 10 Ma. The main purpose is to prove or disprove orbital modulation of the
geomagnetic field to clarify energy sources of the geodynamo. For recovering reliable paleomagnetic
records, in particular those of relative paleointensity, it is required to use relatively oxic sediments with
magnetic properties that are as homogeneous as possible. Considering expected penetration depths of
about 200m for the Advanced Piston Corer (APC), sediments with moderate depositional rates of 10 to
40 m/m.y. are needed to obtain long-enough records with resolution of the orbital frequencies. A global
distribution of sites is required for separating global and local geomagnetic features, and for testing a
model of correlation between intensity and inclination variations. This is also required for discriminating
geomagnetic signals from lithological artifacts; an argument against the orbital modulation of the
paleointensity is that it could be an artifact caused by paleoclimatically induced rock-magnetic changes
in sediments. This possibility can be tested by detailed comparison of paleointensity records from
sediments of different oceanographic environments, in particular by examining phase relationships
between paleointensity and magnetic property variations. The requirement of global site distribution is
incompatible with a conventional ODP-style leg, and hence we propose a multi-expedition program to
implement this proposal; a few sites are devoted to this program during an expedition mainly for other
purposes carried out in a nearby area. To accomplish a general test of the hypotheses within a
reasonably short period of time, we first focus on three high priority areas, and request an expedition
devoted to this program to visit two areas among the three: the western equatorial Pacific and central
North Pacific.
612-Add
The main objective of this proposal is to evaluate importance of orbital forcing and/or paleoclimate
changes as external energy sources of the geodynamo from paleomagnetism of deep-sea sediments. We
propose a coring program to establish long-term secular variations both in intensity and direction
(inclination) for the last ca. 10 m.y., and to examine orbital signals, in particular the Milankovitch orbital
frequencies: ~100 and ~400 kyr eccentricity, ~41 kyr obliquity, and ~23 and ~19 kyr precession. The
period of time, the last ca. 10 m.y., is long enough to determine whether there are orbital frequencies, and
variations of dominant frequency with time if they are. We also test a model of the correlations between
intensity and inclination variations. Other than the main objectives, paleointensity records during the last
10 m.y. with more than 40 polarity reversals would be quite valuable for examining the “asymmetric
sawtooth pattern” hypothesis on paleointensity variations, a possible link between reversal frequency and
paleointensity, and correspondence between paleointensity and “tiny-wiggles” in marine magnetic
anomalies. They are also useful for high-resolution chronostratigraphy in the Miocene
(“paleointensity-assisted stratigraphy”). In addition to the paleomagnetism, a site in the western equatorial
Pacific is aimed at paleoceanographic and paleoclimatic studies on the evolution of temperature and
salinity during the Neogene. In the central North Pacific, studies on the variations of eolian flux and water
mass in the Kuroshio extension associated with paleoclimate changes are the secondary objectives.
Non-magnetic core barrel and drill strings
Proposed Sites:
Sed Bsm Total
(m)
Phase I High priority sites
One Expedition
WCB-1B 1°42.7’N, 135°50.9’E 4277 200 0 200
WCB-3B 1°52.2’N, 141°56.3’E 2591 600 0 600
WCB-4A 0°06.1’S, 139°35.0’E 3226 200 0 200
CNP-1B 38°17.3’N, 175°00.8’E 4540 500 0 500
CNP-2A 35°14.6’N, 175°00.0’E 4950 200 0 200
CNP-3A 37°25.6’N, 176°14.7’E 3400 200 0 200
Piggyback
SEP-1A 44°S, 122°W 4000 150 0 150
Phase II Global site distribution
NER-1A 1°11’N, 89°24’E 3100 200 0 200

MHP-1A 9°20’S, 162°50’W 2900 200 0 200
ENP-1A 48°N, 155°W 5000 200 0 200
SIR-1A 45°S, 90°E 3500 200 0 200
Proposal Name Geodynamo
Summary
The main objective of this proposal is to evaluate importance of orbital forcing and/or paleoclimate changes as external
energy sources of the geodynamo from paleomagnetism of deep-sea sediments.
Vessel Riserless
Operation Time Estimate 43 days (including transit)
Lithology Hemipelagic Clay, Calcareous Ooze, siliceous clay
Operational Risks None identified
Drilling/Coring Triple APC to ~200m at 9 sites, Triple APC to refusal, XCB to basement at 2 sites
Logging Standard logging (at WCB-3A and CNP-1A)
Technical Issues Non-magnetic core barrel and drill strings, suggested to use larger-diameter corer
Costs scale
Milestones
EPSP Site Approval
OTF Scheduled
SAS / OTF History
Apr-02 PRE
iSSEPs Jun-02 develop to full proposal
suggest that the proponents submit any available data to the data bank when convenient and make plans to acquire
iSSP Jul-02 necessary survey data in the other areas.
Apr-03 FULL
Proposal Name Geodynamo
Apr-04 FULL2
SSP Aug-04 Site readiness ranked as: 3A
Unlikely for FY2005, possible for later
SSEP Nov-04
Revise Full Proposal
SSP Feb-05 Site readiness classifications: WCB-1, -2: 3A / CNP-1, -2: 3A / SEP: 3A / CIR: 3A / MHP: 3A / ENP: 3A / SIR: 3B
Apr-06 FULL3
SSEP Jun-06 Forward to SPC. Make sure that APC & DVTP temperature measurements are done - no need to forward to STP
Oct-06 FULL3/ADD
1Ac (WCB-1B, WCB-4A), 2C (WCB-3B, CNP-1B), 1Aa (CNP-2A, CNP-3A), 3A (ENP-1A, MHP-1A, NER-1A, SIR-1A),
SSP Feb-07
2B (SEP-1A)
Received 14 July 2006

New Revised X Addendum
626-Add2
Title: Cenozoic Pacific Equatorial Age Transect – Following the Palaeo-equator
Proponent(s): Heiko Pälike (Southampton), Mitchell W. Lyle (Boise), Theodore C. Moore (Michigan), Neil
Mitchell (Cardiff), Jan Backman (Stockholm), Daivd K. Rea ( Michigan), Lisa Taux (Scripps)
Keywords: Paeoceanography, Equatorial Pacific, Cenozoic Eastern Equatorial
Area:
(5 or less) Pacific
Contact Person: Heiko Pälike
Department: School of Ocean & Earth Sciences
Organization: University of Southampton, National Oceanography Centre
Address European Way, Southampton SO14 3ZH
Tel.: +44 2380 593638 +44 23 8059 3052/3059
E-mail: heiko@noc.soton.ac.uk
Here we present revised drilling locations, taking into account results from a recent site survey (R/V Roger
Revell AMAT-03, Mar-Apr 2006). We attach revised Site Summary Forms, and propose a drilling strategy
given the most recent plans for the SODV refit and deployment schedule (June 2006).
As the largest ocean, the Pacific is intricately linked to major changes in the global climate system that took
place during the Cenozoic. Throughout the Cenozoic the Pacific plate has had a northward component. Thus,
the Pacfic is unique, in that the thick sediment bulge of biogenic rich deposits from the currently narrowly
focused zone of equatorial upwelling is slowly moving away from the equator. Hence, older sections are not
deeply buried and can be recovered by drilling. Previous ODP Legs 138 and 199 were designed as transects
across the paleo-equator in order to study the changing patterns of sediment deposition across equatorial
regions, while this proposal aims to recover an orthogonal “age-transect” along the paleo-equator. Both
previous legs were remarkably successful in giving us new insights into the workings of the climate and
carbon system, productivity changes across the zone of divergence, time dependent calcium carbonate
dissolution, bio- and magnetostratigrahpy, the location of the ITCZ, and evolutionary patterns for times of
climatic change and upheaval. Together with older DSDP drilling in the eastern equatorial Pacific, both Legs
also helped to delineate the position of the paleo-equator and variations in sediment thickness from
approximately 150ºW to 110ºW.
As we have gained more information about the past movement of plates, and where in time “critical” climate
events are located, we now propose to drill an age-transect (“flow-line”) along the position of the
paleo-equator in the Pacific, targeting selected time-slices of interest where calcareous sediments have been
preserved best. Leg 199 enhanced our understanding of extreme changes of the calcium carbonate
compensation depth across major geological boundaries during the last 55 million years. A very shallow CCD
during most of the Paleogene makes it difficult to obtain well preserved sediments, but we believe our siting
strategy will allow us to drill the most promising sites and to obtain a unique sedimentary biogenic carbonate
archive for time periods just after the Paleocene-Eocene boundary event, the Eocene cooling, the
Eocene/Oligocene transition, the “one cold pole” Oligocene, the Oligocene-Miocene transition, and the
Miocene, contributing to the objectives of the IODP Extreme Climates Initiatives, and providing material that
the previous legs were not able to recover.
626-Add2
We propose an ocean drilling cruise with the aim to achieve an age transect along the paleo-equatorial Pacific
spanning the early Eocene to Miocene (with earlier intervals being covered by previous ODP Legs). Drill sites
target specific time-slics of interest, at locations that provide optimum preservation of calcareous sediments.
Recovered cores will contribute towards (1) resolving questions of how and why paleo-productivity of the
equatorial Pacific changed over time, (2) provide rare material to validate and extend the astronomical calibration
of the geological time sacle for the Cenozoic, (3) determine sea-surface and benthic temperature and nutrient
profiles and gradients, (4) provide important information about the detailed nature of calcium carbonate
dissolution and changes of the CCD, (5) enhance our understanding of bio-and magnetostratigraphic datumes at
the equator, as well as (6) provide information about rapid biological evolution and turn-over during times of
climatic stress. (7)As out strategy also implies a paleo-depth transect, we hope to improve our knowledge about
the reorganization of water masses as a function of depth and time. (8) Integrated with additional site-survey
proposals, we intend to make use of the high level of correlation between tropical sediment sections and seismic
stratigraphy to develop a more complete model of equatorial circulation and sedimentation. (9) Due to the
northward component of the Pacific plate motion, our siting strategy also implies a limited N-S transect across the
paleo-equator of some of the proposed time slices, providing additional information about N-S hydrographic
gradients.
Please describe below any non-standard measurements technology needed to achieve the proposed scientific
objectives.
We request two non-standard technologies to achieve our objectives: (1) To improve the quality of shipboard
palaeomagnetic measurements with shallow equatorial inclinations, we request the use of non-magnetic
core-barrels. (2) In order to facilitate penetration of potential chert encounters, we request the addition of
half-length core-barrels for the expedition.
Proposed Sites:
Brief Site-specific
Objectives
Site Name Position Depth
Appr
(m) Sed Bsm Total
oved
Obtain calcareous
sediments along an
paleo-equatorial
age-transect to decipher
paleoceanograhy and
paleoclimatology from
the:
PEAT-1C 12º04.089’N 142º09.698’W 5132 187 5m 192 250 earliest Eocene

PEAT-2C 11º54.711’N 141º02.744’W 4941 162 5m 167 250 middle Eocene
PEAT-3C 10º30.997’N 138º25.175’W 4874 174 5m 179 250 middle/late Eocene
PEAT-4C 07º59.999’N 131º58.396’W 4809 268 5m 273 300 E/O boundary
PEAT-5C 07º42.075’N 128º15.254’W 4311 253 5m 258 300 Oligocene
PEAT-6C 05º18.736’N 126º16.997’W 4362 362 5m 367 400 O/M boundary
PEAT-7C 03º50.009’N 123º12.352’W 4491 452 5m 457 480 Miocene
PEAT-8C 02º36.327’N 117º59.412’W 4330 455 5m 460 480 Miocene
PEAT-3D (Alt.) 10º32.720’N 138º20.183’W 4889 181 5m 186 250 middle/late Eocene
PEAT-5D (Alt.) 07º42.069’N 128º06.068’W 4400 296 5m 301 330 Oligocene
Proposal Name Equatorial Pacific
Summary
ISP Objective Deep Biosphere and Environmental Change
Resolve crucial questions concerning: paleo-productivity, astronomical calibration of the geological time scale for the
Cenozoic, temperature and nutrient profiles nad gradients, changes of the CCD. Obtain the best caronate preserved
Scientifc Purpose(s) record in the Pacific from the EOCene to Miocene. Investigate how, where and when paleo-productivity changed.
Integrate seismic and sediments to develop a basin scale model of oceanic circulation. Use age slice approach on
paleo-euqator to obtain shallow burial.
Vessel Riserless
Operation Time Estimate 48 days for drilling and logging from proponents (IO estimate total time to be 86 days)
Lithology Pelagic clay, siliceous ooze, calcareous ooze, chalk and chert
Environmental Constraints None
Drilling/Coring Drill 8 sites using triple APC to refusal then XCB to basement
Logging Standard logging with triple combo and FMS Sonics
Limitations / Assumptions NSF survey pending
Technical Issues Poor recovery in Chalk-Chert Sequences
Status of Technical Issues No special tools will be utilized. Consider advancing only 4.5meters
3rd Party Requirements No third party tools presently requested
Special Tools APCT measurements
Costs scale
Milestones
SAS / OTF History
Apr-03 FULL
iSSP Jul-03 sites classified as 3A
Apr-04 FULL2
SSEP Nov-04 Unlikely for 2005, possible for later ; Forwarded to SPC
SSP Feb-05 All sites classified as a 2B based on scheduled site survey
Ranked #3 and forwarded to OTF - SPC Consensus 0503-21: The SPC forwards the top three of nine ranked
proposals, 603C-Full NanTroSEIZE Plate Interface, 595-Full3 Indus Fan and Murray Ridge, and 626-Full2 Pacific
SPC Mar-05 Equatorial Age Transect, for the Operations Task Force to consider in developing drilling schedule scenarios for
FY2007 and beyond. SPC nominated prospective Co-chief candidates
A site survey is required for the equatorial Pacific program to determine specific site locations. It is unclear when this
OTF Jun-05 cruise will be completed. This could jeopardize the equatorial Pacific program, if scheduled early.
Timing of the site survey has not been resolved and raises the question as to when is the earliest that the Equatorial
Pacific program can be scheduled. NOTE added in proof: Site survey now planned for early 2006 with an EPSP email
OTF Oct-05 review probably in August 2006. Starting with the Equatorial Pacific provides maximum flexibility in the planning
process both from operational and SODV perspectives.
Schedule approved - SPC Motion 0510-23: The SPC approves the FY2007-08 operations schedule of the
U.S.scientific ocean drilling vessel (SODV) as proposed in model 2 of the Operations Task Force. The recommended
SPC Oct-05 expeditions will begin in August 2007 and proceed as follows: - Equatorial Pacific Paleogene Transect (Proposal 626-
Full2)…
Concern expressed with the lengthy drill time for 626-FUll2 - SPC Consensus 0603-29: The SPC approves the revised
FY2007-09 operations schedule of the U.S. scientific ocean drilling vessel (SODV) as proposed in Model 1B of the
Operations Task Force (OTF). The recommended expeditions would begin in August 2007 and proceed through March
2009 as follows: - Equatorial Pacific Paleogene Transect I (Proposal 626-Full2) - Costa Rica Seismogenesis Project
Stage 1 (Proposal 537A-Full5) - NanTroSEIZE Stage 1 (Proposals 603A-Full2, 603B-Full2, 603C-Full) - NanTroSEIZE
Stage 1 continued (Proposals 603A-Full2, 603B-Full2, 603C-Full) - Bering Sea Paleoceanography (Proposal 477-Full5)
- Juan de Fuca Flank Hydrogeology III (Proposal 545-Full3) - Equatorial Pacific Paleogene Transect II (mini expedition,
SPC Mar-06 Proposal 626-Full2) - Canterbury Basin (Proposal 600-Full) - Wilkes Land Margin (Proposals 482-Full3, 638-APL2)
SPC-OTF members felt that it was more important to fulfill the Equatorial Pacific objectives (or at least complete a large
majority of the eight proposed sites, as opposed to doing ~half the sites) then to make a major start at CRISP
OTF Jun-06
The first Equatorial Pacific expedition would require the USIO to receive an exemption from the Passenger Act (as it
will pick up and drop off scientists in Honolulu). This act requires non US-flagged vessels to first land at a non-US port
after leaving a US port. While it is possible to get this exemption, it is a risk to be considered at this time.
Sites approved. In order to obtain final drilling approval proponents are required to submit to the EPSP Chair, USIO
EPSP Jun-06 and to IODP-MI the completed safety sheets for PEAT-3D and PEAT5-D.
SSP Jul-06 Sites classified as 1Aa (Peat 1C to 8C).
readjustments required in the event of a delay in the starting date for SODV operations. The recommended expeditions
SPC Aug-06 will begin in November 2007 and proceed as follows: -Equatorial Pacific Paleogene Transect I (Proposal 626-Full2), -
NanTroSEIZE Stage I (Proposals 603A-Full2, 603B-Full2, 603C-Full)
-NanTroSEIZE Stage I continued, -Bering Sea Plio-Pleistocene Paleoceanography (Proposal 477-Full4), -Juan de Fuca
Flank Hydrogeology II (Proposal 545-Full3), -Equatorial Pacific Paleogene Transect II (Proposal 626-Full2)
date to international operations and a short transit, the approved schedule would include the following sequence:
Expedition 301
operations
Recommended that SODV operations start at the beginning of Mar 2008 with back to back Eq Pac programs and the
OTF Jul-07 second program will also include Juan de Fuca remedial cementing operations.
633-Full2
Title:
Mud extrusion and seamount subduction along the Middle America continental
slope – deciphering deep fluid processes at an erosive convergent margin
Proponent(s): C. Hensen & W. Brueckmann, both at: Leibniz Institute for Marine Sciences, IFM-GEOMAR, Kiel, Germany, N. Fekete,
IFM-GEOMAR, Kiel, Germany, T. Ferdelman, Max-Planck Institute for Marine Microbiology, Bremen, Germany, A.
Fisher, University of California, Santa Cruz, USA, J.C. Fry, School of Biosciences, Cardiff University, Wales, UK, I.
Grevemeyer, IFM-GEOMAR, Kiel, Germany, M. Haeckel, IFM-GEOMAR, Kiel, Germany, Bo B. Jørgensen, Max-Planck
Institute for Marine Microbiology, Bremen, Germany, S. Morita, Geological Survey of Japan, AIST, Tsukuba, Japan, T.
Mörz, Research Center Ocean Margins, Bremen University, Germany, C. Müller, Bundesanstalt für Geowissenschaften und
Rohstoffe, Hannover, Germany, J. Parkes, Earth, Ocean and Planetary Sciences, Cardiff University, Wales, UK, C.R.
Ranero, Instituto de Ciencias del Mar, Barcelona, Spain, T. Reston, IFM-GEOMAR, Kiel, Germany, V. Spiess, Department
of Geosciences, Bremen University, Germany, K. Takai, JAMSTEC, Japan Marine Science and Technology Center,
Yokosuka, Japan, A. Talukder, IFM-GEOMAR, Kiel, K. Wallmann, , IFM-GEOMAR, Kiel, Germany, A.J. Weightman,
School of Biosciences, Cardiff University, Wales, UK
Keywords: Central America
(5 or less) mud diapirs, seamounts, fluid flow, Central America, Area:
(Costa Rica)
Contact Person: Warner Brueckmann
Department: SFB574
Organization: Leibniz Institut für Meereswissenschaften, IFM-GEOMAR, Kiel, Germany
Address Wischhofstr. 1-3, 24148 Kiel
Tel.: +49 431 600 2819 Fax: +49 431 600 2916
E-mail: wbrueckmann@ifm-geomar.de
Permission to post abstract on IODP-MI Web site: Yes

The active continental margin off Costa Rica and Nicaragua comprises a unique set of geological features that provide insight
into deep fluid processes. We propose to drill sites of active fluid dewatering in order to elucidate fluid flow processes and
constrain dewatering budgets at an erosive continental margin. Major sites of dewatering are mounds, positive sea floor
anomalies, which are related mud diapirism/volcanism and precipitation of authigenic carbonates, and large-scale slides related
to the subduction of seamounts. Recent data compilations suggest that fluid advection - triggering the development of mud
liquefaction and upward migration –can be attributed to deep structural processes that favor the release of mineral-bound, fresh
water from subducting sediments between 10-12 km depth. Preliminary budget calculations based on the total number of
dewatering sites and average rates of fluid expulsion indicate that up to 90% of this mineral-bound water is recycled within the
forearc. Data from expelled mud volcano fluids, however, show significant spatial differences in geochemical composition
suggesting variations in flow velocity and alterations along the flow path. In addition, unequivocal data could not be obtained
from any seamount site. Hence, drilling information is needed to understand the interrelationship between deformation and fluid
generation in an erosive margin setting.
The suggested drilling will not only improve our understanding of processes controlling and driving fluid flow, but also
constrain volatile and material budgets of the erosive subduction system. In general, the following major hypotheses are to be
tested: (1) Mud diapirism/volcanism is a major dewatering pathway and provides a window into deep fluid processes. (2)
Seamount subduction creates major pathways for deep fluid advection and canalization. (3) Release of deep, freshened fluids
controls mud mobilization and hence the formation of the mounds and their internal build-up.
The Pacific margin offshore Costa Rica is one of the best-studied continental margins worldwide and processes observed here
might be representative for erosive continental margins in general. Hence, the proposed drilling sites offer the unique
opportunity to calculate real mass budgets of forearc recycling of fluids and volatile elements. This knowledge is of key
importance in terms of a better understanding of the role of subduction zone processes in global biogeochemical cycles.
633-Full2
Mound structures observed in numerous places along the Costa Rica and Nicaragua margin are manifestations of
dewatering pathways that essentially control and balance the overall fluid budget at this erosive convergent margin.
The major pathway of forearc dewatering is triggered by the release of mineral-bound water at the plate boundary (at
10-12 km depth). Characteristic, freshened fluids are flowing upwards along pervasive faults and vent at mounds and
seamount scarps at mid-slope depths. We propose to drill 2 deep (800 m) drill holes, one at each of the mounds
(Mound Culebra, Mound 11) to trace the main fluid conduits and monitor fluid flow and fluid geochemistry over
time.
Seamount subduction at the Central America continental margin provides an unusual mechanism for dewatering and
devolatilization of subducting sediments by creating deep-reaching faults and fractures and causing large collapse
structures on the slope. It is proposed to drill two deep (1000 m) holes on top of Jaco Scarp and on a terrace near the
base of the slide created by it. This will help to identify fluid pathways and dewatering patterns in the wake of the
subducting seamount.
The internal build-up of the mounds has major implications for the development of fluid conduits, the potential
mixing of fluids from different sources, and allows major conclusions on the evolution and fundamental mechanisms
of mound formation. In order to further the understanding of these fundamental questions we propose to drill
additional cores (up to 500 m) at the mounds.
Proposed Sites:
(m) Sed Bsm Total
CRMD-04A -86:18:22, 10:17:51 1500 800 0 800 identify source depth and
CRMD-04B -86:18:33, 10:17:44 1500 500 0 500 geochemistry of
CRMD-04C -86:18:19, 10:18:05 1500 500 0 500 sediments, sediment
CRMD-04E -86:18:06, 10:18:00 1500 500 0 500 structure
CRMD-05A -84:18:15, 8:55:22 2250 800 0 800 identify source depth and
CRMD-05B -84:18:36, 8:55:22 2250 500 0 500 geochemistry of
CRMD-05D -84:18:30, 8:55:36 2250 500 0 500 sediments, sediment
structure
CRSM-02C -84:49:58.8, 9:07:40.8 1200 1000 0 1000 fluid geochemistry and

CRSM-02D -84:49:20, 9:09:00 800 1000 0 1000 pathways
Proposal Name Costa Rica Mud Mounds
Summary
To improve our understanding of processes controlling and driving fluid flow and also to constrain volatile and material
budgets of the erosive subduction system. In general, the following major hypotheses are to be tested: (1) Mud
Scientifc Purpose(s) diapirism/volcanism is a major dewatering pathway and provides a window into deep fluid processes. (2) Seamount
subduction creates major pathways for deep fluid advection and canalization. (3) Release of deep, freshened fluids
controls mud mobilization and hence the formation of the mounds and their internal build-up.
Vessel Riserless
Lithology Calcareous clay, indurated mud clasts
Operational Risks Shallow gas, shallow water flow, fault, methane hydrate, and diapir and mud volcano
Environmental Constraints Good weather all year
Drilling/Coring APC, XCB, and RCB drilling and coring
Logging Standard logging
Technical Issues
CORK description (if app) 4 CORKs to monitor pressure, chemical species, temperature evolution.
Costs scale 4 CORKS requested….cost may be decreased if low cost observatories deployed.
Milestones
EPSP Site Approval
OTF Scheduled
SAS / OTF History
Apr-03 PRE
iSSEPs May-03 Develop into full proposal
Apr-04 FULL
Proposal Name Costa Rica Mud Mounds
SSEP May-04 Request Revision
SSP Aug-04 Site readiness ranked as: 3A
Oct-05 FULL
SSP Jul-06 7 sites classified as 2Cd, 2 sites classified as 2Ad
637-Full2
Title: A Shallow Drilling Campaign to Assess the Pleistocene Hydrogeology, Geomicrobiology, Nutrient
Fluxes, and Fresh Water Resources of the Atlantic Continental Shelf, New England
Proponent(s): 1
M. Person, 2H. Kooi, 3B. Dugan, J. K. 2Groen, B. 2Van Breukelen, 2W.F.M Röling,
2
J. Kenter, 1P. Sauer, 1K. Litch
1
Indiana University, 2Vrije Universiteit, Amsterdam, 3Rice University
Keywords: Pleistocene, Hydrogeology, Submarine Groundwater Discharge New England

Area:
(5 or less) Continental Shelf
Contact Person: Mark Person
Department: Department of Geological Sciences
Organization: Indiana University
Address 1001 East 10th Street
Tel.: 812-855-4404 Fax: 812-855-7899
E-mail: maperson@indiana.edu

Abstract:
In many coastal settings around the world the distribution of freshwater within continental shelf sediments is
far out of equilibrium with modern sea level conditions. One of the most remarkable examples of this can be found
on the Atlantic continental shelf off New England where groundwater within shallow Pliocene-Pleistocene sand
units over 100 km offshore Long Island are remarkably fresh ( ~ 3000 mg/l salinity). On Nantucket Island to the
North, a 514 meter-deep borehole penetrating the entire Cretaceous–Tertiary sedimentary package showed
considerable vertical variations in salinity with extremely fresh (< 1000 mg/l) waters in sand aquifers, higher
salinity levels (between 30–70% seawater) in thick clays/silts and intermediate to low salinities in thin confining
units, attesting to marked disequilibrium conditions because diffusion tends to eliminate such patterns. Pore fluids
within Pleistocene to Upper Cretaceous sands beneath Nantucket Island were also found to be modestly
over-pressured by about 4 m above the local water table.
We hypothesize that the rapid incursion of freshwater on the continental shelf in New England could have
been caused by one or more of the following mechanisms: (1) Meteoric recharge during Pleistocene sea-level
low-stands including vertical infiltration of freshwater associated with local flow cells that may have developed on
the continental shelf during sea level low stands; (2) Sub-ice-sheet recharge during the last glacial maximum; (3)
Recharge from pro-glacial lakes. We further hypothesize that the overpressures could be due to either:
(1) Pleistocene sediment loading; or (2) fluid-density differences associated with the emplacement of a thick fresh
water lens overlying saltwater (analogous to excess pressures observed in gas legs of petroleum reservoirs).
We argue that these different recharge mechanisms can be distinguished using environmental isotope and noble gas
data.
This work will extend our understanding of the current and past states of fluid composition, pressure and
temperature in continental shelf environments. It will help better constrain rates, directions, and mechanisms of
groundwater flow and chemical fluxes in continental shelf environments. It will contribute to developing new tools
for measuring freshwater resources in marine environments. The apparent transient nature of continental shelf
salinity patterns could have important implications for microbial processes and long-term fluxes of carbon and
nitrogen and other nutrients to the global ocean.
637-Full2
Scientific Objectives:
We argue here that targeted drilling for the collection of hydrogeochemical, microbiological, isotopic, and noble
gas samples, measurement of hydraulic properties and fluid pressures will permit us to unravel the origin of the
offshore groundwaters and to quantify the role of continental shelves in global biogeochemical and climate cycles.
We propose to conduct a shallow (< 1000 mbsf) drilling campaign on the Atlantic continental shelf off Martha’s
Vineyard, Massachusetts to evaluate the above hypotheses and map the distribution of freshwater resources. We
propose to drill six sites along a transect off Martha’s Vineyard, MA. This transect takes advantage of existing
borehole 6001 on Nantucket Island and ENW-50 on Martha’s Vineyard. The sites were selected to obtain a suite of
hydrogeochemical/microbiological samples across the freshwater-saltwater mixing zone. Based on paleohydrologic
reconstructions by the PIs, the freshwater-saltwater mixing zone should be ~40 km offshore of Martha’s Vineyard.
Our planned drilling campaign utilizing Rotosonic drilling in combination with cased/screened wells and packer
systems for sampling should help us to overcome prior water/sediment sampling problems experienced on prior ODP
and AMCOR drilling campaigns. Post cruise mathematical modeling including direct simulation of groundwater
residence times and noble gas transport will be compared to observed pore fluid data to aid in our interpretation. The
proposed work is highly interdisciplinary and would be the first to focus almost exclusively on the coupled
hydrogeological/ biogeochemical/microbiological processes operating on the continental shelf.
Collection of noble gas samples
Proposed Sites:
(m) Sed Bsm Total
MV- 01 N 41:30 E 70:46 18 350 350 Characterize freshwater leg of

transect
N 40:57 E 70:40 19 550 Characterize saltwater-
MV- 02 550
freshwater transition zone
MV- 03B N 40:39 E 70:33 48 650 650 Characterize saltwater-
MV- 04 N 40:32 E 70:20 59 750 750 Characterize saltwater-
MV- 05 N 40:22 E 70:15 80 775 775 Characterize saltwater-
MV- 06 N 40:12 E 70:10 109 800 800 Characterize saltwater- leg of
transect
Proposal Name Atlantic Continental Shelf
Summary
To extend our understanding of the current and past states of fluid composition, pressure and temperature in
Scientifc Purpose(s) continental shelf environments thus unraveling the origin of the
offshore groundwaters and quantifying the role of continental shelves in global biogeochemical and climate cycles.
Vessel MSP
Lithology Sands, clays and silts
Operational Risks Possible hazards include: abnormal pressure and strong currents
Environmental Constraints Preferred weather window March - Aug. (avoids hurricane season and winter storms)
Drilling/Coring Rotosonic, APC to refusal and XCB
LWD + geochemical, formation flude sampling and borehole temperature and pressure - packers will be used to collect
Logging
water for Noble Gas and Environmental Isotope analysis of sand horizons.
Technical Issues Collection of noble gas samples
Costs scale MSP + specialty downhole tools requested
Milestones
Forwarded to OTF
EPSP Site Approval
SAS / OTF History
SSP Oct-01 637-Pre
SSEP Nov-03 Develop Full Proposal
637-Full
SSEP Nov-04 Proposal sent back for revision
637-Full2
SSEP May-05 Proposal sent out for external review
Ranked #3 in Group 1 however it was not forwarded to OTF due to insufficient site survey data see SPC Motion 0603-
SPC Mar-06 21: the SPC retains hold of Proposals 637-Full2, 552-Full3, 654-Full2, 555-Full3, and 667-Full because of notable
deficiencies in the completeness of their associated site-survey data. The committee will reconsider forwarding those
proposals individually to the OTF in the event of any improvement in their site-survey completeness
As of the start of the June 2006 Operations Task Force meeting, no program had been selected for FY08 MSP
operations. Several proposals had been discussed as potential candidates at previous meetings, including New South
Pacific Sea Level (519-Full2), portions of Canterbury Basin (600-Full) and England Shelf Hydrogeology (637-Full2),
although the latter was not officially at the OTF until forwarded by the SPC at its March 2006 meeting.
OTF Jun-06
The most viable MSP operation following completion of New Jersey Shallow Shelf and the Great Barrier Reef programs
is New England Hydrogeology. However, this program is in the “SPC Holding Bin” as it is in need of site surveys. The
status of those surveys is uncertain at this time. OTF, however, determined that this proposal could benefit from limited
scoping activities to resolve technical issues and possibly guide the site survey proponents in designing surveys.
commended the proponents for attempting to assess fresh water deposits beneath the continental shelf. The results of
the proposed MCS geophysical program are expected to provide geologic maps of the unconsolidated sands while the
TDEM survey is expected to enable an understanding of the nature of the pore water contained in the sands. This
survey will enable the proponents to optimize site locations and penetrations for the proposed program. SSP
understand that drilling into unconsolidated sands, which may also be overpressured, is a difficult undertaking. The
SSP Jul-06 scientific success of the proposed program will hinge on a successful drilling and sampling effort. The proponents have
proposed a variety of drilling and sampling methods (which are not necessarily complementary), but it is not clear to us
that there is a body within SAS with a mandate to develop and/or evaluate such methods. In order to avoid
unnecessary delays in developing a drilling strategy for this proposal, SSP urges SPC to consider this issue as a matter
of urgency.
All sites classified as 2Cd
SPC Consensus 0608-10: The SPC receives SSP Consensus 0607-01 concerning the drilling and sampling
technology for Proposal 637-Full2 New England Shelf Hydrogeology. The committee notes that the Engineering
SPC Aug-06 Development Panel (EDP) and the Scientific Technology Panel (STP) have already reviewed this proposal and
provided feedback to the proponents and the program
Proposal 637 – New England Hydrogeology – is a placeholder for MSP 2009. No site survey data are available. An
EPSP Jan-07 update to the reef drilling guidelines was presented. EPSP members are asked to review guidelines and provide
recommendations so that the guidelines can be finalized before the June panel meeting.
Received 1 October 2006
644-Full2
Title: ENVIRONMENTAL SIGNIFICANCE OF THE MEDITERRANEAN

OUTFLOW WATER AND ITS GLOBAL IMPLICATIONS
Proponent(s):
Professor Dr. Dorrik STOW 1& Dr. Fº Javier HERNÁNDEZ-MOLINA2
1
National Oceanography Centre, Southampton (NOCS), Waterfront Campus, Southampton SO14 3ZH,
UK (davs@soc.soton.ac.uk)
2
Facultad de Ciencias del Mar, Universidad de Vigo, 36200 Vigo, Spain (fjhernan@uvigo.es)
Keywords: Gateways, global implications, paleoceanography, Gulf of Cadiz &
(5 or less) environmental changes, contourites Area: West Iberian
Margin
Contact Person: Francisco Javier Hernández Molina
Department: Geociencias Marinas
Organization: University of Vigo
Address Campus Universitario Lagoas-Marcosende
Tel.: 0034-986-814017 Fax: 0034-986-812614
E-mail: fjhernan@uvigo.es
This is a paleoceanographic proposal focussing on the broader significance of Mediterranean

Outflow Water (MOW) on North Atlantic circulation and climate. It addresses important questions
highlighted in the IODP Initial Science Plan related to paleocirculation and climate, the influence of
oceanic gateways, and sea-level control on sediment architecture along continental margins. In order
to answer these questions, we propose targeted drilling of a Neogene continental margin sequence in
the Gulf of Cadiz and off West Iberia. The high rates of accumulation associated with Contourite
Depositional System (CDS) deposits in this region provide an expanded sedimentary record that
permits detailed examination of paleocirculation patterns linked to past environmental change. This
proposal offers a unique opportunity to understand the global link between paleoceanographic, climatic
and sea-level changes from Messinian to recent time. The Gulf of Cadiz and off West Iberia CDS is
an extensive compound sedimentary body, which has been developing along the mid-slope over the
past 5 million years, under the direct influence of MOW. It therefore holds an unmistakable signal of
MOW through the Gibraltar Gateway, re-opened following tectonic adjustments at the end of the
Messinian Salinity Crisis, and hence a clear record of Mediterranean Sea and MOW influence on the
North Atlantic Ocean.
An extensive array of high quality data exists for the region and a detailed seismic stratigraphic
framework has recently been proposed, which can only be confirmed by drilling. Seven primary sites
have therefore been identified that will allow us to identify and calibrate the third and fourth order
depositional units and associated widespread erosive discontinuities across the CDS. This is of great
significance, both regionally and globally, for: (1) monitoring the long-term variability of MOW and
its global climatic significance; (2) constraining the main paleoceanographic events through late
Miocene to Recent time, including high-resolution focus on late Pleistocene and Holocene rapid
climate events; (3) evaluating the influence of opening of the Gibraltar gateway on North Atlantic
oceanography and climate, and monitoring the effects of sea-level change on MOW flux; (4)
understanding the architecture of a complex contourite depositional system, and the nature of its unit
stacking pattern related to allogenic and autogenic controls and (5) investigating the dramatic large-
scale asymmetric cycles of seismic character evident on high-resolution records, thereby identifying
their occurrence onto Quaternary-Pliocene climate/sea-level and paleoceanographic changes.
i
644-Full2
An extensive Contourite Depositional System (CDS) has been developing within the Gulf and the
West Iberian Margin over the past 5 million years as the direct result of the Mediterranean Outflow
Water (MOW). The high rates of accumulation and expanded sedimentary records of drift deposits
permit high-resolution examination of past environmental change. The CDS deposits, therefore, hold the
very best signal of MOW flow through the Gibraltar gateway, and a clear record of its influence on the
oceanography and climate of the North Atlantic Ocean and on North Atlantic Deep Water (NADW)
variability. The importance of the Gulf of Cadiz is clearly reflected in the large number of regional
studies and multinational interest shown over the past 30 years. But, despite such extensive surveying,
the region has not yet been drilled for scientific purposes, even though the Gibraltar gateway clearly has
major implications for global climate and oceanography. We have identified the following four broad
scientific objectives, which require a total of seven drill sites through the Pliocene to Quaternary
sedimentary record: 1) Influence of the Gibraltar Gateway; 2) MOW paleoceanography and global
climate significance; 3) Sea-level changes and sediment architecture of the Cadiz CDS and Iberian
margin; and 4) Synsedimentary neotectonic control on architecture and evolution of the CDS. To
achieve theses major scientific objective, it is essential to integrate the results of the proposed drill sites
with a dense network of existing high-resolution seismic reflection profiles. Interpretation of this
seismic network is already well established, although the inferred ages require drilling confirmation.
Please describe below any non-standard measurements technology needed to achieve the proposed
scientific objectives.
Proposed Sites:
Water Penetration (m) Brief Site-specific Objectives
Site Name Position Depth (See Sites location and proposal
(m) Sed Bsm Total for further details)
Site GC-01A 36º 49´38´´ N 900 m 475 m 475 m MOW upper core (Only
7º 44´ 43´´ W Quaternary record)
Themes 1,2 & 3
MOW upper core (Only Pliocene

Site GC-09A 36º 48´ 19 ´´ N 654 m 625 m 625 m record)
7º 43´ 09´´ W Themes 1,2 & 3
36º 17´08´´ N 800 m 450 m 450 m Neotectonic
Site GC-02A
7º 48´ 28´´ W Theme 4
36º 15´16´ N Close to the Gibraltar Gateway

Site GC-04B 6º 48´ W 810 m 750 m 750 m Themes 2 & 3
MOW lower core (Pliocene &

Site GC-05B 36º 25´42´´ N 655 m 615 m 615 m Quaternary record)
7º 14´ 06´´ W Themes 1,2 & 3
37º 20´36´´ N MOW West Iberian Margin

Site WI-01B 1100 m 690 m 690 m Themes 2 & 3
9º 25´ 18´´ W
Site WI-02A 37º 48´ N 3146 m 733 m 733 m MOW influence on the Global
10º 10’ W System.
Theme 2
ii
Proposal Name Gulf of Cadiz
Summary
To learn more on: 1) Influence of the Gibraltar Gateway; 2) MOW paleoceanography and global climate significance;
Scientifc Purpose(s) 3) Sea-level changes and sediment architecture of the Cadiz CDS and Iberian margin; and 4) Synsedimentary
neotectonic control on architecture and evolution of the CDS.
Water Depth 654 -3146 m
Vessel Riserless
Operation Time Estimate 58 days (including port call)
Lithology Sands, silts, clays, marls
Operational Risks Shallow gas, shallow water flow, soft seabed, and currents
Environmental Constraints Currents,
Drilling/Coring Drill 7 sites using single-APC, XCB to refusal, and RCB to target depth
Logging Standard logging
Technical Issues
Costs scale
Milestones
EPSP Site Approval
OTF Scheduled
SAS / OTF History
Apr-04 PRE
SSEP May-04 Request pre-proposal revisions
Apr-05 PRE2
SSEP May-05 To be developed into full proposal
Oct-05 FULL
Proposal Name Gulf of Cadiz
SSEP Jun-06 Revise Full
SSP Jul-06 All sites classified as 3A
Oct-06 FULL2/PRL2
Received 30 May 2006
New Revised X Addendum
654-Add
Title:
Testing Plume and Plate Models of Ocean Plateau Formation at Shatsky
Rise, Northwest Pacific Ocean
Proponent(s): William W. Sager (Texas A&M University), John J. Mahoney (University of
Hawaii), Yoshiyuki Tatsumi (Kyoto University), Masao Nakanishi (Chiba
University), Anthony Koppers (University of California, San Diego), Yaoling
Niu (Durham University), Adam Klaus (Texas A&M University)
Keywords: Northwest
Plume, hotspot, plateau, Pacific Ocean, Shatsky Rise Area:
(5 or less) Pacific Ocean
Contact Person: William W. Sager
Department: Oceanography Department
Organization: Texas A&M University
Address MS-3146, College Station, TX 77843-3146 USA
Tel.: 979-845-9828 Fax: 979-845-6331
E-mail: wsager@ocean.tamu.edu

One of the most fundamental questions of modern geodynamics is the process of mantle convection
and its impact on the Earth’s surface through volcanism. The greatest source of non-ocean-ridge
volcanism appears to be massive eruptive episodes that formed oceanic plateaus, volcanic passive
margins, and continental flood basalts. A widely accepted hypothesis for such volcanism is that it
results from the head of a starting plume, which rises from the deep mantle, spreads out beneath the
lithosphere, and melts cataclysmically in a massive outpouring of volcanic activity. Despite the wide
acceptance of this hypothesis, a convincing case for a plume head origin has not been made for any
plateau; rather, significant complexities have been revealed by recent drilling of the Kerguelen and
Ontong Java plateaus. Indeed, non-plume models for non-ridge oceanic volcanism recently have
gained favor among some workers, and the very existence of mantle plumes has been questioned.
One great difficulty with research to date is that the original setting, relative to mid-ocean ridges and
plate tectonics, is poorly known for most plateaus because they were formed during the
mid-Cretaceous when no magnetic reversals formed ridge-parallel anomalies to record ridge
locations. Shatsky Rise, located 1500 km east of Japan, is unique in being the only large oceanic
plateau formed during a time of magnetic reversals, permitting its tectonic setting to be resolved.
Magnetic lineations show that the plateau formed along the trace of a triple junction, intimately
related to ridge tectonics. Existing data demonstrate that several aspects of Shatsky Rise’s history
(e.g., massive, rapid initial growth, transition from large magma flux to small, capture of ridges) fit
the plume head model. On the other hand, the coincidence of volcanism with the triple junction,
ridge jumps, and the lack of isotopic evidence for a hotspot-type mantle source can all be taken as
favoring a plate-controlled origin. Its unique combination of features makes Shatsky Rise the best
location on Earth to test plume versus plate-tectonic hypothesesof ocean plateau formation. We
propose a single leg on the non-riser drill ship to core ~1000 m of igneous basement at 6 sites on
Shatsky Rise to examine the history, source(s), and evolution of this plateau. From the results, we
hope to be able to put to rest the question of whether oceanic plateaus like Shatsky Rise were formed
from deep-sourced mantle plumes or interaction of plate boundaries and the lithosphere with the
shallow mantle.
654-Add
The primary objective is to core igneous rocks from the volcanic massifs of Shatsky Rise to
determine the age, sources, and evolution of this plateau and to test hypotheses of a plume head or
plate-controlled origin. Primary data will be radiometric ages, chemical and isotopic composition,
and mineralogical information that will allow scientists to understand under what conditions and
from what source the igneous rocks were derived. Other goals are to learn about the surface
manifestation and environment of emplacement of this plateau through lithostratigraphic core and
log data; to illuminate plate motions and volcanic structure from paleomagnetic data; and to explore
links between Shatsky Rise formation and the synchronous Jurassic-Cretaceous boundary through
stratigraphic, geochemical, and age data.
Proposed Sites:
(m) Sed Bsm Total
Recover igneous rock; TAMU
SRSH-2A 30° 49.17’N, 156° 21.90’E 4721 297 100 397
Massif lower flank
Recover igneous rock: TAMU
SRSH-3 32° 18.57’N, 158° 59.88’E 2987 311 300 611
Massif summit
SRSH-5 32° 50.98’N, 157° 52.92’E 3450 210 100 310 Recover igneous rock; TAMU
Massif summit
SRSH-6 34° 25.32’N, 159° 22.93’E 3268 150 100 250 Recover igneous rock; TAMU
Massif faulted north flank
SRCH-3 36° 00.52’N, 158° 20.97’E 3243 130 300 430 Recover igneous rock; ORI
Massif summit
SRNH-1 37° 49.27’N, 162° 59.19’E 3339 265 100 365 Recover igneous rock; Shirshov
Massif summit
Proposal Name Shatsky
Summary
The primary objective is to core igneous rocks from the volcanic massifs of Shatsky Rise todetermine the age, sources,
and evolution of this plateau and to test hypotheses of a plume head or plate-controlled origin. Other goals are to learn
about the surface manifestation and environment of emplacement of this plateau through lithostratigraphic core and log
data; to illuminate plate motions and volcanic structure from paleomagnetic data; and to explore links between Shatsky
Rise formation and the synchronous Jurassic-Cretaceous boundary through stratigraphic, geochemical, and age data.
Vessel Riserless
Lithology Ooze, cherty chalk, cherty shaley chalk sediment; basalt basement
Operational Risks Possible Hazards include strong currents
Environmental Constraints Typhoon season July - Nov. Kuroshio current.
Drilling/Coring RCB coring at 6 sites.
Logging Standard logging at 2 sites: SRSH-3 and SRCH-3.
Technical Issues
Costs scale
Milestones
EPSP Site Approval
OTF Scheduled
SAS / OTF History
Oct-04 FULL
SSEP Nov-04 Sent back for revision
Proposal Name Shatsky
SSP Feb-05 All sites classified as a 3A/3B
Apr-05 FULL2
SSP Sep-05 All sites classified as a 2A/2C
SRNH-1: 1Bb (A few required items are missing from the Data Bank but data are readily available, data image the
target adequately but there are scientific concerns of drill site location or penetration) - SRSH-2A, SRSH-6: 2Cc
SSP Feb-06 (Substantial items of required data are not in the Data Bank and not believed to exist, data do not image target
adequately) - SRCH-3, SRSH-3, SRSH-5: 1Bc (A few required items are missing from the Data Bank but data are
readily available, data do not image target adequately)
5 of the six drilling sites need better images and no site surveys have been scheduled. - sites incompletely
characterized.
Ranked 11th out of 17 to forward on to the OTF in Group II. (SPC Motion 0603-21) In practice, however, the SPC
SPC Mar-06
retains hold of Proposals 637-Full2, 552-Full3, 654-Full2, 555-Full3, and 667-Full because of notable deficiencies in the
completeness of their associated site-survey data. The committee will reconsider forwarding those proposals
individually to the OTF in the event of any improvement in their site-survey completeness.
SSP Jul-06 New survey data submitted - Sites PEAT 1C to 8C 1Aa
Has been inserted into the TBD slot in the late FY08 SODV schedule. Primarily based on better weather window than
OTF Jul-07 Mariana and NanTroSEIZE.
SPC Mar-07 SPC Concensus 0703-13: SPC Ranked 6th out of 15 and was forwarded to the OTF in group I.
X New Revised Addendum
659-Full
Title:
CONTINUED DRILLING IN THE NEWFOUNDLAND BASIN TO ADDRESS THE
OBJECTIVES OF CONJUGATE MARGIN DRILLING IN A NON-VOLCANIC RIFT
Proponent(s): Brian E. Tucholke, Neal W. Driscoll, W. Steven Holbrook, John R. Hopper, Keith Louden,
Gianreto Manatschal, Kathleen Marsaglia, Timothy A. Minshull, Alastair H. F. Robertson,
Dale S. Sawyer, Donna Shillington, Jean-Claude Sibuet, Shiri P. Srivastava, Elspeth Urquhart,
Robert B. Whitmarsh, Xixi Zhao
Keywords: Continental extension and breakup, non-volcanic conjugate North Atlantic,
(5 or less) margins, rifting to seafloor-spreading transition, mantle Area: Newfoundland
exhumation, serpentinite. Basin.
Contact Person: Brian E. Tucholke
Department: Geology and Geophysics
Address Clark 241, MS 22, Woods Hole, MA 02543, USA
Tel.: 508-289-2494 Fax: 508-457-2187
E-mail: btucholke@whoi.edu

The underlying premise of many empirical, analytical, and numerical models of continental rifting is that
mantle melt supply and/or temperatures prior to and during extension govern structural architecture and magmatic
construction in the rift. However, drilling on the Iberia margin has documented extreme extension with little or no
decompression melting of the asthenospheric mantle in a wide transition zone, defying model predictions. The
puzzles raised by Iberia drilling are compounded by observations from geophysical studies in the transition zone
on the conjugate Newfoundland margin, which document significant cross-rift asymmetries in basement depth,
amount of tectonic extension, and other deep structure. These results raise fundamental questions about rifting of
non-volcanic margins, including the cause and extent of mantle unroofing, the presence or absence of
decompression melting, the origin of the deep and crustal asymmetry between conjugates, the age-subsidence and
strain-partitioning history, and the relation of rift events to development of shallow-water unconformities and the
stratigraphic record.
ODP Leg 210 conducted the first conjugate-margin drilling in the history of the Ocean Drilling Program, to
study the transition zone in the Newfoundland Basin in a position conjugate to the ODP Leg 149/173 drilling
transect across the Iberia Abyssal Plain. The prime Leg 210 target, Site 1276, drilled to 1737 mbsf and bottomed in
latest Aptian to earliest Albian post-rift diabase sills some 90-160 meters above basement; appropriate drillin
casing or liner was not available to complete the hole into basement. Site 1277, drilled 40 km seaward near
magnetic anomaly M1, recovered serpentinized peridotite that appears to represent autothonous basement, even
though magnetic anomalies and wide-angle velocity data suggest that this is normal oceanic crust.
Fundamental questions about nonvolcanic rifts thus remain unanswered and are even magnified by the initial
Newfoundland Basin drilling.
We propose a return to Site 1276 in the Newfoundland transition zone to case the hole and deepen it at least
100 meters into basement. This hole remains the prime target for addressing the broadest range of questions about
the process and results of non-volcanic rifting. We also propose alternate sites seaward of Site 1276 to investigate
the transition from rifting into steady-state seafloor spreading. We propose a set of working hypotheses for the
origin of the Newfoundland and Iberia transitions zones. Newfoundland drilling results, together with constraints
from Iberia drilling and from rift-basin studies of the adjacent Grand Banks and Lusitania Basin will provide direct
tests of these hypotheses.
659-Full
• Determine the nature of basement in the Newfoundland transition zone (is it exhumed mantle like that off Iberia?),
and investigate the mechanisms responsible for its emplacement.
• Investigate whether lithospheric thinning and removal of the continental crust occurred with or without
decompression melting of the asthenospheric mantle (was the entire rift amagmatic?).
• Examine what compositional features in basement (e.g., in serpentinites) account for the formation of observed
marine magnetic anomalies along the drilling transect.
• Determine the age of basement in the Newfoundland transition zone, and the paleodepth and subsidence history
recorded in sediments deposited immediately above basement.
• Determine if the asymmetry between the Newfoundland and Iberia transition zones is an original feature of rifting
or whether it was created by post-rift magmatism.
• Investigate the source, age, and depth distribution of magmatism that emplaced diabase sills in sediments overlying
basement in the Newfoundland transition zone.
• Investigate the nature and timing of rift events (e.g., cessation of continental rifting, subsidence, transition from
rifting to seafloor spreading) and how they correlate between conjugate margins.
• Examine how spatial and temporal strain partitioning predicted from these events relate to symmetric or asymmetric
extension, distribution of melt products in the rift, development of stratigraphic sequences, and well documented
synrift and "break-up" unconformities on the shallow margins.
• Investigate the transition from non-volcanic rifting into steady-state seafloor spreading.
None
Proposed Sites:
(m) Sed Bsm Total
Site 1276 45°24.23’N, 4549 ~1900 ~220 ~2120 Interval between 1276 TD at 1737 mbsf
and basement, plus basement
(NNB01A) 44°47.15’W
penetration of at least 100 meters.
Nature and origin of transition zone
basement, basement age, age/depth
history, record of magmatism.
45°11.80’N 4626 85 200+ 285+ Basement penetration to >200 m or bit

Site 1277 destruction. Structure, origin,
(NNB04A) 44°22.60’W
deformation, alteration, magnetic
signature, magmatic interaction in
serpentinites that form the ‘ocean crust’
in the transition to steady-state seafloor
spreading.
NNB05A 45°06.2’N 4695 355 100+ 455+ Basement penetration to >100 m or bit
destruction. Structure, origin,
44°11.8’W deformation, alteration, magnetic
signature, magmatic record of basement
near anomaly M0 in the transition to
steady-state seafloor spreading.
45°01.6’N 4735 ~700 100+ 800+ Basement penetration to >100 m or bit

NNB06A destruction. Structure, origin,
44°03.0’W deformation, alteration, magnetic
signature, magmatic record of basement
near anomaly M0 in the transition to
steady-state seafloor spreading.
Proposal ID 659-Full
Proposal Name Newfoundland Rifted Margin
Summary
• Determine the nature of basement in the Newfoundland transition zone (is it exhumed mantle and investigate the
mechanisms responsible for its emplacement.
• Investigate whether lithospheric thinning and removal of the continental crust occurred decompression melting of the
asthenospheric mantle (was the entire rift amagmatic?).
• Examine what compositional features in basement (e.g., in serpentinites) account for the marine magnetic anomalies
along the drilling transect.
Scientifc Purpose(s) • Determine the age of basement in the Newfoundland transition zone, and the paleodepth recorded in sediments
deposited immediately above basement.
• Determine if the asymmetry between the Newfoundland and Iberia transition zones is an or whether it was created by
post-rift magmatism.
• Investigate the source, age, and depth distribution of magmatism that emplaced diabase sills basement in the
Newfoundland transition zone.
• Investigate the nature and timing of rift events (e.g., cessation of continental rifting, subsidence, rifting to seafloor
Vessel Riserless
Deep Hole: Section above basement are mudstone, sandstone, and grainstone. These may be intruded by diabase sills.
100 m of basement to be drilled may be basalt or serpentinite, the latter being more likely. Remote possibility of continental
Lithology
igneous or metamorphic crust. Shallow Holes: Mudstone turbidites make up the sediment layer, Basement is made up of
Serpentinites, basalts, and/or gabbros.
Pressence of hydrocarbons, abnormal pressure, eddie currents, and iceburg drift, and hole stability are concerns for deep
Operational Risks
hole. Eddie currents and iceburg drift are concern for shallow holes
June through Sept is optimum. Storms are more unpredictable and can be intense outside this window, and the chance of
hurricane passage through this area increases until the end of November.
Primary focus on drilling deep borehole site to to complete sampling of the sedimentary and igneous section between the
U reflection and basement, and to core into basement to a depth of at least 100 meters. Secondary focus is a transect of
3 shallower sites to characterize basement composition in supposedly ‘normal’ ocean crust seaward of anomaly M3.
Drilling/Coring
Drilling these holes would be primarily a post-Leg 210, IODP program. However, the holes also serve as alternates if
drilling cannot be finished in the deep hole. Deep hole involves RCB drilling and reentry of Hole 1276A - see text for
detailed plan. APC, XCB and RCB drilling used in shallow holes.
Logging plan consists of Triple Combo/FMS-Sonic/VSP logs in Reentry (deep) hole. Alternate site plan include Triple
Logging
combo/FMS-Sonic/WST logging plan.
Proposal ID 659-Full
Proposal Name Newfoundland Rifted Margin
Technical Issues No significant technical issues
3rd Party Requirements No third party tools requested for use
Costs scale
Milestones
Forwarded to SPC May05
Forwarded to OTF: rank Mar07 (originally forwarded Mar06 but returned to SPC by OTF in Jun06 since not scheduled)
SSP Classification Feb06 - 1Aa
EPSP Site Approval
OTF Scheduled
SAS / OTF History
Oct-04 FULL
SSP Feb-05 Site readiness classification of 3A
SSP Sep-05 Site readiness classification of 1B
SSP Feb-06 All sites classified as: 1Aa (All required data are in the Data Bank and have been reviewed by SSP)
SPC Mar-06 SPC Motion 0603-21: Forwarded to SPC in Group II, ranked 10 out of 17
OTF Jun-06 Will revert back to SPC if not scheduled
Oct-06 FULL/ADD
Received 30-September-2005
661-Full2
Title: Newfoundland Paleogene and Cretaceous Sediment Drifts: Deep sea circulation in a
Greenhouse world
Proponent(s): Richard Norris, Karen Bice, Tim Bralower, Helen Coxall, Jochen Erbacher, Peter Hoffmann,
Daniel Clay Kell, Dirk Kroon, Heiko Paelike, Thomas Pletsch, Ros Rickaby, Ursula Röhl,
Philip Sexton, Ellen Thomas, Brian Tucholke, Tom Wagner, Paul Wilson, James Zachos
Keywords: Paleogene, Cretaceous,, Drifts, Extreme climates, Boundary Northwest
Area:
(5 or less) Currents Atlantic
Contact Person: R.D. Norris

Department: MS-0244, Scripps Institution of Oceanography
Organization: University of California-San Diego
Address 308 Vaughan Hall, La Jolla CA 92093-0244, USA
Tel.: 858-822-2783 Fax: 858-822-3310
E-mail: Rnorris@ucsd.edu
The Newfoundland Ridges (near the “Titanic Site”) are covered by large-scale drift deposits
that accumulated under the western boundary current during the early Paleogene and late
Cretaceous “greenhouse”. We propose to drill a depth transect between 2400 m and 5000 m
water depth into a sequence of sediment drifts of late Cretaceous-Oligocene age on the J
Anomaly and SE Newfoundland Ridges. The drilling area contains an extensive record of
early Late Cretaceous and Paleogene “Extreme Climate” events and the possible onset of
northern hemisphere glaciation in the Eocene. The depth transect ranges from ~1.2 to 5 km
in the Eocene, reaching below the depth of the CCD. Therefore, the transect is ideal to
reconstruct the history of ocean chemistry through a multitude of “Extreme Climate” events.
In addition, the sequences accumulated directly under the flow path of the deep western
boundary current and so preserve a record of the chemistry, flow history, and depth structure
of the waters exiting the Nordic seas and the Arctic into the rest of the world ocean. The high
deposition rates associated with drift sedimentation also record the detailed history of past
climate transients much better than our existing records from condensed pelagic sites.
Finally, the drill sites are located under one of the regions which climate modeling suggests
should have a particularly high amplitude orbital signal and, in concert with excellent
magnetic stratigraphy seen in existing drill cores, should help to finally extend the
astronomical time scale throughout the Cenozoic.
1
661-Full2
1. History of the N. Atlantic deep waters during the Paleogene and latest Cretaceous
2. History of possible Northern hemisphere glaciation in the Eocene and Oligocene.
3. Abyssal chemistry, vertical structure and flow strength of the Deep Western Boundary Current and
outflow from the Arctic and Nordic seas
4. Expanded records of extreme climate events such as the Eocene-Oligocene glacial step (Oi1), the
hyperthermals of the early Paleogene, and the K/P mass extinction.
5. Extension of the astronomical time scale throughout the Cenozoic.
Proposed Sites:
(m) Sed Bsm Total
JA-1A 39°55'N/51°47'W 4940 550 550 deep end of transect
JA-13A 40°00'N/51°49'W 4710 300 300 within lysocline
JA-14A 40°03'N/51°49'W 4250 300 300 lower middle transect
JA-3A 40°03'N/51°37'W 4725 300 300 lysocline on transect
JA-12A 40°05'N/51°23'W 5010 400 400 deep end of transect
SENR-1B 2750 400 400 shallow end of transect

41°36'N/49°18'W
SENR-10A 40°04'N/47°43'W 4250 300 300 middle of transect
SENR-19B 41°04'N/49°18'W 2470 250 250 shallow end of transect
Upper middle of transect

SENR-11A 41°37'N/48°58'W 3300 550 550
middle of transect
SENR-16A 40°14'N/47°30'W 4120 300 300
41°32'N/49°35'W Cretaceous OAEs, Reef

SENR-5B 3180 550 550
drowning,
2
Proposal Name Newfoundland Sediment Drifts
Summary
1. History of the N. Atlantic deep waters during the Paleogene and latest Cretaceous
2. History of possible Northern hemisphere glaciation in the Eocene and Oligocene.
3. Abyssal chemistry, vertical structure and flow strength of the Deep Western Boundary Current and outflow from the
Scientifc Purpose(s) Arctic and Nordic seas
4. Expanded records of extreme climate events such as the Eocene-Oligocene glacial step (Oi1), the hyperthermals of
the early Paleogene, and the K/P mass extinction.
5. Extension of the astronomical time scale throughout the Cenozoic.
Vessel Riserless
Lithology Sediment of Carbonate Ooze, hemipelagic clay, shallow water carbonates
Operational Risks
Environmental Constraints June - July (Hurricanes, Icebergs and Gales are an issue August - May)
Drilling/Coring Double APC/XCB
Logging Standard
Technical Issues
Costs scale
Milestones
EPSP Site Approval
OTF Scheduled
SAS / OTF History
Oct-04 PRE
SSEP Nov-04 To be developed to Full Proposals
Proposal Name Newfoundland Sediment Drifts
Apr-05 FULL
SSEP May-05 Request revision of full proposal
SSP Sep-05 Site readiness classification of 1B – 2A for all sites
Oct-05 FULL2
JA-1A & -3A and SENR-1B, -5B, -10A, -11A, -16A: 1Ba (A few required items are missing from the Data Bank but data
are readily available [velocity profile, useful MBES]; data image the target adequately and there are no scientific
concerns of drill site location and penetration)
SSP Feb-06
• JA-12A, -13A, & -14A and SENR-19B: 2Aa (Substantial items of required data are not in the Data Bank but are
believed to exist [SCS profiles, velocity profile, useful MBES]; data image the target adequately and there are no
scientific concerns of drill site location and penetration)
Received 11 March 2005
IODP Proposal Cover Sheet 667-Full
Title: North West Shelf, Australia: the next step in the global approach to understanding
the role of eustasy in the generation and preservation of stratigraphy.
Proponent(s): Craig S. Fulthorpe, James A. Austin, Jr., Luc Lavier (all at UTIG), Charles Kerans (Bureau of
Economic Geology), Marita Bradshaw, Neville Exon, Donna Cathro, Richard Howe (all at
Geoscience Australia), Neil Marshall (Woodside Petroleum Ltd.).
Keywords: Sea-level, sequence stratigraphy, carbonates, continental margin North West Shelf,
Area:
(5 or less) Australia
Contact Person: Craig S. Fulthorpe
Department: Institute for Geophysics
Organization: University of Texas at Austin
Address 4412 Spicewood Springs Road, Bldg. 600, Austin, TX 78759-8500, USA
Tel.: (512) 471-0459 Fax: (512) 471-8844
E-mail: craig@ig.utexas.edu
Discrete sedimentary packages, known as sequences, are common on continental margins worldwide and the
stratal architectures, best recognized using seismic profiles, that define sequences are relatively simple. However,
these architectures result from the complex, and incompletely understood, interplay of multiple forcing
mechanisms. These mechanisms include eustatic (global sea-level) change, thought to exert primary control on
sequence timing, together with a range of local geological and oceanographic processes, e.g., rates of tectonic
subsidence and uplift, rate of sediment supply, isostasy, compaction, in-plane stress, and current activity, all of
which also influence sequence geometry and timing. Because these global and local processes act in combination,
and vary both temporally and in three dimensions spatially, determining their relative importance to the generation
and preservation of stratigraphy is a challenge that requires both geophysical and geological control. However,
developing such an understanding is fundamental to deciphering the long-term geologic and climatic history
recorded by continental margin stratigraphy.
This proposal continues a global array of scientific ocean drilling transects designed to study the influence of
eustasy on depositional cyclicity and sedimentary processes. The targeted section on the Australian North West
Shelf (NWS) constitutes a Southern Hemisphere carbonate counterpart to coeval siliciclastic examples globally,
e.g., New Jersey, Canterbury Basin (New Zealand), as well as the carbonate Great Bahama Bank, all of which have
already been drilled by ODP, or are under consideration for IODP drilling. The NWS Neogene carbonate and
mixed carbonate/siliciclastic passive continental margin displays similarities in seismic geometry and scale to these
margins. The more complex tectonic history of the NWS, and the presence of subordinate siliciclastic sediments,
will allow for expanded study of how competing formative processes interacted with global sea-level change and
tectonic subsidence to produce early Oligocene-Recent stratigraphy in this classic carbonate clastic progradational
environment.
IODP drilling of the NWS drilling will constitute a fundamental addition to the global array of transects designed
to link sequence formation and preservation to depositional and erosional forcing processes. Only by drilling
multiple basins with different tectonic and depositional histories can understanding of the relative roles of eustasy,
tectonics and local sedimentary processes in generating continental margin stratigraphy be achieved.
667-Full
Understand the timing and amplitudes of global sea-level change (eustasy) and the stratigraphic response to eustatic
change.
1) Calibrate sequence stratigraphy of late early Oligocene – Recent sequences by providing age control for
global correlation and paleobathymetric estimates for determination of eustatic amplitudes.
2) Reconstruct original depositional geometries (uncompacted) and estimate eustatic amplitudes using 2D
flexural backstripping.
3) Investigate the stratigraphic response to sea-level change:
x Extent of lowstand paleoshelf exposure; sediment transport mechanisms on shelf and slope.
x History of reef development.
x Interaction of carbonate and siliciclastic sedimentary processes through multiple sea-level cycles
x Paleocirculation (history of the Leeuwin current).
Proposed Sites:
(m) Sed Bsm Total
NCB-01A 19º 40.8’S 115º 49.0’E 131 1904 1904 Facies landward of breakpoints
of DLS3-DLS_top
NCB-02A 19º 37.1’S 115º 45.3’E 139 2384 2384 Facies landward of breakpoint
of DLS_top. Slope facies of
DLS 1-5.
NCB-03A 19º 33.8’S 115º 41.8’E 203 1392 1392 Facies immediately landward of
DLS_top.
NCB-04A 19º 29.5’ S 115º 37.6’E 315 2240 2240 Slope facies of
DLS-1-DLS_top
All sites will also sample

younger sequences, to be
interpreted in the future. These
interpretations may result in
changes to site locations and
penetrations.
Proposal ID 667-full
Proposal Name NW Australian Shelf Eustasy
Summary
Understand the timing and amplitudes of global sea-level change (eustasy) and the stratigraphic response to eustatic
change.
1) Calibrate sequence stratigraphy of late early Oligocene – Recent sequences by providing age control for global
correlation and paleobathymetric estimates for determination of eustatic amplitudes.
2) Reconstruct original depositional geometries (uncompacted) and estimate eustatic amplitudes using 2D flexural
Scientifc Purpose(s) backstripping.
3) Investigate the stratigraphic response to sea-level change:
• Extent of lowstand paleoshelf exposure; sediment transport mechanisms on shelf and slope.
• History of reef development.
• Interaction of carbonate and siliciclastic sedimentary processes through multiple sea-level cycles
• Paleocirculation (history of the Leeuwin current).
Vessel Riserless
Lithology Calcarenites, calcilutites with minor dolomites, calcsiltites and sandstones
Operational Risks Possible hazards include: shallow gas
Drilling/Coring APC to refulsal,then XCB, RCB with reentry for deep penetration
Logging Standard + Borehole seismic (WST check shot tool for core/seismic correlation)
Technical Issues Proponents asks says LWD would be nice to have available but not required in planning
Costs scale
Milestones
EPSP Site Approval
OTF Scheduled
Proposal ID 667-full
Proposal Name NW Australian Shelf Eustasy
SAS / OTF History
Apr-05 FULL
SPC Motion 0603-21: Forwarded to OTF in Group II, ranked 13th out of 17. The SPC however holds onto 667 due to
SPC Mar-06
incomplete site survey data
OTF Jun-06 Included in scenerios 1 and 2
SPC Consensus 0703-11: The SPC defines the pool of proposals to be ranked for FY2009 and beyond as including
15 of the 18 proposals reviewed at this meeting. The three exceptions are: 555-Full3 (Cretan Margin), 667-Full (NW
SPC Mar-07 Australian Shelf Eustasy), and 535-Full5/Add2 (Atlantis Bank). The SPC excludes Proposal 667-Full (NW Australian
Shelf Eustasy) from this year’s ranking pool so that the proponents’ ongoing analysis of industry seismic data can be
completed to the point that the proposal’s conceptual “preliminary” sites are fully characterized as actual sites. It is
hoped that this proposal will be ready to rank at the next SPC proposal-ranking meeting.
I ODP Proposal Cover Sheet
677-Full
✘ New Revised Addendum
Title:
Microbiology of a Sediment Pond and the Underlying Young, Cold,
Hydrologically Active Ridge Flank
Proponent(s): Katrina Edwards, Wolfgang Bach, Geoff Wheat, Andreas Teske, Axel Schippers, Julie Huber, Steve
D'hondt, Heiner Villinger, Tom McCollom, Virginia Edgcomb, Joan Bernhard, Olivier Rouxel
Keywords:
sub-surface ocean, deep biosphere, weathering North Atlantic
Area:
(5 or less) Ocean
Contact Person: Katrina Edwards
Department: Marine Chemistry & Geochemistry
Address McLean Lab, MS#8
Tel.: 508-289-3620 Fax: 508-457-2183
E-mail: katrina@whoi.edu
Permission to post abstract on IODP-MI Sapporo Web site: ✘ Yes No
We propose a Drilling Leg aimed at elucidating the microbiological communities associated

with (1) an isolated sediment pond located on a slow spreading ridge, and (2) the underlying
basement community harbored within a young ridge flank with low heat flow. The location
we propose is North Pond, at 22°N on the western flank of the Mid-Atlantic Ridge (MAR).
This region has been previously drilled (DSDP Site 395) and Hole 395A was last logged
during ODP Leg 174B. The sediment pond (~300 m maximum) overlies 7 Ma crust. We
propose several cores to sample sediments, and one core into basement (500 m basement). We
propose to CORK the basement Hole drilled here and re-CORK Hole 395A.
Three characteristics unique to North Pond make it ideal for our objectives: (1) the
geochemistry, hydrology, and geologic setting of North Pond have been previously studied,
providing the contextual information for the studies proposed herein; (2) access to young ridge
flank crust and the establishment of subseafloor “observatories” will allow us to determine the
nature of microbial communities in young ridge flanks, and the role, if any, they play in ocean
crust weathering; and (3) the isolation of the sediment pond enables major outstanding
questions about deep-seated sedimentary communities to be addressed – do the inoculum
microbes derive from the sediments themselves as they are laid, or do deep communities
propagate laterally within sediments from deeper sources following redox gradients?
Combined molecular microbiological, geochemical, mineralogical, isotopic, and
microscopic methods will be used to study North Pond. Results of the drilling and CORK
operations will provide new insights and long-term opportunities to study biogeochemical
subseafloor processes in a section of young ridge flank that may be representative of globally
"average" ridge flank processes.
677-Full
NP-1: Our first priority is to drill the NW edge of North Pond (near Hole 1074A). This Site is in
vicinity of hydrological discharge, and high local heat flow. Piston-core (PC) drilling of sediment
will be followed by 500 m basement drilling (rotory core). Major objectives at NP-1 are paired
microbiological/chemical studies of recovered sediment and basement and the installation of
packers and basement microbiology "observatories" for long-term studies. Hole will be CORKed.
NP-3: Our second priority is to drill sediment (only; PC) at the SE edge of NP (near Hole 395A).
This Site is in vicinity of hydrological recharge and low local heat flow. Major objectives at NP-3
are paired microbiological/chemical studies of recovered sediment, and returning to Hole 395A for
installation of basement microbiology "observatories" with packers and re-CORKing.
NP-2/NP-4: Our third priority is to drill sediment (only; PC) at 1-2 deeper locale(s) at midpoint
along the flow path between the two Sites we propose to drill above. Two Sites are selected, a
primary (NP-2) and alternate (NP-4). NP-2 is directly in line with above drilling Sites; alternate is
2100 m SE of NP-2. Major objectives are paired microbiological/chemical studies on recovered
sediment.
At NP-1 and NP-3, line observatories, packers, and CORKing will be installed following methods
used for IODP Leg 301.
Proposed Sites:
(m) Sed Bsm Total
NP-1 22°46.63'N 46°06.47'W 4450 100 500 600 Recover sediments and
basement for chemical and
biological analysis. Log, set
triple packers, observatories,
and CORK Hole.
NP-2 22°46.10'N 46°05.78'W 4450 200 200 Recover sediments for

chemical and biological
analysis.
NP-3 22°45.57'N 46°05.13'W 4450 120 120 Recover sediment for chemical
and biological analysis. Set
triple packer, observatories,
and reCORK Hole 395A.
NP-4 22°46.095'N 46°06.76'W 4450 220 220 Recover sediments for

chemical and biological
analysis.
Proposal Name Mid-Atlantic Ridge Microbiology
Summary
To provide new insights and long-term opportunities to study biogeochemical subseafloor processes in a section of young
ridge flank that may be representative of globally "average" ridge flank processes.
Water Depth 4450 m
Vessel Riserless
Lithology Nannofossil ooze and clay sediments , Basalt basement
Operational Risks none identified
Environmental Constraints Heaviest seas August - November
Triple-APC/XCB at 4 sites into the uppermost basement. One deeper hole which requires casing the upper 5 m of basalt,
Drilling/Coring cementing the hole, RCB to 500m, and installing a multilevel CORK. Re-entry of Hole 395A, set microbial observatories,
triple-packer, and reCORK hole.
Logging Standard logging plus multi-level packers, CORK, WSTP at site NP-1
Technical Issues line observatories, packers, and CORks will be installed. Possible use of hammer-in casing
CORK description (if app) Multi-level (multipacker) CORK, complete reentry and CORK (similar to Exp. 301)
Costs scale One multi-level CORK
Milestones
OTF Scheduled
SAS / OTF History
Apr-05 FULL
Proposal Name Mid-Atlantic Ridge Microbiology
SPC Mar-06 SPC Motion 0603-21: Forward to OTF for scheduleling in Group I. Ranked 1st out of 17.
OTF Jun-06 Included in Scenerio 1

The Okhotsk and Bering Seas High Resolut

Uploaded by

Document Information

Copyright

Available Formats

Share this document

Share or Embed Document

Sharing Options

Did you find this document useful?

Is this content inappropriate?

Copyright:

Available Formats

The Okhotsk and Bering Seas High Resolut

Uploaded by

Copyright:

Available Formats

Received 28 Jan 2006

IODP Proposal Cover Sheet

Title: The Okhotsk and Bering Seas: High Resolution Plio-Pleistocene

Permission to post abstract on IODP-MI Sapporo Web site: X Yes No

Abstract: (400 words or less)

Title: Cenozoic East Antarctic Ice Sheet History from the

Permission to post abstract on iSAS Web site: Yes No

Abstract: (400 words or less)

WLRIS-01A 64°54 S/145°59 E 3345 700 0 700 Late Neogene and

WLSHE-08A 66°00 S/143°18 E 525 250 0 250 Miocene fluctuations

Keywords: Cenozoic, Ice sheet evolution, East Antarctica

Permission to post abstract on IODP-MI Sapporo Web site: Yes No

Abstract: (400 words or less)

WLSHE-08A 66º00’S, 143º18’E 525 220 0 220 Fluctuations in glacial regime

Title: Mariana Convergent Margin: Geochemical, Tectonic, and Biological Processes at

Permission to post abstract on iSAS Web site: Yes

Abstract: (400 words or less)

To examine serpentinite muds and pore

To examine serpentinite muds and pore

To examine serpentinite muds and pore

To examine serpentinite muds and pore

To examine serpentinite muds and pore

To examine serpentinite muds and pore

Permission to post abstract on iSAS Web site: No

Proposed Sites: (Only High Priority Sites are listed here.)

6 holes (transect) -Recovery of

TAH-03A 17.45S – 149.35E 20/300 50/100 10 440 6 holes (transect) -Recovery of

RIB-01A 15.30S– 145.40E 25/250 30/100 10 330 5 holes (transect) - Recovery

HYD-01A 18.40S - 147.40E 40/250 50/100 10 400 6 holes (transect) - Recovery

Alternate site 6 holes (transect) - Recovery

SAS/IODP Proposal Cover Sheet

Permission to post abstract on SAS Web site: Yes No

Abstract: (400 words or less)

MBF-1A 8°N 0.42 / 86°E17.00 3745 900 0 900 Neogene history

Permission to post abstract on IODP-MI Web site: X Yes No

Abstract: (400 words or less)

IODP Proposal Cover Sheet

Title: Costa RIca Seismogenesis Project CRISP Program A

SAMPLING AND QUANTIFY INPUT TO THE SEISMOGENIC ZONE AND FLUID

Permission to post abstract on IODP-MI Web site: Yes No

Abstract: (400 words or less)

Permission to post abstract on IODP-MI Web site: X Yes No

Abstract: (400 words or less)

Permission to post abstract on IODP-MI Web site: X Yes No

Abstract: (400 words or less)

6HFRQG5LGJH ILUVWSULRULW\ 'ULOODW6LWH65P66:RI2'36LWHZKHUHVHGLPHQWWKLFNQHVVLV

Title: Chicxulub: Drilling the K-T Impact Crater

Keywords: Chicxulub, cratering, K-T impact Gulf of Mexico

Permission to post abstract on IODP-MI Web site: Yes No

Abstract: (400 words or less)

Chicx-03A 21 27.0846 N 17 m 3000 m 3000 m Primary hole: constrain

Chicx-02A 21 27.33 N 17 m 3000 m 3000 m Original site; now contingency

Chicx-04A 21 28.6578 N 17 m 1750 m 1750 m Contingency site to reach

Chicx-01A 21 17.72 N 23 m 4100 m 4100 m Identify the thickness,

Permission to post abstract on IODP-MI Sapporo Web site: X Yes No

Abstract: (400 words or less)

The major scientific objectives of this drilling proposal are:

Keywords: Turbidites , Monsoon, Channel levee, Source to Sink Bay of Bengal

Permission to post abstract on iSAS Web site: Yes No

Abstract: (400 words or less)

MBF-1A 8°0.42’N / 86°16.97E 3747 900 0 900 Neogene history

MBF-2A 8°0.4N / 87°38'E 3678 900 0 900 Neogene history

MBF-3A 8°0.4N / 88°41'E 3620 1500 0 1500 Neogene history

MBF-5A 8°0.4N / 87°10.9E 3687 300 0 300 Depocenter migration

6HFRQG5LGJHILUVWSULRULW\'ULOODW6LWH65P66:RI2'36LWHZKHUHVHGLPHQWWKLFNQHVVLV