Professional Documents
Culture Documents
Delhi Pioneer 21 4
Delhi Pioneer 21 4
#(!!_VhSVUdhZ]]SVRUUVUhZeYZ__Vie%&URjd+DZd`UZR
BC055A4?>AC4AQ =4F34;78
+RPH6HF\DSSRLQWHG1RGDO 2^_bRaTPcTVaTT]R^aaXS^aU^a
RIILFHUWRVXSHUYLVHPLJUDQWLVVXHV cP]ZTabRPaahX]V!:[XcaTb^ghVT]
he Delhi Government will
T escalate bed strength amid
rising cases of coronavirus in the
national Capital, as on Tuesday,
after a high-level meeting with B0?=0B8=67Q =4F34;78 when required. Commissioner (HQ) Revenue BC055A4?>AC4AQ =4F34;78 COVID Action Balaji Hospital.
Health Minister Satyendra Jain It is noteworthy to men- Department, and Secretary , The two tankers were escort-
and officials, deputy Chief mid restrictions imposed tion here that while announc- Delhi building and other con- he Delhi Police on Tuesday ed by Delhi police vehicles,”
Minister Manish Sisodia said
2,700 new beds will be added
A to curb the spread of
Covid -19 sparked the exit of
ing the lockdown, Chief
Minister Arvind Kejriwal had
struction workers welfare
board.
T created a green corridor for
two tankers carrying 19,500
said the Additional DCP.
“Meanwhile, 25 oxygen
within next 4-5 days while city migrant workers, the Delhi urged migrant workers not to Putting their health at litres of liquid oxygen from cylinders were arranged
administration already Government on Tuesday leave the city as the imposed risk, the migrant workers Uttar Pradesh and Haryana through the cooperation of
increased beds from 6,071 to health department, presently, ment preparedness report on appointed Bhupinder Singh lockdown was of short dura- strived to reach their homes borders to a Covid-19 hospital medical superintendents of
19,101 in the last two 320 beds in Burari Hospital, corona, Jain said that the beds Bhalla, Principal Secretary tion. and had to wait hours at bus in outer Delhi’s Paschim Vihar Sanjay Gandhi, Bhagwan
weeks. which will be increased to 800. have been increased upto three (Home) as State Nodal officer The order cited the stop faced harassment being area. Mahavir, Maharaja Agrasen
Urging people to follow the The capacity of beds at times in Delhi in the last few for the coordinating and observation of the Delhi High charged ten times fairs more Police said that the tankers and Jaipur Golden hospitals,”
covid norms, and encouraging Ambedkar Nagar Hospital will days, 2426 beds out of 18923 supervising matters pertaining Court stated DDMA consti- than usual. had to urgently reach Sri he said.
for home isolation, and to be increased from 200 to 600 beds available in covid hospi- to migrant workers. tuted the committee of offi- Meanwhile, R ajesh Action Balaji Hospital, where Dr Sunil Sumbil, medical
check the Delhi Corona App and the beds at Deen Dayal tals. More than 90 thousand As per the Delhi Disaster cers – Principal (Pr) Secretary Khurana, Special oxygen levels had reached a superintendent of Sri Balaji
for the availability of beds in Upadyay Hospital will be covid tests were conducted in Management Authority (Home ) Chairperson, Pr Commissioner (Police) will critical point, but were stuck in Action Hospital thanked the
hospitals, Sisodia also warned increased from 250 to 750. Delhi on Monday and positiv- (DDMA) order, the appoint- S ecretar y (L abour), also be the Nodal Officer as a traffic jam. Delhi Police for its efforts.
hospitals for showing inaccu- 250-250 new beds will be ity rate was 26 percent, It has ed officer may issue necessary Commissioner (Labour ), per the DDMA notice to According to Sudhanshu “The oxygen levels at our
rate information on the App added at Achar ya Shree been appealed to the Central instructions to the District Director (Education) mem- ensure support and assistance Dhama, the Additional Deputy facility had reached a critical
will be dealt with stringent Bhikshu (150 to 400) and Government that all companies Magistrates (DMs) and ber, Special S ecretar y required from the Police Commissioner of Police point. The vehicles carrying
action. DRDO's covid-19 Centre. should be allowed to supply District DCPs of Delhi as and (Finance ), Deputy department. (DCP), Outer district, the liquid oxygen could not reach
Siodia said, “The Delhi The number of beds in the Remdesivir so that its shortage police received information on time as they were stuck in
government is working on a Satyawadi Raja Harishchandra ends, There is an appeal to the around 11.30 PM on Monday a traffic jam. We immediate-
war footing to increase the
number of beds in Delhi's hos-
Hospital of Narela will be
increased from 200 to 400
migrants that Delhi has a very
short lockdown, they should
&LW\UHFRUGVQHZFDVHVRQ7XHVGD\GHDWKV and immediately teams were
rushed to ensure smooth pas-
ly informed the police and
they rushed their teams. They
pitals. In the last 2 weeks the while government school will not leave Delhi, the Kejriwal BC055A4?>AC4AQ =4F34;78 The positivity rate report- 7,87,898 total sage for the containers. created a green corridor and
number of covid designated be connected to the LNJP hos- government will take care of its ed 32.82 percent per cent pos- discharged.Currently, 40,0124 “A dedicated corridor was both vehicles reached on
beds in Delhi have been pital which will include 125 people, If the central govern- elhi on Tuesday registered itivity rate, 19430 patients dis- people are in home isolation in provided by Outer district time,” said Dr Sumbil. If the
increased by 3 times. The num-
ber of covid-19 beds in Delhi
beds and a center of 500 beds
will be set up in the
ment allows us to start vacci-
nation centres in schools and
D 28,395 new Covid-19 cases
and 277 fatalities in the last 24
charged. The death toll in
Delhi recorded at
the national capital.
In the last 24 hours, 56,724
police for two oxygen tankers
carrying 19,500 litres of liquid
tankers had not reached in
time, the lives of
on April 3rd 2021 was 6071 Commonwealth Games community centers, then we hours, the highest single-day 12,638. samples were tested. Out of oxygen from the UP and COVID-19 patients would
which is 19101 on April 20.” Village. will be able to do inoculate at since the beginning of the pan- On Monday, 21,500 this, 29,803 were RT-PCR Haryana borders. The con- have been in danger, he
According to database of Citing the health depart- a steadier pace. demic. patients were discharged. With tests. tainers had to reach all- said.
=^SP[^UUXRTabc^RWTRZPePX[PQX[Xch^UQTSbX]_ec6^ecW^b_bX]6´VaP\ 0SS#\^aT2^eXSQTSb)BXb^SXP
?0AE4B7B70A<0 Q 6DAD6A0<)
:HHNORQJORFNGRZQWULJJHUVPLJUDQWV¶H[RGXVDJDLQ 6WD\KRPHGXULQJORFNGRZQ
WRSFRSXUJHV'HOKLLWHV
BC055A4?>AC4A Q =4F34;78 that she fear that it will be a
repeat of last year. “What if the
fter the Delhi Government lockdown is extended? What if
A imposed a week long lock-
down from Monday night to
they completely stop con-
struction activities for a longer
curb the spike in Covid cases, period? What will we eat then?
in a replay of last year's, a large Last time we waited for the sit-
number of migrant labourers uation to get better but ulti-
gathered at bus stations on mately had to go back home
Tuesday to go at their homes anyway,” said Geeta, waiting for
from the city, fearing the shut- family members at Kaushambi
down of the public transport bus depot.
may force them to walk hun- “I have seven members in
dreds of kilometers. my family, including a senior
Last year, hundreds of citizen. During the last lock-
migrant labourers had left the down, we went to Nepal after
city on foot in the absence of the situation became worse. We
public transport during the returned around four to five
lockdown. months ago. We work as a daily
On Tuesday scores of ?PbbT]VTabPaaXeTPc0]P]SEXWPaCTa\X]P[X]=Tf3T[WX^]CdTbSPh AP]YP]3X\aXk?X^]TTa labourers and do not have
migrant labourers were seen at work due to the ongoing situ-
Anand Vihar ISBT, Kashmiri scared for our lives. We reached “I work as a carpenter in A bus conductor said they ation. We have no work back in
Gate, New Delhi railway sta- Jaunpur after travelling in a west Delhi's Subhash Nagar. I have instructions that there our native place so we will have BC055A4?>AC4A Q =4F34;78 expressed concern over the keep sufficient stock of covid
tions and Kaushambi bus truck. We came back around have to go to my hometown as should not many passengers to come back but not sure health and safety of police per- equipment like PPE kits, masks,
depot. The officials at the bus two months ago. On Monday, my sister is getting married inside the bus and that they when as the lockdown could be n the first day of week- sonnel who are serving 24x7 on sanitisers etc and pay attention
stands and railway station were
seen making several announce-
we told our employer that we
are leaving for Jaunpur and
next week. Earlier, I was plan-
ning to go there this weekend,
have to maintain social dis-
tancing.
extended,” she said.
Scenes similar to last year's
O long lockdown, the Delhi
Police Commissioner S N
the ground and exposing them-
selves to risks of infection.
to repeated cleanliness of toi-
lets and common areas of the
ments and asking people to requested him for some money. but after the lockdown was Deepak Kumar, an e-rick- migrant exodus could be seen Shrivastava held a briefing via “Being frontline warriors, barracks and police stations,
maintain social distancing, He only gave Rs 500 each to us. announced by the government, shaw driver at Dilshad Garden, replaying at interstate bus ter- video conference with senior our personnel need to perform Biswal said.
wear masks and regularly sani- Its not going to be the same this my family told me to come as said he is not leaving for his minals with thousands of police officers of districts to their duties, but also ensure Daily health monitoring of
tise themselves. year, nobody will help,” Siroj soon as possible. I somehow hometown now but he is hav- migrant workers gathering review the situation on ground. COVID safety by following the staff should go carried out.
Chandan Siroj, a native of said who works, along with his reached Anand Vihar to board ing trouble making ends meet there to catch a bus home, “We urge people to follow strict covid discipline,” The police colonies should also
Jaunpur in Uttar Pradesh, said four friends from Jaunpur, at a a bus till Lucknow,” he said. as he is not getting many pas- hours after Chief Minister Covid appropriate behaviour Shrivastava said. be sanitised because police-
that during the last lockdown, factory in north Delhi’s Anand “I hope the situation does sengers. Arvind Kejriwal announced a and stay home during this Delhi Police Public men return to homes from
he travelled in a truck to reach Parbat area. not deteriorate as I have to “We are barely getting one week-long lockdown and lockdown,” he said. Relation Officer (PRO), duties. Officers should remain
his home. Dharamvir Singh, a native return for earning my liveli- or two passengers. It will appealed to them with folded Emphasizing that essen- Chinmoy Biswal said that the in communication with staff
“We were stuck for over of Akbarpur near Lucknow, hood. We will be again out of become difficult to survive as hands not to leave tial services and goods need to CP also directed the deploy- who have fallen sick and make
one month here last year dur- was looking for a bus to his work and there will again be a my family's financial condition Delhi. be facilitated, Shrivastava ment of police officials at pick- best possible arrangements for
ing the lockdown. The food hometown. He, however, had crisis,” he added. in not good. I am not going The chief minister directed that unnecessary ets and areas to be in small their treatment, the CP said.
was not an issue, but we were different reasons to go home. At Kaushambi bus stand, back home because I have to appealed workers to not leave movement of vehicles and peo- groups and with social dis- The Covid Helpline 011-
earn a livelihood and send Delhi, saying the short period ple on roads be curbed, police tancing, even while checking 24369900 is already getting
money but what will I do if I of lockdown would need not be said. people or vehicles so that their nearly thousand calls a day for
don't get any passengers due to extended. At present, there is He asked the field officers exposure risk is minimum. facilitation and help and max-
lockdown," he wondered. no restriction on inter-state to also make use of announce- Shrivastava also directed imum possible assistance is
Geeta Kumari, a migrant movement during the lock- ments in colonies and densely the district and unit officers to being extended, officials said.
daily wager from Nepal, fears down. populated areas for people to
obey the COVID curfew,
besides strictly checking at the
pickets on roads, officials said.
Anyone coming out of
home will be definitely checked
by the police personnel and
questioned. Essential services
like medicine shops, vegetable
shops etc. the social distancing
be ensured, they said.
“The priority task is to
implement this week-long
lockdown and tightness in
restrictions be kept,” he said,
adding that if anyone is found
in disobedience to the restric-
tions without a genuine ground
or exemption, needs to be
prosecuted at once.
The Commissioner also
$OWKRXJKHYHU\SRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHO\IRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULW\RIRUELQGLQJLQDQ\ZD\RQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQ\UHVSRQVLELOLW\IRUDQ\
GDPDJHRUORVVWRDQ\SHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQ\DFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO\5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULI\DQGVHHNDSSURSULDWHDGYLFHWRVDWLVI\WKHPVHOYHVDERXWWKHYHUDFLW\RIDQ\NLQGRIDGYHUWLVHPHQWEHIRUH
UHVSRQGLQJWRDQ\FRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQ\HPSOR\HHRIWKH3LRQHHU*URXS·VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQ\NLQGRIFODLPPDGHE\WKHDGYHUWLVHUVRIWKHSURGXFWV VHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQ\NLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV
m m
0XaBdaRWPaVT4gcaPXU0__[XRPQ[T
=4F34;78F43=4B30H0?A8; ! !! *?064B !C"
CE>B9C5BC
C51B38
69BCDG9>
!"C@?BD
fffSPX[h_X^]TTaR^\
5VWVc]`T\U`h_eZ]]a`ddZS]V+A> 1RR[\JHQ&RYLG
VXSSO\2SSRVLWLRQSDUWLHVH[SUHVVGLVDSSRLQWPHQWDW0RGL¶VDGGUHVV FDUHLQPRUWDOSHULO
$VVXUHVSHRSOHQDWLRQZHOOVWRFNHGZLWKYDFFLQHVPHGLFLQHVR[\JHQ
?=BQ =4F34;78 speech. While most twitteratis workers will help them, and
BC055A4?>AC4AQ =4F34;78 5V]YZ4>dVV\d4V_ecV¶dZ^^VUZReVYV]a
were relieved that the PM’s did- that they will be vaccinated in 4`gZU"* s Delhi is staring at severe oxygen is available for the next The Delhi Chief Minister
6WDWHV¶DSSURDFKHV
and private sector are collec- The PM sought youth to patients in the ICU are heavi- he Delhi High Court on ical opinion was divided on use
tively trying to step-up the pro- come forward and make small ly dependent on oxygen. “If we T Tuesday expressed hope of Remdesivir.
duction of oxygen supply, the
requirement of which has
committees to “implement
Covid discipline” which will #!!!5:6:?2 don’t get oxygen on time, then
many will die,” he warned.
that the Central Government
was allocating or diverting
The Delhi HC also said
economic interests cannot
YDU\IRUZDQWRI 52J42D6D?62C
increased in recent weeks. lessen the need for having con- On Monday, the Delhi resources and medicines, like override human lives and in
Similarly, the PM said in tainment zones or lockdown, Government set up a 24-mem- Remdesivir, based on the view of various hospitals in
many States big hospitals are
being set up. In reference to
he said. He appealed to chil-
dren to ensure in their homes $=2<9 52J>2C< ber committee to ensure “ratio-
nal” use of oxygen for treat-
needs and situation of each
State, otherwise “people will
Delhi running low on oxygen,
the Centre should immediate-
?=BQ =4F34;78
?dQ[XR[^^bQaTTSX]V
Thackeray will take a final call
5aTTePRRX]TU^aP[[
I n the absence of a uniform
policy for lockdown, the
on complete lockdown as
merely tightening of restric-
tions are not delivering the
9PQbPUTU^a_T^_[TfXcWU^^S PQ^eT 'habX]D?
SadV[PcTgQTTbcX]VP[[TaVXTb
Va^d]SU^a_P]ST\XR
State Government have gone desired result. Lucknow: The UP
for different approaches amid UP has, on the other hand, Government on Tuesday
confusion and uncertainty, taken a contrarian view to the decided to administer Covid-
triggering, in some cases, lockdown prescription saying ?=BQ =4F34;78 vaccinations in more than 19 vaccine free of cost to all
the exodus of migrant it had to “protect both, lives 65,000 people who have those above 18 years of age
workers and hoarding and and livelihoods.” 0A270=09H>C8Q =4F34;78 counter placed at various ndividuals with severe aller- become fully vaccinated, with from May 1. The decision was
back marketing.
While Maharashtra on
The Jammu & Kashmir
Government on Tuesday lanning to use a public loo
heights of the toilet and urinal
to capture the size and number
Ilatex,
gies to foods, oral drugs,
bee stings or venom can
the Pfizer-BioNTech and
Moderna Covid vaccines. PEG
taken at a Cabinet meeting
chaired by CM Yogi
Tuesday prepared for complete
lockdown, and Jharkhand has
ordered the extension of night
curfew to all municipal and
P or restroom to attend
nature’s call? Beware, for high
of droplets generated upon
flushing.
safely receive the Covid-19 vac-
cines, a team of scientists at
is the common excipient in
both the mRNA Covid vac-
Adityanath. The Cabinet also
thanked Prime Minister
announced a seven-day “shut urban areas due to the rise in chances are that you might risk Results demonstrated that Massachusetts General Hospital cines, whereas polysorbate 80 Narendra Modi for allowing
down”, other States have the cases of Covid-19. contracting the deadly coron- public restrooms could serve as (MGH) in the US has said after is the excipient in the Janssen administering of coronavirus
announced night curfew, avirus from there, researchers hotbeds for airborne disease studying 65,000 people. Covid-19 vaccine. vaccine to those above 18
weekend lockdown, and sev- have warned. transmission, especially if they “Our main goal is to enable The US Centers for Disease years of age.
eral other restrictions. B2bcPhb72^aSTa They pointed out that do not have adequate ventila- as many individuals as possible Control and Prevention
National Capital Delhi is
already in the midst of an
SXaTRcX]VD?6^ec while respiratory droplets are
the most prominent source of
tion or if toilets do not have a
lid or cover. The study holds
to receive a Covid-19 vaccine
safely and avoid unnecessary
described the rate of anaphy-
laxis after receipt of the mRNA 20?BD;4
extended 24x7 curfew till c^X\_^bTbcaXRc transmission for Covid-19, the importance in the context of vaccine hesitancy due to a lack Covid-19 vaccines as 4.5 cases
8=3804DBD<<8C) ?<´B
next Monday morning. Uttar
Pradesh has refused to imple-
aTbcaXRcX^]bX]$RXcXTb small numbers of viable virus-
es have, however, been found to
India too where most public
loos often are not equipped
of knowledge around allergic
reactions to vaccines,” said lead
per million doses adminis-
tered, with 89 per cent occur- E8B8C20;;43>55
ment a High Court order to New Delhi: The Supreme be in urine and stool samples. with toilet seat lids and urinals author Aleena Banerji, ring within the 15- to 30- =Tf3T[WX)?aX\T<X]XbcTa
implement lockdown in five Court on Tuesday stayed the Hence, public restrooms or vomit. When dispersed wide- are not covered. clinical director of the Allergy minute observation period. =PaT]SaP<^SX³b_[P]]TSeXbXcc^
districts and got a stay from Allahabad High Court order toilets can be cause of concern ly through aerosolisation, these For the study, researchers and Clinical Immunology Unit However, Polysorbate 80 caused ?^acdVP[c^PccT]ScWTP]]dP[
the Supreme court. directing the Uttar Pradesh for transmitting the pathogen pathogens can cause Ebola, obtained data from three dif- at MGH. anaphylaxis is extremely rare. 8]SXP4da^_TP]D]X^]bd\\Xc
Maharashtra, the State Government to impose strict because they are relatively con- norovirus that results in violent ferent scenarios: toilet flushing; However, people with a If a person is allergic to ]Tgc\^]cWWPbQTT]RP[[TS^UU
with the largest positive cases restrictions till April 26 in fined, experience heavy foot food poisoning, as well as covered toilet flushing and uri- recent severe allergic reaction PEG, s/he should not receive an X]eXTf^UcWTR^a^]PeXadbRaXbXb
in the country has placed five cities due to the surge in traffic and may not have ade- Covid-19 caused by SARS- nal flushing. They examined to polyethylene glycol (PEG) — mRNA Covid-19 jab, instead
stringent measures of restrict- Covid-19 cases. A bench of quate ventilation, researchers CoV-2, said the scientists who the data to determine the an ingredient in the vaccines — speak to the physician about 82B420=24;B2;0BB
ing the timing of groceries and Justices Vipin Sanghi and from Florida Atlantic investigated droplets generated increase in aerosol concentra- should see an allergist before receiving the Janssen Covid-19 G1>0A34G0<B
shops to curb the crowding but Rekha Palli said oxygen sup- University’s College of from flushing a toilet and a uri- tion, the behavior of droplets of getting the jabs, they recom- vaccine, the team suggested. =Tf3T[WX)CWT82B42[Pbb
will take a couple of days ply of various hospitals will Engineering and Computer nal in a public restroom under different sizes, how high the mended. The findings are pub- On the other hand, if you are Q^PaSTgP\bWPeTQTT]
before completely shutting run out in 4-8 hours and in Science have now cautioned. normal ventilation conditions. droplets rose, and the impact of lished in the Journal of Allergy allergic to polysorbate 80, you RP]RT[[TSX]eXTf^UcWT
down the State. such a situation there was no It is already known that a The study is published in covering the toilet. Ambient and Clinical Immunology: In should not receive the Janssen f^abT]X]V2^eXS (bXcdPcX^]
As of now, Maharashtra justification in implementing variety of pathogens are usual- the journal Physics of Fluids. aerosol levels were measured Practice. vaccine and instead speak to P]ScWT^_cX^]U^abcdST]cbc^
has tightened curbs, limit the ban from April 22 as the ly found in stagnant water as To measure the droplets, before and after conducting the The study examined pos- your physician about receiving P__TPaX]cWTTgP\b[PcTaWPb
timings of grocery shops to 4 need was now. well as in urine, feces and researchers used a particle experiments. sible allergic reactions to Covid the mRNA Covid-19 vaccines. QTT]fXcWSaPf]
3A3>bTccX]Vd_WdVT2^eXSUPRX[XcXTbX]#RXcXTb CRYf]<4CeVde4`gZUgV<V[cZhR]Z_bfRcR_eZ_V
5VW>Z_Rd\ddVcgZTVd4YZVWde``aV_eYVZcY`daZeR]dW`cTZgZ]ZR_d ([30&0V$GLW\DQDWK<HGG\XUDSSD SOP, those who came in con-
tact with them was to manda-
9LMD\DQDPRQJPDQ\SROLWLFLDQVWHVWHGYH torily quarantine to prevent
?=BQ =4F34;78 advised to ensure medical ser- hospitals in Lucknow for further spread of deadly virus.
vice to patients among both Covid-19 patients. 344?0::D<0A970Q Mukherjee, Congress chief Union Ministers Arjun
iving a boost to the nation- cantonment residents and non- Rajnath was briefed about =4F34;78 political strategist Ahmed Patel, Munda, Sanjeev Baliyan, Arjun
G al effort to fight corona
pandemic, the armed forces
residents.
The DRDO chief G
the measures taken by the
DRDO, Defence Public Sector fter former Prime Minister
Union Minister Suresh Angadi
succumbed to the deadly virus
Meghwal were amongst the
few Ministers who also tested
have opened the doors of their
hospitals to civilians. The
Satheesh Reddy informed the
Minister that a Covid-19 facil-
Undertakings (DPSUs),
Ordnance Factory Board
A Manmohan Singh, now
former Congress chief Rahul
last November. Former crick-
eter and a Minister in Yogi
Covid positive.
Early this month, Kerala
Defence Research and ity developed by DRDO has (OFB) and the National Cadet Gandhi and Telangana Chief Cabinet Chetan Chauhan too Chief Minister Pinarayi Vijayan
Development Organisation again been made functional in Corps (NCC) in providing aid Minister K Chandrashekhar died battling corona in the tested positive just two days
(DRDO) is setting up huge New Delhi and efforts are being to the civil administration in Rao have tested Covid-19 pos- first phase. Bengal over a frightening surge after polls were conducted in
hospitals in Varanasi, made to soon increase the num- this hour of crisis. itive while Delhi Chief Minister Rahul Gandhi tweeted to in Covid-19 cases across the Kerala. He has now recovered.
Ahmedabad, Lucknow and ber of beds from 250 to 500. He urged the DPSUs, OFB Arvind Kejriwal had to isolate say that he has tested positive countr y. Prime Minister CPI leader D Raja also was
Patna for exclusive use of coro- He also informed the meet- and DRDO to work on war himself as his spouse caught the for the Covid-19 infection. He Narendra Modi wished him a diagnosed with corona
na patients. ing that the ESIC Hospital, footing to provide oxygen cylin- infection. Uttar Pradesh Chief said he had mild symptoms of speedy recovery. amid the peak of Kerala
Reviewing the pace of these which was converted to Covid ders and extra beds to civil Minister Yogi Adityanath is Covid-19 and simultaneously On Monday, Manmohan Assembly elections.
projects here on Tuesday in a hospital in Patna, has started administration at the earliest. He recuperating while asked all those who may Singh was admitted to AIIMS Congress candidate PSW
virtual meeting with the functioning with 500 beds. He also delegated the emergency several MLAs, Ministers and have come into his contact in after he tested positive for the Madhav Rao from Tamil Nadu
Defence Ministry top brass, informed that work is on war powers of procurement so that candidates of the recent the past few days to get them- infection. died of Covid-19, a
Defence Minister Rajnath directed Army Chief General footing to set up a 450-bed hos- critical needs are procured. Assembly polls have suc- selves tested. Other politicians who test- few days after he contested
Singh also asked the three MM Naravane to instruct local pital in Lucknow, 750-bed hos- The DRDO chief further cumbed to the disease. “After experiencing mild ed positive for Covid-19 were from the Srivilliputhur on April
Services to be in regular touch commanders to reach out to pital in Varanasi and 900-bed said SpO2 (Blood Oxygen Last year, too, when the symptoms, I have just tested Uttar Pradesh Chief Minister 11. Another Congress candi-
with the State Governments on Chief Ministers of States and hospital in Ahmedabad. Saturation)-based supplemen- nation saw a long lockdown, positive for Covid. All those Yogi Adityanath who fell ill date Rezaul Haque and a RSP
the preparations for fighting offer whatever help The DRDO on Monday tal oxygen delivery system bigwigs like Vice President M who’ve been in contact with after coming back from elec- candidate in West Bengal
the disease. possible in dealing with the supplied 150 jumbo cylinders developed for soldiers posted at Venkaiah Naidu, Union me recently, please follow all tion rallies in West Bengal last Assembly elections died
The meeting was attended Covid-19 situation. of medical oxygen to the Uttar extreme high-altitude areas Ministers Amit Shah, Nitin safety protocols and stay safe,” week. He developed complica- due to corona.
by the three Services chiefs. Following this, Defence Pradesh Government, as per can be used or Covid patients Gadkari, Madhya Pradesh he said. tions during the course and Karnataka CM BS
Rajnath asked them to offer Secretary Ajay Kumar also directions by the Defence as their conditions become Chief Minister Shiv Raj Singh Rahul had held an election now is on a recovery path. Yeddyurappa, Tripura CM
available facilities and expertise issued instructions that during Minister. An additional similar. The product will be Chouhan had tested positive rally on April 14 in West All the leaders used the Biplab Kumar Deb, the then
to the civil administration dur- the current surge of coron- 1,000 cylinders would be pro- available soon in the market for Covid and undergone pro- Bengal’s Uttar Dinajpur. He social media platforms to share Uttarakhand CM Trivendra
ing the ongoing Covid crisis. avirus cases, 67 Cantonment vided by the DRDO later. The from the industry as per tech- longed hospitalisation. later announced the cancella- that they were victims of the Singh Rawat too fell to corona
The Defence Minister also Board hospitals across India be oxygen would be supplied to nology provided by the DRDO. Former President Pranab tion of all his rallies in West pandemic and hence, as per the and self-isolated and recovered.
=4F34;78kF43=4B30H k0?A8; ! !! ]PcX^]#
D^R]]DeReVdFEUVaV_U`_8`geW`c[RSd
1WPaPc1X^cTRWc^_a^SdRT&\X[[X^] 2__cd]UTY^VbQd_
?=BQ =4F34;78 nered with Indian
Immunologicals (IIL) to man-
ith the third phase of ufacture the drug substance
W Covid-19 vaccination
S^bTbhTPa[hc^\TTcaXbX]VST\P]S for Covaxin.
dQ]UfYbecEDcd_\T
opening up in less than two The technology transfer
weeks for everyone above 18 process is well underway and
years largely through private IIL has the capabilities and
facilities, almost all small ?=BQ =4F34;78 expertise to manufacture
States and Union Territories inactivated viral vaccines at
are still entirely or mostly s India starts vaccinating commercial scale and under
dependent upon Government
facilities, according to the
A all those above 18 years
of age f rom May 1,
biosafety containment.
Bharat Biotech uses a
?=BQ =4F34;78
Government’s CoWIN portal. Hyderabad-based Bharat proprietary adjuvant Algel- he Centre on Tuesday
The role of private facili-
ties conducting vaccinations
Biotech has announced scal-
ing up of manufacturing
IMD G, which has now
proven to be a safe and effec-
T directed Delhi and other
Union Territories to plan aug-
holds importance in view of capacity at its various facili- tive adjuvant, especially to mentation of hospital infra-
the Government’s announce- ties to produce 700 million stimulate memory T cell structure for next three weeks
ment to liberalise the vacci- doses per annum of Covaxin responses, said the statement. and ramp up testing and strict
nation drive to allow States, annually to meet the growing The synthesis and man- enforcement of Covid appro-
private hospitals and indus- demand. Sources said the ufacture of the IMDG com- priate behaviour. The high-
trial establishments to pro- company had 200 million ponent has been successfully level meeting chaired by Union Lakshadweep has seen a sud- Government for augmenting
cure the doses directly from doses capacity when it start- indigenised and will be man- Home and Health Secretaries den spike after 14th April, their hospital beds capacity,
manufacturers in the third ed producing Covaxin in the ufactured at commercial scale reviewed and discussed Covid 2021 primarily due to travel of during last year and this year.
phase of Covid-19 vaccina- beginning last year. within the country. status, and the management large number of people to Their efforts to ramp up test-
tions to be launched from According to a press This is the first instance and response strategy with mainland to shop for the recent ing and reduce the turnaround
May 1. release issued by the city- timeline, mainly due to the Emergenc y Use where a novel adjuvant has Chief Secretaries of all the festive occasions. Most UTs time for the test results were
However, as p er the based vaccine maker, manu- availability of new specially Authorisations in several been commercialised in India. Union Territories of India. have imposed movement also outlined,” it added.
Government data, 13 small facturing scale up has been designed BSL-3 facilities, first countries across the globe EUAs have now been Home Secretar y Ajay restrictions, including night Expressing concern over
States and Union Territories carried out in a stepwise of its kind for manufacturing with another 60 in process. obtained from Mexico, the Bhalla pointed out the steep curfew, restriction of intra- the worrying scenario, Health
have less than 10 private facil- manner across multiple facil- in India that have been repur- Manufacturing partner- Philippines, Iran, Paraguay, growth in a number of cases all island movement in the island Secretary Rajesh Bhushan and
ities where vaccination ities at Hyderabad and posed and preexisting exper- ships are being explored with Guatemala, Nicaragua, across the country. From UTs. Chandigarh informed Dr V K Paul pointed out the
against Covid-19 infection is Bangalore. tise and know how to manu- our partners in other coun- Guyana, Venezuela, 20,000 cases reported on 1st that they are conducting door criticality of next three weeks
being conducted and out of Capacity expansion in facture, test and release high- tries, who have prior expertise Botswana, Zimbabwe, among January 2021, India has almost to door counselling for increas- for COVID response mea-
these while five States and vaccines manufacturing is a ly purified inactivated viral with commercial scale man- several other countries. 10 times more cases (more ing vaccination. 90% of the sures. The UT administra-
Union Territories have no long and tedious process, vaccines,” the firm said a day ufacture of inactivated viral Pricing for international than 2,00,000 cases) being patients are in home isolation tors were advised to plan in
private facilities for vaccina- requiring investments and after the Government opened vaccines under biosafety con- markets and supplies to gov- reported daily since 15th April who are being monitored by advance for three weeks. A
tion. several years, the release said. up vaccination policy includ- tainment, the Bharat Biotech ernments under EUAs have 2021. In the last 11 days, new mobile teams,” said Centre in survey to promptly identify
The States and Union “Bharat Biotech is able to ing all those above 18 years of said. been established between cases have almost doubled a statement. the COVID positive people
Territories with less than 10 expand Covaxin manufac- age. To further increase capac- USD15 - 20/ dose, the vaccine from 1.31 lakh reported on 9th “UT of Delhi discussed should be taken up. Paul
private facilities for vaccina- turing capacity in a short Covaxin has received ities, Bharat Biotech has part- maker said. April to 2.73 lakh reported on shortage of beds and the pre- stressed on planning the
tion are — Andaman and 20th April. sent efforts to augment this minutest details of COVID
Nicobar (0 private facility), “The UTs shared their pre- through Central Government management. For UT of
Arunachal Pradesh (0), Dadra (2), according to the CoWIN absence of such facilities there. Kerala and Uttar Pradesh above 18 years of age will be sent efforts for containment infrastructure and support Ladakh, he recommended
and Nagar Haveli (2), Daman portal’s dashboard. Interestingly, Tamil Nadu reporting high numbers of eligible for Covid vaccination. and management of the posi- through the DRDO’s recently regulation of the incoming
and Diu (0), Ladakh (0), A senior health ministry is the only state in the coun- Covid-19 cases have 817, 230, The announcement tive cases. Ladakh, J&K, and operationalised COVID labourers and supervised con-
Lakshadweep (0), Manipur official had earlier said some try with over 1,000 private 1101 and 561 private facilities comes as India grappled to Lakshadweep pointed to the Hospital. Delhi Government tainment. Islands can be made
(3), Meghalaya (7), Nagaland states and union territories facilities conducting vacci- conducting vaccinations rein in the surging coron- rise in cases due to a large expressed gratitude for the large containment zones, he
(4), Puducherry (7), Sikkim have no private facilities con- nations. It has 1118 facilities. respectively. In the third phase avirus infections that crossed number of inbound travelers. timely support of Union suggested.
(1), Tripura (1) and Mizoram ducting vaccination due to In comparison, Delhi, commencing from May 1, all 1.50 crore.
cPgPQ[T_Tab^]bP]bR^VT]c 2aX\X]P[?aPRcXRT!!
the country, Prime Minister
Narendra Modi on Tuesday
2Q^WQ\_bU]Udb_Uh`Q^cY_^
and more people. Appreciating
the efforts of vaccine manu- CWT3aPUcAd[Tb^U
facturers for their achieve- ?=BQ =4F34;78
ments and professionalism, 2aX\X]P[?aPRcXRT
Modi said that biggest strengths tiative and he Supreme Court on !! STP[bfXcW
of our vaccine industry are its AtmaNirbhar’ T Tuesday directed all High ePaX^dbPb_TRcb^U
‘Samarthya, Sansadhan and campaign Courts to adopt the Draft Rules RaX\X]P[caXP[
Seva Bhaav’, and these are what and would of Criminal Practice, 2021 as
make them a vaccine leader in help develop- part of the rules governing
X]R[dSX]V_^bc
the world. ment of criminal trials and ensure that \^acT\aT_^ac
Noting the fact that vac- infrastructure the existing rules, notifications, RWPaVTcaXP[
cines manufactured here are like roads, rail- orders and practice directions aTR^aSX]V^U
the cheapest, PM Modi said ways water, etc. are suitably modified and pro- TeXST]RTP\^]V
India the world’s largest vac- providing mulgated within six months.
cine programme is under- major boost to “If the State Government’’s ^cWTab
way in India and reiterated economy in co-operation is necessary in
them to gear up for May 1, the eastern this regard, the approval of the hearing, the court should con-
when vaccination is opening part of the concerned department or sider the total number of wit-
up for people above 18 years. c o u n t r y ?=BQ =4F34;78 not be protected without departments, and the formal nesses, and classify them as
“PM Modi remarked that including pro- ordering a provisional attach- notification of the said Draft eyewitness, material witness,
throughout this process of moting ancil- he Supreme Court on ment. Rules, shall be made within the formal witness (who would be
developing and manufactur-
ing vaccines, the country has
lary industry.
The project
T Tuesday said the power to
order a provisional attachment
The top court said the
Commissioner is duty bound
said period of six months,” a
bench headed by Chief Justice
asked to produce documents,
etc) and experts,” the bench said.
constantly worked with the city and airport. He said the will also provide New busi- of the property including the to deal with the objections to S A Bobde said. The Draft Rules of Criminal
spirit of public-private part- ?=BQ =4F34;78 new metro lines of 59 kilo- ness opportunity in form of bank account of the taxable the attachment by passing a The apex court also direct- Practice, 2021 deals with vari-
nership under the ‘Mission meters worth C14,788 crore ancillary industries in the person is draconian in nature reasoned order which must be ed that the State Governments, ous aspects of criminal trial
Covid Suraksha’, and created he Union Cabinet on will provide economic pros- catchment area of the project,” and must be based on tangible communicated to the taxable as well as the Union of India (in including post mortem report,
an end-to-end vaccine devel-
opment ecosystem. The
T Tuesday approved further
development of Bangalore
perity, last mile connectivity
and sustainable transporta-
said Government in state-
ment detailing the Urea sub-
material.
A Bench of Justices D Y
person whose property is
attached.
relation to investigating agencies
in its control) shall carry out
charge, trial, recording of evi-
dence among others.
Government ensured that all Metro Rail project worth tion in Bangalore city. sidy project. Chandrachud and M R Shah The apex court’’s judge- consequential amendments to According to the draft rules,
the vaccine manufacturers C14,788 crore. The two pro- “Considering the strategic Coal gasification plants said the exercise of the power ment came against an order of their police and other manuals, as per Every Medico Legal
not only get all possible help jects titled as phase 2A and 2B energy security and urea self- are strategically important as for ordering a provisional Himachal Pradesh High Court within six months from today. Certificate, Post Mortem Report
and logistic support, but also will connect the metro rail to sufficiency of the country, coal prices are non-volatile attachment must be preceded which dismissed the writ peti- “This direction applies, shall contain a printed format of
the process of vaccine Central Silk Board Junction to looking into the country’s and coal is abundantly avail- by the formation of an opinion tion instituted under Article specifically in respect of Draft the human body on its reverse
approval is speedy and scien- K.R. Puram and K.R.Puram vast coal reserves, it has able. Talcher plant shall also by the Commissioner that it is 226 of the Constitution chal- Rules 1-3. The appropriate and injuries, if any, shall be indi-
tific, said the Prime Minister. to Air por t via Hebbal been decided go ahead with reduce dependence on impor- necessary to do for the purpose lenging orders of provisional forms and guidelines shall be cated on such sketch.
He also assured all possible Junction. The Cabinet Talcher Fertilizer Limited tant Natural Gas for produc- of protecting the interest of the attachment. brought into force, and all agen- The rules state that the
support and smooth approval Committee of Economic plant based on coal gasifica- tion of urea leading to reduc- government revenue. The petitioner Radha cies instructed accordingly, depositions of witnesses shall be
process for the vaccine can- Affairs chaired by Prime tion technology. tion in LNG import bill. “Before ordering a provi- Krishan Industries challenged within six months from today,” recorded, in typed format, if
didates which are currently Minister Narendra Modi also The project shall improve The gasification process sional attachment the the orders issued on October the bench said. possible and the record of evi-
under trial phase. approved the proposal of the availability of adopted in Talcher unit is a Commissioner must form an 28, 2020 by the Joint The three-judge bench also dence shall be prepared on
“The Prime Minister said Department of Fertilisers for fertilizer to farmers thereby Clean Coal Technology giving opinion on the basis of tangi- Commissioner of State Taxes comprising Justices L computers, if available, in the
the health infrastructure of the formulation of exclusive boosting development of east- negligible SOx, NOx and free ble material that the assessee is and Excise, Parwanoo in Nageswara Rao and S Ravindra Court on the dictation of the
our private sector has played subsidy policy for Urea pro- ern region and will save trans- particulate emissions as com- likely to defeat the demand, if Himachal Pradesh provision- Bhat said that the courts in all Presiding Officer.
a big role in the country’s fight duced through coal gasifica- port subsidy for supply of pared to directly coal fired any, and that therefore, it is ally attaching the appellant’’s criminal trials should, at the The judgement came on a
against Covid-19 and in the tion route by Talcher urea in processes. Talcher Fertilizers necessary so to do for the pur- receivables from its customers. beginning of the trial, i.e. after suo motu case of 2017 related to
coming days, the private sec- Fertilizers Limited (TFL). eastern part of the country. It Ltd. (TFL) is a Joint Venture pose of protecting the interest The provisional attach- summoning of the accused, the “deficiencies and inadequa-
tor will play an even more Addressing media though would assist in reducing Urea Company of four PSUs name- of the government revenue,” ment was ordered while invok- and framing of charges, hold a cies” in criminal trials in the
active role in the vaccination video conference Union imports to the tune of 12.7 ly Rashtriya Chemicals & the bench said. ing Section 83 of the Himachal preliminary case management country in which it proposed to
drive. This will require better Minister Piyush Goyal said LMT per annum leading to Fertilizers (RCF), GAIL It also clarified that the Pradesh Goods and Service hearing. amend the criminal manual
coordination between hospi- that the development project savings in foreign exchange. (India) Ltd. (GAIL), Coal expression “necessary so to do Tax Act, 20172 and Rule 159 of “This hearing may take and the rules which can be
tals and industry,” said PMO of Bangalore Metro will give “The project will also give India Ltd. (CIL) and Fertilizer for protecting the government Himachal Pradesh Goods and place immediately after the incorporated in the existing
said in a statement. more connectivity with the a boost to ‘Make in India’ ini- Corporation of India Ltd. revenue” implicates that it can- Service Tax Rules, 2017. framing of the charge. In this ones of the High Courts.
=4F34;78kF43=4B30H k0?A8; ! !! ]PcX^]$
4V_ecVdYZc\Z_XcVda`_dZSZ]Zej`_[RSd+5ZUZ
B0D60AB4=6D?C0Q :>;:0C0 announced the much-delayed lous” dealings and “mecha- adults from May 1 and also lift- but indulge in empty rhetoric. get vaccines for their citizens.
'universal' vaccine policy on nisms” she warned reminding ed the bar on the State She wrote “when the number of “You all know how the
ith the country’s corona 19th April, 2021, which appears the Prime Minister that he had Governments to procure stocks cases...is spiraling...the Centre pandemic is rising … the work-
W graph rising to helpless
levels Bengal Chief Minister
to be hollow, without sub-
stance, and a regrettable show
yet to responded to her earlier
letter written on April 24 seek-
from the manufacturers and
the open market.
has chosen to tactically indulge
in empty rhetoric...”
ers are coming back … now we
needed to vaccinate them and
Mamata Banerjee on Tuesday of evasion of responsibility...at ing permission (for her Considering the fact that Later launching a vitriolic the other residents … but even
shot off a second letter to the time of crisis.” Government Bengal) to pur- the young people going out for attack on the Prime Minister if I have the intention to pro-
Prime Minister Narendra Complaining that the chase vaccines directly from earning livelihoods were more from an election rally at vide vaccine to the people free
Modi in which she faulted him Centre has failed to address the market. likely to contact and transmit Murshidabad she said that her the Centre acted as a stumbling
for “evading” “responsibility.” issues like quality and stable flow Later she told in rallies that the disease faster a number of Government could have vacci- block … Here was a Prime
Days after writing to the of drugs in the market Banerjee “I am sitting with money ready. States like Maharashtra, Bengal nated many people by this Minister who was busy build-
Prime Minister to make wrote, “the announcement does I am willing to buy the vaccine Andhra Pradesh etc had com- time but the Centre’s faulty pol- ing his image internationally by
arrangements for 5 crore vac- not address major issues like the from the market and distribute plained about shortage of vac- icy failed her initiative. exporting vaccine doses …
cines and life-saving drugs like quality, efficacy, stable flow of it free among the people but here cines and demanded opening Attacking the Prime how can we feed others
remedesivir Banerjee on supply...” reminding that the is a Government that will not up the vaccination drive for Minister she said Modi had remaining hungry ourselves
Monday tore into the central policy “appears to be based on allow me to do so.” people of all ages. exported vaccines to other … and now they are saying that
Government’s “belated” deci- market prices which may put the With the medical system In the strongly-worded let- countries to earn praises from they are opening up vaccina-
sion to universalize the distri- common people under huge buckling under huge pressure of ter, the Chief Minister also the international community tion for the States also but
bution of vaccines even as she financial burden.” demand in the backdrop of ris- wrote that the Centre through whereas States like where is the stock … they have
wrote, “I'm informed that the The Government’s policy ing cases, the Centre had earli- its new policy had preferred not Maharashtra, Delhi, Rajasthan, already been exported out of
Central government has could encourage “unscrupu- er okayed vaccinations for all only to shirk its responsibility and Bengal were struggling to India,” she said.
Ra^bb^]T\X[[X^]\PaZ
n a significant development that will have bear- cent to 81.14 per cent.
I ing on the academic careers of lakhs of students
slated to appear for 10th standard exam this year, I519ndailyinanMaharashtra
alarming development, the
Covid-19 toll shot up a record
The total “active cases” cases in the
state rose from 6,76,520 to 6,83,856.
the Maharashtra government on Tuesday decid- on Tuesday, even The fatality rate in the state dropped
:D<0A274;;0??0=Q lives across Tamil Nadu. ed to cancel the state board SSC examinations in as 62,097 people tested positive for the from 1.56 per cent to 1.55 per cent.
:>278274==08 The hike in the number of view of the worsening Covid-19 situation in the pandemic in various parts of the With 34 fresh deaths, the Covid-
persons afflicted with pan- state. state. 19 toll in Mumbai rose from 12,301 to
ith hundreds of ambu- demic in both the States are a Announcing the cancellation of the SSC Two days after the pandemic had 12,354, while the infected cases went
W lances blaring the emer-
gency sirens speeding to hos-
fall out of the high pitched
campaigns for the election to
examinations, Maharashtra Education Minister
Varsha Gaikwad tweeted: “Given the worsening sit-
claimed 503 lives on a single day in the
state, Maharashtra logged 519 deaths,
up by 7192 to trigger a jump in the
infections from 5,86,867 to 5,94059.
pitals with patients in the last assemblies. Though Tamil uation of the #Covid-19 pandemic, the taking the total number of deaths in While Pune accounted for a max-
phase of their lives, the num- Nadu ahead of Kerala in the Maharashtra government has now decided to the state from 60,824 to 61,343. imum 1,117521 “active cases” in the
ber of Covid patients in Kerala number of Covid-19 patients CANCEL the state board exams for class 10th. Similarly, the number of infections state, Mumbai stood second with
crossed past the 1.2 million by leap and bounds, as on Health & safety of students & teachers is our top- rose from Monday’s tally of 58,924 to 82,761, followed by Thane (80440),
mark by Tuesday evening. The Tuesday there were only 1.01 most priority”. 62,097 on Tuesday. The state had Nagpur (78,484), Nashik (44,279),
day saw 19,577 new persons million positive cases in Tamil “As the current atmosphere is not conducive recorded an all time high of 68,631 Ahmednagar (21,634), Latur (19,062),
getting diagnosed with Covid- Nadu against Kerala’s 1.27 mil- to exams, we had earlier postponed our exams infections on Sunday, On Saturday, the ), Chandrapur (15,744), Bhandara
19 on a single day taking the lions. while requesting other boards to reschedule theirs. state had recorded 67,123 infections. (15,186),Aurangabad (14779), Satara
total number of patients in the Both Kerala and Tamil In response to our communication, other boards With 62,097 fresh infections (14,183), Jalgaon (13,475), Nanded
State to 1,27, 2645. The day also Nadu have declared night cur- have now cancelled their exams, so maintaining reported on Tuesday, the total num- (13,233), Parbhani (12,964), Solapur
saw 28 fatalities across Kerala few for the nest fortnight with parity, we have cancelled ours too,” she tweeted. ber of infections went up from (12487), Beed (11,359) Gondia (9762)
due to Covid-19. effect from Tuesday night. The minister said that the criterion on the basis 38,98,262 to 39,60,359. and Nandurbar (7128).
As leaders of the Indian Kerala has announced stringent of which results would be declared for class 10th As 54,224 patients were discharged Of the 2,43,41,736 samples sent to
Medical Association described rules to discipline people who & date of result declaration would be announced from the hospitals across the state after laboratories, 39,01,359 have tested
that the situation has gone out do not wear masks and main- shortly. “The School Education Dept is commit- full recovery, the total number of peo- positive (16.27 per cent) for COVID-
of control in the State, a polit- taining social distancing. ted to devising a fair and accurate assessment cri- ple discharged from the hospitals 19 until Tuesday.
ical diatribe commenced with Though the Government has terion,” she tweeted. since the second week of March last Currently, 38,76,998 people are in
ministers and politicians blam- tightened the rules and limit- “As far as the state board exams of class 12th year went up to 32,13,464. The recov- home quarantine while 27,690 people
ing the Centre for short supply ed the number of guests who are concerned, we have already conveyed our deci- ery rate in the state for the first time are in institutional quarantine.
of vaccines. Though Chief could be invited for marriages sion to postpone the exams till May end. The sta-
Minister Pinarayi Vijayan had and social functions, the police tus remains the same. We are closely monitoring
claimed before the assembly
election that the State would
initiate measures to manufac-
officials turn a blind eye to vio-
lations of rules.
“So long as nobody regis-
the health and safety situation in the state,” the min-
ister tweeted.
It may be recalled that on April 12, the
9:bTTbWXVWTbcbX]V[TSPhb_XZT^U
ture its own branded vaccine,
he is maintaining silence on the
issue once the election was
ters any complaint, we do not
have any issues. But ensure that
your neighbours do not create
Maharashtra government on Monday postponed
the board examinations of Standard 10th and 12th
in view of the worsening Covid-19 situation in the
!"PRcXeTRPbTbRa^bb ":
over. any problems,” is the standard state. Jammu : Jammu & Kashmir logged 2,030 new Covid cases on Tuesday, the high-
Meanwhile neighbouring advice from the cops to persons The State Education Minister had at that time est single day spike since the beginning of the pandemic while the number of
Tamil Nadu too saw the num- who are holding such said that “keeping in mind the schedule of active cases crossed 13,000. Officials said that the new cases included 944 from
ber of Covid-19 patients shoot- events. entrance exams for professional courses, class 12th the Jammu division and 1,086 from the Kashmir division while 716 patients
ing up though not as badly as Situation in Kerala is grave exams will be held by end of May, while 10th stan- were discharged from different hospitals after recovery.
Kerala. On Tuesday, and medical doctors asked dard exams will be in June”. Eight patients -- five from Jammu division and 3 from Kashmir division -
Directorate of Public Health people in other States to The postponement of the SSC and HSC - succumbed on Tuesday, as the total number of people killed by coronavirus
and Preventive Medicine said reschedule their travel plans to examinations had come on the state government rose to 2,071. So far, 150,238 people have been infected with coronavirus in
in a release that the State saw God’s Own Country till the announcement made on April 3 that all state board J&K out of which 134,697 have recovered.
10,986 new cases of Covid-19 Covid-19 situation is brought students from standard 1 and 8 would be promoted The number of active cases is 13,470 out of which 5,575 are from the Jammu
while the pandemic claimed 48 under control. to the next without any examination. division and 7,895 are from the Kashmir division. IANS
5,/VXSSOLHVWRQQHVRIPHGLFDOR[\JHQGDLO\WR6WDWHV87
C=A067D=0C70Q <D<108 Diu, free of cost through special setup process to produce and Corporate houses held here on ity to 260. ICMR to be part of a multicen-
tankers. supply medical-grade oxygen by Saturday last, Maharashtra chief Reliance Foundation also tre clinical trial to evaluate the
mid the shortage of liquid The 700 tonnes of medical diverting industrial oxygen to minister Uddhav Thackeray developed a fully-equipped iso- efficacy of plasma therapy, set
A Oxygen across the country,
the Reliance Industries Ltd
oxygen is sufficient to provide
relief to at least 70,000 critical-
produce medical-grade oxygen
to pitch its contribution to meet
had among other things
appealed to them to make
lation facility at Lodhivali in
Maharashtra and handed it
up an exclusive 10 bedded dial-
ysis centre in HBT Trauma
(RIL) has tweaked its manu- ly ill Covid-19 patients daily in the demand for medical arrangements for priority pro- over to the district authorities Hospital, Mumbai in collabo-
facturing process at Jamnagar three states and UT. Oxygen. “Currently, the entire duction and supply of oxygen there. It also supported the set- ration with BMC.
Refinery to produce and dis- Sources said that the RIL supply of oxygen, including for Covid patients in the state ting up of a quarantine ward for Sir HN Reliance
tribute around 700 metric was prepared to supply medical transportation in special tankers The industrialists had unani- suspected patients at Spandan Foundation Hospital, the Sir
tonnes of medical grade oxygen Oxygen for other states in the at (-) 183oC is being made free mously agreed to do the need- Holistic Mother-And-Child H.N. Reliance Foundation
everyday to three states and a country as well, provided there of cost to the state governments ful. It may be recalled that Care Hospital in Mumbai. Hospital also provided home
Union Territory. were specific requests from the as a part of RIL’s CSR initiative. Reliance Foundation had earli- Reliance Foundation sup- quarantine services. It provided
For the past two days, RIL states concerned and they were This is one more initiative of the er set up country’s first Covid ported digital and medical infra- over 5.5 lakh litres of free fuel,
has been transporting 700 met- ready to bear the transportation Reliance Industries and Reliance hospital in Mumbai In collab- structure at Sardar Patel supporting over 14,000 ambu-
ric tonnes of medical Oxygen cost. Foundation to provide relief in oration with the Brihanmumbai COVID-19 Care Centre, Delhi. lances across 249 districts in 18
daily to the states of Gujarat, Given that the medical the ongoing pandemic,” an RIL Municipal Corporation (BMC) In addition, Sir HN Reliance states. It produces 1,00,000 PPE
Maharashtra, Madhya Pradesh grade oxygen was not produced spokesperson said. in just two weeks. After setting Foundation Hospital, which and face masks per day for
and Union Territory of Dadra, earlier at the Jamnagar refinery, At a meeting with promi- up a 100-Covid bed hospital ini- was the first institute in India’s health and frontline
Nagar Haveli and Daman & RIL has installed equipment and nent industrialists and leaders of tially, it scaled up the bed capac- Maharashtra identified by workers.
=4F34;78kF43=4B30H k0?A8; ! !!
%
gggTQY\i`Y_^UUbS_]
7KHFRQXQGUXP
UPRTQ^^ZR^\SPX[h_X^]TTak /CWT3PX[h?X^]TTak X]bcPVaP\R^\SPX[h_X^]TTa
A2A6CH:E9A2DD:@?
=ZadVcgZTV0
7
7KHSDUWLHV
GHFLVLRQWRFXUWDLOHOHFWLRQHHULQJ
LQ%HQJDOVPHOOVPRUHRIK\SRFULV\WKDQFRQFHUQ
KHSDUWLHVLQWKH:HVW%HQJDOSROOIUD\KDYHUHDOLVHGDOEHLWWRRODWHLQWKHGD\
WKDWLWLVHVVHQWLDOWREUHDNWKHWUDQVPLVVLRQFKDLQWRPLWLJDWHWKHVSUHDGRIWKH
JHWVWULFNLHU 1C8?;;<47C0
&29,'YLUXV:LWKWKHQXPEHURILQIHFWLRQVLQWKHFRXQWU\VN\URFNHWLQJRQ
DGDLO\EDVLVWKHFRQWDJLRQKDVFOHDUO\PDUNHGLWVHOIDZLGHWHUULWRU\DQGWKHGHFL
CWTBd_aT\T2^dac³bbRPcWX]VYdSV\T]c]^cfXcWbcP]SX]V
VLRQRIWKHSROLWLFLDQVDSSHDUVWREHDP\RSLFFDVHRIWRROLWWOHWRRODWH,QIDFWUDWKHU
WKDQDQDFWRIJHQXLQHFRQFHUQDQGHPSDWK\LWUHVHPEOHVDUDWUDFHZLWKWKHSDUWLHV =T_P[b?<:?>[XWPb_a^a^VdTScWT7^dbTPbTR^]ScX\T
Y\LQJWRVFRUHEURZQLHSRLQWVDERXWZKLFKRQHRIWKHPKDVLWVKHDUWLQWKHULJKWSODFH fter the Supreme Court
YLVjYLV WKHKHDOWKRIWKHLUFRQVWLWXHQWV+DGWKHVHSDUWLHVDQGWKHLUOHDGHUVUHDOO\
FDUHGIRUWKHPDVVHVWKH\ZRXOGQ·WKDYHZDLWHGILYHSKDVHVWRVKRZWKHLUIUDWHUQDO
FRQFHUQ2QO\DIWHUWKH/HIWWKH&RQJUHVVDQG70&
DQQRXQFHGWKDWWKH\ZRXOGQRWKROGELJUDOOLHVLQ
A of Nepal on February
23 overturned Prime
Minister (PM) KP Oli’s
decision to dissolve Parliament,
he prorogued the House session
WKH6WDWHLQWKHEDFNGURSRIULVLQJ&RURQDYLUXVFDVHV on Monday afternoon.
GLGWKH%-3SURFODLPWKDWLWZRXOGFXWGRZQRQWKH A two-year power struggle
QXPEHURIDWWHQGHHVDWWKHSXEOLFPHHWLQJVLQFOXG between Oli and his bête noire,
revolutionary leader Prachanda,
LQJWKRVHDGGUHVVHGE\3ULPH0LQLVWHU1DUHQGUD has ended in a climactic anti-cli-
0RGL 6DGO\ EXW ILWWLQJO\ QRQH RI WKH SDUWLHV max with Oli providentially
GHVHUYHV D FRPPHQGDWLRQ IRU VXFK D GHFLVLRQ keeping his chair. Witness the
PD\EHWKHLUOHDGHUVDUHQRZDFWXDOO\ZRUU\LQJDERXW events in the last six months: Oli
dumped the Prachanda-Madhav
WKHLURZQZHOOEHLQJDIWHUWKHLUIHOORZSDUW\PHQDUH Nepal group, ditched the Chinese
IDOOLQJOLNHQLQHSLQVWRWKHYLUXV7KH&RQJUHVVDQG by refusing to step down as the
LWVPRWOH\JURXSRIDOOLHVSUDJPDWLFDOO\VSHDNLQJ PM, dissolved Parliament,
ZHUHQHYHUWUXO\LQWKHEDWWOHIRU:HVW%HQJDOVR ordered elections and reinstated
himself as the PM — not caretak-
LWGRHVQ·WUHDOO\PDWWHULIWKH*DQGKLVFLRQFDPSDLJQVWKHUH er — of a revived Government,
)RUWKH70&³WKHUXOLQJSDUW\LQWKH6WDWHZKLFKLVILJKWLQJDUHVROXWH%-3WRRWK insisting that it was business as
DQGQDLO³LW·VQRWHDV\WR\LHOGDQGIROGXSOLNHWKH&RQJUHVVKHQFHLWZRXOGVWLOO usual. Except that the quality of
JRDKHDGZLWKFDQYDVVLQJEXWZLOORUJDQLVHRQO\VPDOOPHHWLQJVZLWKPLQXWHVSHHFK governance had declined further
through rule by ordinances, makers in a House of 275. No to the hurriedly drafted good and quiet work by
HV7KH%-3LVDOVRWR\LQJZLWKDVLPLODUSODQ%XWWKHTXHVWLRQLV'RHVWKH6$56 boosted by the party faithful party or combination of par- Constitution of 2015. Ambassador Vinay Kwatra
&R9YLUXVWDNHORQJHUWKDQRGGPLQXWHVIRUWUDQVPLVVLRQ"+RZHYHURQ'LGL·V President Bidhya Devi Bhandari. ties has filed a motion of no- Nepal has had seven and agencies. The
SDUWLW·VDFDOFXODWHGPRYHWRVHQGRXWWKHPHVVDJHWKDWVKHFDUHVIRUKHU6WDWH·V In a shock-and-awe judg- confidence according to Constitutions (1948, 1951, Kathmandu-Raxaul DPR for
SHRSOH+RZHYHUWKH%-3KDVHPHUJHGLQWKLVHSLVRGHDVWKHSDUW\PRVWLQGLIIHUHQW ment, the Supreme Court Article 100 (5) of the 1959, 1962, 1990, 2007 and a broad gauge railway line,
deprived the Nepal Communist Constitution that requires 68 2015). It is a federal, secular, 198-km-long and costing
WRWKHHOHFWRUDWH·VKHDOWKDQGVDIHW\%HLQJWKHUXOLQJSDUW\DWWKH&HQWUHRQHZRXOG Party (merged CPN-UML and lawmakers. (The new democratic republic, not com- $3.15 bn, has been submitted
KDYHH[SHFWHGIURPLWPRUHPDWXULW\DQGVHULRXVQHVVLQILJKWLQJWKHJOREDOFULVLV CPN Maoist Centre) of its label Constitution bars a no-confi- pletely inclusive though one- to Singha Durbar. India has
DQGFHUWDLQO\QRWWKHEXOOKHDGHGQHVVWKDWDWEHVWRYHUDUFKHVWKHPDMRULW\LQDQ$VVHPEO\ and symbol, reducing it to sep- dence motion in the first two third of Parliament’s strength said it will complete the rail-
1RGRXEWWKH%-3OHG*RYHUQPHQWKDVPDGHODXGDEOHHIIRUWVLQWKHILJKWDJDLQVW arate constituents. Prachanda’s years of any Government.) is meant to be women. But way five years after the land is
writ petition for the NCP’s The political conundrum con- janjatis and Madhesis are dis- obtained. In addition, several
&29,'EXWLWFDQQRWDIIRUGWRORRNERRULVKZKHQLWVSROLWLFDORSSRQHQWVDUHDLU
LQJFRQFHUQIRUSHRSOH2QDVHSDUDWHQRWHRQWKH&29,'LVVXHWKH&HQWUHKDV
revival was rejected. Strangely,
the Election Commission with-
tinues with Oli at the helm.
The arithmetic of the
=4?0;70B satisfied with its provisions.
The Madhesis in the JSP are
legs of the Hulaki Rajmarg
connecting the East-West
DOORZHGDOODGXOWVWRJHWYDFFLQDWHGIURP0D\XQGHUWKHQDWLRQZLGHLQRFXODWLRQSUR held its decision on allotting the revived House is the CPN- 703B4E4= negotiating with Oli to redress Highway with the Indian bor-
JUDPPH5DWKHUWKDQORRNLQJOLNHDJUDGHGUHVSRQVHEDVHGRQHPSLULFDOGDWDWKH NCP’s ‘Sun’ symbol and party UML - 121 (including 38
2>=BC8CDC8>=B their constitutional grievances der are being completed. The
QHZOLEHUDOLVHGYDFFLQHSROLF\DSSHDUVPRUHRIDNQHHMHUNUHDFWLRQWRWKHVXGGHQ label to either faction, saying the dissident lawmakers belong- in lieu of supporting the grand China-Nepal Economic
DQGH[SRQHQWLDOULVHLQWKH&RURQDYLUXVLQIHFWLRQFDVHV+RZHYHULWLVWKHGHVWLQ\RI
party had not split. The story of ing to the Nepal-Khanal fac- B8=24 (#'8C8B0 Government’s formation. It is Corridor, which includes a
political hara-kiri was scripted in tion); Nepali Congress - 63 interesting that in 2008-09, road and railway line from
WKHFRPPRQPDQLQRXUFRXQWU\WRVWDQGLQDORQJTXHXHIRUORQJKRXUVEHLWRXW the NCP despite its overwhelm- (fractured among Sher 5434A0;B42D;0A Nepal turned away from a Kyrong-Kathmandu-Pokhara-
VLGHDSROOLQJERRWKRUYDFFLQDWLRQFHQWUH ing and unprecedented political
stability in Parliament, majority
Bahadur Deuba, Ramchandra
Poudyel and Koirala factions);
34<>2A0C82 Maoist Government (Maoists
won nearly a 2/3rds majority
Lumbini, is awaiting the green
light and funds. Once com-
Governments in six of the seven Janata Samajwadi Party - 32 A4?D1;82=>C but were relegated to the pleted, Chinese goods will
?82D1<; provinces and 80 per cent of
posts in the local elections.
(Upendra Yadav, Baburam
Bhattarai, Mahanta Thakur
2><?;4C4;H third position in 2013). In
2021, Nepal has shied away
reach the rich markets of the
Indo-Gangetic Plain.
Landmark dates in the cal- and Rajendra Mahto groups), 8=2;DB8E4C7>D67 from Communist rule despite While Deuba has said
endar of events are February
2018 (Oli elected as the PM with
CPN Maoist Centre - 48 to 53.
The Government-formation >=4C78A3>5 China’s Herculean efforts to
keep the Left flock together.
there is no chance of a new
Government till Maoists
Maoist support); May 17, 2018 combinations realistically at ?0A;80<4=CB Ambassador Hou Yanqui has withdraw support to Oli, the
(the merger of the NCP factions); play are the CPN-UML plus not abandoned her efforts to PM has prorogued the House
July 2, 2020 (Oli prorogues JSP; NC, Maoists plus JSP; and BCA4=6C78B keep the Left parties united again even as a no-confidence
House); December 20, 2020 (Oli
dissolves Parliament); February
CPN-UML plus NC. As Oli is
tarred by the brush of poor
<40=CC>14 and has met both former
Prime Ministers Madhav
vote was being planned. The
political conundrum seems
23, 2021 (the Supreme Court’s governance and “self before F><4=1DC Nepal and Prachanda. But the embedded in the
verdict on revival of the House
on March 7); April 19, 2021 (Oli
service”, the NC is unlikely to
support Oli, who has not
90=90C8B0=3 unity project appears to be
beyond reach. The
Constitution of Nepal.
(The writer, a retired Major
prorogues the House again). sought a vote of confidence. <0374B8B0A4 Himalmedia Public Opinion General, was Commander,
While Oli has not resigned
on moral grounds, the Maoists
Strange are the ways of Nepali
politics (imbibing the Belgian 38BB0C8B5843F8C7 Survey April 2021 has blamed
Oli and Prachanda for putting
IPKF South, Sri Lanka, and
founder member of the Defence
have not withdrawn support to model where the country 8CB?A>E8B8>=B the democracy at risk. Planning Staff, currently the
him. No single party has the operates seamlessly without a India has made an impres- Integrated Defence Staff. The
necessary majority of 138 law- Government), probably due sive comeback, thanks to the views expressed are personal.)
;4CC4AB C>C
C74438C>A SOUNDBITE
CWT:PaQXcaXQP[bSdaX]VcWTcaPSXcX^]P[6^WPX]D[XdfPUTbcXeP[Pc<Ph^]VeX[[PVTX]<^aXVP^]SXbcaXRc0bbP\ ?C8
CWTaTXb]^[^RZS^f]
C855B@?<9D93C9>G5CD25>71<
<_S[T_g^Yc^_dQc_\edY_^ X]cWTR^d]cahP]S
3ZeeVcY`^VT`^Z_X
Sir — It refers to the editorial ‘The guides’ _T^_[TS^]^c]TTSc^
(April 20). The decision taken by the polit- _P]XRPQ^dcW^fcWTh
ical parties to break the chain of virus came PeP[P]RWT ^U RPbTb ;^RZS^f]b PaT [TPZh fX[[aTPRWW^\T
quite late as the voting for five phases already d][Tbb cWT SXbTPbT bdaeTX[[P]RT \TRWP]Xb\ CaPX]bfX[[R^]cX]dTc^
7KHPLJUDQWZRUNHUVDUHUXVKLQJEDFNEHFDXVH over and campaigning for the sixth phase is
going on. A huge damage has already been
X\_a^eTbfTPaX]V^U\PbZbXbbcaXRc[hT]U^aRTS
X]bcXcdcX^]P[P[cTa]PcXeTbc^W^\T`dPaP]cX]TPaT
ad]PbQTU^aT
$
VWKHSDQGHPLF·VVHFRQGZDYHVXUJHV,QGLD·VPLJUDQWZRUNHUVDUHDJDLQKHDG reporting significant number of COVID-19 P]Tg^Sdb[XZT[PbchTPa5dacWTaPRRTbbc^cTbc
X]VP]SWTP[cWRPaTUPRX[XcXTb\dbc]cQTaTcPaS <^bR^fbP[[TVTS
LQJKRPHMXVWOLNHWKH\GLGZKHQWKHILUVWZDYHUHVXOWHGLQDKDUGQDWLRQZLGHORFN cases. Earlier it was the TMC and the
Congress which announced that they would TS>cWTafXbTP[^RZS^f]fX[[]^cbTaeTXcb X]e^[eT\T]cX]cWT
GRZQLQDPDWWHURIIRXUKRXUVODVW0DUFK7KLVWLPHDURXQGIRUWXQDWHO\ZHDUH X]cT]STS_da_^bT ! #P\\d]XcX^]
C
not conduct or organise mega rallies and WT[^RZS^f]X\_^bTSX]3T[WXP]S\P]h
QRWZLWQHVVLQJWKHKHDUWEUHDNLQJPDVVPLJUDWLRQRILPSRYHULVKHGZRUNHUVZLWKIDPL finally the BJP also followed in their foot- ^cWTa RXcXTb Qh cWT aTb_TRcXeT BcPcT B^\TPdcWT]cXRaT_^acbR[PX\cWPccWTeXadb ST_^cTg_[^bX^]
OLHVLQWRZFDUU\LQJDOOWKHLUZRUOGO\JRRGVRQWKHLU caP]b\XbbX^]cPZTb_[PRTTeT]X]PXa3^^ac^ fPb]^cP]PRc^U
steps and showed some restraint by 6^eTa]\T]cbbW^fbcWPcXcXbU^acWTBcPcT
S^^acTbcX]VP]ScaPRX]Vc^b_^cPbh\_c^\PcXR BcPcTcTaa^aXb\
VKRXOGHUVDVWKH\WUXGJHEDFNKRPHLQWKHVHDULQJ announcing that rallies with only 500 peo- SXb_T]bPcX^]c^cPZTSTRXbX^]b^]cWTRdaQbP]S
ple will be organised. RdaUTfQPbTS^]cWT_aTePX[X]VbXcdPcX^]X]cWTXa b_aTPSTab\dbcQTX]cT]bXUXTS3Tb_XcT\dRW
VXPPHU1RZWKHZRUNHUVGRQ·WWUXVWWKHLQVHQVLWLYH PS^PQ^dcP\XRa^R^]cPX]\T]cbcaPcTVhcWT 2iTRW?<
Anyhow, West Bengal is going to be a _PacXRd[Pa BcPcT CWXb bXcdPcX^] RP] ePah* ¯0]SaTY1PQXb
*RYHUQPHQWVHPSOR\HUVDQGFLW\GZHOOHUVHQRXJKVR high-stake battle where innocent people have WT]RT Xc³b QTccTa cWPc ^][h cWT BcPcT _dQ[XR WTP[cW bhbcT\b SXbTPbT bdaeTX[[P]RT
DVWREHOHIWLQWKHOXUFK$VPRUHFLWLHVFRPHXQGHU lost their lives to dirty politics. However, it 6^eTa]\T]cb cPZT P RP[[ fXcW aTb_TRc c^ Xc RP_PRXchXb_^^aCWXbXbfWhcWTbTR^]SfPeT
WKH FRQWDJLRQ·V JULS DQG DV WKH *RYHUQPHQWV VWDUW seems that the leaders of political parties have 2daaT]c[h]^cP[[BcPcTbPaTfXc]TbbX]VcWTbP\T bda_aXbTS db 8\_^bX]V P [^RZS^f] P]S
ST_^_d[PcX]V_dQ[XRb_PRTb\dbc]c_dbWcWT FTfT]cU^aPW^[XSPh
LQFUHDVLQJWKHQXPEHURIUHVWULFWLRQVDQGFXUIHZVVKRUW realised the importance of the lives of citi- d]R^]ca^[[PQ[TbdaVT^UcWT2>E83X]UTRcX^]b
6^eTa]\T]c \PRWX]Tah X]c^ X]PRcX^] c^CdbRP]hP]SfT
zens and hopefully lessons would be learnt 7^fTeTacWTVPX]bUa^\cWTRdaUTf\dbcQT
ORFNGRZQVWKHPLJUDQWZRUNHUVZKRKDGMXVWVWDUW from it. Any public gatherings of large mag- _a^_^acX^]PcTc^cWTR^bcbX]RdaaTS1aTPZX]V ;^RZS^f]bRP]]^cQTR^\TcWTSTUPd[cR^]cPX] WPSP[[cWTbTP\PiX]V
HGWRUHVHWWOHLQWKHFLWLHVDIWHUUHWXUQLQJWRWKHLUMREV \T]cbcaPcTVhfWX[TfPXcX]VU^acWTePRRX]P QaXRZ^eT]_XiiPbP]S
nitude should not be allowed anywhere in cWTRWPX]^UcaP]b\XbbX^]SdaX]VcWT]TgcbXg 8RP\TQPRZVPX]X]V
DIHZPRQWKVDJRDUHUXVKLQJEDFN7KHWUDLQVJRLQJ the country till we develop herd immunity SPhbfX[[^UUTab^\TaTb_XcTc^WTP[cWRPaTf^aZ cX^]_a^YTRcc^aP\_d_
=BPSWPbXePATSSh k1T]VP[dad TXVWcZX[^b
WR %LKDU DQG 8WWDU 3UDGHVK WKH ELJJHVW VRXUFHV RI by way of aggressive vaccination. With the Tab P]S UPRX[XcXTb cWPc PaT bfP\_TS Qh P] 0Rc^a
Government allowing everybody above 18
PLJUDQWZRUNHUVDUHOHDYLQJ0XPEDL/XFNQRZ'HOKL years of age to get the jab from May 1, we The Government has been working hard for mere target-oriented exercise entrusted to the
¯:PaTT]P:P_^^a:WP]
1&5DQG$KPHGDEDGZLWKVWDQGLQJURRPRQO\ will soon develop herd immunity. It’s good over a year to ensure that the maximum enforcing agencies, including the police, by
(YHQWKRXJKPRVWRIWKHZRUNHUVNQRZWKDWWKH\ that the States can buy doses directly from number of Indians are able to get the vac- the Government to show that they are seri- CWTC^Zh^>[h\_XRb
fX[[QTSXUUTaT]cU^a
DUHUHWXUQLQJWRMREOHVVQHVVDQGSHQXU\WKH\VD\WKH\SUHIHUVWDUYLQJDWKRPHDPRQJ vaccine-makers in the “liberalised and cine in the shortest possible time. India’s ous in tackling the menace. It, however,
\T8\[TPa]X]VW^f
accelerated Phase 3 strategy of COVID-19 approach to building scientific and epidemi- appears that our politicians are in a class by
WKHLUORYHGRQHVWKDQEHVWUDQGHGLQDQDOLHQSODFHZLWKRXWDQ\VRFLDOVHFXULW\KRSH vaccination”. We have reported 2.73 lakh new ological pillars is guided by the global best themselves in that they seem to exempt c^R^]ca^[\h
RUKHOSLQJKDQGIURPWKH*RYHUQPHQWVRUWKHSHRSOH7KHWUDXPDWKH\ZHQWWKURXJK daily cases in the highest spike since the pan- practices, SoPs of the WHO as well as the themselves from the orders passed for cW^dVWcb0ccWTbP\T
cX\T8\_TaU^a\X]V
ODVW\HDUZLOOVWD\DOLIHWLPHDQGWKH\KDYHFKRVHQZKDWWRWKHLUPLQGLVDQHDVLHU demic broke out a year ago. vision of experts in the National Expert effective control of COVID-19. Is the QTccTa
RSWLRQ+RZHYHUWKLVH[RGXVGRHVQRWDXJXUZHOOIRUWKHQDWLRQ·VILVFDOKHDOWKWKDWKDG Bal Govind | Noida Group on Vaccine Administration for Coronavirus biased in its virulent approach
COVID-19. The total vaccinations across the that it makes clear-cut distinctions between
MXVWVWDUWHGUHFRYHULQJDIWHUODVW\HDU·VKDUGORFNGRZQGHOLYHUHGDQRWKHUFUXVKLQJEORZ B978DCD5@9>D85B978D49B53D9?> country have crossed more than 13 crore. politicians and the common man while it
0aRWTa
¯3TT_XZP:d\PaX
WRDQDOUHDG\WRWWHULQJHFRQRP\&RPSULVLQJSHUFHQWRIWKHZRUNIRUFHPLJUDQWODERXU Sir — It’s a good decision by the Centre to This is the right step towards a decisive bat- tears across the country on its infecting spree!
LVYLWDOWRHYHU\HFRQRPLFVHFWRUHVSHFLDOO\WKHLQIRUPDOVHFWRUDQG060(VDQGFRQ announce that all Indian citizens above the tle against COVID-19. Hope that people will While the need of the hour is to stave off the
VWLWXWHVQHDUO\SHUFHQWRI,QGLD·V*'3(YHQWKRXJKPRVW6WDWH*RYHUQPHQWVDQG age of 18 years can get COVID-19 vaccine come forward for vaccination and cooper- threat of the virus by standing unitedly CWT?<WPb
starting May 1. The immunisation drive was ate in curbing the pandemic. against it, the State Governments blaming R^\_[TcT[hUPX[TSc^
WKH&HQWUHWRRDUHFOHDUWKDWWKHUHZLOOEHQRKDUGORFNGRZQWKLVWLPHWKHPHVVDJH currently restricted to only citizens aged Amit Singh Kushwaha | Satna each other for the huge COVID-19 surge at _a^eXSTPbT]bT^U
VHHPVWREHORVWRQWKHXQQHUYHGZRUNHUV7KHRQO\RSWLRQIRUWKH*RYHUQPHQWWRVWRS above 45. The Government has allowed such a time is uncalled for. bPUTchSXaTRcX^]^a
WKLVPLJUDWLRQLVWRJHWWKHPHVVDJHDFURVVORXGDQGFOHDU7KHZRUNHUVQHHGWREH States, private hospitals and industrial estab- 2581F5@B?@5B<IG9D839D9J5>C Pachu Menon | Goa [TPSTabWX_SdaX]VcWXb
DVVXUHGWKDWWKH\ZLOOQRWEHOHIWWRIHQGIRUWKHPVHOYHVWKLVWLPHDURXQG,IWKH*RYHUQPHQWV lishments to procure the doses directly from Sir — The manner in which flying squads \PbbXeTWd\P]RaXbXb
the manufacturers. It’s good to scale up their have been enforcing pandemic-related pro- fTPaTUPRX]V
IDLOWRFRQYLQFHWKHPWKHQDWLRQ·VUXUDODQGXUEDQHFRQRPLHVZLOOEHLQDVKDPEOHV manufacturing by increasing the role played tocols in public places and behaving with BT]Shh^daUUTTSQPRZcc^) 2^]VaTbb[TPSTa
7KLVLVVXUHO\QRWVRPHWKLQJZHFDQDIIRUGULJKWQRZ by the private sector and State Governments. the citizens needs to be condemned. It is a [TccTabc^_X^]TTa/V\PX[R^\ ¯?aXhP]ZP6P]SWX
=4F34;78kF43=4B30H k0?A8; ! !!
&
gggTQY\i`Y_^UUbS_] UPRTQ^^ZR^\SPX[h_X^]TTak /CWT3PX[h?X^]TTak X]bcPVaP\R^\SPX[h_X^]TTa
FIRSTCOLUMN 0HPRULHVRIWKHELUWK
RI%DQJODGHVK
52C<52JD29625
7@CA2<:DE2? 1>470:B0A
C;?[TPSTaAXieXQhST\P]SX]VTg_d[bX^]^UcWT5aT]RW
0\QPbbPS^aWPbRPdVWc8\aP]:WP]QhWXbcWa^Pc 7KLVGHVFULSWLRQDOVRSRLQWVWRWKHFRPPRQDOLW\LQWKHKLVWRU\RI,QGLD3DNLVWDQDQG%DQJODGHVK
LQDZLGHUEDFNJURXQGRIWLPHDQGVSDFHWKDWDOVRGHVHUYHVSUHVHQWUHFROOHFWLRQ
ast month’s celebration of the 50th anniversary
=1B;1>45I :0C9D
L of Bangladesh’s independence, brought back
some memories of those times. Here they are,
for those whose interest may have been aroused by
7
KH 3DNLVWDQL *RYHUQPHQW DQG WKH UHOLJLRXV IXQGDPHQWDOLVW Prime Minister Modi’s recent visit to our neighbour-
7HKUHHNH/DEDLN3DUW\7/3KDYHDJUHHGWRSODFHWKHLVVXHRI ing country on that occasion. Fifty years ago, in 1971,
H[SHOOLQJWKH)UHQFK$PEDVVDGRUEHIRUHWKH3DUOLDPHQW7KH7/3 I was in the Indian Foreign Service and assigned
as Political Counselor in India’s permanent mission
LVDIDU5LJKWH[WUHPLVWJURXSZKLFKZDQWVVWULFWHQIRUFHPHQWRIWKH to the UN, at New York. My work involved follow-
EODVSKHP\ODZVLQ3DNLVWDQZKLFKDUHRIWHQXVHGWRWDUJHW$KPDGLV ing current events and the role of the UN. The ongo-
+LQGXV6LNKV&KULVWLDQVDQGVRRQ,QWKH7/3ODXQFKHGDQDJL ing tension and conflict in then East Pakistan was
WDWLRQZKLFKEURXJKWWKHZKROHRI3DNLVWDQWRDVWDQGVWLOORYHUDSUR a part of that job. This became especially so in the
SRVHGFKDQJHLQDQHOHFWLRQODZZKLFKLWVDLGZDVDJDLQVWWKHFRQ heated environment of late 1971 for the subconti-
FHSWRI´NKDWPHQDEXZDW ILQDOLW\RI3URSKHWKRRGµ1RZWKH7/3KDV nent. The Cold War was at full blast, the US was
GHPDQGHGWKHH[SXOVLRQRIWKH)UHQFK$PEDVVDGRUDQGQL[LQJDOOWUDGH seeking a historic opening with China, and India
was steadfastly maintaining its policy of non-align-
WLHVZLWK)UDQFHDVFDUWRRQVRIWKH3URSKHWKDGEHHQVKRZQWKHUHDQG ment, while grappling with massive refugee inflows
3UHVLGHQW0DFURQKDGVDLGWKLVZDVSDUWRIWKHIUHHGRPRIVSHHFKJXDU fleeing the genocide inflicted by the Pakistani army
DQWHHGE\WKH)UHQFKODZ,WKLQNDQ\03LQ3DNLVWDQZKRZLOOSOHDG on its own population in the East.
DJDLQVWH[SXOVLRQRIWKH)UHQFK$PEDVVDGRULQWKHGHEDWHZLOOEHSODF Much has been written about this conflict. Here >=3424<14A"
LQJKLVOLIHDWULVNDQGEHFRPLQJ´ZDMLEDOTDWO GHVHUYLQJWRGLHµOLNH are some key vignettes from the sidelines of action C74?0:8BC0=08A
WKRVHPHPEHUVRIWKH)UHQFK1DWLRQDO&RQYHQWLRQZKRLQ-DQXDU\ at the UN. As the situation escalated, with rising 5>A24;0D=2743
YRWHGWRVSDUH.LQJ/RXLVIURPWKHJXLOORWLQH pressure at the UN from the US on behalf of their B=40:0CC02:B
Pakistani proxies, in August 1971 there was a news 08<430C
flash that India and the Union of Soviet Socialist 38B01;8=6
Republics (USSR) had just signed a bilateral treaty. AD=F0HB>= !
There was then an immediate media request for an 5>AF0A3
interview on this treaty with the Indian Mission in
New York. We could not delay a response and I was
F4BC4A=
asked to go for this interview, though we had not 8=380=08A10B4B India’s support ironically). A cease- would also be drawn further into the Sen went to the UN bar-lounge to
till then received the treaty’s text. C748=380=08A fire would have been severely prej- debate by the US, with memories in meet his Pakistani counterpart Agha
I prepared carefully, as best as I could, based on 5>A24B7AD6643 udicial to Bangladesh and India, India running high of the 1962 con- Shahi. I happened to accompany Sen
what we knew within the Mission on India’s over- C78B>550=3 given the ongoing ground operations flict with its northern neighbour. to this meeting. After some time, we
all policy posture. A main question asked by the 4BC01;8B74308A of the Indian Army in support of Three very personal memories of were also joined by Bhutto. Asked to
media was if this treaty with the USSR affected BD?4A8>A8CH>E4A Bangladeshi liberation. that time have remained with me. get Bhutto a drink from the bar, I
7/3 OHDGHU 5L]YL E\ GHPDQGLQJ H[SXOVLRQ RI WKH )UHQFK India’s policy of non-alignment. I denied this firm- 40BC?0:8BC0= We were not members of the The first was of corridor talk, on the went back there for a glass of Black
$PEDVVDGRUKDVFDXJKW3ULPH0LQLVWHU,PUDQ.KDQE\KLVWKURDWDQG ly, non-alignment being a cornerstone of our for- C78BF0B0=4F UNSC at the time, but our margins of the UNSC chamber, Dog whiskey (his reputed favourite).
LVWZLVWLQJLWVORZO\EXWVXUHO\,IWKHGHPDQGLVDFFHSWHGDOO:HVWHUQ eign policy, and on return to office, was glad to find 38<4=B8>=>50 Ambassador was invited to the ses- about yet another ceasefire resolu- As I handed it to him, and sat down,
that my position had been in line with the treaty 38A42C<8;8C0AH sion, where I went with him and we tion, this time by a Soviet ally mem- he looked at us and said something
QDWLRQVLQFOXGLQJWKH868.*HUPDQ\,WDO\DQGVRRQPD\FXWRII text that had meanwhile arrived. 2>=5;82C14CF44= lobbied heavily behind the scenes. ber, as all other members were get- that I still remember. “Some forces
GLSORPDWLFWLHVWUDGHDQGDLGWR3DNLVWDQZKLFKZLOOVZLIWO\EULQJWKH As the conflict continued, some Bangladesh rep- 8=3800=3 With Indian support, the USSR ting increasingly concerned about the were opposed to our being together.
FRXQWU\WRLWVNQHHVILQDQFLDOO\%XWLILWLVQRWDFFHSWHGWKHQ,PUDQ.KDQ resentatives also came to New York to further their ?0:8BC0=0=3C74 insisted that members of the prolongation of the conflict on the Otherwise, we would not have been
ZLOOEHEUDQGHGDVDFROODERUDWRUZLWKWKRVHZKRKDYHLQVXOWHGWKH3URSKHW cause in late 1971. I was asked to help them. Some <0CC4AF0B Bangladeshi liberation movement ground and its potential for wider separated. Then I may not have
,QKLVHOHFWLRQFDPSDLJQLQ,PUDQ.KDQKREQREEHGZLWK7HKUHHNH of these visitors later became important figures in 5DAC74AC0:4=D? also be invited to the UNSC to pre- conflict. But before any such even- become the Prime Minister but
/DEDLNDQGRWKHUH[WUHPLVWJURXSVWRJHWYRWHVDQGJDYHKLVSDUW\·V independent Bangladesh. One of them was Rehman 8=C74D=B2>= sent their case and evidence of tuality, news also came of the would certainly have been the
WLFNHWVWRGXELRXVHOHFWDEOHVLQFOXGLQJPDQ\VKDG\EXVLQHVVPHQDQG Sobhan, a friend from our student days, who also 3424<14A# heinous crimes by the Pakistani Pakistani forces surrendering to the Foreign Minister of a united India,”
wrote about our discussions in his memoirs, pub- army. The ceasefire resolutions were Indian side on December 17, ending he said.
WKHLQIDPRXV$PLU/LDTXDWZKRVH79VKRZUHVXOWHGLQWKHNLOOLQJRI lished just five years ago. Referring in them to me, ultimately vetoed by the USSR. a matter that then seemed rather Not much later, Bhutto did
PDQ\ LQQRFHQW $KPDGLV +H H[SHOOHG $WLI 0LDQ DQ LQWHUQDWLRQDOO\ he wrote that I “assured him that no action by the The Soviet veto gave a brief win- touch-and-go. The other is of listen- become the Prime Minister of
UHQRZQHG3ULQFHWRQEDVHGHFRQRPLVWIURPWKH3DNLVWDQ(FRQRPLF UN would frustrate the march of the Indian Army dow to the Bangladeshi freedom ing to Bhutto’s fierce final speech to Pakistan, and visited India. His
$GYLVRU\&RXQFLORQO\EHFDXVHKHZDVDQ$KPDGL7KXV,PUDQ.KDQ to Dhaka as the Soviet Union had told them of a forces, supported by the Indian the UNSC, when he tore up his meeting with Prime Minister Indira
DEDQGRQHGDOOKLVSURIHVVHGSULQFLSOHVVRRQDIWHUFRPLQJWRSRZHU veto,” in the UN Security Council (UNSC). The sit- Army, to persevere with their goal of papers and walked out of the meet- Gandhi, and their famous Simla
DQG EHFDPH D SXFFD SROLWLFLDQ OLNH D )DXVW GRLQJ D GHDO ZLWK D uation continued to escalate through the fall, an liberating their country. As the fight- ing. Some speculated that it was Agreement are of course well-known.
0HSKLVWRSKHOHV8QGHUKLVUXOHWKH3DNLVWDQLHFRQRP\KDVJRQHGRZQ important and busy time at the UN as this conflict ing continued, some days later the meant more for his home audience So is the subsequent history of con-
continued. Growing pressure on the Pakistani mil- UNSC reconvened on December 6 and politics rather than the UN tacts between India, Pakistan and
KLOOZLWKULVLQJXQHPSOR\PHQWDQGVN\URFNHWLQJSULFHVRIIRRGVWXIIV itary from the Mukti Bahini freedom fighter forces to forward the case to the General where the matter of conflict seemed Bangladesh over the next five
IXHOHOHFWULFLW\DQGVRRQ in Bangladesh led to a rapidly unfolding end-game Assembly. This time both India and almost over. decades. During this period, all
,QWKHFXUUHQWFULVLVZLWKODUJHVFDOHSURWHVWVDQGGHPRQVWUDWLRQV in December 1971. Pakistan sent senior Ministers to rep- But my most vivid memory is of these three subcontinental neigh-
JRLQJRQDOORYHU3DNLVWDQ,PUDQ.KDQWKRXJKWWKDWE\HQWHULQJLQWRDQ On December 3, the Pakistan air force launched resent their positions. From India it an encounter with Bhutto himself. I bours have experienced their own
DJUHHPHQWZLWKWKH7/3KHFRXOGZDUGRIIWKHGDQJHU,QIDFWLWZDV sneak attacks aimed at disabling runways on 12 for- was Sardar Swaran Singh, a stalwart had first heard about him from political changes — in Governments,
OLNH1HYLOOH&KDPEHUODLQVLJQLQJWKH0XQLFK3DFWZLWK+LWOHULQ ward western Indian airbases. The Indian Air Force Cabinet Minister of the then senior school fellows, some of whom ruling parties and leaders. These also
DQGDQQRXQFLQJ´,WLVSHDFHLQRXUWLPHVµ&KXUFKLOOULJKWO\FDOOHGLWD shrugged this off and established air superiority over Congress Government. From knew of him from their times togeth- impacted their mutual relations. The
East Pakistan. This was a new dimension of a direct Pakistan it was the just-appointed er at the University of Southern memories here recalled and
GLVKRQRXUDEOHVXUUHQGHUDQGWKH6HFRQG:RUOG:DUVWDUWHGWKHQH[W military conflict between India and Pakistan, and Foreign Minister and leader of the California. I had then met him in the described reflect only one important
\HDU,PUDQ.KDQIRUJRWWKDWVXUUHQGHUWREODFNPDLOHUVRQO\LQYLWHVIXU the matter was further taken up in the UNSC on recently-formed Pakistan People’s 1960s when I was Deputy Chief of section of this process. But this
WKHUEODFNPDLO+HZLOOVRRQUHDOLVHWKLV7KHQH[WGHPDQGZLOOEHVWULFW December 4. There the US delegation, led by George The writer is a former Party, Zulfiqar Ali Bhutto. Protocol for India’s Ministry of description also points to the com-
O\HQIRUFLQJWKHEODVSKHP\ODZVDJDLQVWWKHPLQRULWLHV,EHOLHYH,PUDQ Bush Sr twice proposed ceasefire resolutions, sup- diplomat and a translator Their exchanges intensified along External Affairs and he had come to monality in their history and culture,
.KDQ·VGD\VDUHQRZQXPEHUHGDQGWKHDUP\ZLOOUXOH+RZHYHUPDQ\ ported by a majority of members, including the of Sanskrit classics. The with the ground conflict now going India for bilateral exchanges. After in a wider background of time and
People’s Republic of China that had just been seat- views expressed on more and more against Pakistan. the final UNSC session on December space, that also deserves present
DUP\SHUVRQQHODUHUHSRUWHGO\VXSSRUWHUVRIWKH7/3DQGWKHH[DP are personal.
SOHRI*RYHUQRU6DOPDQ7DVHHU·VDVVDVVLQDWLRQZRXOGKDYHSXWIHDULQ ed in the UNSC, replacing Taiwan in October (with There was also speculation if China 16, India’s UN Ambassador Samar recollection.
WKHKHDUWVRIJHQHUDOVRURIILFHUVZKRZRXOGOLNHWRVXSSUHVVWKH7/3
+HQFHDWLPHPD\FRPHZKHQD7/3OHG*RYHUQPHQWPLJKWEHIRUPHG
7KH7/3LVDVIHXGDOPLQGHGDQGUHDFWLRQDU\DVWKH7DOLEDQ6R3DNLVWDQ POINTCOUNTERPOINT
LVKHDGHGWRZDUGVWKH0LGGOH$JHVDQGZHPD\VRRQVHHVKDULD ODZ
LPSRVHGLQIXOOULJRXULQ3DNLVWDQZLWKZRPHQVWRQHGWRGHDWKIRUDGXO C74F0H?<<>38´B?7>C>8B?DC>=E0228=0C8>= C78B8B0E0228=0C8>=3A8E48C8B>1E8>DBC70C
WHU\DQGOLPEVRIWKLHYHVFXWRII7KRVHZKRGRQRWVD\QDPD]ILYH 24AC85820C4BF434<0=3C70CC74?<´B?7>C> C74?82CDA4F8;;14>5C74?<>5C742>D=CAH
WLPHVGDLO\ZLOOEHIORJJHG$QGRIFRXUVHSRYHUW\XQHPSOR\PHQWFKLOG
PDOQRXULVKPHQWDUHDOO,UUHOHYDQW$OOWKDWPDWWHUVZLOOEHKRZWRDWWDLQ B7>D;314?DC>=340C724AC85820C4B0;B> 0=3=>C>5C74;4034AB>5C74>??>B8C8>=
MDQQDWKHDYHQHYHQLILWLVRQDQHPSW\EHOO\ °<070A0B7CA0<8=>A8CH05508AB<8=8BC4A °D=8>=7><4<8=8BC4A
7KHZULWHULVDIRUPHUMXVWLFHRIWKH6XSUHPH&RXUWRI,QGLD7KH =0F01<0;8: 0<8CB707
YLHZVH[SUHVVHGDUHSHUVRQDO
&KLHI0LQLVWHUVVKRXOGQRWEODPHLWDOORQ30DQGWKH&HQWUH
(KOZKSVRU_SKTZMKTKXGZOUTKIUTUSOIMXU]ZNUXK\KTVGTJKSOISGTGMKSKTZZNK9ZGZKYGTJZNK)KTZXKNG\KZUYNGXKZNKXKYVUTYOHOROZOKY
second wave of the efforts by the Centre and medical education are part of highlight that the COVID which was doing election 500 people, the next day.
A COVID-19 pandemic
is spreading at a much
faster rate than the first one
States. Building hospitals and
research centres, setting up
manufacturing facilities for
the Concurrent List.
Therefore, both the Centre
and States are empowered to
vaccine was mocked as the
“BJP vaccine” and the
Opposition was busy raising
campaigning in West Bengal.
However, thankfully, this
is one area where the
But given the criticism
the Centre is facing from the
Opposition over the han-
and data showed the worst medicine and medical equip- take decisions in these mat- questions over the effective- Opposition showed some ini- dling of the current pan-
ever daily spike in the coun- ment and so on, are time con- ters. ness of the vaccine which cre- tiative to help the nation in demic, it seems that the fed-
try on Sunday. Certain sec- suming processes and can’t be If someone blames only ated confusion in the minds the fight against the eral structure of our country
tions have raised the demand ramped up in a short span of the Centre for the poor state of the common man. Coronavirus and Congress is highlighted by our politi-
of a nationwide lockdown but C8C81>; B0DA0E time to fight the pandemic. of medical care in the coun- This was a time when the leader Rahul Gandhi decided cians only when they have to
given last years’ experience, it In the Indian federal try then s/he is passing the entire political leadership not to hold any rally in West take grants from the Centre
is unlikely that the Centre will structure, though the Centre buck to the Prime Minister should have stood together Bengal. As a matter of fact, his or when petty political con-
implement any such pan- and States share responsibil- for something which is the and spoken in a common last rally in Bengal was on siderations compel them to
India shut down. ities in managing the health- joint responsibility of the voice but alas! It can happen April 14. But the proclama- do so, but there is complete
The States are better- care system, the States have a Chief Ministers (CMs) and only in our vibrant democra- tion by the Gandhi scion silence when it comes to tak-
placed to evaluate the situa- larger role to play. Entry six the Union Government cy where someone can first came only after completing ing accountability.
tion and take necessary steps of list II of the Seventh together. question the vaccine itself his campaign in Kerala and Be it employment gener-
accordingly. A complete lock- Schedule of the Constitution According to the October 2019-20. Therefore, the ques- and when the situation goes Tamil Nadu. It would have ation, economic growth or
down situation will also jeop- puts “public health and san- 2020 Reserve Bank of India tion should be asked from the out of control then starts been better if the political even pandemic management,
ardise the economic recovery itation; hospitals and dispen- (RBI) report on State CMs on what they have done blaming others for what has leadership of the Congress the States and the Centre
and given the fact that now saries” under the State List. finances, 12.1 per cent of to improve the situation. happened. had taken this decision ear- have to share these responsi-
we have vaccines against the Therefore, State Governments overall expenditure towards Further, health research The discussion on the lier. bilities equally. The CMs
deadly virus, a conscious call have a larger role to play in social services has been spent and collaboration with inter- COVID pandemic is incom- However, the good thing should understand that infor-
should be taken by the poli- managing and maintaining on medical and public health national bodies lies under plete without mentioning the about the Congress’ decision mation travels very fast in this
The writer is a
cymakers. chartered accountant and the healthcare system during alone by the State the specific domain of the ongoing State elections. Social to stop campaigning in new-era and it would be dif-
Our healthcare system a public policy analyst. this pandemic. Governments in the Financial Centre and now we have an media campaigns are target- Bengal was that the States’ ficult for inept policymakers
lacks basic facilities and The views expressed However, certain aspects Year (FY) 2019-20. The effective cure to the disease in ed towards the BJP in gener- Chief Minister and even the to remain hidden from pub-
improving health infrastruc- are personal. of healthcare like population health expenditure of States the form of the Coronavirus al and Modi in particular as BJP decided to limit the num- lic scrutiny, whether it is at
ture requires continuous control, family planning and was C1,92,636 crore in the FY vaccine. It is worthwhile to if the BJP was the only party ber of people at its rallies to the Centre or in the States.
=4F34;78kF43=4B30H k0?A8; ! !! f^a[S'
AR\8`gedfccV_UVcdSVW`cV &KDG
V3UHVLGHQWNLOOHGRQ GXWXcb^dcPcDBbPhbcWTaT
bW^d[SQT]^Q^bbX]V\TSS[X]V
cRUZTR]:d]R^ZdeaRcej EDWWOHILHOGVD\VPLOLWDU\ X]^cWTabX]cTa]P[PUUPXab 0?Q =390<4=02703 members but by the National Deby’s death could not imme-
A4B>;DC8>=C01;438=?0A;C>4G?4;5A4=274=E>H had’s longtime leader has
Assembly.
“The army seizing power
diately be independently con-
firmed due to the remote loca-
Beijing: Chinese President Xi
Jinping on Tuesday hit out at
video link.
"Big countries should
?C8Q 8B;0<0103;07>A4 French ambassador will be
presented on Tuesday in the
Assembly for the expulsion of
the French ambassador from
C died of wounds suffered
during a visit to front-line
and conferring it on the son of
the president ... is a coup and
tion of the fighting. The gov-
ernment has released few
the US, saying there should be
no "bossing" and "meddling" in
behave in a manner befitting to
their status and with a greater
uccumbing to Islamists' National Assembly,” Interior Pakistan over the issue of blas- troops battling a little-known unconstitutional," Sogunro details of its efforts to put the internal affairs of other sense of responsibility," he said.
SKhan-led
demands, Pakistan's Imran
Government on
Minister Sheikh Rashid said in
a video statement.
phemous cartoons being pub-
lished in the European
rebel group, the military
announced on Tuesday, just
tweeted Tuesday, calling for the
African Union to condemn
down the rebellion in northern
Chad. The army said Tuesday
countries as Beijing is increas-
ingly coming under pressure
His snide remark against
Washington came as US
Tuesday decided to introduce The cases against TLP work- country. hours after he was declared the the transfer of power. that Deby had fought heroically from Washington and its allies President Joe Biden vigorous-
a resolution in Parliament to ers, registered under terrorism Amjad Ali Khan of the rul- winner of an election that Deby's 37-year-old son, but was wounded in a battle. over issues of human rights vio- ly pursued a strong China con-
expel the French ambassador charges, will also be quashed. ing Pakistan Tehreek-e-Insaf would have given him anoth- Mahamat, is best known as a He was then taken to the cap- lations, Taiwan and Hong tainment policy initiated by his
and quash all criminal cases Besides, the names of TLP lead- (PTI) party presented the res- er six years in power. top commander of the Chadian ital where he later died of Kong. predecessor by Donald Trump.
filed against the banned radi- ers from the Fourth Schedule will olution in the National The militar y quickly forces aiding a U.N. peace- unspecified wounds. "Bossing others around or Biden united US allies like
cal Islamist party TLP after they also be taken off, Rashid said. Assembly with Speaker Asad announced President Idriss keeping mission in northern Some residents of the cap- meddling in others' internal the UK, the EU and Japan over
reached a deal following a The expulsion of the Qaiser in the chair. Technically, Deby Itno's son as the central Mali. The military said Tuesday ital, though, said they feared affairs would not get one any his China policy. He also held
marathon round of talks. French ambassador is one of the it was not an official document African nation’s interim leader, he now will head an 18-month there was more to the story of support. We must advocate the first quadrilateral summit
The agreement came a day main four demands of the rad- as it was moved by a member succeeding his 68-year-old transitional council following Deby’s demise. peace, development, equity, of the emerging alliance called
after Prime Minister Khan said ical Islamist party, which was in his private capacity but it was father who ruled for more his father's death. “The rumors that are going justice, democracy and free- Quad which included US,
that the expulsion of the French banned last week after its mem- accepted for discussion. than three decades. The military called for around about the transitional dom, which are common val- Australia, Japan and India.
ambassador was not a solution bers staged violent anti-France The resolution condemned Some observers immedi- calm, instituting a 6 p.m. cur- council give me the impression ues of humanity, and encour- The US, the European
to stop the incidences of blas- protests across the country. the publication of blasphe- ately questioned the chain of few and closing the country's that some information is false,” age exchanges and mutual Union, Britain and Canada
phemy in the western world, On Monday, the National mous caricatures by French events leading up to Tuesday's land and air borders as panic Thierry Djikoloum said. “They learning among civilizations to have imposed coordinated
noting that “it will only trigger Assembly session was magazine Charlie Hebdo in stunning announcement on kept many inside their homes are already talking about dis- promote the progress of human sanctions on China over alleged
incidents of blasphemy in other adjourned to meet again on September last year and national radio and television. in the capital, N’Djamena. solving parliament ... So for me, civilization," Xi said, without human rights violations against
countries as in the West they April 22. However, shortly after expressed regret over the Ayo Sogunro, a Nigerian “In the face of this worrying I’d say it was a coup d’etat. He directly referring to the US. Uygur Muslims in Xinjiang, a
call it freedom of expression”. the minister's statement, a ses- French's president "encour- lawyer and fellow at the South situation, the people of Chad was killed.” "What we need in today's charge Beijing denied.
"Under a marathon round sion of the lower house of agement of the elements hurt- Africa-based Center for must show their commitment to Some foreign observers world is justice, not hegemony," These countries have also
of talks and an agreement Parliament was summoned in ing the sentiments of the hun- Human Rights, said that under peace, to stability, and to nation- also questioned how a head of he said addressing the annual taken united position on China
reached with the Tehreek-e- the late afternoon. dreds of millions of Muslims in Chadian law the term of an al cohesion,” Gen. Azem state could have been killed, Boao Forum for Asia (BFA), a firming up its control over
Labbaik Pakistan (TLP), a res- Hours later, a resolution the name of freedom of expres- incumbent president who dies Bermandoa Agouma said. saying it cast doubt on his pro- China promoted influential Hong Kong.
olution on the expulsion of the was tabled in the National sion". is completed not by family The circumstances of tective guard. AP think tank based in Hainan via PTI
&RQYLFWHG *OREDO&2
H[0DOD\30 HPLVVLRQVVHWIRU
FDOOHGRXWIRUWDOO QGELJJHVWVSLNH
WDOHVLQFRXUW LQKLVWRU\,($
New Delh: Global energy-related carbon diox-
80=BQ :D0;0;D<?DA ide (CO2) emissions are on course to surge by
1.5 billion tonnes in 2021,the second-largest
ormer Malaysian Prime Minister Najib increase in history, reversing most of last year's
F Razak was accused on Tuesday of coming
up with a "cock and bull story" to try to over-
decline caused by the Covid-19 pandemic,
according to a new International Energy Agency
turn his 12-year jail sentence for corruption and (IEA) report released on Tuesday.
abuse of office. This would be the biggest annual rise in emis-
Prosecutor V Sithambaram told Malaysia's sions since 2010, during the carbon-intensive
Court of Appeal that Najib's claim that his bank recovery from the global financial crisis.
account was "manipulated" was "bizarre" and "a The IEA's Global Energy Review 2021 esti-
trick", reports DPA news agency. mates that CO2 emissions will increase by
Sithambaram said Najib's story was under- almost five per cent this year to 33 billion tonnes,
mined by text messages between the appellant based on the latest national data from around the
and Low Taek Jho, a fugitive "financier" better world as well as real-time analysis of economic
known as Jho Low. growth trends and new energy projects that are
Najib was sentenced to 12 years in jail in 2020 set to come online.
on charges related to the theft of 42 million ring- The key driver is coal demand, which is set
git ($9 million) from SRC International, a sub- to grow by 4.5 per cent, surpassing its 2019 level
sidiary of the 1MDB state fund set up by Najib. and approaching its all-time peak from 2014, with
Up to $4 billion dollars could have been stolen the electricity sector accounting for three-quar-
from 1MDB, according to the US Department ters of this increase.
of Justice, which has returned hundreds of mil- "Global carbon emissions are set to jump by
lions of dollars to Malaysia after seizing assets 1.5 billion tonnes this year, driven by in the resur-
bought using 1MDB money, including by Jho gence of coal use in the power sector.
Low. IANS IANS
DB0\QPbbPS^ac^[TPeTAdbbXPcT\_^aPaX[h
Moscow: US Ambassador to that is another important rea- Sergey Lavrov said at a press
Russia John Sullivan on son for me to return home for conference on April 16 that
Tuesday said that he will return a visit. I will return to Moscow presidential aide Yuri Ushakov
to Washington for consulta- in the coming weeks before any at a meeting with Sullivan had
tions "about the current state of meeting between Presidents recommended that the US
bilateral relations" between the (Joe) Biden and (Vladmimir) Ambassador return to
the two nations. Putin," the Ambassador added. Washington for consultations.
"I believe it is important for According to the US Russian Ambassador
me to speak directly with my embassy, "Ambassador Sullivan Anatoly Antonov to Washington
new colleagues in the Biden is returning to the US for con- returned to Moscow amid wors-
administration in Washington sultations this week". ening bilateral ties on March 22
about the current state of bilat- Sullivan's announcement after he was recalled following
eral relations between the US comes after an exchange of President Biden's remarks on
and Russia" he told Russia's harsh sanctions between the March 17 that Russia will "pay
TASS News Agency. two countries, including mutu- a price" for its alleged interfer-
"Also, I have not seen my al expulsions of 10 diplomats. ence in the 2020 American elec-
family in well over a year, and Russian Foreign Minister tion. IANS
=4F34;78kF43=4B30H k0?A8; ! !! \^]Th(
(FRPPHUFH277JDPLQJ
approach the government with third phase of its vaccination
2PQX]TcVXeTbTg_^bc 2PQX]TcP__a^eTb<^DQTcfTT] a formal proposal for allowing
import of vaccine, the waiver
strategy, manufacturers will be
required to supply 50 per cent
UPRc^P__a^eP[U^a
8]SXP1P]V[PSTbWc^X]RaTPbT
would be given, government of their monthly doses to the
VDZRYHUJURZWKLQ P\T]S\T]cbc^
R^^_TaPcX^]X]caPSTaT\TSXTb
sources explained.
No proposal has been
made so far, finance ministry
government and the rest to
state governments or the open
market.
80=BQ =4F34;78 expenditure across the PayU “For gaming and enter- 5X]P]RT1X[[!!
platform, year on year. tainment, the number of trans- ?C8Q =4F34;78 ?C8Q =4F34;78
3QRWHVLQYHVWPHQWGURSV
WRCFULQ0DUFK
?C8Q =4F34;78 rities - fell to C89,100 crore in
March-end from C91,658 crore
nvestments through partici- in February-end.
IIndian
patory notes (P-notes) in the
capital market declined
Prior to that, the invest-
ment level was at C84,916 crore
to C89,100 crore at March-end, at January end.
after hitting 33 months high Of the total Rs 89,100 crore
level in the preceding month. invested through the route till
P-notes are issued by reg- March, C81,236 crore was
istered foreign portfolio invested in equities, C7,306
investors (FPIs) to overseas crore in debt and C559 crore in
investors who wish to be part hybrid securities.
of the Indian stock market The month of February
without registering themselves 2021 saw the highest level of
directly. investment since May 2018,
They, however, need to go when fund inflow through
through a due diligence such route stood at C3,497
process.According to Sebi data, crore, and experts said the
the value of P-note invest- trend indicated growing confi-
ments in Indian markets-- dence of overseas investors
equity, debt and hybrid secu- into domestic markets.
=4F34;78kF43=4B30H k0?A8; ! !! PeT]dTb
AE?D5?6D8541I
:TT_PfPhUa^\_T^_[TfW^
7KH-((0DLQ cahc^QT[Xcc[Th^daP\QXcX^]b
$SULOVHVVLRQKDV B\P[[_T^_[TP[fPhbS^cWPc
QdccWTaTP[[hVaTPc\PZTh^d
EHHQSRVWSRQHG UTT[cWPch^dc^^RP]
QTR^\TVaTPc
DQGIUHVKGDWHVDUH °<PaZCfPX]
DZDLWHG086%$
+$6+0,VSHDNV EXacdP[WPRZPcW^]PcBA<8BC
ZLWKHGXFDWLRQLVWV he Department of IEEE at SRM Institute of Science and
T Technology, Kattankulathur conducted HackTrix, a three day
DQGVWXGHQWV international virtual hackathon with an add-on conference recent-
ly. Students chose from eight diverse tracks to pit against each other
DERXWZKDWWKH
as they revolutionised their chosen field. The event turned out to
be the perfect place for participants to foster their learning skills.
The flagship hackathon was presided by leaders and veterans of
GHOD\PHDQVDQG
their respective fields. Participants were from Australia, Germany,
USA, Canada, Russia, Turkey, Mexico among others. With a vision
to coordinate splendid mentalities, IEEE SRM Student Branch con-
6((<286221-((
Devasheesh Saxena, Principal Architect and Global Delivery Leader
for Digital Business for QuEST Global also graced the panel.
The mentor’s panel was graced by Ayon Roy who has been a
mentor in 70+ hackathons; SDE1 at Hackerrank, Aditya Agarwal,
TR Rohith who is a Software Engineering Intern at Bajaj Health,
Jahanavi Bhagat, a mentor at Tesseract Coding and Praveen Kumar
Puroshattam an ex-Microsoft MVP. This is not all. \Sahil Rahman,
a mentor at Future Blink and Anustup Mukherjee who is a men-
tor from Dark Horsealong with the international names Bormotov
he postponement of JEE Main of JEE Advanced exam as well. But stu- tically and if they don’t and get relaxed, dents,” says Swoyan Satyendu, Director, Dmitrii who is a mentor from Flow Health and Michael Pautav,
*HWVHWIRU+5 CdU`e`i_ebWQ]U
:LWKFKDQJLQJWLPHVUHVNLOOLQJKDVSLFNHGXSSDFHDQGLV
4\TaVX]VcTRW]^[^VXTbWPeTaTe^[dcX^]bTScWT7AV^P[bUa^\\TaT[h
VTccX]V_a^RTbbTbX]_[PRTc^P\^aTQa^PSQPbTSV^P[¯SaXeX]V QRZLQFUHDVLQJO\SUHIHUUHGE\RUJDQLVDWLRQV560$$1WHOOV
\RXKRZLWEHQHILWVSURIHVVLRQDOV
eP[dTUa^\cP[T]cbPhbE82:H908= he pandemic’s occurrence in 2020 dis- has no further scope of growth. managerial are some of the abilities that are
EXacdP[f^aZbW^_QhEXQVh^a 0RR^[PSTbU^aE8CbcdST]cb
ductivity and employee brand. cient to be effective. are available online to look for
engagement. Gone are the days Key challenges of talent Role of HR during the the best candidates for the
when HR was a person, now it acquisition current crisis scenario position. The complete recruit-
has become portal. Shifting to Finding the right talent HR is now adopting new ing process has become easy he team from VIT School of Law, VIT Chennai, has
SAAS based HRM softwares
has provided the firms to have
when you have a huge skilling
gap in the country is one of the
ways to operate and support
every new decision the com-
and effective with the use of the
technology. as many people
?=BQ =4F34;78 tual workshop for students on
Sunday, April 11, to mark Pet
T made its college proud by winning the second Surana
and Surana and Army Institute of Law, Mohali, Family
universal access to HR services biggest challenges in these pany is taking to reduce the come to know of the offer and
even when you're remote work-
ing, dramatically changing the
unprecedented times. It is piv-
otal that HR team is using the
effect of the pandemic. The
new role of HR is to become
hence increases the probabili-
ty of hiring efficient employees.
Shelppending time with pets when
staying indoors all day can
children develop non-ver-
Day.
In an interactive session
Abodh Aras, CEO, Welfare for
Law National Moot Court Competition held virtually
between April 9 and April 11, 2021.
A total of 37 law schools from all over the country
practice of human resource right technology in order to more agile, adaptable and aug- Employers can present all nec- bal communication, compas- Street Dogs, taught students how participated in the competition and the team compris-
management. streamline the whole process of menting. HRM must aim at essary information related to sion and empathy, say experts. to become responsible pet own- ing N Asmitha (third year BBA, LLB), Nivedita
The need of cost cutting or managing the various job achieving competitiveness in job, careers and personal devel- Pets who are normally accus- ers and how to take care of stray Muchilote (third year BBA LLB) and Aarcha Sasikumar
expansion or providing better vacancies and spreading out the the field of HR by providing opment of each employee on tomed to outdoor activity can animals amid the lockdown. (second year BA, LLB) from VIT School of Law, VIT
services has propelled these right messaging. An advanced constant educational and train- portals online. This is a great also benefit similarly from their The students from Classes Chennai has emerged as the winners and won a cash
changes. Recent research shows HRMS helps to manage all the ing programs for the personal promotional tool for the organ- indoor interactions with chil- IV to VIII, from Gurugram, prize of C20,000.
organisations that successfully vacancies at one platform. It and professional development isation. dren, which can help to destress Vadodara, Surat, Lucknow, Asmitha has also shared the Best Student Advocate
adopt sophisticated HR tech- has been observed that mas- of the employees of the organ- CWTfaXcTaXb5^d]STad:]^feP them. Nashik and Indore participated award with Chaturya Srinivasan, student of NLU
nology tools outperform those tering the art of balancing effi- isation. It has been seen that the <^QX[T4]PQ[TS7AB^UcfPaTU^ah^da With this view, Vibgyor in the hour-long virtual fun and Jodhpur. And Nivedita has been declared as the Best
that do not. Since many com- ciency and quick decision mak- companies have understood 1dbX]Tbb Group of Schools hosted a vir- engaging session. Speaker for the final round.
=4F34;78kF43=4B30H k0?A8; ! !! PeT]dTb
´8iRbYT\UQb^Y^W]ecd
V_bRUcd_edS_]Ucµ
>93; 8EDD?>dU\\cC81<9>9
C1;C5>1X_gdXU9^dUb^UdXQc]QTU
Yd`_ccYR\UV_bUTeSQdY_^d_bUQSXdXU
bU]_dUcd`Qbdc_V9^TYQ
QWhat is a hybrid learning model?
362
A hybrid learning model is a learn-
ing model in which most of the learn-
ing is done online supplemented with
face-to-face instruction. Hybrid learn-
ing combines the benefits of both online
E649?@
and offline learning, giving students a
balanced perspective: Where the in-per-
son interventions can fulfill the social
and emotional needs of students, and the
online, self-paced learning allows for
3:@=@8:DE
flexibility and personalisation. This
effectively prepares the learner for the
workforce and whatever lies ahead.
QHow to implement it effectively?
To effectively implement a hybrid
learning model, States and districts will
need to ensure that the technology
utilised is one that can fully support both
online and offline learning. It should
allow the online activity to be engaging
%LRWHFKQRORJ\LVJURZLQJDWDIDVWSDFH0RUHVRDIWHUWKHSDQGHPLFRSHQLQJGRRUVWR and personalised, because if it isn’t, the =XRZ77dcc^]
ATVX^]P[3XaTRc^a0bXP3!;
students will not be able to effectively
OXFUDWLYHRSWLRQVIRUWKRVHZDQWLQJWRSXUVXHWKLVFRXUVHVD\V'5$50,1'(5.$85 take advantage of the learning model. As
such, teacher intervention becomes is through the hybrid model: Anyone
s the admission season life. Biotechnology is used in the the study of micro-organisms ing for pharmacology make a bet- completely inadequate. The technology who wants to study and get access to
F <8=38C
WT]PbcdST]c_[P]bc^bcdShPQa^PS 7TaTXbW^f^da^eTabTPbTSdRPcX^] cWTeXbP^UUXRXP[bCWThT]bdaTcWPccWT cWPch^dbW^d[SQTPQ[Tc^XST]cXUhcWPcW^f
WXb\X]SXbUd[[^U`dTbcX^]baXVWc R^]bd[cP]cbRP]VdXST) bcdST]cVTcbcWTXaeXbPP__[XRPcX^]P__a^eTS fT[[WTWPb_[PRTS^cWTabcdST]cbX]cWT
Ua^\RW^^bX]VcWTaXVWcRPaTTaeXbP CWThd]STabcP]Sh^daaT`dXaT\T]cb) bdRRTbbUd[[h d]XeTabXcXTb^UcWTXaRW^XRTb
_a^RTSdaTc^PRRd\d[PcX]VcWTQPbXR 8cbeTahX\_^acP]ccWPch^dRW^^bTcWTaXVWc 7^fc^RW^^bTcWT\^bcaT[XPQ[T CWTP]^cWTaX\_^acP]ccWX]Vh^dbW^d[S
S^Rd\T]cPcX^]]TTSTSU^acWTPS\XbbX^] R^dabTST_T]SX]Vd_^]cWTbZX[[bP]SY^Q TSdRPcX^]P[X]bcXcdcTbX]P_PacXRd[PaR^d]cah TSdRPcX^]R^]bd[cP]c)CPZX]VWT[_^UP] R^]bXSTacWPccWTR^]bd[cP]cbW^d[SQT
_a^RTbb4Pa[XTacWTPfPaT]TbbaTVPaSX]V Tg_TRcPcX^]bh^dWPeTCWTRPaTTaR^d]bT[^a 0S\XbbX^]_a^RTbbQTR^\TbTPbh)FT TSdRPcX^]P[R^]bd[cP]RhRP]QTPZThc^ R^]bXbcT]cX]WXbP__a^PRWaXVWcUa^\
bcaTP\bP]SbdQbcaTP\bfTaT[X\XcTSP]S _a^eXSTbPbbXbcP]RTX]RW^^bX]VcWTaXVWc P[[Z]^fW^fRd\QTab^\TcWTfW^[T bdRRTbbFXcWcWTaXVWcVdXSP]RTP]SPSeXRT bcPacX]VfXcWcWTPS\XbbX^]_a^RTSdaTV^X]V
cWTbcdST]cbWPSc^aT[h^]cWTb]X__Tc^U RPaTTa^_cX^]ST_T]SX]Vd_^]cWT_a^UX[TcWT PS\XbbX^]_a^RTbbQTR^\Tb1dcXUh^dV^ XcXbYdbc^daSdchc^f^aZWPaSP]SR^]`dTa cWa^dVWc^_aTST_PacdaTVdXSP]RTCWTQTbc
cWTX]U^a\PcX^]_dQ[XbWTSX]P]Tfb_P_Ta^a bcdST]cWPbCWXbd[cX\PcT[hWT[_bcWT cWa^dVWPR^d]bT[^acWTh\PZTcWT_a^RTbb P[[h^daSaTP\bP]SSTbXaTb0bh^daUdcdaT TSdRPcX^]R^]bd[cP]cfX[[VdXSTh^dPQ^dc
^]cWTSTRXbX^]_PaT]cbf^d[ScPZTU^acWT\ bcdST]cbc^QTbdRRTbbUd[X][XUT TPbhCWThcPZTRPaT^UTeTahcWX]VaXVWcUa^\ R^\_[TcT[hST_T]Sbd_^]cWTR^]bd[cP]c eXbPP]SR^[[TVTbT[TRcX^]
1dcfXcWRWP]VX]VcX\TbcWTaTXbPbTP ?XRZX]VcWTaXVWcd]XeTabXch)1TU^aT R^\_X[X]VcWT]TRTbbPahS^Rd\T]cbc^ Xcb_Xe^cP[cWPch^dV^cWa^dVWcWTaTeXTfb 0_a^UTbbX^]P[R^]bd[cP]cfX[[_a^eXST
^UZ]^f[TSVTU^abcdST]cbfW^fP]cc^ bT[TRcX]VcWTd]XeTabXchXcbX\_TaPcXeTc^ bT]SX]VcWTU^a\c^cWTd]XeTabXch=^c^][h faXccT]PQ^dccWTR^]bd[cP]c^]cWTX]cTa]Tc h^dT]Sc^T]SbTaeXRTb0V^^SRPaTTa
bcdShbcdSXTb0[[cWP]Zbc^cWT8]cTa]Tc1dc [TPa]cWTeXbX^]P]SU^Rdb^UcWTd]XeTabXch cWPccWThP[b^caPRZcWTP__[XRPcX^]U^a\ H^dRP]P[b^RWTRZcWTXafTQbXcTP]Sb^RXP[ R^d]bX[^afX[[aTVd[Pa[hcahc^\PZTcWT
VXeTcWTWdVTX]U^a\PcX^]cWPcXb^dccWTaT 8cbW^d[SP[XV]fXcWh^daX]cTaTbcP]SV^P[b bcPcdbcX\Tc^cX\TCWThZTT_d_SPcX]VcWT \TSXP_PVTbU^aRdbc^\TacTbcX\^]XP[bP]S T]cXaT_a^RTbbPR^\U^acPQ[TTg_TaXT]RTU^a
^]T]TTSbc^RW^^bTcWTTUUTRcXeT^]TU^a 2^d]RX[^abZ]^fQ^cW¯h^daP\QXcX^]b bcPcdbc^cWTbcdST]c PfPaSb h^d
h^dP]ScWXbXbfWTaTcWTa^[T^URPaTTa P]Sd]XeTabXcXTbfT[[WTfX[[WT[_c^bT[TRc EXbPP__[XRPcX^])=^a\P[[hcWT CWT]cahP]SPbZPb\P]h`dTbcX^]bPb CWTfaXcTaXb2P_cPX]0\PaSTT_5^d]STaSXaTRc^a
R^d]bT[^aR^\TbX]c^_[Ph cWTaXVWcd]XeTabXchUa^\cWT[^]V[Xbc^UcWT TSdRPcX^]P[R^]bd[cP]cbWPeTV^^ScXTbfXcW _^bbXQ[TCWTR^]eTabPcX^]bW^d[SQTbdRW CaXchP6a^d_^U8]bcXcdcX^]b
2>=C4=CFA8C8=60C1>>;<4=C
B>5CF0A434E4;>?<4=C
;^RPcX^])F^aZ5a^\7^\T
BcX_T]S)C$C _Ta\^]cW
8=1A845
2>6=8I0=2454BC!! 0C88CA>>A:44
?`c``^W`cWR\V_Vhd
;X]Z)X]cTa]bWP[PR^\X'"#$"&#
xtensive sessions were held on the Development Programme/Research
3TPS[X]T)0_aX[!(!! WT88CA^^aZTTW^bcTS CWTf^a[S³bUXabc7X]SXb_TPZX]V E
C
discourse of information in dig- Methodology Workshop on the
obligatory to apply through an 2^V]XiP]RT!! ¯ Wd\P]^XSa^Q^cP]ScWT5Xabc ital age and how it impacts the theme ‘Developing Academic Leaders
online application form. 6A0?78234B86=0C<0BC4A2G> T]STPe^abWPeTQTT] cX\TSXb_[Ph^UV[dR^bT]^]Xc^a democracies at the ongoing for Future: The Way Forward’ is
Application deadline: It is ;^RPcX^])F^aZ5a^\7^\T aTR^V]XiTSQhD=4B2><PZTX] b\PacfPcRWQhcWTSXaTRc^a^U International Faculty Development scheduled from April 15, 2021 to
June 18, 2021. BcX_T]S)C _Ta\^]cW 8]SXP244B0H4=P]S\P]h @dP]cd\>_TaPcX^]8]R Programme organised by IP April 27, 2021.
;X]Z)X]cTa]bWP[PR^\X'"#$"&( ^cWTa]PcX^]P[X]bcXcdcX^]b¯cWT CWTTeT]cbR^]cX]dTSfXcW University, New Delhi. Experts from The programme is organised by
he University of Sheffield The Portland State University 3TPS[X]T)0_aX[!(!! UXabc^][X]TTSXcX^]CWT cWT_PacXRX_P]cbX]cTaTbcTSX] national and international universi- University S chool of Mass
C
time postgraduate taught pro- ble for this application ; however, ;^RPcX^])3T[WX importance of information and Flipped Learning and Blended
BRW^^[^U T]cWdbXPb\P]S 0ahP_aXhP6P]Vd[h
gramme at the University of activation of the support will be BcX_T]S)C!_Ta\^]cW media literacy in his address titled Learning’.
1dbX]Tbb _PbbX^]U^a 0bb^RXPcT?a^UTbb^a
Sheffield. You must be studying a delayed until after the ESL restric- ‘Research in Communication and Dr Dhiman Chattopadhyay from
premaster’s qualification at an tion has been lifted and the students ;X]Z)X]cTa]bWP[PR^\X'"#$"' 5X]P]RT8B15 X]]^ePcX^]X]4<5 8B152WXaPPV<TWcP
Media Studies: An Information Shippensburg University of
3TPS[X]T)0_aX[!(!! X]PdVdaPcTS 0a^d]S! Pbb^RXPcTSXaTRc^a
NCUK Centre, in any country. are fully eligible for unrestricted 7hSTaPQPS³bUXabc [TPa]TabUa^\ 8B15bPXS)°CWT4<5
Literacy driven agenda’. He discussed Pennsylvania, USA will deliver his
Postgraduate Diploma enrollment in academic classes. 4R^]^\XRb 2[PbbTbGG8P]S PaTX]cTaaT[PcTS
the democratic potential of new lecture on the topic ‘Nature and
(PGDip) and Postgraduate Supporting documents: Send 5A>=C4=334E4;>?<4=C0C media whereas cautioned regarding Types of Social Science Research’.
<P]PVT\T]c G88[TSQhU^d]STa SXbRX_[X]TbP]SPaT
Certificate (PGCert) courses are a photocopy (never the original) of 43D6>A8;;0 the digital divide and other chal- The Faculty Development
5X]P]RT4<52[dQ \T\QTaBWaThP _PcWfPhbc^
ineligible for this application. the document to the institution that ;^RPcX^]);dRZ]^f X]_Pac]TabWX_fXcW BWXePZd\Pa^UcWT [dRaPcXeTP]S lenges. Programme was inaugurated by
Supporting documents: originally issued it. BcX_T]S)C #_Ta\^]cW 6XcP]YP[XBT]X^a 2[PbbG88c^^Z_Pac X]cT[[TRcdP[[h Professor Nikolaos Panagiatou Ambassador Akhilesh Mishra (IFS),
Applicants need to provide proof of Admission requirements: ;X]Z)X]cTa]bWP[PR^\X'"#$"'" BRW^^[CWTR[dQXb X]P]T]VPVX]VP]S RWP[[T]VX]V f rom Aristotle University of OSD (Development Partnership
your previous degree, academic ref- Eligible students typically have 3TPS[X]T)0_aX[!(!! PbcdST]c[TSQ^Sh X]cTaPRcXeT4<5`dXi RPaTTab± Thessaloniki, Greece discussed the Administration), Ministry of External
erences, English language certifi- entering grade point averages need and potential of Data Affairs, Government of India. The
cates, a supporting statement, (GPA) of at least 3.5 out of a pos- Journalism. He emphasised that jour- ceremony was graced by Padma Shri
CV/resume. sible 4.0 grading scale. 6A0?78234B86=0CF4C74 nalists are required to draw meanings Prof (Dr) Mahesh Verma, Vice
Admission requirements: Language requirement: 5;0FB><4 '#?0C4=CB5>A88C<03A0B out from the large sets of data and the Chancellor, Guru Gobind Singh
Applicants need to check out the Candidates must meet all the ;^RPcX^])<^WP[X?P]RWZd[P algorithms or machine cannot Indraprastha University, New Delhi.
2WP]SXVPaW WT8]SXP]8]bcXcdcT^U aTb_XaPc^ahbh]Sa^\T
C
admission requirement page at the English Language Requirements of replace them. Journalists should give Prof AK Saini, (University School
university. the university. BcX_T]S)C(C !_Ta\^]cW CTRW]^[^Vh<PSaPb5PRd[ch 2^a^]PeXadb!PbcP]SP[^]T importance to accuracy over speed, of Management Studies), Chairman,
Language requirement: How to apply: In order to ;X]Z)X]cTa]bWP[PR^\X'"#$"( ATbTPaRWTabP]SBcdST]cb _^acPQ[TbX]V[TdbTP]SfXaT[Tbb meaning than describing, multiple NAAC-IIQAC-NAAC and Prof
Students must be proficient in apply for the award, applicants must 3TPS[X]T)0_aX[!(!! UX[TS '#_PcT]cbSdaX]V!! eT]cX[Pc^abhbcT\ sources than merely reading and Queeny Pradhan, Dean, USMC are
written and spoken English, nor- take admission in an undergradu- ^eTaR^\X]VcWTbTeTaP[\^]cWb CWT_PcT]cP[b^X]R[dSTbP analysis than impressions. the Chairpersons for the Faculty
mally demonstrated by grade 4 or ate at the university. After being 2>=C4=CFA8C8=60CB7>?F41 ^U]PcX^]fXST[^RZS^f] bhbcT\U^a]^]X]ePbXeT He tried to predict the future of Development Programme.
grade C or above in GCSE English enrolled, they should complete the CWXbX]R[dSTb]X]T_PcT]cb RP[XQaPcX^]UaTTQ[^^S_aTbbdaT journalism in the digital age.His lec- Dr Durgesh Tripathi is the coor-
;^RPcX^])1WdQP]TbfPa aT[PcTSc^2>E83 (U^a \TPbdaT\T]c³P]Sb\PacP]S
Language or an acceptable English application form for access the ture was titled ‘Emerging trends in dinator for the programme and Dr
language qualification. fund. BcX_T]S)C$C&_Ta\^]cW X]eT]cX^]baP]VX]VUa^\ bdbcPX]PQ[TSTeXRTbU^a Data and Journalism’. Sachin Bharti is the Co-Coordinator
How to apply: In order to Application deadline: The last ;X]Z)X]cTa]bWP[PR^\X'"#$"(! BhbcT\bP]S\TcW^SbU^a X]UTRcX^db\PbZP]S??4fPbcT The two-week online Faculty for the event.
apply for the award, candidates are date to apply is August 1, 2021. 3TPS[X]T)0_aX[!'!! STcTRcX^]^UbTeTaTPRdcT caTPc\T]c
=4F34;78kF43=4B30H k0?A8; ! !! 20?C08=´B20;; !"
F74=H>D0A4?;0H8=6H>D3>=CA40;;H
F0=C0=H>=4C>B0H74BD=58C870E4C>
:44?D?F8C7C74H>D=64A6DHBC74H0A4
E4AH50BC8CB6>>3C>270;;4=64C74<
¯<B37>=8
TODAY FC
CD1BC
;8E45A><
$+$!A>:DE
C@?BDC!
!>
>5DG?B;
FC
CD1BC
;8E45A><
(+$!A>:DE
C@?BDC!
!>
>5DG?B;
from the three matches. after the win in their tournament MASON INTERIM HEAD COACH
Pb_[P]]TS)822
He also needs some serious intro- opener over Rajasthan Royals. They
spection before deciding his playing lost to Chennai Super Kings and
XI on Wednesday.
Warner and Rashid Khan are
Delhi Capitals.
After a batting collapse against
;>=3>=)C^ccT]WP\R^]UXa\TS^]CdTbSPh
cWPcU^a\Ta\XSUXT[STaAhP]<Pb^]f^d[SQT
X]RPaTcPZTaRWPaVTd]cX[cWTT]S^UcWTbTPb^]
U^[[^fX]VcWTbPRZX]V^U9^bT<^daX]W^
?C8Q 3D108
RI6XSHU/HDJXH,QIDQWLQR
certainties in the foreign players’ CSK, Punjab made a significant he World Test Championship final “There is no doubt whatsoever of FIFA’s
slots, but the absence of Kane
Williamson has been badly
improvement to post a challenging
195 for four against DC.
7 MORE BOXERS IN SEMIS
=4F34;78) 1PQha^YXbP]P2WP]d^dcR[PbbTS
T between India and New Zealand will
go ahead as planned in Southampton from
disapproval for this.”
Liverpool, Arsenal, Chelsea, Manchester
felt as he can provide But a below-par effort STUT]SX]V4da^_TP]RWP\_X^]0[TgPb June 18, the International Cricket Council City, Manchester United and Tottenham
solidity to the middle- from their bowlers :dQXRZPPbbTeT]8]SXP]Q^gTabbc^a\TSX]c^ (ICC) has assured after Britain added India Hotspur are the six English clubs involved,
order, especially after spoiled the hardwork cWTbT\XUX]P[bPccWTh^dcWf^a[S to its travel ‘red list’ following a massive together with Barcelona, Atletico Madrid and
they faltered in three of the openers. RWP\_X^]bWX_bX]:XT[RT?^[P]S surge in Covid-19 caseload. Real Madrid from Spain and Italian trio
consecutive chas- Mohammed India’s entry into the ‘red list’ effective- Juventus, AC Milan and Inter Milan.
es. Shami has not been in NZ PLAYERS GET VACCINATED ly bans all travel from the country and UEFA has said the teams would be
Going by his best form so far and =0?;4B)=TfITP[P]S2aXRZTc=I2bPXS^] makes a 10-day hotel quarantine compul- banned from domestic and other European
Wr i d h h i m a n leaked runs but what CdTbSPhcWPcP[[^UcWTRaXRZTcTabfW^fX[[QT sory for UK residents arriving back home. competitions, including the Champions
Saha’s poor would be a concern for [TPeX]VU^acWTXac^da^U4]V[P]SWPeTQTT] However, the ICC expressed confi- League.
form, Jonny KL Rahul is the perfor- ePRRX]PcTS dence in staging the WTC final in a bio- Real Madrid president Florentino Perez,
Bairstow is the mance of Australian pace secure environment. the head of the new ESL, has insisted that
frontrunner for duo of Jhye Richardson LEEDS HOLD LIVERPOOL “The ECB and other members have 05?Q <>=CA4DG would be “impossible”, but Infantino threat-
the wicket-keep- and Riley Meredith. ;443B);XeTa_^^[fTaTWT[Sc^P SaPf demonstrated how we can stage ened action as FIFA took a stronger stance
er’s position. Both Richardson PfPhc^;TTSbD]XcTS^]<^]SPhX]P\PcRW International cricket safely in the middle IFA boss Gianni Infantino on Tuesday than it did with its initial statement when the
But what would and Meredith were ^eTabWPS^fTSQhcWTUdaX^dbaTb_^]bTc^cWT
<TabThbXSTab_[P]]TSX]e^[eT\T]cX]P
of a pandemic and we are confident that F blasted the proposed European Super news first broke.
>C74AC@?BD
be troubling Warner most is expensive in all we can continue to do that and that the League and warned that the clubs involved “It is our task to protect the European
the lack of depth in the the matches QaTPZPfPh4da^_TP]Bd_Ta;TPVdT0SaPf[TUc WTC Final will go ahead as planned in could face “consequences”. sport model, so if some elect to go their own
team’s local batting resources. they played bXgcW_[PRTS;XeTa_^^[cf^_^X]cbPSaXUc^U June in the UK,” said the ICC in a state- Twelve major clubs launched plans on way then they must live with the conse-
It’s high time the likes of without U^dacW_[PRTSFTbc7P\X]cWT[TPVdTcPQ[T ment on Monday night. Monday for a new breakaway league which quences of their choices,” said Infantino.
Manish Pandey, Vijay much suc- “We are currently discussing with the would drastically change the landscape of the “They are responsible for their choices.
Shankar, Abhishek Sharma cess and it NO ICC INTERVENTION IN CSA UK Government the impact of countries world’s most popular sport. “Either you’re in or you’re out. You can’t
and Abdul Samad pulled is time for <>=CA4DG)CWT822^]CdTbSPhbPXSXcfX[[ being on the 'red list',” it added. “At FIFA we can only and strongly dis- be half in and half out. Think of it, this has
up their socks as the Rahul to ]^cX]cTaeT]TX]cWTV^eTa]P]RTRaXbXb A BCCI source told PTI that it’s dif- approve the creation of the Super League, to be absolutely, absolutely clear.”
likes of seasoned Kedar think of T]Vd[UX]VB^dcW0UaXRP]RaXRZTccX[[cWT ficult to say anything at this point in time which is a closed shop, a breakaway from the UEFA president Aleksander Ceferin
Jadhav and Priyam other alter- R^d]cahbQ^PaSPbZbU^aXcPUcTacWTcWaTT and the Board is hoping that India will not current institutions, from the leagues, from said there was still time for clubs to pull out,
Garg are waiting in the natives like ]PcX^]P[cTP\RP_cPX]bTg_aTbbTSR^]RTa]b be in the ‘red list’ by the time the team the associations, from UEFA, and from FIFA,” addressing the owners, particularly of the
wings for their C h r i s ^eTa_^bbXQ[Tbdb_T]bX^]QhcWTVP\TbV[^QP[ leaves for UK in early June for the WTC Infantino told a UEFA congress in Premier League teams involved, and saying
opportunities. Jordan. V^eTa]X]VQ^Sh 0VT]RXTb final. Switzerland. they could row back on their “mistake”.