You are on page 1of 152

31 & 44

CONTENTS
4 JA N UA RY 2 0 1 9 • V O LU M E 3 6 3 • I S S U E 6 4 2 2
Internalizing
receptors to forget

18

Downloaded from http://science.sciencemag.org/ on January 7, 2019


NEWS FEATURES
18 BIOLOGY IN THE BANK
How an open-access trove of data on
31 WEAKENING SYNAPSES TO
CULL MEMORIES
Calcium sensor synaptotagmin-3 helps
Britons is unlocking the genetics of weaken synaptic strength and supports
IN BRIEF disease, behavior, and physical traits forgetting By N. J. Mandelberg and R. Tsien
▶ RESEARCH ARTICLE P. 44
8 What to expect in 2019 By J. Kaiser and A. Gibbons

IN DEPTH 21 SPOTTING EVOLUTION AMONG US 32 IMPROVING CROP YIELD


The half-million people in the Synthetic photorespiration bypass
11 THE WORLD DEBATES OPEN-ACCESS increases crop yield
UK Biobank hold the genetic
MANDATES By M. Eisenhut and A. P. M. Weber
legacy of Neanderthals—and clues
Spurred by European funders behind ▶ RESEARCH ARTICLE P. 45
to how we are still evolving
Plan S, many countries consider similar
By A. Gibbons
moves By T. Rabesandratana 33 REALLY COOL NEUTRAL PLASMAS
▶ PODCAST Properties of laser-cooled neutral

13 TROPICAL UPLIFT MAY SET


EARTH’S THERMOSTAT
INSIGHTS plasmas can be used to model high–
energy-density plasmas By S. Bergeson
▶ REPORT P. 61
Indonesia’s mountains could be cause of
current glacial age By P. Voosen PERSPECTIVES POLICY FORUM
14 COMPUTERS TURN NEURAL SIGNALS 27 FLOWING CROWDS 35 FROM VOLUNTARY COMMITMENTS
CREDITS: (GRAPHIC) V. ALTOUNIAN/SCIENCE; (PHOTO) NIGEL HILLER

INTO SPEECH Modeling human crowds as a fluid TO OCEAN SUSTAINABILITY


Fed data from invasive brain recordings, allows prediction of group behavior A common pledge and review system is
algorithms reconstruct heard and By N. T. Ouellette needed By B. Neumann and S. Unger
spoken sounds By K. Servick ▶ REPORT P. 46
BOOKS ET AL.
15 DO PLANTS FAVOR THEIR KIN? 28 THE SOUND OF A TROPICAL FOREST 37 A MILITARY ALLIANCE GOES GREEN
Once considered outlandish, the idea Recording of forest soundscapes Seeking solutions to Cold War divisions,
that plants help their relatives is taking can help monitor animal biodiversity in the mid-20th century NATO embraced
root By E. Pennisi for conservation environmentalism By D. Degroot
By Z. Burivalova et al.
16 ASTEROID MISSION FACES 38 ROBOTS, TELEWORK, AND THE JOBS
‘BREATHTAKING’ TOUCHDOWN 30 UNDERSTANDING LASSA FEVER OF THE FUTURE
As first data roll in from Hayabusa2, Genomics study informs about Lassa Globalization and AI are primed to
engineers plan descent to rocky surface fever epidemiology By N. Bhadelia disrupt tomorrow’s workplace, argues
By D. Normile ▶ REPORT P. 74 an economist By J. Peha

SCIENCE sciencemag.org 4 JANUARY 2019 • VOL 363 ISSUE 6422 3


Published by AAAS
33 & 61
CONTENTS
4 JA N UA RY 2 0 1 9 • V O LU M E 3 6 3 • I S S U E 6 4 2 2
Ultracold plasma

LETTERS 78 PALEONTOLOGY
24 NEXTGEN VOICES:
CHALLENGING TRANSITIONS 27 & 46 An elephant-sized Late Triassic
synapsid with erect limbs
T. Sulej and G. Niedźwiedzki

RESEARCH 81 EVOLUTION
DNA fragility in the parallel evolution
of pelvic reduction in stickleback fish
K. T. Xie et al.
IN BRIEF
84 PROTEIN TRANSLOCATION
39 From Science and other journals Structure of the posttranslational
Sec protein-translocation channel
REVIEW

Downloaded from http://science.sciencemag.org/ on January 7, 2019


complex from yeast
42 OPTICS S. Itskanov and E. Park
Exceptional points in optics and
photonics M.-A. Miri and A. Alù 88 PROKARYOTIC IMMUNITY
REVIEW SUMMARY; FOR FULL TEXT: Functionally diverse type V CRISPR-Cas
dx.doi.org/10.1126/science.aar7709 systems W. X. Yan et al.

RESEARCH ARTICLES
43 IMMUNOLOGY DEPARTMENTS
Commensal-specific T cell plasticity
54 MESOSCOPIC PHYSICS 7 EDITORIAL
promotes rapid tissue adaptation to
Counter-propagating charge transport Examining author gender data
injury O. J. Harrison et al.
in the quantum Hall effect regime By Jeremy Berg
RESEARCH ARTICLE SUMMARY; FOR FULL TEXT:
dx.doi.org/10.1126/science.aat6280 F. Lafont et al.
98 WORKING LIFE
44 NEUROSCIENCE 57 NANOMATERIALS Lessons from the ‘real world’
Synaptotagmin-3 drives AMPA receptor Fluorine-programmed nanozipping to By Barbara A. Wanchisen
endocytosis, depression of synapse tailored nanographenes on rutile TiO2
strength, and forgetting A. Awasthi et al. surfaces M. Kolmer et al.
RESEARCH ARTICLE SUMMARY; FOR FULL TEXT: ON THE COVER
dx.doi.org/10.1126/science.aav1483
61 ATOMIC PHYSICS Artist’s rendering of an
▶ PERSPECTIVE P. 31
Laser cooling of ions in a neutral early morning in Silesia,
plasma T. K. Langin et al. Poland, during the Late
45 PLANT SCIENCE ▶ PERSPECTIVE P. 33
Synthetic glycolate metabolism Triassic. The elephant-
pathways stimulate crop growth and sized dicynodont
64 NEUROSCIENCE Lisowicia bojani,
productivity in the field P. F. South et al.
CREDITS: (PHOTO) MARCO MEGA/ALAMY STOCK PHOTO; (GRAPHIC) C. BICKEL/SCIENCE

A collicular visual cortex: Neocortical a distant cousin of


RESEARCH ARTICLE SUMMARY; FOR FULL TEXT:
space for an ancient midbrain visual present-day mammals,
dx.doi.org/10.1126/science.aat9077
structure R. Beltramo and M. Scanziani plods slowly through
▶ PERSPECTIVE P. 32
the woodland as gracile theropod dinosaurs
70 CLIMATE CHANGE search for prey. In the foreground, the
REPORTS mammalian ancestor Hallautherium moves
The Little Ice Age and 20th-century
46 CROWD DYNAMICS deep Pacific cooling cautiously along a branch. Lisowicia, the
Dynamic response and hydrodynamics of G. Gebbie and P. Huybers largest known dicynodont, had upright
polarized crowds N. Bain and D. Bartolo limbs and walked with an erect gait,
▶ PERSPECTIVE P. 27; VIDEO 74 VIROLOGY similar to modern mammals. See page 78.
Metagenomic sequencing at the Illustration: Julius Csotonyi
49 CHEMICAL PHYSICS epicenter of the Nigeria 2018 Lassa
Rovibrational quantum state resolution fever outbreak L. E. Kafetzopoulou et al. Science Staff ..................................................6
of the C60 fullerene P. B. Changala et al. ▶ PERSPECTIVE P. 30 Science Careers ...........................................94

SCIENCE (ISSN 0036-8075) is published weekly on Friday, except last week in December, by the American Association for the Advancement of Science, 1200 New York Avenue, NW, Washington, DC 20005. Periodicals mail
postage (publication No. 484460) paid at Washington, DC, and additional mailing offices. Copyright © 2019 by the American Association for the Advancement of Science. The title SCIENCE is a registered trademark of the AAAS. Domestic
individual membership, including subscription (12 months): $165 ($74 allocated to subscription). Domestic institutional subscription (51 issues): $1971; Foreign postage extra: Mexico, Caribbean (surface mail) $55; other countries (air
assist delivery): $98. First class, airmail, student, and emeritus rates on request. Canadian rates with GST available upon request, GST #125488122. Publications Mail Agreement Number 1069624. Printed in the U.S.A.
Change of address: Allow 4 weeks, giving old and new addresses and 8-digit account number. Postmaster: Send change of address to AAAS, P.O. Box 96178, Washington, DC 20090–6178. Single-copy sales: $15 each plus shipping
and handling; bulk rate on request. Authorization to reproduce material for internal or personal use under circumstances not falling within the fair use provisions of the Copyright Act is granted by AAAS to libraries and others who use
Copyright Clearance Center (CCC), www.copyright.com. The identification code for Science is 0036-8075. Science is indexed in the Reader’s Guide to Periodical Literature and in several specialized indexes.

SCIENCE sciencemag.org 4 JANUARY 2019 • VOL 363 ISSUE 6422 5


Published by AAAS
BOARD OF REVIEWING EDITORS (Statistics board members indicated with S)
1200 New York Avenue, NW, Washington, DC 20005 Adriano Aguzzi, U. Hospital Zürich Wendell Lim, U. of California, San Francisco
Clarendon House, Clarendon Road, Cambridge, UK CB2 8FH Takuzo Aida, U. of Tokyo Marcia C. Linn, U. of California, Berkeley
Leslie Aiello, Wenner-Gren Foundation Jianguo Liu, Michigan State U.
Judith Allen, U. of Manchester
Luis Liz-Marzán, CIC biomaGUNE
Sebastian Amigorena, Institut Curie
Jonathan Losos, Harvard U.
Paola Arlotta, Harvard U.
Editor-in-Chief Jeremy Berg Johan Auwerx, EPFL Ke Lu, Chinese Acad. of Sciences
David Awschalom, U. of Chicago Christian Lüscher, U. of Geneva
Executive Editor Monica M. Bradford News Editor Tim Appenzeller Clare Baker, U. of Cambridge Fabienne Mackay, U. of Melbourne
Editor, Insights Lisa D. Chong Editors, Research Valda Vinson, Jake S. Yeston Nenad Ban, ETH ZÜrich Anne Magurran, U. of St. Andrews
Franz Bauer, Pontificia Universidad Católica de Chile Oscar Marín, King’s College London
Ray H. Baughman, U. of Texas at Dallas
Charles Marshall, U. of California, Berkeley
Research and Insights Carlo Beenakker, Leiden U.
Christopher Marx, U. of Idaho
Yasmine Belkaid, NIAID, NIH
DEPUTY EDITORS Julia Fahrenkamp-Uppenbrink(UK), Stella M. Hurtley(UK), Phillip D. Szuromi, Sacha Vignieri SR. EDITORIAL FELLOW Geraldine Masson, CNRS
Philip Benfey, Duke U.
Andrew M. Sugden(UK) SR. EDITORS Gemma Alderton(UK), Caroline Ash(UK), Pamela J. Hines, Paula A. Kiberstis, Marc S. Gabriele Bergers, VIB C. Robertson McClung, Dartmouth College
Lavine(Canada), Steve Mao, Ian S. Osborne(UK), Beverly A. Purnell, L. Bryan Ray, H. Jesse Smith, Jelena Stajic, Peter Stern(UK), Bradley Bernstein, Mass. General Hospital Rodrigo Medellín, U. of Mexico
Brad Wible, Laura M. Zahn ASSOCIATE EDITORS Michael A. Funk, Brent Grocholski, Priscilla N. Kelly, Tage S. Rai, Seth Thomas Peer Bork, EMBL Graham Medley, London School of Hygiene &
Scanlon(UK), Keith T. Smith(UK) ASSOCIATE BOOK REVIEW EDITOR Valerie B. Thompson LETTERS EDITOR Jennifer Sills LEAD CONTENT Chris Bowler, École Normale Supérieure Tropical Med.
PRODUCTION EDITORS Harry Jach, Lauren Kmec CONTENT PRODUCTION EDITORS Amelia Beyna, Jeffrey E. Cook, Amber Esplin, Chris Ian Boyd, U. of St. Andrews
Jane Memmott, U. of Bristol
Emily Brodsky, U. of California, Santa Cruz
Filiatreau, Cynthia Howe, Nida Masiulis SR. EDITORIAL COORDINATORS Carolyn Kyle, Beverly Shields EDITORIAL COORDINATORS Aneera Ron Brookmeyer, U. of California, Los Angeles (S) Edward Miguel, U. of California, Berkeley
Dobbins, Joi S. Granger, Jeffrey Hearn, Lisa Johnson, Maryrose Madrid, Shannon McMahon, Jerry Richardson, Alice Whaley(UK), Christian Büchel, UKE Hamburg Tom Misteli, NCI, NIH
Anita Wynn PUBLICATIONS ASSISTANTS Alexander Kief, Ope Martins, Ronmel Navas, Hilary Stewart(UK), Alana Warnke, Brian White Dennis Burton, Scripps Research Yasushi Miyashita, U. of Tokyo
EXECUTIVE ASSISTANT Jessica Slater ASI DIRECTOR, OPERATIONS Janet Clements(UK) ASI SR. OFFICE ADMINISTRATOR Jessica Waldock(UK) Carter Tribley Butts, U. of California, Irvine Alison Motsinger-Reif, NC State U. (S)
Gyorgy Buzsaki, New York U. School of Med. Daniel Nettle, Newcastle U.
Blanche Capel, Duke U. Daniel Neumark, U. of California, Berkeley
News Annmarie Carlton, U. of California, Irvine
Kitty Nijmeijer, TU Eindhoven
NEWS MANAGING EDITOR John Travis INTERNATIONAL EDITOR Martin Enserink DEPUTY NEWS EDITORS Elizabeth Culotta, Lila Guterman, Lars-Erik Cederman, ETH Zürich
Nick Chater, U. of Warwick Helga Nowotny, Austrian Council
David Grimm, Eric Hand, David Malakoff SR. CORRESPONDENTS Daniel Clery(UK), Jon Cohen, Jeffrey Mervis, Elizabeth Pennisi Rachel O’Reilly, U. of Warwick
Ib Chorkendorff, Denmark TU
ASSOCIATE EDITORS Jeffrey Brainard, Catherine Matacic NEWS WRITERS Adrian Cho, Jennifer Couzin-Frankel, Jocelyn Kaiser, Kelly James J. Collins, MIT Harry Orr, U. of Minnesota
Servick, Robert F. Service, Erik Stokstad(Cambridge, UK), Paul Voosen, Meredith Wadman INTERN Frankie Schembri CONTRIBUTING Robert Cook-Deegan, Arizona State U. Pilar Ossorio, U. of Wisconsin
CORRESPONDENTS Warren Cornwall, Ann Gibbons, Mara Hvistendahl, Sam Kean, Eli Kintisch, Kai Kupferschmidt(Berlin), Andrew Alan Cowman, Walter & Eliza Hall Inst. Andrew Oswald, U. of Warwick
Lawler, Mitch Leslie, Eliot Marshall, Virginia Morell, Dennis Normile(Shanghai), Charles Piller, Tania Rabesandratana(London), Carolyn Coyne, U. of Pittsburgh Isabella Pagano, Istituto Nazionale di Astrofisica
Emily Underwood, Gretchen Vogel(Berlin), Lizzie Wade(Mexico City) CAREERS Donisha Adams, Rachel Bernstein(Editor), Katie Roberta Croce, VU Amsterdam
Margaret Palmer, U. of Maryland
Jeff L. Dangl, U. of North Carolina
Langin COPY EDITORS Julia Cole (Senior Copy Editor), Cyra Master (Copy Chief) ADMINISTRATIVE SUPPORT Meagan Weiland Tom Daniel, U. of Washington Elizabeth Levy Paluck, Princeton U.
Chiara Daraio, Caltech Jane Parker, Max Planck Inst. Cologne
Nicolas Dauphas, U. of Chicago Giovanni Parmigiani, Dana-Farber Cancer Inst. (S)
Executive Publisher Rush D. Holt Frans de Waal, Emory U. Samuel Pfaff, Salk Inst. for Biological Studies
Stanislas Dehaene, Collège de France
Publisher Bill Moran Claude Desplan, New York U.
Julie Pfeiffer, UT Southwestern Med. Ctr.
Matthieu Piel, Institut Curie
DIRECTOR, BUSINESS STRATEGY AND PORTFOLIO MANAGEMENT Sarah Whalen DIRECTOR, PRODUCT AND CUSTOM PUBLISHING Will Schweitzer Sandra DÍaz, Universidad Nacional de CÓrdoba
Kathrin Plath, U. of California, Los Angeles
MANAGER, PRODUCT DEVELOPMENT Hannah Heckner BUSINESS SYSTEMS AND FINANCIAL ANALYSIS DIRECTOR Randy Yi DIRECTOR, BUSINESS Dennis Discher, U. of Penn.
Jennifer A. Doudna, U. of California, Berkeley Martin Plenio, Ulm U.
OPERATIONS & ANALYST Eric Knott ASSOCIATE DIRECTOR, PRODUCT MANAGMENT Kris Bishop SENIOR SYSTEMS ANALYST Nicole Mehmedovich Albert Polman, FOM Inst. for AMOLF
Bruce Dunn, U. of California, Los Angeles
SENIOR BUSINESS ANALYST Cory Lipman MANAGER, BUSINESS OPERATIONS Jessica Tierney BUSINESS ANALYSTS Meron Kebede, Sandy Kim, William Dunphy, Caltech Elvira Poloczanska, Alfred-Wegener-Inst.
Jourdan Stewart FINANCIAL ANALYST Julian Iriarte ADVERTISING SYSTEM ADMINISTRATOR Tina Burks SALES COORDINATOR Shirley Young Christopher Dye, U. of Oxford Julia Pongratz, Ludwig Maximilians U.
DIRECTOR, COPYRIGHT, LICENSING, SPECIAL PROJECTS Emilie David DIGITAL PRODUCT ASSOCIATE Michael Hardesty RIGHTS AND PERMISSIONS Todd Ehlers, U. of TÜbingen Philippe Poulin, CNRS
ASSOCIATE Elizabeth Sandler RIGHTS, CONTRACTS, AND LICENSING ASSOCIATE Lili Catlett RIGHTS & PERMISSIONS ASSISTANT Alexander Lee Jennifer Elisseeff, Johns Hopkins U. Jonathan Pritchard, Stanford U.
Tim Elston, U. of North Carolina
DIRECTOR, INSTITUTIONAL LICENSING Iquo Edim ASSOCIATE DIRECTOR, RESEARCH & DEVELOPMENT Elisabeth Leonard David Randall, Colorado State U.
Nader Engheta, U. of Penn.
SENIOR INSTITUTIONAL LICENSING MANAGER Ryan Rexroth INSTITUTIONAL LICENSING MANAGERS Marco Castellan, Chris Murawski Karen Ersche, U. of Cambridge Félix A. Rey, Institut Pasteur
Barry Everitt, U. of Cambridge Trevor Robbins, U. of Cambridge
SENIOR OPERATIONS ANALYST Lana Guz MANAGER, AGENT RELATIONS & CUSTOMER SUCCESS Judy Lillibridge
Vanessa Ezenwa, U. of Georgia Amy Rosenzweig, Northwestern U.
WEB DEVELOPMENT DIRECTOR David Levy PROJECT MANAGER Virginia Bramante Michael Feuer, The George Washington U. Mike Ryan, U. of Texas at Austin
Toren Finkel, U. of Pittsburgh Med. Ctr. Mitinori Saitou, Kyoto U.
DIGITAL MEDIA DIRECTOR OF ANALYTICS Enrique Gonzales DIGITAL REPORTING ANALYST Timothy Frailey MULTIMEDIA MANAGER Sarah Crespi Kate Fitzgerald, U. of Mass. Shimon Sakaguchi, Osaka U.
MANAGING WEB PRODUCER Kara Estelle-Powers DIGITAL PRODUCER Jessica Hubbard VIDEO PRODUCERS Chris Burns, Meagan Cantwell Gwenn Flowers, Simon Fraser U.
Miquel Salmeron, Lawrence Berkeley Nat. Lab
Peter Fratzl, Max Planck Inst. Potsdam
DIGITAL/PRINT STRATEGY MANAGER Jason Hillman QUALITY TECHNICAL MANAGER Marcus Spiegler DIGITAL PRODUCTION MANAGER Lisa Nitin Samarth, Penn. State U.
Elaine Fuchs, Rockefeller U.
Stanford ASSISTANT MANAGER DIGITAL/PRINT Rebecca Doshi SENIOR CONTENT SPECIALISTS Steve Forrester, Antoinette Hodal, Eileen Furlong, EMBL Jürgen Sandkühler, Med. U. of Vienna
Lori Murphy CONTENT SPECIALISTS Jacob Hedrick, Kimberley Oster Jay Gallagher, U. of Wisconsin Alexander Schier, Harvard U.
Susan Gelman, U. of Michigan Wolfram Schlenker, Columbia U.
DESIGN DIRECTOR Beth Rakouskas DESIGN MANAGING EDITOR Marcy Atarod SENIOR DESIGNER Chrystal Smith DESIGNER Christina Aycock
Daniel Geschwind, U. of California, Los Angeles Susannah Scott, U. of California, Santa Barbara
GRAPHICS MANAGING EDITOR Alberto Cuadra GRAPHICS EDITOR Nirja Desai SENIOR SCIENTIFIC ILLUSTRATORS Valerie Altounian, Karl-Heinz Glassmeier, TU Braunschweig Vladimir Shalaev, Purdue U.
Chris Bickel SCIENTIFIC ILLUSTRATOR Alice Kitterman INTERACTIVE GRAPHICS EDITOR Jia You SENIOR GRAPHICS SPECIALISTS Holly Bishop, Ramon Gonzalez, Rice U.
Beth Shapiro, U. of California, Santa Cruz
Nathalie Cary PHOTOGRAPHY MANAGING EDITOR William Douthitt PHOTO EDITOR Emily Petersen Elizabeth Grove, U. of Chicago
Nicolas Gruber, ETH ZÜrich Jay Shendure, U. of Washington
IMAGE RIGHTS AND FINANCIAL MANAGER Jessica Adams
Kip Guy, U. of Kentucky College of Pharmacy Brian Shoichet, U. of California, San Francisco
SENIOR EDITOR, CUSTOM PUBLISHING Sean Sanders: 202-326-6430 ASSISTANT EDITOR, CUSTOM PUBLISHING Jackie Oberst: 202-326-6463 Taekjip Ha, Johns Hopkins U. Robert Siliciano, Johns Hopkins U. School of Med.
ADVERTISING PRODUCTION OPERATIONS MANAGER Deborah Tompkins SR. PRODUCTION SPECIALIST/GRAPHIC DESIGNER Amy Hardcastle SR. Christian Haass, Ludwig Maximilians U. Lucia Sivilotti, U. College London
TRAFFIC ASSOCIATE Christine Hall DIRECTOR OF BUSINESS DEVELOPMENT AND ACADEMIC PUBLISHING RELATIONS, ASIA Xiaoying Chu: +86-131
Sharon Hammes-Schiffer, Yale U. Alison Smith, John Innes Centre
Wolf-Dietrich Hardt, ETH ZÜrich Richard Smith, U. of North Carolina (S)
6136 3212, xchu@aaas.org COLLABORATION/CUSTOM PUBLICATIONS/JAPAN Adarsh Sandhu + 81532-81-5142 asandhu@aaas.org EAST COAST/E. CANADA
Louise Harra, U. College London
Laurie Faraday: 508-747-9395, FAX 617-507-8189 WEST COAST/W. CANADA Lynne Stickrod: 415-931-9782, FAX 415-520-6940 MIDWEST Jeffrey Mark Smyth, QIMR Berghofer
Jian He, Clemson U.
Dembksi: 847-498-4520 x3005, Steven Loerch: 847-498-4520 x3006 UK EUROPE/ASIA Roger Goncalves: TEL/FAX +41 43 243 1358 JAPAN Kaoru Carl-Philipp Heisenberg, IST Austria Pam Soltis, U. of Florida
Sasaki (Tokyo): + 81 (3) 6459 4174 ksasaki@aaas.org Ykä Helariutta, U. of Cambridge John Speakman, U. of Aberdeen
Janet G. Hering, Eawag Tara Spires-Jones, U. of Edinburgh
ASSOCIATE DIRECTOR, BUSINESS DEVELOPMENT Justin Sawyers GLOBAL MARKETING MANAGER Allison Pritchard DIGITAL MARKETING ASSOCIATE Kai-Uwe Hinrichs, U. of Bremen Allan C. Spradling, Carnegie Institution for Science
Aimee Aponte MARKETING MANAGER, JOURNALS Shawana Arnold MARKETING ASSOCIATES Mike Romano, Tori Velasquez David Hodell, U. of Cambridge Paula Stephan, Georgia State U.
SENIOR DESIGNER Kim Huynh TRADE SHOW COORDINATOR Andrew Clamp Lora Hooper, UT Southwestern Med. Ctr. V. S. Subrahmanian, U. of Maryland
Fred Hughson, Princeton U.
GLOBAL SALES DIRECTOR ADVERTISING AND CUSTOM PUBLISHING Tracy Holmes: +44 (0) 1223 326525 CLASSIFIED advertise@sciencecareers.org SALES Ira Tabas, Columbia U.
Randall Hulet, Rice U.
MANAGER, US, CANADA AND LATIN AMERICA SCIENCE CAREERS Claudia Paulsen-Young: 202-326-6577, EUROPE/ROW SALES Sarah Lelarge SALES Auke Ijspeert, EPFL Sarah Teichmann, U. of Cambridge
ADMIN ASSISTANT Kelly Grace +44 (0)1223 326528 JAPAN Miyuki Tani(Osaka): +81 (6) 6202 6272 mtani@aaas.org CHINA/TAIWAN Xiaoying Chu: Akiko Iwasaki, Yale U. Shubha Tole, Tata Inst. of Fundamental Research
Stephen Jackson, USGS and U. of Arizona Wim van der Putten, Netherlands Inst. of Ecology
+86-131 6136 3212, xchu@aaas.org
Kai Johnsson, EPFL Bert Vogelstein, Johns Hopkins U.
AAAS BOARD OF DIRECTORS, CHAIR Susan Hockfield PRESIDENT Margaret A. Hamburg PRESIDENT-ELECT Steven Chu TREASURER Carolyn Peter Jonas, IST Austria Kathleen Vohs, U. of Minnesota
N. Ainslie CHIEF EXECUTIVE OFFICER Rush D. Holt BOARD Cynthia M. Beall, May R. Berenbaum, Rosina M. Bierbaum, Kaye Husbands Matt Kaeberlein, U. of Washington David Wallach, Weizmann Inst. of Science
William Kaelin Jr., Dana-Farber Cancer Inst.
Fealing, Stephen P.A. Fodor, S. James Gates, Jr., Michael S. Gazzaniga, Laura H. Greene, Robert B. Millard, Mercedes Pascual, Daniel Kammen, U. of California, Berkeley
Jane-Ling Wang, U. of California, Davis (S)
William D. Provine Abby Kavner, U. of California, Los Angeles David Waxman, Fudan U.
SUBSCRIPTION SERVICES For change of address, missing issues, new orders and renewals, and payment questions: 866-434-AAAS (2227) or 202-326-6417, Masashi Kawasaki, U. of Tokyo Jonathan Weissman, U. of California, San Francisco
FAX 202-842-1065. Mailing addresses: AAAS, P.O. Box 96178, Washington, DC 20090-6178 or AAAS Member Services, 1200 New York Avenue, NW, Washington, DC 20005 V. Narry Kim, Seoul Nat. U. Chris Wikle, U. of Missouri (S)
Robert Kingston, Harvard Med. School Terrie Williams, U. of California, Santa Cruz
INSTITUTIONAL SITE LICENSES 202-326-6730 REPRINTS: Author Inquiries 800-635-7181 COMMERCIAL INQUIRIES 803-359-4578 PERMISSIONS 202-326-6765, Nancy Knowlton, Smithsonian Institution Ian A. Wilson, Scripps Research (S)
permissions@aaas.org AAAS Member Central Support 866-434-2227 www.aaas.org/membercentral. Etienne Koechlin, École Normale Supérieure
Yu Xie, Princeton U.
Science serves as a forum for discussion of important issues related to the advancement of science by publishing material on which a consensus has been reached as
Alexander Kolodkin, Johns Hopkins U.
Jan Zaanen, Leiden U.
well as including the presentation of minority or conflicting points of view. Accordingly, all articles published in Science—including editorials, news and comment, and book
Thomas Langer, U. of Cologne
Mitchell A. Lazar, U. of Penn. Kenneth Zaret, U. of Penn. School of Med.
reviews—are signed and reflect the individual views of the authors and not official points of view adopted by AAAS or the institutions with which the authors are affiliated.
Stanley Lemon, U. of North Carolina Jonathan Zehr, U. of California, Santa Cruz
INFORMATION FOR AUTHORS See www.sciencemag.org/authors/science-information-authors Ottoline Leyser, U. of Cambridge Maria Zuber, MIT

6 4 JANUARY 2019 • VOL 363 ISSUE 6422 sciencemag.org SCIENCE

Published by AAAS
Corrected 4 January 2019. See full text.

ED ITORIAL

Examining author gender data

I
previously reported results of a study on au- compared with 16% in the physical sciences and 22% in
thor gender in Science (science.sciencemag.org/ other fields. The values for corresponding authors are
content/355/6323/329) that was based on the ex- 19, 12, and 20%, respectively.
amination of a random sample of approximately The gender distributions for papers that were pub-
2600 authors for which gender was inferred by lished can be compared with those for the overall sub-
painstaking analysis of websites and similar sourc- missions pool. The acceptance rates for Reports were
es. Unfortunately, this approach does not scale not significantly different for female as compared to
well to large samples necessary for many analyses. male first authors for papers submitted in 2016 and Editor-in-Chief,
We have since initiated systematic efforts to examine 2017, although significant differences were observed Science Journals.
gender distributions of key populations of authors and favoring male authors from 2011 to 2015. Further work jberg@aaas.org
reviewers for the Science family of journals using addi- is in progress to determine if these disparities are

Downloaded from http://science.sciencemag.org/ on January 7, 2019


tional data and tools and plan to use this information due to gender biases in reviews, editorial decisions,
to guide policy develop- or other factors such as
ment and other appro- Acceptance rates for Reports by gender of frst authors institutional differences
priate steps to address and preferences. Signifi-
any gender disparities. 0.100 cant differences in Re-
Since our initial study, port acceptance rates by
we have collected gender gender of corresponding
and other demographic authors were observed
0.075
information voluntarily in 2012, 2014, and 2015.
from approximately 5000 We can also examine
Acceptance rate

individuals (authors and other article types. For


reviewers). To extend this 0.050 example, the fraction
dataset further, we’ve of female correspond-
used first name–based ing authors for Perspec-
gender inference software tives (driven largely by
0.025
that we validated and editorial invitations to
Female
calibrated with accurate Perspective authors and,
Male
datasets, as described in indirectly, peer review-
the accompanying Sci- 0.00 ers) grew steadily from
encehound post (https:// 2010 2011 2012 2013 2014 2015 2016 2017 19 to 26% from 2010 to
blogs.sciencemag.org/ 2017. The Science news
sciencehound/2019/01/03/new-tools-for-gender- team’s analysis of data regarding its use of women and
analysis). The automated tool provides inferred genders men as sources and in quotes in its stories reveals an
for more than 70% of the authors of both published and increase in the fraction of quoted female sources from
rejected Science papers submitted from 2010 to 2017. approximately 20% to more than 30% over the course
Based on comparisons with the individual-provided of 2018.
dataset, these inferred genders are more than 93% ac- With these data and tools in place, we are now well
curate on an individual basis. Furthermore, the inferred positioned for further analyses and actions that ad-
gender information can be extended to populations dress gender disparities. We plan to examine the gender
with gender distributions that appear to be more than distribution of our peer reviewers. Social science stud-
98% accurate. ies indicate that women and men tend to have similar
The fractions of male and female authors for Re- gender biases, based on their perceptions of the gender
ports submitted to Science are nearly constant over the distribution of the population that they are examining.
GRAPH: J. BERG/SCIENCE; (TOP RIGHT) TERRY CLARK

8-year period examined. Twenty-five ± 1% of the first Nonetheless, ensuring that gender distributions for re-
authors are female, while 18 ± 1% of the correspond- viewers approximate those for authors is good practice,
ing authors are female, consistent with the results from and peer reviewers do get access to exciting scientific
our earlier analysis. These figures reflect the weighted results and are often invited to write Perspectives. We
averages across the different fields covered by Science. plan to share these and other analyses and encourage
Separating submissions by field reveals that 30% of first others to perform and share similar examinations.
authors of submissions in the life sciences are female, –Jeremy Berg

10.1126/science.aaw4633

SCIENCE sciencemag.org 4 JANUARY 2019 • VOL 363 ISSUE 6422 7


Published by AAAS
NEWS

Downloaded from http://science.sciencemag.org/ on January 3, 2019


IN BRIEF

AREAS TO WATCH the ice’s structure and the water and land
beneath it, using everything from seismo-
meters to instrument-carrying seals. Both
What’s coming up in 2019 missions will benefit from revitalized satel-
lite coverage, as two satellites launched last

S
cientists in Europe and the United States face an uncertain year, the Ice, Cloud, and Land Elevation
political landscape in the new year, which could affect fund- Satellite-2 and the Gravity Recovery and
ing and collaborations. The threat is most acute in the United Climate Experiment Follow-on, which
measure ice height and mass, respectively,
Kingdom, which plans to exit the European Union in March begin to beam science data back home.
but has not settled on the terms of its departure. Some big re-
search findings could share the headlines, however, including
A science whisperer for Trump
the first clear images of the supermassive black hole at the heart of
SCIENCE POLICY | For 2 years, President
our galaxy, from astronomers in an international collaboration called Donald Trump has been making decisions
the Event Horizon Telescope. Science’s news staff forecasts other involving science and innovation without
areas of research and policy likely to make news this year. input from a White House science adviser.
Meteorologist Kelvin Droegemeier, whom
PHOTO: ALFRED WEGENER INSTITUTE/STEFAN HENDRICKS

Trump nominated in late July 2018 to


of Arctic Climate, hosting researchers fill that void, was awaiting final Senate
All eyes on polar ice from 17 countries. They’ll study how polar approval at press time. The question is
| If you want to
C L I M AT E S C I E N C E clouds, ocean dynamics, and first-year ice what his arrival will mean for the adminis-
understand Earth’s warming future, look formation contribute to the Arctic’s shift tration’s handling of an array of technical
to the poles. This year, scientists in two to ice-free summers. Then, near year’s challenges, from regulation of human
international projects will heed that call. end, researchers from the United States embryo engineering and self-driving cars
In September, researchers will position a and United Kingdom will fan out across to combatting cyberterrorism and foster-
German icebreaker, the RV Polarstern, to the remote Thwaites Glacier, the part of ing a more tech-savvy workforce. Some
freeze in Arctic sea ice for a year’s stay. the Antarctic ice sheet most at risk of col- science-soaked issues may already have
The ship will serve as the central hub lapsing into the ocean and driving up been settled, such as leaving the Paris cli-
for the €120 million Multidisciplinary sea levels, in the first full season of a mate accord and forsaking the Iran nuclear
drifting Observatory for the Study $50 million, 5-year effort. They’ll probe deal. But many others remain unresolved,

8 4 JANUARY 2019 • VOL 363 ISSUE 6422 sciencemag.org SCIENCE

Published by AAAS
The RV Polarstern, shown the team will loft a balloon into the strato-
here on a 2013
Seeking new physics in the muon sphere, where it will release 100 grams
polar research cruise, | By studying the
PA R T I C L E P H YS I C S of reflective particles—probably calcium
will spend a winter magnetism of a particle called the muon, carbonate, the chalky ingredient in antacid
frozen in Arctic sea ice. physicists hope to find results this year tablets. Flying back through the plume,
that could point to new particles or forces, the balloon will observe its cooling effect.
something they have craved for decades. Solar-radiation management, as it’s known,
Scientists at Fermi National Accelerator is controversial. It does not reduce the
Laboratory (Fermilab) in Batavia, Illinois, built-up carbon dioxide that drives climate
are examining whether the muon—a change and ocean acidification, and there’s
heavier and shorter-lived cousin of the no accepted international governance.
electron—is more magnetic than theory
predicts. The Muon g-2 experiment found
a hint of such an excess when it ran at Divided we stand?
Brookhaven National Laboratory in Upton, SCIENCE POLICY | You’ll need a Ouija
New York, from 1997 to 2001. Physicists board to predict how U.S. science will fare
moved the experiment’s 15-meter-wide this year under a divided government, with
electromagnet to Fermilab in 2013, Democrats now in control of the House of
upgraded the apparatus, and started to Representatives while Republicans retain
record data in January 2018. A first result

Downloaded from http://science.sciencemag.org/ on January 3, 2019


could be one of the biggest stories in particle
physics this year, with the world’s biggest
atom smasher, Europe’s Large Hadron
Collider, idled for 2 years of upgrades.

A fine-grained look inside cells


| In cell biology, higher
B I O P H YS I C S
resolution means more gets revealed. Now,
scientists are ready to use new combina-
tions of tools and techniques to provide
close-up looks at components inside
cells in unprecedented detail, and in 3D. With control of the U.S. House of Representatives,
including how to deal with Chinese espio- Already, researchers can analyze DNA, Democrats will likely examine environmental policies.
nage at U.S. universities without stifling proteins, RNA, and epigenetic marks in
global scientific cooperation. single cells. This year, multidisciplinary the Senate with President Donald Trump
teams plan to combine those methods in the White House. There are the known
with advances in cryoelectron tomography, flashpoints—Democrats challenging the
New rights for alleged harassers labeling techniques to trace molecules, Trump administration on its environment
#METOO | This year, the U.S. Department and other types of microscopy to see and energy policies, for example. Spending
of Education may finalize controver- subcellular structures and processes. For cuts will be on the table as lawmakers
sial proposed rules that would reduce example, a multifaceted technique for face tight budget caps mandated by a 2011
universities’ liability for policing sexual imaging and staining DNA could shed law. Then there are the what-ifs, including
harassment and sexual assault and give new light on how chromosomes fold. And whether the Supreme Court will throw out
more rights to the accused. The regula- the blended methods could yield clearer a citizenship question on the 2020 census
tions, proposed in November 2018, would pictures at the molecular level of how cells and lawmakers can suspend partisan bick-
change how institutions investigate such divide and change shape, and how gene ering long enough to pass an infrastructure
allegations under the landmark 1972 activity affects structure and function. package that would boost U.S. innova-
law known as Title IX. They wouldn’t tion. A few science-savvy new members of
be responsible for investigating most Congress hope to lend a hand.
off-campus incidents of harassment or Solar dimming gets a test
assault, and the standard of evidence | A geoengineering
C L I M AT E S C I E N C E
for confirming allegations of on-campus technique to curb global warming by New GM mosquitoes take off
misconduct could rise. The definition of temporarily dimming the sun’s rays could | The first release of
B I O T E C H N O L O GY
PHOTO: CARLOS BARRIA/REUTERS/NEWSCOM

sexual harassment would be narrowed get its first, modest field experiment this genetically modified (GM) mosquitoes in
from “unwelcome conduct of a sexual year. In solar geoengineering, vast amounts Africa is set to happen in Burkina Faso
nature” to “unwelcome conduct on the of reflective aerosol particles would this year, an initial step in a planned “gene
basis of sex that is so severe, pervasive, be sprayed into the high atmosphere, drive” strategy against malaria. It will be
and objectively offensive that it effec- mimicking the cooling effects of volcanic the first release of GM mosquitoes of the
tively denies a person equal access” to eruptions. The Stratospheric Controlled genus Anopheles, which transmits the
education. And defendants’ lawyers will Perturbation Experiment, led by climate parasite responsible for the disease. The
be able to cross-examine accusers. The scientists at Harvard University, will test gene drive approach, under development at
department is accepting comments on the the idea in a small, controlled way. If its the nonprofit consortium Target Malaria,
proposals until 28 January. plans are approved by an advisory board, would spread mutations through the wild

SCIENCE sciencemag.org 4 JANUARY 2019 • VOL 363 ISSUE 6422 9


Published by AAAS
NEWS | I N B R I E F | A R E A S T O WAT C H

population that knock out key fertility to living descendants. Some warn, however,
genes or reduce the proportion of female The next planetary mission that widespread adoption of similar methods
insects, which transmit disease. But the | In July, NASA will chart
S PAC E S C I E N C E could be used to coerce communities into
first GM Anopheles mosquitoes released its next major step in planetary science genetic testing. In France, a government-
won’t bear such mutations and aren’t when it selects the next billion-dollar mis- commissioned report recommended in
intended to cut down the population. sion under its New Frontiers program. The November 2018 that over the next 5 years,
Researchers will let out fewer than agency will choose between two finalists. French museums work with colleagues in
10,000 genetically sterilized males to Dragonfly would send a semiautonomous Africa to repatriate tens of thousands of
observe how they survive and disperse quad-copter to fly across the surface of cultural artifacts looted during colonial rule
in the wild and to help introduce the Titan, the saturnian moon sculpted by if their countries of origin ask for them.
concept of GM mosquitoes to regulators rivers of liquid methane. The copter would
and community members. search for clues of chemical reactions that
could lead to life. The Comet Astrobiology Disease crisis looms for swine
Exploration Sample Return mission would | Pig farmers—
L I V E S T O C K AG R I C U LT U R E
Nations size up biodiversity return gases and ice from the nucleus of and perhaps some bacon lovers—will anx-
| Three years in the mak-
C O N S E R VAT I O N the comet 67P/Churyumov-Gerasimenko. iously scan the headlines this year for news
ing, a $2.4 million assessment of Earth’s Such samples, likely unaltered for billions of African swine fever (ASF). Harmless to
biodiversity and ecosystems will be pub- of years, could provide a window into the humans, the viral disease is highly infec-
lished in May. By evaluating trends over role comets played in delivering water and tious and lethal among pigs, causing serious
50 years in indicators such as species organic compounds to Earth in its economic damage through culls and trade

Downloaded from http://science.sciencemag.org/ on January 3, 2019


extinctions and extent of marine pro- early history. bans. ASF made major jumps in Europe last
tected areas, it will chart progress toward year, turning up for the first time in pigs and
international goals on biodiversity wild boar in Bulgaria and in boar in Belgium
conservation—and, in many places, how A push to return museum holdings and Hungary. The virus can jump from boar,
far short the world is falling. Experts RESEARCH ETHICS | Researchers are which are difficult to manage, to swine.
from 50 nations have participated in a beginning new efforts to return bones and Germany, Denmark, and other major pork
review of scientific literature and govern- cultural artifacts collected for study and producers are on high alert. Most worrisome
ment data conducted under the auspices as museum specimens to the peoples from was the first detection of the virus in China,
of the Intergovernmental Science-Policy whom they were obtained, often without a long-dreaded development in the country
Platform on Biodiversity and Ecosystem consent. Expect renewed debate on this with the world’s largest pig population. China
Services. The report, the first since a issue, as after centuries of exploitative col- has recorded more than 80 outbreaks since
similar effort in 2005, will forecast the lecting, some researchers use new methods August 2018, including in boar. Authorities
future of species on the planet under to collaborate with those communities, and have clamped down on the transport of pigs,
business-as-usual and other scenarios. also expand efforts to return objects of art. culled more than 630,000,and last month
The new assessment is intended to A study from Australia published last month reportedly banned pig farming where wild
inform the next generation of biodiversity showed ancient DNA can be used to reliably boar are present. Despite these efforts, the
targets, due in 2020. link the remains of Aboriginal ancestors virus could still explode in China and else-
where in Asia.

A global assessment will


examine endangered China eyes bioethics overhaul
species, which include the BIOETHICS | China is likely to tighten its
ploughshare tortoise in rules for genetic engineering of humans,
Madagascar. including the creation of heritable traits,
in the wake of an uproar over such work in
2018. A Chinese scientist named He Jiankui
announced in November 2018 that he modi-
fied a gene in embryos that led to twin baby
girls. The modification is meant to protect
them and their descendants from HIV infec-
tion, a feat widely condemned in China and
worldwide as unethical, unjustified, and
possibly harmful to the babies. Most coun-
tries ban or outlaw such experiments. In
China, however, what is apparently the most
relevant regulation was enacted in 2003 and
PHOTO: RYAN BOLTON/SHUTTERSTOCK

never updated to cover advances in gene


editing. Since the announcement, numerous
Chinese researchers, ethicists, and officials
have called for an overhaul of the country’s
bioethics laws and regulations, although
no agency or institution has been named
to lead the effort. Another question for this
year is whether He will face sanctions.

10 4 JANUARY 2019 • VOL 363 ISSUE 6422 sciencemag.org SCIENCE

Published by AAAS
IN DEP TH

Downloaded from http://science.sciencemag.org/ on January 7, 2019


PUBLISHING

The world debates open-access mandates


Spurred by European funders behind Plan S, many countries consider similar moves

By Tania Rabesandratana ary 2020, has drawn support from many to OA, says librarian Jeffrey MacKie-Mason,
scientists, who welcome a shake-up of a pub- the chief digital scholarship officer at the

H
ow far will Plan S spread? lishing system that can generate large prof- University of California, Berkeley.
Since the September 2018 launch its while keeping taxpayer-funded research Robert-Jan Smits, the European Com-
of the Europe-backed program to results behind paywalls. But publishers (in- mission’s OA envoy in Brussels, who is one
mandate immediate open access (OA) cluding AAAS, which publishes Science) are of the architects of Plan S, says publishers
to scientific literature, 16 funders in concerned, and some scientists worry that have stalled by emphasizing the need for
13 countries have signed on. That’s Plan S could restrict their choices. broad participation. “The big publishers
still far shy of Plan S’s ambition: to con- If Plan S fails to grow, it could remain told me: ‘Listen, we can only flip our jour-
vince the world’s major research funders a divisive mandate that applies to only a nals [to OA] if this is signed by everyone. So
to require immediate OA to all first go on a trip around the world
published papers stemming from “[Plan S] is perhaps our best chance to and come back in 20 years. Then
their grants. Whether it will we can talk again,’” Smits recalls.
reach that goal depends in part transform the publishing industry soon.” “Some people try to do anything to
on details that remain to be set- Jeffrey MacKie-Mason, University of California, Berkeley keep the status quo.”
tled, including a cap on the au- OA mandates are nothing new:
thor charges that funders will pay for OA small percentage of the world’s scientific In Europe, 74 research funders require that
ILLUSTRATION: DAVIDE BONAZZI/SALZMAN ART

publication (Science, 30 November 2018, papers. (Delta Think, a consulting company papers be made free at some point, up from
p. 983). But the plan has gained momen- in Philadelphia, Pennsylvania, estimates 12 in 2005, according to the Registry of
tum: In December 2018, China stunned that the first 15 funders to back Plan S ac- Open Access Repository Mandates and Poli-
many by expressing strong support for counted for 3.5% of the global research ar- cies. But existing policies typically allow a
Plan S (Science, 14 December 2018, p. 1218). ticles in 2017.) To transform publishing, the delay of 6 or 12 months after initial publica-
This month, a national funding agency in plan needs global buy-in. The more funders tion, during which papers can remain be-
Africa is expected to join, possibly followed join, the more articles will be published in hind a publisher paywall.
by a second U.S. funder. Others around the OA journals that comply with its require- Plan S requires immediate OA; it also in-
world are considering whether to sign on. ments, pushing publishers to flip their jour- sists that authors retain copyright and that
Plan S, scheduled to take effect on 1 Janu- nals from paywall-protected subscriptions hybrid journals, which charge subscrip-

SCIENCE sciencemag.org 4 JANUARY 2019 • VOL 363 ISSUE 6422 11


Published by AAAS
NEWS | I N D E P T H

tions but also offer a paid OA option, sign government research funder and two na- National Institute of Informatics in Tokyo,
“transformative agreements” to switch to tional science libraries issued strong state- an adviser to the Japan Alliance of Univer-
fully OA. ments backing Plan S’s goals. “China needs sity Library Consortia for E-Resources, says
Some European funders think Plan S to contribute to international open access that despite interest from funders and li-
goes too far. “We and many German [or- [and] open its research results to its own braries, OA has yet to gain much traction
ganizations] think that we should not be people,” says Zhang Xiaolin of Shanghai- in his country.
as prescriptive as Plan S is,” says Wilhelm Tech University in China, who chairs the South America has a strong tradition
Krull, secretary general of the Volkswagen Strategic Planning Committee of the Chi- of OA repositories and fee-free publish-
Foundation, a private research funder in nese National Science and Technology Li- ing, often with government subsidies.
Hannover, Germany. The country is Eu- brary. Even if Chinese organizations do not Bianca Amaro, president of LA Referencia,
rope’s top producer of scientific papers, join Plan S formally, similar OA policies in a Santiago-based Latin American network
ahead of the United Kingdom and France, China would have a “huge, perhaps deci- of repositories, says Plan S takes a more
whose main funding agencies have signed sive impact on the publishing industry,” “systemic view” than previous policies, and
on to Plan S. Germany’s biggest MacKie-Mason says. she values its pledge to monitor APCs and
federal funding agency, DFG, For now, North America is their impact—a worry for lower-income
said it supports Plan S’s goals Paper players not following suit. The Bill & countries. “We’ll see how Europe handles
but prefers to let research- Melinda Gates Foundation was this,” she says.
Percentages of the
ers drive the change. Other world’s 2016 science
the first Plan S participant out- Of course, MacKie-Mason says, not every
funders, including the Esto- articles by country side Europe, and another pri- funding agency will agree that Plan S is the
nian Research Council, say the vate funder may follow. But U.S. best way to universal OA. “But some will

Downloaded from http://science.sciencemag.org/ on January 7, 2019


timeline is too tight, and they federal agencies are sticking to agree it’s good enough and perhaps our best
will reconsider joining when policies developed after a 2013 chance to transform the publishing indus-
Plan S’s impact is clearer. White House order to make try soon,” he says. It comes in the wake of
Other European funders are peer-reviewed papers on work often incremental OA initiatives in the past
18.6 China
weighing pros and cons. Spain’s they funded freely available 15 years, and some disagreement about the
science ministry says it is analyz- within 12 months of publication best route to OA.
ing the potential repercussions (Science, 10 April 2015, p. 167). “In the OA movement, it seems to a lot of
of Plan S on the country’s science “We don’t anticipate making people that you have to choose a road: green
and finances, and on research- any changes to our model,” said or gold or diamond,” says Colleen Campbell,
ers’ careers. FNRS, the fund for Brian Hitson of the U.S. Depart- director of the OA2020 initiative at the Max
scientific research in Belgium’s ment of Energy in Oak Ridge, Planck Digital Library in Munich, Germany,
Wallonia-Brussels region, is United Tennessee, who directs that referring to various styles of OA. “Publish-
17.8
waiting for Plan S to announce States agency’s public access policy. ers are sitting back laughing at us while we
its cap on article-processing Nor are the three main fed- argue about different shades” instead of
charges (APCs), the fees for pub- eral research funders in Canada focusing on a shared goal of complete, im-
lishing in OA journals, which the ready to change their joint 2015 mediate OA. Because of its bold, stringent
coalition’s funders have pledged 4.8 India
OA policy. Plan S is “a bold and requirements, she and others think Plan S
to pay. “We’re not ready to com- aggressive approach, which can galvanize advocates to align their ef-
mit if the costs are too high,” says is why we want to make sure forts to shake up the publishing system.

CREDITS: (GRAPHIC) N. DESAI/SCIENCE; (DATA) NATIONAL SCIENCE BOARD, SCIENCE & ENGINEERING INDICATORS 2018
4.5 Germany
Véronique Halloin, secretary- we’ve done our homework to The Plan S team predicts steady growth
general of FNRS, whose exist- 4.3
United ensure it would have the best ef- in the coming months. Funders will dis-
ing OA mandate caps APC re- Kingdom fect on Canadian science,” says cuss Plan S in São Paulo, Brazil, at the May
imbursement at €500—which 4.2 Japan Kevin Fitzgibbons, executive meeting of the Global Research Council,
Halloin admits is on the low side. director of corporate planning an informal group of funding agencies. Al-
Many await the European 3 France and policy at Canada’s Natural though Smits will leave the European Com-
Commission’s policy: Although 3 Italy Sciences and Engineering Re- mission in March, the Plan S coalition is
its grants represent a small 2.8 South Korea
search Council in Ottawa. seeking a replacement who can keep the
percentage of research funding Outside Europe and North momentum going.
2.6 Russia
in Europe, its OA rules can in- America, funders gave Science “The combined weight of Europe and
fluence national mandates. The 2.5 Canada mixed responses about Plan S. China is probably enough to move the sys-
commission’s research chief, 2.3 Brazil India, the third biggest pro- tem,” says astrophysicist Luke Drury, of the
Carlos Moedas, supports Plan 2.3 Spain ducer of scientific papers in Dublin Institute for Advanced Studies and
S, and its 7-year funding pro- 2.2 Australia the world, will “very likely” the lead author of a cautiously supportive
gram Horizon Europe, which join Plan S, says Krishnaswamy response to Plan S by All European Acad-
will begin in 2021, contains VijayRaghavan in New Delhi, emies, a federation of European academies
general statements of support principal scientific adviser to of sciences and humanities.
for OA. Plan S’s rules will go India’s government. But the If Plan S does succeed in bringing about a
into the program’s model con- Other
Russian Science Foundation fairer publishing system, he says, a transition
tract for grants, Smits says. 25.1 is not planning to join. South to worldwide OA is sure to follow. “Some-
countries
Smits has found unexpected Africa’s National Research body has to take the lead, and I’m pleased
support from China, which Foundation says it “supports that it looks like it’s coming from Europe.” j
now produces more scientific Plan S in principle,” but wants
papers than any other coun- to consult stakeholders before With reporting by Jefrey Brainard, Sanjay
try. Last month, China’s largest signing on. Jun Adachi of the Kumar, Dennis Normile, and Brian Owens.

12 4 JANUARY 2019 • VOL 363 ISSUE 6422 sciencemag.org SCIENCE

Published by AAAS
In some wet tropical mountains, carbon dioxide is
captured and flushed out of the atmosphere.

90 million and 50 million years ago lined up


neatly with the collisions of a chain of island
volcanoes in the now-vanished Neo-Tethys
Ocean with the African and Asian continents.
A similar collision some 460 million years
ago formed the Appalachians, but it was
thought to have taken place in the subtropics,
where a drier climate does not favor weather-
ing. By reanalyzing ancient magnetic fields
in rocks formed in the collision, Macdonald’s
team found the mountains actually rose deep
in the tropics. And their uplift matched a
2-million-year-long glaciation. “They’re de-
CLIMATE veloping a pretty compelling story that this
was a climate driver in Earth’s past,” says Lee

Tropical uplift may set Kump, a paleoclimatologist at Pennsylvania


State University in University Park.

Downloaded from http://science.sciencemag.org/ on January 3, 2019


But those cases could be exceptions. So the

Earth’s thermostat team compiled a database of every tectonic


“suture”—the linear features left by tectonic
collisions—known to contain ophiolites,
Indonesia’s mountains could be cause of current glacial age those bits of volcanic sea floor, over the past
half-billion years. Based on magnetism in
By Paul Voosen changes in the planet’s temperature are gov- each suture’s rocks and a model of continen-
erned by shifts in CO2, and that plate tecton- tal drift, they mapped their ancient latitudes

H
ate the cold? Blame Indonesia. It may ics somehow drives those shifts as it remakes to see which formed in the topics, and when.
sound odd, given the contributions the planet’s surface. But for several decades, “We were surprised that this is not as compli-
to global warming from the country’s researchers have debated exactly what turns cated as we thought,” Macdonald said.
270 million people, rampant defores- the CO2 knob. Many have focused on the vol- The team compared the results to records
tation, and frequent carbon dioxide canoes that rise where plates dive beneath of past glaciations and found a strong cor-
(CO2)-belching volcanic eruptions. But one another. By spewing carbon from Earth’s relation. They also looked for declines in
over much longer times, Indonesia is sucking interior, they could turn up the thermostat. volcanism, which might have cooled the cli-
CO2 out of the atmosphere. Others have emphasized rock weathering, mate. But their influence was much weaker,
Many mountains in Indonesia and neigh- which depends on mountain building driven Macdonald said.
boring Papua New Guinea consist of ancient by plate tectonics. When the mountains Kimberly Lau, a geochemist at the Univer-
volcanic rocks from the ocean floor that contain seafloor rocks rich in calcium and sity of Wyoming in Laramie, calls the work
were caught in a colossal tectonic collision magnesium, they react with CO2 dissolved “exciting in idea and novel in execution.” Lee,
between a chain of island volcanoes and a in rainwater to form limestone, which is however, would like to see direct evidence
continent, and thrust high. Lashed by tropi- eventually buried on the ocean floor. Both from ancient sediments that the collisions
cal rains, these rocks hungrily react with CO2 processes matter; “the issue is which one is drove up rock weathering. “They have to go
and sequester it in minerals. That is why, changing the most,” says Cin-Ty Lee, a volca- to the sink and study those,” he says. And a
with only 2% of the world’s land area, Indo- nologist at Rice University in Houston, Texas. recent study challenges the mountain ther-
nesia accounts for 10% of its long-term CO2 Having the right rocks to drive the CO2- mostat idea with evidence for the importance
absorption. Its mountains could explain why chewing reaction is not sufficient. Climate of volcanoes. The study used ages from thou-
ice sheets have persisted, waxing and wan- matters, too. For example, the Siberian Traps, sands of zircons, durable crystals that can in-
ing, for several million years (although they a region that saw devastating volcanic erup- dicate volcanic activity, to show that upticks
are now threatened by global warming). tions 252 million years ago, are rich in such in volcanic emissions were the dominant
Now, researchers have extended that rocks but absorb little, says Dennis Kent, a force driving the planet’s warm periods. It’s
theory, finding that such tropical mountain- geologist at Rutgers University in New Bruns- likely both teams have at least one hand on
building collisions coincide with nearly all of wick, New Jersey. “It’s too damn cold,” he the truth, adds Lee, who contributed to the
the half-dozen or so significant glacial periods says. Saudi Arabia has the heat and the rocks zircon paper.
PHOTO: ROBERT HARDING/ALAMY STOCK PHOTO

in the past 500 million years. “These types of but lacks another ingredient. “It’s hotter than The beauty of his team’s model, Macdonald
environments, through time, are what sets Hades but it doesn’t rain.” Indonesia’s loca- said at the end of his talk, is that it explains
the global climate,” said Francis Macdonald, tion in the rainy tropics is just right. “That is not just why glacial times start, but also why
a geologist at the University of California, probably what’s keeping us centered in an ice they stop. A hothouse Earth appears to be
Santa Barbara, when he presented the work age,” Kent adds. the planet’s default state, prevailing for three-
last month at a meeting of the American Geo- Over the past few years, Macdonald and fourths of the past 500 million years. An
physical Union in Washington, D.C. If Earth’s his collaborators have searched for other Indonesia-style collision may push the global
climate has a master switch, he suggests, the times when tectonics and climate could have climate into a glacial period, but only for a
rise of mountains like Indonesia’s could be it. conspired to open an Indonesia-size CO2 while. Mountains erode and continents drift.
Most geologists agree that long-term drain. They found that glacial conditions And the planet warms again. j

SCIENCE sciencemag.org 4 JANUARY 2019 • VOL 363 ISSUE 6422 13


Published by AAAS
NEWS | I N D E P T H

NEUROSCIENCE

Computers turn neural signals into speech


Fed data from invasive brain recordings, algorithms reconstruct heard and spoken sounds

By Kelly Servick removal of a brain tumor, when electrical words aloud. Meanwhile, electrodes re-
readouts from the exposed brain help sur- corded from the brain’s speech planning ar-

F
or many people who are paralyzed and geons locate and avoid key speech and motor eas and motor areas, which send commands
unable to speak, signals of what they’d areas. Another is when a person with epi- to the vocal tract to articulate words. The
like to say hide in their brains. No one lepsy is implanted with electrodes for several network mapped electrode readouts to the
has been able to decipher those sig- days to pinpoint the origin of seizures before audio recordings, and then reconstructed
nals directly. But three research teams surgical treatment. “We have, at maximum, words from previously unseen brain data.
recently made progress in turning 20 minutes, maybe 30,” for data collection, According to a computerized scoring sys-
data from electrodes surgically placed on Martin says. “We’re really, really limited.” tem, about 40% of the computer-generated
the brain into computer-generated speech. The groups behind the new papers made words were understandable.
Using computational models known as neu- the most of precious data by feeding the Finally, neurosurgeon Edward Chang and
ral networks, they reconstructed words and information into neural networks, which his team at the University of California,

Downloaded from http://science.sciencemag.org/ on January 3, 2019


sentences that were, in some cases, intelli- process complex patterns by passing infor- San Francisco, reconstructed entire sen-
gible to human listeners. mation through layers of computational tences from brain activity captured from
None of the efforts, described in papers in “nodes.” The networks learn by adjusting speech and motor areas while three epi-
recent months on the preprint server bioRxiv, connections between nodes. In the experi- lepsy patients read aloud. In an online test,
managed to re-create speech that 166 people heard one of the sen-
people had merely imagined. In- tences and had to select it from
stead, the researchers monitored among 10 written choices. Some
parts of the brain as people ei- sentences were correctly identi-
ther read aloud, silently mouthed fied more than 80% of the time.
speech, or listened to recordings. The researchers also pushed the
But showing the reconstructed model further: They used it to
speech is understandable is “defi- re-create sentences from data
nitely exciting,” says Stephanie recorded while people silently
Martin, a neural engineer at the mouthed words. That’s an impor-
University of Geneva in Switzer- tant result, Herff says—“one step
land who was not involved in the closer to the speech prosthesis
new projects. that we all have in mind.”
People who have lost the abil- However, “What we’re really
ity to speak after a stroke or waiting for is how [these meth-
disease can use their eyes or ods] are going to do when the pa-
make other small movements tients can’t speak,” says Stephanie
to control a cursor or select Riès, a neuroscientist at San Diego
on-screen letters. (Cosmologist Epilepsy patients with electrode implants have aided efforts to decipher speech. State University in California who
Stephen Hawking tensed his studies language production. The
cheek to trigger a switch mounted on his ments, networks were exposed to recordings brain signals when a person silently “speaks”
glasses.) But if a brain-computer interface of speech that a person produced or heard or “hears” their voice in their head aren’t
could re-create their speech directly, they and data on simultaneous brain activity. identical to signals of speech or hearing.
might regain much more: control over tone Mesgarani’s team relied on data from five Without external sound to match to brain ac-
and inflection, for example, or the ability to people with epilepsy. Their network analyzed tivity, it may be hard for a computer even to
interject in a fast-moving conversation. recordings from the auditory cortex (which sort out where inner speech starts and ends.
The hurdles are high. “We are trying to is active during both speech and listening) Decoding imagined speech will require “a
work out the pattern of … neurons that turn as those patients heard recordings of stories huge jump,” says Gerwin Schalk, a neuro-
on and off at different time points, and infer and people naming digits from zero to nine. engineer at the National Center for Adap-
the speech sound,” says Nima Mesgarani, a The computer then reconstructed spoken tive Neurotechnologies at the New York
computer scientist at Columbia University. numbers from neural data alone; when the State Department of Health in Albany. “It’s
“The mapping from one to the other is not computer “spoke” the numbers, a group of really unclear how to do that at all.”
very straightforward.” How these signals listeners named them with 75% accuracy. One approach, Herff says, might be to give
translate to speech sounds varies from per- Another team, led by neuroscientists feedback to the user of the brain-computer
PHOTO: WENHT/ISTOCK.COM

son to person, so computer models must Miguel Angrick of the University of Bremen interface: If they can hear the computer’s
be “trained” on each individual. And the in Germany and Christian Herff at Maas- speech interpretation in real time, they may
models do best with extremely precise data, tricht University in the Netherlands, relied be able to adjust their thoughts to get the
which requires opening the skull. on data from six people undergoing brain result they want. With enough training of
Researchers can do such invasive record- tumor surgery. A microphone captured both users and neural networks, brain and
ing only in rare cases. One is during the their voices as they read single-syllable computer might meet in the middle. j

14 4 JANUARY 2019 • VOL 363 ISSUE 6422 sciencemag.org SCIENCE

Published by AAAS
ECOLOGY

Downloaded from http://science.sciencemag.org/ on January 3, 2019


Sunflowers are among a number of plants that appear

Do plants favor their kin? to recognize and help kin.

the plants grown with kin put out more


Once considered outlandish, the idea that plants help their flowers, making them more alluring to pol-
linators. The floral displays were especially
relatives is taking root big in plants in the most crowded pots of rel-
atives, Torices and his colleagues reported
By Elizabeth Pennisi better, a finding that suggested family ties on 22 May 2018 in Nature Communications.
can be exploited to improve crop yields. “It Torices, now at King Juan Carlos Univer-

F
or people, and many other animals, seems anytime anyone looks for it, they find sity in Madrid, calls the kin effects “altruis-
family matters. Consider how many a kin effect,” says André Kessler, a chemical tic” because each individual plant gives up
jobs go to relatives. Or how an ant will ecologist at Cornell University. some of its ultimate seedmaking potential
ruthlessly attack intruder ants but res- From termites to people, kin-specific be- to expend more energy making flowers. In
cue injured, closely related nestmates. haviors have evolved over and over in ani- the end, he suspects, more seeds are fertil-
There are good evolutionary reasons mals, showing there is a strong advantage ized overall in the closely related pots.
to aid relatives, after all. Now, it seems, fam- to helping relatives pass on shared genes. Doubts linger. Is a plant identifying genetic
ily feelings may stir in plants as well. Dudley reasoned that the same evolutionary kin, or simply recognizing that its neighbor is
A Canadian biologist planted the seed of forces should apply to plants. Not long after more or less similar to itself? “I do not think
the idea more than a decade ago, but many researchers proved that plants can distin- that there has been convincing evidence for
plant biologists regarded it as heretical— guish “self” from “nonself” roots, she tested kin recognition in plants yet,” says Hélène
plants lack the nervous systems that enable whether they could also pick out and favor Fréville, a population biologist studying crops
animals to recognize kin, so how can they kin. She grew American searocket (Cakile at the Montepellier outpost of the French Na-
know their relatives? But with a series of edentula), a succulent found on North tional Institute for Agricultural Research.
recent findings, the notion that plants re- American beaches, in pots with relatives or Sagebrush bushes (Artemisia tridentata)
ally do care for their most genetically close with unrelated plants from the same popu- have provided some strong clues, however.
peers—in a quiet, plant-y way—is taking lation. With strangers, the searocket greatly When injured by herbivores, these plants
root. Some species constrain how far their expanded its underground root system, but release volatile chemicals that stimulate
roots spread, others change how many flow- with relatives, it held these competitive urges neighboring sagebrush to make chemicals
ers they produce, and a few tilt or shift their in check, presumably leaving more room for toxic to their shared enemies. Ecologist
leaves to minimize shading of neighboring kin roots get nutrients and water. The claim, Richard Karban at the University of Califor-
plants, favoring related individuals. published in 2007, shocked colleagues. A few nia, Davis, wondered whether kin were pref-
“We need to recognize that plants not sharply criticized the work, citing flawed sta- erentially warned. His group had already
only sense whether it’s light or dark or if tistics and bad study design. found that sagebrush plants roughly fall into
they’ve been touched, but also whom they Since then, however, other research- two “chemotypes,” which mainly emit ei-
PHOTO: RON STEINER/ALAMY STOCK PHOTO

are interacting with,” says Susan Dudley, a ers have confirmed her findings. Recently, ther camphor or another organic compound
plant evolutionary ecologist at McMaster working with Moricandia moricandioides, called thujone when their leaves are dam-
University in Hamilton, Canada, whose a Spanish herb, Rubén Torices and his col- aged. The team showed that the chemotypes
early plant kin recognition studies sparked leagues at the University of Lausanne in are heritable, making them a potential kin
the interest of many scientists. Switzerland and the Spanish National Re- recognition signal. In 2014, the researchers
Beyond broadening views of plant be- search Council demonstrated cooperation reported that when volatiles from a plant
havior, the new work may have a practical in flowering. After growing 770 seedlings in of one chemotype were applied to the same
side. In September 2018, a team in China pots either alone or with three or six neigh- type of plant, those plants mounted stronger
reported that rice planted with kin grows bors of varying relatedness, the team found antiherbivore defenses and had much less

SCIENCE sciencemag.org 4 JANUARY 2019 • VOL 363 ISSUE 6422 15


Published by AAAS
NEWS | I N D E P T H

insect damage than when the volatiles were yields. His lab studies rice varieties that give PLANETARY SCIENCE
applied to a plant of the other chemotype—a off weed-killing chemicals in their roots.
hint of a kin effect.
The mustard Arabidopsis thaliana has
provided another clue. About 8 years ago,
Right now, they don’t have high enough
yields to replace commonly grown variet-
ies that require herbicides. But in 3-year-
Asteroid
Jorge Casal, a plant biologist at the Univer-
sity of Buenos Aires, noticed that Arabidopsis
long field tests, kin-recognizing versions of
these self-protective rice varieties produced mission faces
‘breathtaking’
plants growing next to relatives shift the ar- a 5% increase in yield when grown with kin,
rangement of their leaves to reduce shading rather than unrelated plants, Kong and col-
of their neighbors, but don’t do that when the leagues reported in late September 2018 in
neighbors are unrelated. How they sense the
presence of relatives was a mystery, however.
The plants do have light sensors, and
New Phytologist. To test the approach on a
larger scale, he and his colleagues are plant-
ing “kin” seedlings of the weed-killing strain
touchdown
in 2015, Casal’s team discovered that the together in paddy fields in South China. As first data roll in from
strength of reflected light striking nearby Brian Pickles, an ecologist at the Uni-
leaves signaled relatedness and triggered versity of Reading in the United Kingdom, Hayabusa2, engineers plan
the rearrangements. Relatives tend to proposes that kin recognition could even descent to rocky surface
sprout leaves at the same height, bouncing help forests regenerate. By tracing flows
more light onto each other’s leaves. By shift- of nutrients and chemical signals between
ing leaves to reduce how much they shade trees connected by underground fungi, he By Dennis Normile, in Yonago, Japan

Downloaded from http://science.sciencemag.org/ on January 3, 2019


J
apan’s Hayabusa mission made his-
tory in 2010 for bringing back to Earth
the first samples ever collected on
an asteroid. But the 7-year, 4-billion-
kilometer odyssey was marked by
degraded solar panels, innumerable
mechanical failures, and a fuel explosion that
knocked the spacecraft into a tumble and
cut communications with ground control for
2 months. When planning its encore, Haya-
busa2, Japan’s scientists and engineers were
determined to avoid such drama. They made
components more robust, enhanced commu-
nications capabilities, and thoroughly tested
new technologies.
But the target asteroid, Ryugu, had fresh
surprises in store. “By looking at the details
of every asteroid ever studied, we had ex-
Initially disbelieved, Susan Dudley’s work on plant kin recognition is winning over more biologists. pected to find at least some wide flat area
suitable for a landing,” says Yuichi Tsuda,
each other, the relatives cumulatively grow showed that the firs preferentially feed Hayabusa2’s project manager at the Japan
more vigorously and produce more seeds, their kin and warn them about insect at- Aerospace Exploration Agency’s Institute
his team found. “There is no other case of tacks. The finding suggested a family of firs of Space and Astronautical Science (ISAS),
kin recognition in plants where the cue, would grow faster than unrelated trees. which is headquartered in Sagamihara. In-
the receptors, and the fitness consequences To some biologists, the emerging picture stead, when the spacecraft reached Ryugu
have been established,” Casal says. of communicating, cooperating plants is in June 2018—at 290 million kilometers
Since then, he has shown that when sun- still based on thin evidence. Laurent Keller, from Earth—it found a cragged, cratered,
flower kin are planted close together, they, an evolutionary biologist at the University boulder-strewn surface that makes land-
too, arrange themselves to stay out of one of Lausanne who has shown that some ap- ing a daunting challenge. The first sam-
another’s way. The sunflowers incline their parent signs of kin recognition in Arabidop- pling touchdown, scheduled for October,
shoots alternately toward one side of the sis can instead stem from innate differences was postponed until at least the end of this
row or the other, Casal and his colleagues among the plants, calls for more rigor in month, and at a symposium here on 21 and
reported in 2017 in the Proceedings of the studies. “People have started to realize that 22 December, ISAS engineers presented an
National Academy of Sciences. Taking ad- it is important to think carefully about the audacious new plan to make a pinpoint
vantage of the effect, they planted 10 to design of the experiment to rule out other landing between closely spaced boulders.
14 related plants per square meter—an un- potential explanations,” he says. “It’s breathtaking,” says Bruce Damer, an
heard of density for commercial growers— Keller is keeping an open mind and pre- origins of life researcher at the University of
and got up to 47% more oil from plants that dicts stronger evidence of plant kin rec- California, Santa Cruz.
were allowed to lean away from each other ognition will emerge. Karban is already Yet most everything else has gone accord-
PHOTO: TASMIN CHU

than plants forced to grow straight up. convinced. “We are learning that plants are ing to plan since Hayabusa2 was launched
Chui-Hua Kong, a chemical ecologist at capable of so much more sophisticated be- in December 2014. Its cameras and detec-
the China Agricultural University in Beijing, havior than we had thought,” he says. “It’s tors have already provided clues to the
is exploiting a similar effect to boost rice really cool stuff.” j asteroid’s mass, density, and mineral and

16 4 JANUARY 2019 • VOL 363 ISSUE 6422 sciencemag.org SCIENCE

Published by AAAS
elemental composition, and three rovers to conduct comparative studies of these two studies that can reveal much more about
dropped on the asteroid have examined asteroid brothers,” Watanabe says. the asteroid’s age and content. ISAS engi-
the surface. At the symposium, ISAS re- Geologist Stephen Mojzsis of the Univer- neers programmed the craft to perform
searchers presented early results, including sity of Colorado in Boulder is not convinced autonomous landings, anticipating safe
evidence of an abundance of organic ma- such asteroids will prove to be the source of touchdown zones at least 100 meters in di-
terial and hints that the asteroid’s parent Earth’s water; there are other theories, he ameter. Instead, the biggest safe area within
body once held water. Those findings “add says, including the possibility that a giant the first landing zone turned out to be just
to the evidence that asteroids rather than Jupiter-like gaseous planet migrated from 12 meters wide.
comets brought water and organic materi- the outer to the inner solar system, bringing That will complicate what was already a
als to Earth,” says project scientist Seiichiro water and other molecules with it around nail-biting operation. Prior to each landing,
Watanabe of Nagoya University in Japan. the time Earth was formed. Still, findings Hayabusa2 planned to drop a small sphere
Ryugu is 1 kilometer across and 900 me- on Ryugu’s shape and composition “scien- sheathed in a highly reflective material to be
ters top to bottom, with a notable bulge tifically, could be very important,” he says. used as a target, to ensure the craft is mov-
around the equator, like a diamond. ing in sync with the asteroid’s rotation.
Visible light observations and com- Gravity then pulls the craft down gen-
puter modeling suggest it’s a porous tly until a collection horn extending
pile of rubble that likely agglomerated from its underside makes contact with
dust, rocks, and boulders after another the asteroid; after a bulletlike projec-
asteroid or planetesimal slammed tile is fired into the surface, soil and
into its parent body during the early rock fragments hopefully ricochet into

Downloaded from http://science.sciencemag.org/ on January 3, 2019


days of the solar system. Ryugu a catcher within the horn. For safety,
spins around its own axis once every the craft has to steer clear of rocks
7.6 hours, but simulations suggest that larger than 70 centimeters.
during the early phase of its forma- During a rehearsal in late October,
tion, it had a rotation period of only Hayabusa2 released a target marker
3.5 hours. That probably produced the above the 12-meter safe circle; unfor-
bulge, by causing surface landslides tunately, it came to rest more than
or pushing material outward from the 10 meters outside the zone. But it is
core, Watanabe says. Analyzing surface just 2.9 meters away from the edge of
material from the equator in an Earth- a second possible landing site that’s
based laboratory could offer support 6 meters in diameter. Engineers now
for one of those scenarios, he adds. If plan to have the craft first hover above
the sample has been exposed to space the target marker and then move lat-
weathering for a long time, it was erally to be above the center of one
likely moved there by landslides; if it of the two sites. Because the naviga-
is relatively fresh, it probably migrated tion camera points straight down,
from the asteroid’s interior. the target marker will be outside the
So far, Hayabusa2 has not detected camera’s field of view as Hayabusa2
water on or near Ryugu’s surface. But descends, leaving the craft to navigate
its infrared spectrometer has found on its own.
signs of hydroxide-bearing minerals “We are now in the process of se-
that suggest water once existed either lecting which landing site” to aim for,
PHOTOS: (TOP TO BOTTOM) JAXA; JAXA, UNIVERSITY OF TOKYO, KOCHI UNIVERSITY, RIKKYO UNIVERSITY,
NAGOYA UNIVERSITY, CHIBA INSTITUTE OF TECHNOLOGY, MEIJI UNIVERSITY, UNIVERSITY OF AIZU, AIST

on the parent body or on the asteroid, says Fuyuto Terui, who is in charge
says Mutsumi Komatsu, a planetary ma- of mission guidance, navigation, and
1m
terials scientist at the Graduate Univer- control. Aiming at the smaller zone
sity for Advanced Studies in Hayama, means Hayabusa2 can keep the target
Japan. The asteroid’s high porosity also Hayabusa2 imaged its shadow during a rehearsal descent (top). A marker in sight until the craft is close
suggests it once harbored significant close-up shows a surface strewn with boulders (bottom). to the surface; the bigger zone gives
amounts of water or ice and other vola- more leeway for error, but the craft
tile compounds that later escaped, Watanabe Some new details come from up-close will lose its view of the marker earlier in
says. Asteroids such as Ryugu are rich in car- looks at the asteroid’s surface. On 21 Sep- the descent.
bon as well, and they may have been respon- tember, Hayabusa2 dropped a pair of rovers Assuming the craft survives the first
sible for bringing both water and carbon, the size of a birthday cake, named Minerva- landing, plans call for Hayabusa2 to blast a
life’s key building block, to a rocky Earth II1A and -II1B, on Ryugu’s northern hemi- 2-meter-deep crater into Ryugu’s surface at
early in its history. (Comets, by contrast, are sphere. Taking advantage of its low gravity another site a few months later, by hitting it
just 3% to 5% carbon.) to hop autonomously, they take pictures with a 2-kilogram, copper projectile. This is
Support for that theory, known as the late that have revealed “microscopic features of expected to expose subsurface material for
heavy bombardment, comes from another the surface,” Tsuda says. And on 5 October, observations by the craft’s cameras and sen-
asteroid sample return mission now in Hayabusa2 released a rover developed by sors; the spacecraft may collect some mate-
progress. Early last month, NASA’s OSIRIS- the German and French space agencies that rial from the crater as well, using the same
REx reached asteroid Bennu, which is analyzed soil samples in situ and returned horn device. There could be a third touch-
shaped like a spinning top as well and, the additional pictures. down, elsewhere on the asteroid. If all goes
U.S. space agency has reported, has water The ultimate objective, to bring aster- well, Hayabusa2 will make it back to Earth
trapped in the soil. “We’re lucky to be able oid samples back to Earth, will allow lab with its treasures in 2020. j

SCIENCE sciencemag.org 4 JANUARY 2019 • VOL 363 ISSUE 6422 17


Published by AAAS
FEATURES

BIOLOGY
IN THE BANK
How an open-access trove of
data on Britons is unlocking

Downloaded from http://science.sciencemag.org/ on January 3, 2019


the genetics of disease,
behavior, and physical traits
By Jocelyn Kaiser and Ann Gibbons

I
n early 2017, epidemiologist Rory the encrypted files. Then, on 19 July 2017, long-running controversies about the ap-
Collins at the University of Oxford in they released a final encryption key, firing plication of genetics to behavior in people.
the United Kingdom and his team the starting gun for a scientific race. When the Manchester-based UKB en-
faced a test of their principles. They Within a couple of days, one U.S. group rolled its first volunteer 13 years ago, some
run the UK Biobank (UKB), a huge had done quick analyses linking more than critics wondered whether it would be a
research project probing the health 120,000 genetic markers to more than waste of time and money. But by now, any
and genetics of 500,000 British peo- 2000 diseases and traits, data it eventu- skepticism is long gone. “It’s now clear
ple. They were planning their most ally put up on a blog. Only 60,000 markers that it has been a massive success—largely
sought-after data release yet: genetic had previously been tied to disease, says because the big data they have are being
profiles for all half-million participants. human geneticist Eric Lander, president made widely available,” says Oxford de-
Three hundred research groups had signed and director of the Broad Institute in Cam- velopmental neuropsychologist Dorothy
up to download 8 terabytes of data—the bridge, Massachusetts. “[They] doubled Bishop, a participant. Other biobanks are
equivalent of more than 5000 streamed that in a week.” bigger or collect equally detailed health
movies. That’s enough to tie up a home Within 2 weeks, others had begun to data. But the UKB has both large numbers
computer for weeks, threatening a key goal post draft manuscripts on the bioRxiv pre- of participants and high-quality clinical
of the UKB: to give equal access to any print site. By now, those data have spawned information. It “allows us to do research
qualified researcher in the world. dozens of papers in journals or on bioRxiv, on a scale that we’ve never been able to do
“We wanted to create a level playing firming up how particular genes contrib- before,” says Peter Visscher, a quantitative
field” so that someone at a big center with ute to heart disease, diabetes, Alzheimer’s, geneticist at the University of Queensland
a supercomputer was at no more of an ad- and other conditions, as well as genes’ role in Brisbane, Australia.
vantage than a postdoc in Scotland with a in shaping personality, depression, birth The crucial ingredient, however, may be
PHOTO: NIGEL HILIER

smaller computer and slower internet link, weight, insomnia, and other traits. More open access. Researchers around the world
says Oxford’s Naomi Allen, the project’s chief controversially, data from the trove also can freely delve into the UKB data and rap-
epidemiologist. They came up with a plan: pointed to DNA markers linked to educa- idly build on one another’s work, resulting
They gave researchers 3 weeks to download tion level and sexual orientation, stoking in unexpected dividends in diverse fields,

18 4 JANUARY 2019 • VOL 363 ISSUE 6422 sciencemag.org SCIENCE

Published by AAAS
NEWS

diet and smoking with the development of In 2015, his team released the first batch
disease over time. The model was the famous of genetic data on a subset of 150,000 par-
Framingham Heart Study, a long-term study ticipants. Then came the July 2017 release
that initially analyzed 5200 residents of of full genotyping data for all 500,000. Two
Framingham, Massachusetts, seeking factors months later, Benjamin Neale’s group at the
that influence heart disease. The UKB proj- Broad Institute put up its blog doubling the
ect, which has received $308 million in fund- number of markers linked to traits and dis-
ing so far from the Wellcome Trust medical orders, as well as a web browser for looking
charity, the U.K. government, and disease up specific markers. “We viewed it as a ser-
foundations, “was going to be like Framing- vice to the community,” Neale says.
ham, only 100 times bigger,” says principal
investigator Collins. TODAY, about 7000 researchers have reg-
From 2006 to 2010, the UKB enrolled istered to use UKB data on 1400 projects,
500,000 people aged 40 to 69 through the and nearly 600 papers have been published.
United Kingdom’s National Health Service. Some studies simply link behaviors and dis-
Mailed invitations were sent widely, includ- ease, for example reporting that drinking
ing to people in poor and ethnically diverse more coffee can reduce mortality but that
areas of cities such as Birmingham. But in
the end, participants were “anybody you
could persuade,” Collins says. Investigators Engine of productivity

Downloaded from http://science.sciencemag.org/ on January 3, 2019


sampled their blood and urine, surveyed Published papers based on the UK Biobank’s bounty
their habits, and examined them for more of health and genetics data are piling up fast, in part
than 2400 different traits or phenotypes, in- because the data are freely available.
cluding data on their social lives, cognitive
state, lifestyle, and physical health.
250
The blood samples yielded DNA for ge-
nomic analyses. Links to other U.K. data-
bases added information such as cancer 200
diagnoses, deaths, and hospitalizations. “If
you’re talking about common phenotypes, 150
the Biobank shines,” Lander says. “There’s
arm fat, smoking behavior, miserableness, 100
neurotic behavior, time on your computer,
UK Biobank Principal Investigator eating behavior, drinking behavior.”
50
Rory Collins stands amid Other biobanks have comparably rich
stored biospecimens from the health data, such as deCODE Genetics’s de-
project’s half-million participants. tailed database on Iceland’s population and 0
biobanks run by U.S. health care provid- 2013 2014 2015 2016 2017 2018
ers. Some, such as the U.S. Million Veteran
such as human evolution (see story, p. 21). Program and the DNA testing company binge-watching TV is associated with more
In a crowdsourcing spirit rare in the hyper- 23andMe, are bigger. But in most cases re- colon cancer. But most studies compare the
competitive world of biomedical research, searchers can use these databases only by genomes of people with some trait or dis-
groups even post tools for using the data collaborating with their creators. ease with those without it, in order to home
without first seeking credit by publishing In contrast, the Wellcome Trust and U.K. in on genes that influence that attribute;
in a journal. Medical Research Council insisted that any these projects are known as genome-wide
“The U.K. is getting all of the world’s researcher approved by the UKB board, association studies.
best brains” to study its citizens, says anywhere in the world, be able to download The result, every few days, is a new pa-
Ewan Birney, director of the EMBL Euro- anonymized data sets on all 500,000 par- per using UKB data to link particular gene
pean Bioinformatics Institute in Hinxton, ticipants. (Users pay a relatively modest fee variants to a disease or trait—arthritis, type
U.K., and a member of the UKB’s steering of $2500 and agree to return their raw data, 2 diabetes, depression, neuroticism, heart
committee. The U.K. focus is also the proj- results, and code to the UKB after publish- disease. “It’s so easy for people who don’t
CREDITS: (GRAPHIC) N. DESAI/SCIENCE; (DATA) UK BIOBANK

ect’s chief downside, as it explores just one ing. They also sign a legal agreement not to collect their own data,” says statistical genet-
slice of humanity: northern Europeans. It try to reidentify any participant.) icist Danielle Posthuma of Vrije University in
holds data for only about 20,000 people “It was a novel concept,” says Collins, who Amsterdam, who studies brain diseases. By
of African or Asian descent, for example. says he’s lost track of the times someone has combining data from the UKB and other col-
Yet as new papers appear every few days, asked him after a talk whether he’s inter- lections, investigators can amass samples of
researchers say the UKB remains a shin- ested in collaborating. “I have to say, ‘You a million people or more, amplifying the sig-
ing example of the power of curiosity un- just request the data.’ To some extent people nal of gene variants with subtle effects. For
leashed. “It’s the thing we always dreamed don’t believe it.” some diseases, dozens or hundreds of genes
of,” Lander says. The aim is to maximize the scientific pay- appear to play a role. The genetic links are
off: “By making data available to 100 people suggestive correlations; establishing cause
THE UKB WAS ANNOUNCED in the early 2000s around the world, we can get a lot more re- and effect will take more genetics work and
as a classical epidemiological study—the search done than if I sit here and do one lab studies, which could reveal new disease
kind used to associate risk factors such as study a year with the data,” he says. pathways that might be drug targets.

SCIENCE sciencemag.org 4 JANUARY 2019 • VOL 363 ISSUE 6422 19


Published by AAAS
NEWS | F E AT U R E S

In the near term, the large sample sizes THE UKB’S UNUSUAL DESIGN does have some enrolled 33,000 Britons of Bangladeshi
are boosting the power of “polygenic” risk limitations. The big one: Ninety-four per- and Pakistani ancestry. In his experience,
scores, which calculate a person’s disease risk cent of participants are white. “It’s really South Asians in the United Kingdom are
by combining many genetic markers. For ex- good if you’re British or European,” Lander less likely to respond to mailed invitations.
ample, one study published in August 2018 says. But, “If you’re an American without His project achieved success by approach-
in Nature Genetics drew on the July 2017 European ancestry or an African or Asian, ing potential participants in person—
data to devise risk scores for five diseases, in- you’re going to be poorly serviced by the sometimes in their native language—in
cluding breast cancer and heart disease. The new polygenic risk scores.” Nor will scores “trusted” settings such as health clinics
authors, at Massachusetts General Hospital for traits such as educational attain- and community centers.
in Boston and the Broad Institute, found that ment be meaningful in people with non- Collins and other geneticists hope other
a surprisingly high 8% of people of European European ancestry. biobanks can help fill the gap. For exam-
descent have at least a threefold elevated risk The mailed invitation recruitment strat- ple, the Wellcome Trust is now the main
for heart disease. And up to 6% have a three- egy didn’t work as well as hoped, says funder of the China Kadoorie Biobank,
fold increase in risk for one of the four other Collins, who notes that young, low-income, with data on 515,000 people from main-
diseases, suggesting they should be screened white men are also scarce in the database. land China, belonging to 10 ethnic groups.
early and consider lifestyle changes or other “We were aiming to get heterogeneity, but In the United States, the All of Us biobank
measures that could improve their odds. it’s difficult.” funded by the National Institutes of Health
The most provocative studies have probed Bishop blames the project’s slant toward (NIH) aims to use community outreach to
for genetic influences on human behavior. higher income, healthy, white people on help enroll at least half of its 1 million par-
ticipants from minority groups, and like

Downloaded from http://science.sciencemag.org/ on January 3, 2019


the UKB, promises to make data freely
Long-term investment available. The Human Heredity & Health
Nearly 2 decades after U.K. funding organizations proposed a large, long-term health study, the database is in Africa initiative has 70,000 participants
paying off richly; its timeline is punctuated by massive, open-access data releases. Meanwhile, participants age so far across the continent, with funding
and develop diseases, adding power and momentum to the project. from NIH and the Wellcome Trust. “There
are ways of fixing this up. But we’ve got a
March 2000 October 2015 July 2017 March 2019 long ways to go,” Birney says.
Expert panel proposes cohort Imaging data Genotyping Exome data on 50,000 Meanwhile, the UKB’s riches are grow-
study of 500,000 adults. available for 5000. data on to be released. ing. About half of the participants’ pri-
500,000
April 2002 March 2012 May 2015 released. 2020 mary care data, including clinical data
Wellcome Trust and U.K. UK Biobank Genotyping data on All exome and prescriptions, will become available
government announce initial resource 150,000 released. data released.
funding of £45 million. launches. next spring. The UKB has also done MRI
scans of the brains, hearts, and abdomens
of 25,000 participants, with plans to scan
100,000; researchers are examining and
2000 2002 2004 2006 2008 2010 2012 2014 2016 2018 2020
annotating the images.
Collins has been promoting the UKB’s sci-
Recruitment of participants entific treasure in Silicon Valley in Califor-
nia, where he hopes bioinformatics experts
One, published in Nature Genetics in July a lack of incentives for participants—they will dig in and come up with unexpected
2018, drew on the UKB and 23andMe to pin don’t get even a small payment or the findings. The genetic data are ballooning,
down genetic contributions to a person’s promise of receiving their test results. The too: Several companies are now sequenc-
level of education. Together, 1300 genetic people attracted to the project were those ing the exomes, or protein-coding regions,
markers accounted for 11% of the variability with enough spare time to participate or of all UKB participants, and the United
among individuals, the researchers found. “who [wanted] to help research,” she says. Kingdom’s public Sanger Institute is se-
That’s comparable to certain environmental One problem is that many immigrants quencing whole genomes from 50,000 vol-
influences in the UKB sample, such as fam- to the United Kingdom have little experi- unteers. Unlike the genotyping data, which
ily income, which predicted just 7% of the ence with the research world, says Naveed don’t usually point to specific genes, the
variance in educational attainment among Sattar, an adviser to the UKB and a clinical sequences will allow researchers who have
participants; and mother’s education level, researcher and epidemiologist at the Uni- found a genetic marker linked to a disease
which predicted 15%. Another study pre- versity of Glasgow. “Most first generation to quickly zero in on the causative gene and
sented at a meeting last fall found four ge- Asians simply have no prior experience see the specific mutations at work.
netic markers that appear to have a strong of what research is and that it may help Because of the $150 million cost of this
influence on whether a person has had sex their community and their children in the sequencing work, the UKB had to compro-
with someone of their own sex at least once future,” he says. Surveys have found that mise on open access: Companies have 9 to
(Science, 26 October 2018, p. 385). immigrants are often suspicious of par- 12 months to use the exome data before
Such studies are raising concerns that ticipating in research—perhaps because of they are made widely available. But Collins
genetic tests could be used to screen em- unethical past studies in some countries, and his team, as well as geneticists around
GRAPHIC: N. DESAI/SCIENCE

bryos for desired traits or discriminate or concern that genetic findings could be the world, are already gearing up for the
against individuals with certain genetic used to discriminate. wide release of the first batch of exome
profiles. That would be a misuse of the Engaging such groups is possible, says data on 50,000 participants. Again, they’ll
findings, say the researchers who identi- geneticist David Van Heel of Queen Mary allow time for the download, then release a
fied these links. They stress that the prob- University of London, who heads the code. The starting gun in the next scientific
abilities mean little on the individual level. Genes & Health study, which so far has race is set for March. j

20 4 JANUARY 2019 • VOL 363 ISSUE 6422 sciencemag.org SCIENCE

Published by AAAS
SPOTTING EVOLUTION

AMONG US
The half-million people in the UK Biobank hold the genetic legacy
of Neanderthals—and clues to how we are still evolving
By Ann Gibbons

Downloaded from http://science.sciencemag.org/ on January 3, 2019

N
eanderthals are still among us, get their rubber-gloved hands on enough Among participants in the UK Biobank are people
Janet Kelso realized 8 years ago. people’s genomes to detect the relatively whose Neanderthal DNA predisposes them to traits
She had helped make the momen- rare bits of Neanderthal DNA, much less such as propensity to sunburn, staying up late,
tous discovery that Neanderthals to see whether or how our extinct cousins’ depression, smoking, and feeling lonely.
repeatedly mated with the ances- genetic legacy might influence disease or
tors of modern humans—a find- physical traits. could actually look and say: ‘We see a Ne-
ing that implies people outside of But a few years ago, Kelso and her col- anderthal version of the gene and we can
Africa still carry Neanderthal DNA leagues at the Max Planck Institute for measure its effect on phenotype in many
today. Ever since then, Kelso has Evolutionary Anthropology in Leipzig, people—how often they get sunburned,
ILLUSTRATION: PETER ARKLE

wondered exactly what modern humans Germany, turned to a new tool—the UK what color their hair is, and what color
got from those prehistoric liaisons—beyond Biobank (UKB), a large database that their eyes are,’” Kelso says. They found
babies. How do traces of the Neanderthal holds genetic and health records for half Neanderthal variants that boost the odds
within shape the appearance, health, or per- a million British volunteers (see story, that a person smokes, is an evening person
sonalities of living people? p. 18). The researchers analyzed data from rather than a morning person, and is prone
For years, evolutionary biologists couldn’t 112,338 of those Britons—enough that “we to sunburn and depression.

SCIENCE sciencemag.org 4 JANUARY 2019 • VOL 363 ISSUE 6422 21


Published by AAAS
NEWS | F E AT U R E S

Kelso is one of many researchers who are used proprietary electronic records of 28,000 psychiatric and lifestyle traits.” Those rich
turning troves of genetic and medical data on Americans. His team was the first to publish, data have also made the UKB a hunting
living people into windows on human evolu- reporting Neanderthal DNA variants that ground for clues to evolutionary changes
tion. In addition to unearthing archaic DNA, raise the risk of depression, skin lesions, that have shaped people’s genomes in the
the studies are pinpointing genes that natu- blood clots, and other disorders in people past few generations—and may even be do-
ral selection may now be winnowing out of today (Science, 12 February 2016, p. 648). In- ing so today.
the gene pool and other genes—for example spired by Capra’s study, Kelso jumped in, be-
those linked to fertility—that it may be fa- coming the first to use UKB data to publish A FEW YEARS AGO, Molly Przeworski of Co-
voring. Among the most fruitful of the data Neanderthal gene variants in living people. lumbia University and Joe Pickrell of the
sources is the UKB, which makes its data ac- Her results suggest that although some Ne- New York Genome Center in New York City
cessible to researchers, no matter where they anderthal gene variants may have been op- met for lunch near Columbia’s campus. Talk
are and what their field. Its giant database timal for active lives outdoors in prehistoric turned to aging and Alzheimer’s disease.
is “a magical new resource that [will] help Europe, they may be problematic for people Pickrell had been writing a blog, where he
us answer a whole bunch of hard questions now, who live mostly indoors in artificial had discussed studies showing that between
we’re struggling with now because all of the light and get less exercise. the ages of 70 and 85, carriers of the ApoE4
data has been under lock and key,” says allele, which boosts the risk of Al-
population geneticist Jeremy Berg, a zheimer’s and cardiovascular disease,
postdoc at Columbia University. “It is a died at about twice the rate of non-
step beyond other databases.” carriers. The pair wondered whether
For the UKB architects, who designed other gene variants affect survival so

Downloaded from http://science.sciencemag.org/ on January 3, 2019


it for biomedical research, the evolu- dramatically—and whether natural
tionary discoveries are an unexpected selection is weeding them out.
bonus. “No one was thinking about When it comes to natural selection
Neanderthal traits when we designed in humans, most studies have only
the protocol,” says molecular epidemio- been able to detect dramatic cases
logist Rory Collins of the University of thousands or millions of years ago
Oxford in the United Kingdom, who is in genes of known function. Now,
principal investigator of the UKB. “The Pickrell and Przeworski wondered
experiment [is] working well beyond whether they could detect genetic vari-
people’s expectations.” ants that affect survival today—and
whether natural selection in recent gen-
NEANDERTHALS SNEAKED INTO the UKB erations has been weeding out harmful
in 2013, when Harvard University pop- ones or favoring beneficial ones.
ulation geneticist David Reich was in To do this, they realized they’d need
Oxford to give a talk. His host, Oxford data on DNA as well as on traits like
geneticist Peter Donnelly, was oversee- participants’ age at death. For statis-
ing the design of chips to identify genes tical confidence, they’d need a giant
of interest in blood samples like those sample size—at least 100,000—to de-
in the UKB. Donnelly asked Reich tect how the frequency of common al-
whether he’d like to add Neanderthal Janet Kelso fshed for Neanderthal gene variants in the UK Biobank. leles varied in people of different ages.
variants to a custom chip used to geno- Databases like the UKB were the an-
type the UKB participants; that would allow Groups led by Kelso and Sankararaman swer. “We suddenly realized that the some of
Reich and others to fish for rare Neanderthal are now looking for links between Nean- these databases were large enough to let us
variants in half a million people. “David was derthal DNA and traits in genotyped data study selection in contemporary humans,”
very enthusiastic,” Donnelly recalls. from 500,000 people—the total UKB data Przeworski says.
Soon after, Reich and his postdoc, Sriram set, which was released in July 2017. Al- They soon got access to genetic and health

PHOTO: RONNY BARR/MAX PLANCK INSTITUTE FOR EVOLUTIONARY ANTHROPOLOGY


Sankararaman, emailed Donnelly a wish list ready, they are learning that Neanderthal data on 57,696 people in the Resource for
of variants to add to the chip: 6000 relatively alleles help cause baldness and mental ill- Genetic Epidemiology Research on Aging
rare alleles likely to come from Neander- ness and boost certain immune functions, database at Kaiser Permanente in Oakland,
thals. Their calculations suggested the UKB Sankararaman says. Meanwhile, another California, and 117,648 individuals in the
was big enough to include enough carriers team has found variants that help explain UKB’s 2015 data release. They sorted partici-
of these variants so researchers could probe why modern humans’ heads are round, in pants into 5-year age intervals, and looked
the function of the genes. “Imagine 1% of the contrast to the elongated, football-like shape at the frequency of many alleles, including
population has a Neanderthal variant,” says of Neanderthal skulls (Science, 14 Decem- ApoE4, in each age group, as well as how the
Sankararaman, now a computational geneti- ber 2018, p. 1229). Those researchers plan variants correlated with 42 traits potentially
cist at the University of California (UC), Los to combine forthcoming MRI brain scans associated with early death or long life, such
Angeles. “If you’re looking at half a million of 100,000 UKB participants with genetic as cardiovascular disease, cholesterol levels,
people, you’re looking at enough copies of data to probe the genetic basis of brain dif- asthma, age at puberty, and menopause.
that variant in enough individuals [5000] so ferences between us and our extinct cousins. Nearly all the variants they examined
you can detect subtle effects.” Capra says when it comes to scanning persisted at the same frequency even into
At the same time, computational bio- and understanding DNA from Neander- old age, suggesting they had no large ef-
logist Tony Capra at Vanderbilt University in thals, the UKB cohort offers even more ana- fect on survival. That implies natural se-
Nashville had the same bright idea to search lytical power than the medical databases he lection has efficiently weeded out harmful
for Neanderthal DNA in a large database. He used, because it covers “a broader range of variants, even if they act only in old age—

22 4 JANUARY 2019 • VOL 363 ISSUE 6422 sciencemag.org SCIENCE

Published by AAAS
perhaps, Przeworski speculates, because traits in women and men that might have in- Using other databases, researchers had
the variants curb older men’s fecundity. fluenced fertility, such as age of first birth, found that the number of genes that con-
Or perhaps the hypothesized benefit that age of menopause, height, weight, body tribute to tallness in Europeans increased
healthy grandmothers confer on grandchil- mass, blood pressure, and education. They on a cline from south to north. Many re-
dren was at work. found 23 traits in women and 21 in men searchers, including Berg, had concluded
The researchers did find two genes that linked to having more children. Not surpris- that northern Europeans had inherited
suddenly became rare at older ages, suggest- ingly, mothers who gave birth early and had those genes from an ancient migration—
ing they were harmful. One was ApoE4: As late menopause—and therefore had a longer that of the Yamnaya herders who migrated
expected, fewer carriers—especially women— reproductive span—were more fertile. So from the Eurasian steppe to central Europe
lived past age 80. Also, fewer men with a vari- were women who were heavier and shorter, about 4000 years ago. Berg and others sug-
ant of the CHRN3 gene that makes it harder perhaps because shorter bodies are more gested natural selection had favored tall-
to quit smoking survived past the age of 75 energy efficient, leaving a bigger reserve for ness in the Yamnaya or their ancestors,
than did men without the variant. pregnancy and nursing. and ancient DNA reveals that the Yamnaya
The researchers concluded that natural Visscher and his colleagues then set out were tall.
selection has not yet had time to eliminate to identify the genetic basis of these fertility- But now, with UKB data, population ge-
these two alleles, perhaps because changes linked traits. They analyzed data from neticist Graham Coop of UC Davis and his
in the environment and human behavior 157,807 of the women and 115,902 of the colleagues, including Berg, are challenging
only recently made them deadly (Science, men. As predicted, they found that the most that finding. In a bioRxiv preprint posted in
20 May 2016, p. 876). For example, the fertile women had higher frequencies of al- June 2018, they analyzed genetic and height
CHRN3 allele wouldn’t have affected sur- leles that tend to make them shorter and data on 500,000 people from the 2017 UKB

Downloaded from http://science.sciencemag.org/ on January 3, 2019


vival until many men were smoking. And heavier. In men, greater fertility was asso- data release. With so many people from
women who were more active in the past ciated with more alleles that contribute to similar backgrounds, the researchers could
might have been less vulnerable to the a higher body mass index and hand-grip identify more height alleles, as well as note
cardiovascular diseases caused by differences in diet, disease, and
ApoE4, Przeworski speculates. the environment. They found that
The researchers spotted another “No one was thinking about Neanderthal northerners had no more tall vari-
intriguing pattern. Genetic variants traits when we designed the protocol.” ants than southerners.
that lead to early puberty also be- “It’s true people in northern
came rarer in older age groups. Nat- Rory Collins, University of Oxford Europe are taller on average, but
ural selection may have preserved there is no evidence this has any-
those variants even though they shorten life strength. That suggests men with genes that thing to do with natural selection,” Berg
span because they also boosted fertility. make them taller and bulkier have more kids says. He speculates that northerners’ height
than sedentary types, whether because of fe- might be an environmental effect, perhaps
A LONG LIFE, though, is much less important male choice, some health-related reason, or from a diet richer in protein, or from fewer
to evolution than fertility. When it comes the men’s own preference. childhood or prenatal illnesses.
to the game of evolution, in fact, the per- Not all traits linked to fertility are physi- Although UKB data cast doubt on natural
son who has the most kids wins by pass- cal or likely to have a big genetic component: selection’s role in that case, they do suggest
ing on the most genes. With the advent of Among women who had their first child later that evolution has favored genes for short-
birth control, people in industrial societies in life, those who had more education and ness in pygmy populations on the island of
have more control than ever over their own did better on an intelligence test had more Flores in Indonesia. Visscher and colleagues
fertility—but new studies zeroing in on the babies. This may be because better-educated scanned the DNA of Flores people for genes
genes underlying fertility show the forces of couples tend to be wealthier and can afford the UKB had linked to short stature. They
selection may still be at work. more children. found that Flores pygmies carry more such
Multiple studies have suggested that when But the fact that genes linked to traits gene variants than their closest relatives in
food sources became more reliable in indus- thought to increase fertility are indeed more New Guinea and East Asia, suggesting evo-
trialized societies, women began to mature common in fertile people backs up the idea lution favored genes for shortness on the
faster, weigh more, give birth to their first of recent selection on our genomes, even as island (Science, 3 August 2018, p. 439). All
child earlier, and enter menopause later—all both the environment and humans’ prefer- these studies have generated “huge buzz
traits possibly linked to having more babies. ences for mates and families are changing. among evolutionary biologists about how
But researchers have been unable to tie those “The UK Biobank allows us to show that nat- biobanks can provide very deep informa-
trends to underlying genes to get direct evi- ural selection not only took place in the past, tion about the genetics of different popula-
dence of natural selection. Quantitative ge- but it’s still ongoing,” Visscher says. tions and their evolution,” Kelso says.
neticist Peter Visscher and his colleagues at She hopes to work with researchers de-
the University of Queensland in Brisbane, TEASING OUT natural selection from other signing databases in Africa and Asia to
Australia, realized they could use the UKB factors shaping genes can be tricky, how- identify archaic DNA in those populations.
to see firsthand which gene variants under- ever, especially when multiple genes work Thanks to the success of the Neanderthal
lie those traits in people today, and whether together to influence complex traits, such work, many researchers are eager for data
they are really linked to fertility. as height. About 5000 gene variants si- from Melanesians, because they have inher-
They searched the UKB’s full cohort for multaneously influence a person’s height, ited traces of DNA from Denisovans—the
people who had the most babies to see what some boosting it, some reducing it, says mysterious cousins of Neanderthals who
traits they share, and what genes correlate Jian Yang, a statistical geneticist at the lived in Siberia more than 50,000 years ago.
with those traits. They documented the University of Queensland. The UKB’s huge “That would be amazing, to get Denisovan
number of live births for women over age database allows researchers to find new DNA from more living people [in biobanks].
45 and men over age 55. Then, they analyzed variants and explore their impact and origins. That’s our dream,” Kelso says. j

SCIENCE sciencemag.org 4 JANUARY 2019 • VOL 363 ISSUE 6422 23


Published by AAAS
INSIGHTS
Be prepared
The greatest challenge during my
transition from a teaching assistant to
an assistant professor in a large public
university was the teaching responsibil-
ity. Whereas teaching assistants focus
only on the subject matter and a small
LET TERS group of students, a professor must select
textbooks, prepare syllabi, coordinate lab-
oratory experiments, teach large classes,
handle teaching assistants, manage the
course website, and accommodate athletes’
schedules and students with disabilities.
By taking courses on teaching, I devel-
oped skills in communication, evaluation
and assessment, education psychology,
academic advising, and student accommo-
dations. For me, preparation was the key
to a smooth transition.

Downloaded from http://science.sciencemag.org/ on January 7, 2019


Niluka D. Wasalathanthri
Department of Chemistry, University of Connecticut,
Storrs, CT 06269, USA.
Email: niluka.wasalathanthri@uconn.edu

Postdocs are expected to perform as expe-


rienced researchers. This can be challenging
given the dependence of Ph.D. students
on their supervisors for scientific ideas
and experimental designs. To excel as a
postdoc, I advise thoroughly reviewing the
literature. Read the relevant papers com-
pletely, especially the methods sections.
This will greatly enhance your ability to
design your own experiment.
Syed Shan-e-Ali Zaidi
Plant Genetics Lab, Gembloux Agro-Bio Tech,
University of Liège, Gembloux, 5030 Namur, Belgium.
Email: shan.e.ali@outlook.com

After juggling my experiments and man-


aging a small lab of 10 members as a
graduate student, I now focus solely on
meeting the needs of a 75-person lab.
Although I work far fewer hours now, I
must work much faster in a shorter time
frame. My excellent mentors and my
management experience eased my transi-
NEXTGEN VOICES
tion. To succeed as a lab manager, I advise
others to get as much regulatory, person-

Challenging transitions
nel management, and ordering experience
as possible.
Elena Mahrt
Center for the Genetics of Host Defense,
We asked young scientists these questions: Have you ever encountered University of Texas Southwestern Medical Center,
Dallas, TX 75390, USA.
a particularly stark diference between an old and new position Email: elena.mahrt@utsouthwestern.edu
in your education or career? What was the diference between the
ILLUSTRATION: ROBERT NEUBECKER

positions, and what advice would you give to someone making As a scientist, I could focus on research,
but my transition to a professor role
a similar transition? Here, respondents share the challenges they faced came with new responsibilities. Instead
when they took on new responsibilities and roles, changed fields, of simply reading a publication to plan
or moved to new places. To others in similar situations, they advise: new experiments, I now read with an eye
toward how to explain the concepts to a
Be confident, prepared, and patient; communicate; and always ask student. A scientist might manage a group
for help when needed. —Jennifer Sills of 5 to 10 researchers, whereas a teacher

24 4 JANUARY 2019 • VOL 363 ISSUE 6422 sciencemag.org SCIENCE

Published by AAAS
manages students ranging from under- and maintaining connections to your Transitioning from a dental school in India
graduates to postdoctoral fellows. As a original field. to a business school in the United States was
scientist, I could remain silent and work Fengbo Li tough. Looking back, I was not adequately
out problems internally. As a teacher, I Zhejiang Academy of Agricultural Sciences, prepared to appreciate the teaching peda-
have to talk constantly, yet remain calm. Hangzhou, Zhejiang 310021, China. gogy in a business school, which was in
Email: fengboli@gmail.com
Sudhakar Srivastava stark contrast to what I had been exposed to
Institute of Environment and Sustainable in dental school. Difficulties adapting to the
Development, Banaras Hindu University, Varanasi, When I transitioned from a master’s degree
Uttar Pradesh 221005, India. surroundings, environment, and culture of
program in Colombia to a Ph.D. program in
Email: sudhakar.srivastava@gmail.com a different country further compounded my
the United Kingdom, I encountered cultural
problems during my first year of graduate
shock and language barriers. To address
The training of a physician focuses on the studies. To those in a similar predicament,
these challenges, I acknowledged the differ-
familiarity with medical knowledge and I would recommend being a good listener,
ences, maintained an open dialogue with
clinical guidelines, whereas solid statis- setting achievable goals for each day, focus-
peers and supervisors to ensure accurate
tics and a programming background are ing on seemingly small activities, being
communication, and tried to view setbacks
required to become a data scientist. To detail oriented, and asking for help if you
with perspective. I also surrounded myself
make the transition, I joined a Ph.D. pro- need any. You will be surprised at how much
with other multilingual people who could
gram after medical school; spent 3 years people are willing to help those coming from
relate to the process of learning another
taking classes on statistical inference, a different country.
language and its frustrations, and I looked
machine learning, and computational for academic role models who weren’t native Veerasathpurush Allareddy
biology; and participated in programming College of Dentistry, University of Illinois at Chicago,
English speakers. Rather than compare

Downloaded from http://science.sciencemag.org/ on January 7, 2019


Chicago, IL 60612, USA. Email: sath@uic.edu
contests with undergraduates. As a result, myself to others who had different back-
I benefited from both the medical domain grounds or experience, I took pride in my When I transitioned from undergraduate
knowledge and the quantitative skills I ability to overcome obstacles. to postgraduate (Ph.D.) studies, there was a
learned in my journey.
Maria Fernanda Torres Jimenez substantial change in my effort-reward sys-
Kun-Hsing Yu Department of Biological and Environmental tem. In high school and college, the harder
Department of Biomedical Informatics, Sciences, University of Gothenburg, and Gothenburg
Harvard Medical School, Boston, MA 02115, USA. Global Biodiversity Centre, Gothenburg, Sweden. I studied, the better results I would get. In
Email: kun-hsing_yu@hms.harvard.edu Email: maria.torres@bioenv.gu.se contrast, as a Ph.D. candidate, substantial
effort does not always mean a visible reward
right away. I realized that outcomes do not
Find community depend on me alone but also on supervisors,
When I transitioned from one field in available resources, and even luck. My advice
biology to another, I had to acclimate is to try to find small, perhaps unexpected,
to subtle differences between fields, rewards from that effort and to be patient
such as strategies for collaboration and because a long-term important reward is
publication. Anyone who is planning likely still to come.
to change fields should make sure that Carmen Romero-Molina
the new workplace has a good working Department of Biochemistry and Molecular
Biology, University of Seville, 41012 Seville, Spain.
environment. It would have been impos- Email: carmin533@hotmail.com
sible for me to get started without the
help of colleagues willing to teach me
the nuances of my new field. In return, Trust yourself
I taught them skills I had developed in I transitioned from a position as a special-
my original field. ist in the pharmaceutical industry to a
Karin S. L. Johansson position as a Ph.D. student. I went from
Institute of Technology, University of Tartu, 50411
Tartu, Estonia. Email: ksl.johansson@outlook.com
solving day-to-day tasks with short dead-
lines to doing research projects lasting for
After finishing my Ph.D., I made a career
Be patient several years. Sometimes, when weeks and
transition from aquaculture to entomol- As a premedical student, I focused on even months go by without results, I have
ogy. I had to abandon a decade of fish obtaining high exam scores and a compet- to remind myself that I made the transition
research experience and start studying itive GPA. When transitioning to medical to challenge myself and develop my skills.
school, I realized that I was now studying Remembering the reason that I’m here helps
insects from scratch. Within the ento-
for my future patients, not an exam score. me overcome frustration and setbacks.
mology community in China, however,
a new researcher has little chance to get The expectation that I would retain all Signe Mosegaard
Research Unit for Molecular Medicine,
a research grant, and my career stalled. the information I learned for a lifetime of Aarhus University, DK-8200 Aarhus N, Denmark.
ILLUSTRATION: ROBERT NEUBECKER

When our institute decided to launch clinical practice was daunting. I believe Email: signe.mosegaard@clin.au.dk
a new aquaculture research program, I it is important for students making this
returned to the aquaculture field without transition to prepare themselves not just I left a research assistant position in a
hesitation and reconnected and collabo- for the sprint to the next exam but for the 20-member lab to do my Ph.D. as the sole
rated with colleagues and old friends in “marathon” that is medical training. member of a new lab. Our productivity
the aquaculture community. To those Cody Lo depended on my effort, and I understood
transitioning from one field to another, I University of British Columbia, Vancouver, BC V6T both the responsibility and the opportunity
recommend being prepared for setbacks 1Z3, Canada. Email: codylo@alumni.ubc.ca the position entailed. I advise others to start

SCIENCE sciencemag.org 4 JANUARY 2019 • VOL 363 ISSUE 6422 25


Published by AAAS
INSIGHTS | L E T T E R S

a Ph.D. with a secure and honest vision more we serve as role models, push societal stakeholders with substantially differ-
of what they want to achieve. Otherwise, acceptance of equality, and improve condi- ent levels of expertise, expectations, and
all the distractions in the world will not tions for future academic mothers. backgrounds on a daily basis. Excellent
be comfort enough during the difficult or Christine D. Bacon oral and written communication skills
unexpected moments. Department of Biological and Environmental are essential to ensure that messages are
Sciences, University of Gothenburg, Gothenburg, delivered clearly, precisely, and effi-
Steven M. Heaton Sweden. Email: christinedbacon@gmail.com
Department of Biochemistry and Molecular ciently. Understanding the organizational
Biology, Biomedicine Discovery Institute, landscape also plays a crucial role in effec-
Monash University, Clayton, VIC 3800, Australia. When I started my Ph.D. project, I depended tive communication, and the academic
Email: steven.heaton@monash.edu on guidance from my supervisor. When I platform does not provide that type of
transitioned to postdoctoral work, I had complex environment. Thus, I believe
Medical school was like drinking from a fire to independently navigate my research
hose. There was so much to learn; the more internships and industrial co-op positions
schedule, including both long-term and are the best opportunities for postgradu-
efficient I was, the better. When I transi- short-term goals. It was up to me to stay
tioned to graduate school during my M.D./ ate students who would like to get true
engaged, focus on my goals, and change exposure to the industrial atmosphere and
Ph.D. training, the rules for success were direction when appropriate. Self-navigation
less clear. My research mentor often tells me to improve their soft skills.
driven by intrinsic motivation helped me
to be creative, but there is no textbook for Dhanuka Wasalathanthri
find success as a postdoctoral researcher. Sanofi US, Fiskdale, MA 01518, USA.
creativity. Testing the boundaries of science Email: dhanuka02@gmail.com
Sha Yu
requires experiments or techniques that you School of Biological Sciences, Seoul
have never done before, and when you try National University, Seoul 8826, South Korea.

Downloaded from http://science.sciencemag.org/ on January 7, 2019


Email: shayu@snu.ac.kr
When I was a graduate student, it was
new things, you often fail. The key, I believe, natural and helpful to vent my nega-
is to work on questions that truly interest tive feelings about incomplete tasks to
you. Genuine scientific curiosity can form When I first transitioned from Ph.D. to
someone in our group. After transition-
the foundation for sustained perseverance. postdoc, the most challenging difference
ing to a position as an adviser, I realized
Asking “Why?” can turn failed experiments was the change in expectations. As a Ph.D.
that I had to express my frustration more
into new opportunities. It turns out that student, I benefited from my supervisor’s
constructively. Expressing pessimism to
graduate school is also like drinking from helping hand and the understanding that
the graduate students can affect them,
a fire hose, but the fun part is you get to my colleagues would tolerate mistakes. As
sometimes more than we expect. Although
choose what you drink. a postdoc, I had to face the expectation that
I still share my concerns, I now try to lay
Jonathan Joon-Young Park
I could produce high-impact results with
out the problems and possible solutions
Department of Genetics, Yale University minimal supervision.
School of Medicine, New Haven, CT 06520, USA.
without emphasizing my feelings, and I
Emre Ozan Polat encourage the students to work together to
Email: jonathan.park@yale.edu ICFO–The Institute of Photonic Sciences,
Castelldefels, 8860 Barcelona, Spain. solve problems.
For academics, transitioning to parenthood Email: emre-ozan.polat@icfo.es Wei Wang
can be daunting. During the first years of Fujian Institute of Research on the Structure
of Matter, Chinese Academy of Sciences, Fuzhou,
my child’s life, I experienced academia Fujian 350002, China. Email: wangwei@fjirsm.ac.cn
with a new perspective. We have traveled Communicate effectively
to conferences and field work all over the When I left my position as a graduate During my Ph.D., I started a medical
world. With the help of patient colleagues, research assistant in academia to begin device company. The transition from
supportive family and friends, conference work as a scientist in industry, I learned scientist to entrepreneur was challenging
day care, and a strong will, I have tried my that industry requires complex com- because the business world was com-
best to be an active member of my scientific munication skills. I have to engage and pletely new to me. Young scientists in
community. The more we participate, the communicate with internal and external a similar position, conflicted between a
comfortable academic trajectory and
the unknown startup world, should
not hesitate to reach out to those more
experienced. You will be surprised at
the insights a quick phone call, email,
or coffee chat can generate. In graduate
school, while you’re learning about the
scientific process of hypothesis design and
testing, explore what it takes to translate
new ideas into market-ready products.
It is never too early to learn how to
become a good salesperson. The ability to
ILLUSTRATION: ROBERT NEUBECKER

pitch an idea effectively will help you


communicate your science more success-
fully in any setting.
Divyansh Agarwal
Perelman School of Medicine, University
of Pennsylvania, Philadelphia, PA 19104, USA.
Email: divyansh@upenn.edu
10.1126/science.aaw2641

26 4 JANUARY 2019 • VOL 363 ISSUE 6422 sciencemag.org SCIENCE

Published by AAAS
Downloaded from http://science.sciencemag.org/ on January 3, 2019
PERSPECTIVES

CROWD DYNAMICS A human crowd supports a wave-like transmission


of information when the crowd is modeled as a single

Flowing crowds entity rather than a composite of individuals.

years, researchers have attempted to con-


Modeling human crowds as a fluid allows strain these assumed rules by measuring real
animal groups (6–9). However, this approach
prediction of group behavior is fraught. Data can be hard to come by for
many reasons—including, in the case of hu-
By Nicholas T. Ouellette a continuum “hydrodynamic” model of the mans, substantial ethical considerations.
crowd as a whole and then constrain it with More fundamentally, extracting individual

C
ollective behavior of social animals, observational data collected from marathon interaction rules from observations of group
particularly coordinated group move- runners. This approach circumvents many behavior is a complex, nonlinear inverse
ments, is one of the most striking of the sometimes-questionable assumptions problem, so drawing reliable conclusions in a
phenomena in the natural world, as that have previously been made and provides model-free way is often impossible.
anyone who has been enthralled by a roadmap for constructing an empirically Rather than thinking about a group as a
flocks of starlings or schools of sar- grounded theory of collective behavior. composite of individual agents with their
dines can attest. Research in this broad, in- The dominant paradigm for describing own rules, a group can instead be considered
terdisciplinary field has recently exploded, collective behavior is agent-based model- as an entity itself. The properties of the group
with motivations ranging from understand- ing. Each individual in a group is treated as certainly emerge from interactions between
ing the biological basis of social behavior an “agent” that follows a set of rules to de- the individuals, but to model these properties,
(1) to developing algorithms for designing termine its behavior. Most commonly, these it is not necessary to know where they come
and controlling swarms of robots (2). There rules include instructions to not stray too from. In this sense, collective behavior can
is good reason to think that the behavior far from the group, to avoid collisions, and, be treated analogously to how the mechan-
of human crowds is quite similar to these for directed motion, to move in the same ics of materials are modeled. To describe how
animal groups and that studying humans direction as nearby agents (5). Agent-based water flows, one does not need to consider
might help elucidate the origins of crowd models have succeeded in qualitatively re- molecular interactions; rather, one can apply
panic and other dangerous instabilities that producing patterns observed in real animal conservation laws for a macroscopic amount
can lead to injury or loss of life (3). All these groups (1), providing strong evidence that lo- of water and constrain them with empirical
PHOTO: MARCO MEGA/ALAMY STOCK PHOTO

goals require modeling, both as a check on cal interaction alone is sufficient to drive the observations (in the case of hydrodynamics, a
our understanding and as a predictive tool formation of group-level coherent behavior. linear constitutive law that relates stress and
for analyzing new situations. On p. 46 of this However, pattern isn’t everything, and just strain rate). Such an approach cannot cap-
issue, Bain and Bartolo (4) describe a pow- because a model’s output qualitatively looks ture the behavior of water molecules, but if
erful new way to model human crowds. In- acceptable does not mean that the model is the goal is to formulate a predictive theory of
stead of focusing on individuals, they build right. There is also reason to be skeptical of hydrodynamics, they are not necessary.
this approach because it requires a priori as- Bain and Bartolo have essentially followed
Department of Civil and Environmental Engineering, Stanford sumptions about animal behavior that are at this approach for human crowds. They be-
University, Stanford, CA 94305, USA. Email: nto@stanford.edu least oversimplified if not incorrect. In recent gin with generic equations of motion for the

SCIENCE sciencemag.org 4 JANUARY 2019 • VOL 363 ISSUE 6422 27


Published by AAAS
INSIGHTS | P E R S P E C T I V E S

continuum crowd density and velocity start-


ing from mass and momentum conservation.
To gather the necessary information to con-
strain these equations, they made a series of
observations of a large number of people in a
confined space—in this case, runners at the
start of major marathons who are strongly
constrained by geometry (along a street) and
by the control of race officials. Runners are
typically allowed to start the race in small
groups according to their expected speed.
The authors quantitatively analyzed videos of
runners at the start of races and found that
each starting event (when officials let runners
start to advance toward the starting line) trig-
gered an upstream-propagating wave of den- CONSERVATION
sity and velocity perturbations through the
crowd. In other words, the crowd supported
a wave-like transmission of information (in
this case, the start of the race). The proper-
The sound of a tropical forest
Recording of forest soundscapes can help monitor animal

Downloaded from http://science.sciencemag.org/ on January 3, 2019


ties of this wave provided the information
needed to constrain the equations of motion,
which in turn enabled predictions about the
biodiversity for conservation
dynamics of other crowds without resorting
to any assumptions about human behavior. By Zuzana Burivalova1, Edward T. Game2,3, to conserving biodiversity. Continuing ad-
That’s a very important outcome, including Rhett A. Butler4 vances in spectral imagery and lidar (light
for those interested in modeling potentially detection and ranging) reveal progressively

C
dangerous situations such as crowd panic. onservation areas around the world finer levels of forest change, but they still re-
The approach of Bain and Bartolo opens aim to help conserve animal biodiver- main a proxy for animal biodiversity rather
many avenues for future work for collective sity, but it is often difficult to measure than a direct measure of it (4).
behavior researchers more generally. For ex- conservation success without detailed Repeated on-the-ground surveys can
ample, it should inspire studies that pinpoint on-the-ground surveys. High-resolu- provide the required information to assess
a group response to perturbations—such as tion satellite imagery can be used to animal biodiversity. However, such sur-
the traveling waves launched by the start- verify whether or not deforestation has oc- veys are expensive, cover limited ground,
ing events of a marathon race—to constrain curred in areas dedicated for conservation and may be affected by the biases of indi-
continuum models. Some studies along these (1). Such remote sensing analyses can reveal vidual experts. One possible alternative is
lines have already been done, such as char- forest loss and, in some cases, severe forest the use of bioacoustics, which can detect
acterizing the response of starling flocks to degradation, such as through fragmenta- animals by their vocalizations. Depending
predators (10), of ants to mechanical stresses tion and intensive selective logging, espe- on vegetation structure and the vocaliz-
(11), and of midge swarms to sensory cues (12). cially if it includes the construction of roads ing species, acoustic recorders can detect
More work is necessary to incorporate these or camps. However, conservation benefit is animal calls and song from several hun-
findings into dynamical continuum models determined not only by forest loss but also dred meters away (5). Autonomous sound-
that avoid the need for a priori assumptions by the level of degradation in those forests recording devices are now available from
about animal behavior. Ultimately, such mod- left standing. Bioacoustics—specifically the several companies as small units that are
els may even be an effective way to determine recording and analysis of entire sound- inconspicuous to humans. They can be
the local interactions themselves because any scapes—is an emerging tool with great programmed to record either continuously,
agent-based model must approach the con- promise for effectively monitoring animal if there is sufficient solar power or cellular
tinuum model as a limiting case. j biodiversity in tropical forests under vari- network signal for direct transmission of
ous conservation schemes (2, 3). data to cloud storage, or at given intervals,
REFERENCES
Even forests that appear intact in satellite if battery power and data storage are lim-
1. J. K. Parrish, L. Edelstein-Keshet, Science 284, 99 (1999).
2. M. Rubenstein, A. Cornejo, R. Nagpal, Science 345, 795 imagery can have low biodiversity conserva- iting factors (6). Several multiyear record-
(2014). tion value because of effects such as canopy ings have now been completed (7).
3. D. Helbing, I. Farkas, T. Vicsek, Nature 407, 487 (2000).
4. N. Bain, D. Bartolo, Science 363, 46 (2019). simplification, understory fires, invasion by Selected times of the day can convey a
5. C. W. Reynolds, Comput. Graph. 21, 25 (1987). exotic species, or overhunting. These forms disproportionately large amount of infor-
6. Y. Katz, K. Tunstrøm, C. C. Ioannou, C. Huepe, I. D. Couzin, of degradation are difficult to monitor re- mation about the resident biodiversity; for
PHOTO: RHETT A. BUTLER/MONGABAY.COM

Proc. Natl. Acad. Sci. U.S.A. 108, 18720 (2011).


7. J. E. Herbert-Read et al., Proc. Natl. Acad. Sci. U.S.A. 108, motely with satellite imagery, resulting in example, mornings and evenings have been
18726 (2011). a common but faulty assumption that con- found to be particularly important for de-
8. W. Bialek et al., Proc. Natl. Acad. Sci. U.S.A. 109, 4786 (2012).
9. J. G. Puckett, D. H. Kelley, N. T. Ouellette, Sci. Rep. 4, 4766 serving forest cover is necessarily equivalent tecting differences between forests that are
(2014). used in different ways by humans (8). With
10. A. Procaccini et al., Anim. Behav. 82, 759 (2011). 1 further developments in energy and data
11. M. Tennenbaum, Z. Liu, D. Hu, A. Fernandez-Nieves, Nat. Woodrow Wilson School of Public and International Affairs,
Mater. 15, 54 (2016). Princeton University, Princeton, NJ 08540, USA. 2The Nature storage and transmission, continuous re-
12. R. Ni, J. G. Puckett, E. R. Dufresne, N. T. Ouellette, Phys. Rev. Conservancy, South Brisbane, QLD 4101, Australia. 3School of cording is likely to become the norm.
Lett. 115, 118104 (2015). Biological Sciences, University of Queensland, St. Lucia, QLD
4072, Australia. 4Mongabay.com, Menlo Park, CA 94026, USA. Relative to on-the-ground surveys, bio-
10.1126/science.aav9869 Email: zuzanab@princeton.edu acoustics is inexpensive, making it more

28 4 JANUARY 2019 • VOL 363 ISSUE 6422 sciencemag.org SCIENCE

Published by AAAS
Hornbills, such as this rhinoceros hornbill in protected forests should be determined scape composition due to climate change
Bukit Tigapuluh National Park, Sumatra, not just by how much forest loss has been might be beyond the direct control of the
Indonesia, have prominent vocalizations that avoided, but also by the level of biological companies, but abrupt and quick change in
can be identified in soundscapes. integrity of those forests left standing. Bio- soundscapes is more likely to be attributable
acoustics has the potential to provide this to management. In these cases, other mea-
feasible to repeat measurements over time. information (see the figure). sures (such as prevention of hunting, refor-
Also, the results are not influenced by in- Advances in bioacoustics, as well as the esting edges or the degraded areas of the
dividual researchers’ biases or simply by robustness and affordability of sound- conserved zone with native species, or curb-
the presence of observers in the field. The recording devices, make it possible for ing fires) would be called for by auditors,
method offers the possibility to monitor companies or independent consultants to who are typically involved in independent
multiple taxonomic groups at the same time deploy sound recorders in areas of forest verification of a company’s commitments.
(all vocalizing birds, mammals, insects, and maintained by a company under legal re- Because of the enormous size of the
amphibians), as opposed to, for example, quirements, certification, or a zero-defores- acoustic datasets and the computational
camera traps. Finally, the data can be reana- tation commitment. If the soundscape of a power required to analyze them, there is
lyzed in the future with improved algorithms forest spared from conversion were becom- a need for a global organization to host a
or to search for specific acoustic features. ing more impoverished and altered beyond global acoustic platform, which would al-
Analysis of human-made sounds can help to the natural variation of the soundscape low direct, on-the-fly analysis. The develop-
clarify how sounds from machinery (such as baseline, on-the-ground survey would be ment of such a data hosting and analysis
tractors, bulldozers, and chainsaws) affect warranted. Slow, gradual changes in sound- platform should be a priority, together with
habitat quality and to track illegal human the collection of regional soundscape base-

Downloaded from http://science.sciencemag.org/ on January 3, 2019


activities, such as gunshots from poachers or lines by scientists. Such baselines would
chainsaws in illegal logging (9). How soundscape monitoring be especially useful for understanding and
Acoustic data from soundscapes can be accounting for the natural seasonal and in-
analyzed in many ways (10). Various indi-
can aid conservation terannual variation of soundscapes, as well
This diagram shows how bioacoustics monitoring
ces can be calculated that characterize the as for comparison of the industry-protected
could be implemented in a concession governed
soundscape for each time and frequency by a corporate conservation commitment or
forest soundscapes with the closest avail-
unit (11, 12). Alternatively, individual spe- sustainability certification. Soundscape recordings able undisturbed sites.
cies can be identified by experts, algorithms would be compared to each other over time, Nongovernmental organizations and the
(13), or deep learning (14). as well as to regional baselines from the closest conservation community need to be able
Soundscape analysis using indices ap- available intact forest landscapes. to truly evaluate the effectiveness of con-
pears most suitable to monitor the general servation interventions. Many (but not all)
state and recovery of forests, because it does companies want to be able to provide objec-
not require site-specific species lists (8). Ran- tive, consistent, and easy-to-share evidence
dom forest models based on multiple acous- documenting their conservation efforts, at
tic indices can predict species richness with a low cost. Environmentally aware consum-
very high accuracy (11). However, further ers may feel more confident about purchas-
GRAPHIC: N. CARY/SCIENCE; (PHOTO) RHETT A. BUTLER/MONGABAY; (SOUNDSCAPES) QUEENSLAND UNIVERSITY OF TECHNOLOGY

studies linking on-the-ground biodiversity ing from brands that can show the results
surveys to soundscape indices are needed of their conservation efforts, on top of their
from a wide variety of forest types and hu- certification logo or zero-deforestation
man disturbances to determine whether commitment. The scientific community
such indices can be generalized. In areas will benefit from a huge tranche of data on
Soundscape of a forest that
where hunting is important, the recordings ecological communities across the tropics.
belongs to a nearby plantation
could also be used to determine the presence committed to zero deforestation It is therefore in the interest of certification
or absence of the hunted species (typically bodies to harness the developments in bio-
large mammals and birds) using individual acoustics for better enforcement and effec-
species recognition algorithms. tiveness measurements of their schemes. j
Bioacoustics has particular potential in
REFERENCES
the context of industry sustainability cer-
1. H. K. Gibbs et al., Conserv. Lett. 9, 32 (2016).
tification and zero-deforestation commit- 2. J. Sueur, A. Farina, Biosemiotics 8, 493 (2015).
ments, both of which have become popular, 1 Comparison 3. B. Krause, A. Farina, Biol. Conserv. 195, 245 (2016).
widely publicized conservation strategies (1, over time 4. M. M. C. Bustamante et al., Glob. Change Biol. 22, 92
(2016).
15). Companies involved in such industries 5. K. Darras, P. Pütz, Fahrurrozi, K. Rembold, T. Tscharntke,
as palm oil, beef, soy, and pulp and paper Biol. Conserv. 201, 29 (2016).
production commit to not cause any defor- 6. A. Rodriguez et al., Ecol. Inform. 21, 133 (2014).
7. S. H. Gage, A. C. Axel, Ecol. Inform. 21, 100 (2014).
estation through their industrial develop- 8. Z. Burivalova et al., Conserv. Biol. 32, 205 (2018).
ment. Typically, this means that any new 2 Comparison 9. C. Astaras, J. M. Linder, P. Wrege, R. D. Orume, D. W.
plantation, ranch, or farm can only be devel- Macdonald, Front. Ecol. Environ. 15, 233 (2017).
to a regional
10. J. L. Deichmann et al., Biotropica 50, 713 (2018).
oped in an area that is already deforested or baseline 11. R. T. Buxton et al., Conserv. Biol. 32, 1174 (2018).
heavily degraded. In some countries, such 12. L. M. Ferreira et al., J. Ecoacoust. 2, PVH6YZ (2018).
as Brazil, companies are legally obliged to 13. A. P. Hill et al., Methods Ecol. Evol. 9, 1199 (2018).
14. D. Stowell, Y. Stylianou, M. Wood, H. Pamuła, H. Glotin,
protect parts of their concessions from de-
Methods Ecol. Evol. 10.1111/2041-210X.13103 (2018).
forestation. However, precise definitions of 15. S. Brown, D. Zarin, Science 342, 805 (2013).
zero deforestation are often missing (15).
The conservation benefit of such industry- 10.1126/science.aav1902

SCIENCE sciencemag.org 4 JANUARY 2019 • VOL 363 ISSUE 6422 29


Published by AAAS
INSIGHTS | P E R S P E C T I V E S

INFECTIOUS DISEASE phylogenetic homology). Another recent


study from the current outbreak of Lassa fe-

Understanding Lassa fever ver in Nigeria has drawn similar conclusions


using more traditional genetic sequencing
technology (7).
Genomics study informs about Lassa fever epidemiology Despite the critical epidemiological clues
provided by both studies, it is helpful to keep
in mind that the narrative of Lassa fever is
By Nahid Bhadelia sense of the bigger picture. In the biological driven by where the testing for the disease
world, longer reads of genomic information occurs. Owing to the high number of asymp-

L
assa fever is a viral hemorrhagic fever also provide invaluable information about tomatic cases and the nonspecific symptoms
prevalent in West Africa that has been structural variations and epigenetic modifi- mimicking myriads of infectious diseases in
gaining international attention as an cations between individual organisms. How- the region in patients who actually become
emerging infectious disease with the ever, with longer reads comes greater error sick, establishing the true burden of Lassa
potential to cause epidemics (1). Con- rates, which appear to improve with repeated fever in Nigeria and other West African coun-
firmed and suspected cases of Lassa reads of the same genetic material, as long as tries has been near impossible (8). The dis-
fever have been steadily rising in Nigeria it is of high-enough quality and quantity (5). ease is mainly spread through contact with
over the past 3 years. Laboratory-confirmed With its compact size, portability, and quick the urine and feces of multimammate rats in
cases have increased from 106 in 2016 to 143 turnaround time, the device can be rapidly the household setting, a human-vector inter-
in 2017 and had already reached 562 by No- deployed in outbreak areas where laboratory face that happens mostly in poor communi-

Downloaded from http://science.sciencemag.org/ on January 3, 2019


vember 2018 (2). Part of defining the scope of ties and in rural areas. Unfortunately, these
the problem is trying to assess whether this are also communities with considerably less
is a true increase in the number of people af- access to health care, and, because diagnos-
flicted by the infection, due to either changes tic testing for Lassa fever is only available
in the virus itself or the geographical spread at a handful of reference laboratories, it is
of the vector (rodents of the Mastomys spp.), thought that many suspected patients are
or a reflection of higher rates of detection either never tested or only tested after a de-
and diagnosis secondary to the increased lay (9). Conversely, ~80% of suspected cases
attention and interest of clinicians and labo- tested in 2018 were actually negative for
ratorians (1). Lassa fever outbreaks illustrate Lassa fever (2).
the issues associated with the response and Because of a lack of access to laboratory
management of emerging infectious diseases: testing, a sizeable portion of the world’s
How do you plan the public health, clinical, LASV (blue) is spread by rat urine and droppings and population, particularly in resource-limited
and community responses to a disease while infects humans through ingestion or inhalation. areas, is simply treated on the basis of symp-
you are still learning about the epidemiology, tomatology for common infectious diseases
pathophysiology, and the ecological factors capacity may not exist for genomic sequenc- such as malaria or cholera rather than tested
contributing to the spread of the pathogen? ing and when samples cannot be exported on presentation to confirm the underlying di-
On page 74 of this issue, Kafetzopoulou et out of the country for analysis (4). Its uses agnosis (10). This paradigm allows emerging
al. (3) present the results of a rapid genomic include not only sequencing to evaluate vi- infectious diseases to circulate in populations
study of Lassa virus (LASV) from the cases ral evolution and chains of transmission but without initial detection. Hence, the real test
of 2018, which have improved understanding also, as the authors highlight, identification of emerging microbial detection techniques
of how the disease has been spreading in Ni- of multiple cocirculating viruses in patient will be how accurate, affordable, and amena-
geria and have led to informed and targeted samples. The technology has already been ble to widespread use they are and whether
disease-control strategies. The study also fur- used in outbreaks with other pathogens, in- they can test both for common endemic in-
ther describes the use of a new and compact cluding Ebola virus (6). fectious diseases as well as rarer pathogens
genomic sequencing device, which may start Kafetzopoulou et al. used this technology of high concern, such as viral hemorrhagic
playing a larger role in defining other emerg- to compare the phylogenetic differences be- fevers. To get the true sense of the disease
ing infectious disease outbreaks in real time. tween the strains of viruses from 120 con- burden and deaths from these emerging in-
The device generates exponentially longer firmed LASV samples from Nigeria from fectious diseases, to really solve the problem
reads of genetic material than traditional the spring of 2018. With the increase in the of Lassa fever, we still need diagnostic tech-
sequencing and offers some remarkable number of total cases as well as clusters of nologies closer to the point of care, and ev-
advantages over existing next-generation cases in recent years, one of the concerns has erywhere patients get sick. j
sequencing platforms (4). To date, sequenc- been whether the virus has changed, allow-
REFERENCES
ing the genomes of organisms has been like ing Lassa fever to transmit between humans
1. L. Roberts, Science 359, 1201 (2018).
printing individual pages of a novel in the more easily. By examining the level of genetic 2. Nigeria Centre for Disease Control, “Weekly epidemiologi-
wrong order (many of which end with the diversity between viruses in each of the dif- cal report: Epi week 1, week 46” (2018).
PHOTO: AMI IMAGES/SCIENCE SOURCE

3. L. E. Kafetzopoulou et al., Science 363, 74 (2019).


same words and phrases) and trying to put ferent samples, alongside epidemiological 4. H. Lu et al., Genom. Proteom. Bioinf. 14, 265 (2016).
the story together with guess work. The de- information about the cases, the authors 5. A. D. Tyler et al., Sci. Rep. 8, 10931 (2018).
vice allows researchers to instead print out demonstrated that most of the viral genomes 6. J. Quick et al., Nature 530, 228 (2016).
7. K. J. Siddle et al., N. Engl. J. Med. 379, 1745 (2018).
whole chapters, making it easier to get a were different enough from each other that 8. C. Houlihan, R. Behrens, BMJ 358, j2986 (2017).
they had to have come from humans infected 9. R. S. Dhillon et al., Lancet Infect. Dis. 18, 601 (2018).
Section of Infectious Diseases, Boston University 10. A. M. Caliendo et al., Clin. Infect. Dis. 57 (suppl. 3), S139
by different rodents, rather than from those (2013).
School of Medicine and National Emerging Infectious Diseases
Laboratories, Boston University, Boston, MA, USA. infected through transmission from other
Email: nbhadeli@bu.edu humans (which would have greater shared 10.1126/science.aav8958

30 4 JANUARY 2019 • VOL 363 ISSUE 6422 sciencemag.org SCIENCE

Published by AAAS
NEUROSCIENCE

Weakening synapses to cull memories


Calcium sensor synaptotagmin-3 helps weaken synaptic strength and supports forgetting

By Nataniel J. Mandelberg and tioning in mice can be deactivated through dant at postsynaptic regions, is endocytosed
Richard Tsien optogenetically induced LTD and reactivated when neurons are stimulated, binds directly
with LTP (6). LTP occurs when the activity of to GluA2 receptors, and controls their inter-

F
rom correct answers on a school exam the presynaptic neuron causes a large influx nalization. Awasthi et al. show that SYT3 has
to a loved one’s birthday, we have all of Ca2+ into the postsynaptic neuron. It mani- a functional impact on synaptic plasticity. In-
forgotten things we wish we had not. fests as an increased number of a-amino- duction of LTP was unaffected by Syt3 gene
The ability to forget, however, is a 3-hydroxy-5-methyl-4-isoxazolepropionic deletion in mice, whereas the decay of LTP
feature rather than a flaw of how our acid (AMPA) type 2 subunit–containing glu- and the induction of LTD, both reliant on
brains work. As the celebrated author tamate (GluA2) receptors at the spine, mak- GluA2 receptor endocytosis, were abolished.
Jorge Luis Borges wrote about a man inca- ing the postsynaptic neuron more responsive Notably, SYT3 binds Ca2+ at 5- to 20-fold
pable of forgetting, Funes the Memorious (1), to input from the presynaptic cell. By con- lower concentrations (8) than does SYT1,
“I suspect, however, that he was not very ca- trast, LTD is driven by smaller Ca2+ events which participates in postsynaptic recruit-

Downloaded from http://science.sciencemag.org/ on January 3, 2019


pable of thought. To think is to ment of GluA2 receptors in LTP
forget differences, generalize, (7). Taken together, these find-
make abstractions.” Although Switching between remembering and forgetting ings (5, 7, 8) align with a model
Funes’s example is literary, it 2+
In this model, different SYT isoforms with different Ca affinities (8) determine that attributes the different Ca2+
contains a grain of truth. Neuro- whether GluA2 receptors should be added to synapses, which strengthens them requirements of LTP and LTD
scientists have traditionally paid (LTP), or removed, which weakens them (LTD). This contributes at the synaptic level to their structurally divergent
more attention to how the brain to the decision in the brain of whether a memory should be encoded or forgotten. Ca2+ sensors. Other players, such
remembers than how it forgets, as calmodulin kinases and cal-
but there is increasing clarity Synaptic Memory Synaptic cineurin, may also participate
LTP LTD Forgetting
about mechanisms and roles of strengthening formation weakening in the all-important molecu-
forgetting (2, 3). By forgetting, lar decision between synaptic
we prioritize and separate the strengthening and weakening.
useful from the irrelevant and Work is needed to further inte-
more easily reorganize informa- grate postsynaptic vesicle cycling
tion to learn (4). On page 44 of GluA2 receptor and signaling biochemistry.
this issue, Awasthi et al. (5) show Awasthi et al. show that
that the Ca2+-sensing protein these circuit-level findings have
synaptotagmin-3 (SYT3) is es- SYT1 in vivo relevance by training
sential for synaptic weakening Clathrin mice to find target locations.
and link this molecular process AP-2 When Syt3 was deleted, the
to beneficial forgetting in mice. SYT3 mice learned the target loca-
A compelling association tion as well as the wild-type
exists between memory and GluA2 receptor GluA2 receptor mice did but, when the target
changes in neuron connectivity. exocytosis endocytosis was moved, showed impaired
Neurons are linked by synapses, forgetting of the initial location,
structures in which boutons Stimulation strength reflected by an unwillingness
from the axon of the upstream Calcium
to leave the target’s original
(presynaptic) neuron communi- location. These results extend
SYT1 SYT3
cate with spines on dendrites of reports that GluA2 receptor
the downstream (postsynaptic) endocytosis mediates memory
neuron via neurotransmitter release. If the and reflects the removal of GluA2 receptors loss (9) and that blocking this endocytosis
presynaptic neuron reliably drives the activ- from the synapse through endocytosis, weak- preserves memories (10), by showing that
ity of the postsynaptic neuron, the synapse’s ening the connection. this process is mediated by SYT3 in vivo.
strength, or weight, increases through long- To clarify the mechanism of GluA2 recep- Awasthi et al. go on to demonstrate that
term potentiation (LTP). However, if the ac- tor endocytosis, Awasthi et al. looked closely this inability to forget hinders behavioral
tivities of the neurons are poorly correlated, at members of the synaptotagmin family of flexibility, much as in Borges’s story of Funes.
the connection weakens through long-term Ca2+-sensitive proteins. Synaptotagmins con- The mice were again tasked with finding a
GRAPHIC: V. ALTOUNIAN/SCIENCE

depression (LTD). Controlling LTP and LTD trol the exocytosis of presynaptic vesicles (full hidden platform in a pool of water, but the
in rodents drastically affects memories they of neurotransmitters) from the bouton, and location of the platform was changed every
have formed: Previously learned fear condi- postsynaptic SYT1 and SYT7 are required for day. Mice in which Syt3 was deleted persisted
glutamate receptor exocytosis in LTP (7). Aw- with former platform locations rather than
asthi et al. show that SYT3 has key qualifi- seeking new ones, as if unable to distinguish
Langone Medical Center, New York University,
New York, NY, USA. Email: richard.tsien@nyumc.org; cations to be the arbiter of LTD through its between a past memory and a new, immedi-
nataniel.mandelberg@nyumc.org regulation of GluA2 receptors: SYT3 is abun- ately relevant experience.

SCIENCE sciencemag.org 4 JANUARY 2019 • VOL 363 ISSUE 6422 31


Published by AAAS
INSIGHTS | P E R S P E C T I V E S

The study of Awasthi et al. highlights the METABOLISM


importance of vesicle cycling on both sides of
the synapse. Clarification of the cell biology
of how postsynaptic weights are weakened
shifts the spotlight to questions about the
Improving crop yield
spatiotemporal allocation and reallocation of Synthetic photorespiration bypass increases crop yield
such weights. We speculate that the internal-
ized glutamate receptor vesicles are a synap-
tic resource too precious to waste and can be By Marion Eisenhut and strongly enhanced biomass production in
redistributed among nearby dendritic spines Andreas P. M. Weber field trials, suggesting that this could be used
to strengthen nearby postsynapses (11), much to improve crop yields.

T
as vesicles of neurotransmitters can be real- he enzyme ribulose 1,5-bisphosphate Photorespiration is an essential metabolic
located among presynaptic boutons along an carboxylase-oxygenase (RuBisCO) is repair pathway in all organisms that perform
axon (12). This study begins to show how neu- one of the most abundant proteins oxygenic photosynthesis, from cyanobacte-
rons might use similar tools pre- and post- on Earth. During photosynthesis, it ria, through algae, to land plants (2, 4). Core
synaptically to channel resources to the most assimilates atmospheric CO2 into bio- photorespiratory metabolism comprises nine
important synapses while culling synapses mass and hence is a major driver of the enzymatic steps that are distributed over
that no longer encode relevant information. global carbon cycle. However, the enzyme is chloroplast, peroxisome, and mitochondrion
The work of Awasthi et al. has a close yet catalytically imperfect. It accepts not only CO2 within a plant cell. It converts detrimental
unexplored relationship to pathological pro- as a substrate, but also O2, which leads to the 2-PGlycolate into the Calvin-Benson cycle

Downloaded from http://science.sciencemag.org/ on January 3, 2019


cesses in neuropsychiatric and neurodegen- formation of a toxic byproduct, 2-phospho- intermediate 3-PGlycerate and thereby re-
erative disorders. The exaggerated removal of glycolate (2-PGlycolate) (1). The metabolic turns 75% of otherwise unusable carbon to
glutamate receptors, including GluA2 recep- pathway photorespiration detoxifies 2-PGly- photosynthetic metabolism. However, during
tors, is a feature of Alzheimer’s disease (AD) colate, and it is essential for performing pho- this salvage pathway, 25% of previously fixed
(13) and potentially linked to the associated tosynthesis in an O2-containing atmosphere. CO2 gets lost, and energy is consumed (see
forgetting. This process involves protein in- Importantly, photorespiration causes a 20 to the figure). Hence, albeit essential, photo-
teracting with C kinase-1 (PICK1), another 50% yield penalty, depending on the environ- respiration is also considered a wasteful and
mediator of GluA2 receptor endocytosis (14), mental conditions and the type of photosyn- inefficient process (2). Accordingly, photores-
but the role of SYT3 and the relationships thesis employed (2). Multiple attempts have piration has been identified as a prime target
between PICK1, SYT3, and other proteins in- been undertaken to overcome this yield pen- for engineering to improve crop yields, and
volved in GluA2 receptor endocytosis remain alty and thereby increase biomass production diverse strategies have been developed to im-
unclear. This pathophysiological endocytosis in plants, with limited success to date. On prove photosynthetic efficiency by reducing
could contribute to the memory loss experi- page 45 of this issue, South et al. (3) present a photorespiration and/or enhancing the CO2
enced by AD patients, and we speculate that synthetic pathway that fully detoxifies 2-PG- fixation processes. Some of these attempts
pharmacological interventions that restore lycolate inside plant chloroplasts. Transgenic are inspired by naturally occurring CO2-
normal GluA2 receptor endocytosis could tobacco plants expressing this pathway show concentrating mechanisms present in, for
help mitigate these defects. Furthermore, be- example, cyanobacteria and algae. Others are
havioral inflexibility is a hallmark of autism Institute of Plant Biochemistry, Cluster of Excellence on Plant based on implementing synthetic metabolic
Science (CEPLAS), Heinrich Heine University Düsseldorf,
spectrum disorders (ASD) and might be as- Universitätsstrasse 1, 40225 Düsseldorf, Germany. routes to redirect the canonical pathway of
signed to deficits in forgetting, as supported Email: aweber@hhu.de CO2 assimilation and photorespiration (5).
by five fruitfly models of ASD risk genes (2).
In another study, patients with ASD were
asked to choose the location of a stimulus. Engineering wasteful photorespiration into a beneficial process
Although they performed equally well as the The fixation of O2 by RuBisCO in chloroplasts leads to high rates of photorespiration and a concomitant loss of
control patients, the ASD patients showed CO2 from mitochondria. A synthetic bypass and the restricted activity of PLGG1 allow metabolism of glycolate with
extra reversion back to the original location release of CO2 inside of the chloroplasts, which promotes CO2 fixation by RuBisCO and improves yield.
even after the stimulus location changed (15).
Elucidation of mechanisms of this inflexibil-
Synthetic bypass
ity will benefit from the insights that Awasthi
CO2
et al. have elegantly provided. j O2 Pyruvate
RuBisCO O2 RuBisCO
REFERENCES 2-PGlycolate Acetyl-CoA CO2
3-P Glycerate 2-PGlycolate 3-PG lycerate
1. J. L. Borges, Labyrinths (New Directions Publishing, 1964). Malate
2. R. L. Davis, Y. Zhong, Neuron 95, 490 (2017). Glycolate Glycolate
Chloroplast Glycerate Glycerate Glyoxylate
3. O. Hardt et al., Trends Cogn. Sci. (Regul. Ed.) 17, 111 (2013).
4. B. A. Richards, P. W. Frankland, Neuron 94, 1071 (2017). PLGG1 PLGG1 PLGG1
LGG
5. A. Awasthi et al., Science 363, eaav1483 (2019).
6. S. Nabavi et al., Nature 511, 348 (2014).
7. D. Wu et al., Nature 544, 316 (2017).
GRAPHIC: A. KITTERMAN/SCIENCE

8. S. Sugita et al., EMBO J. 21, 270 (2002). Peroxisome


9. Z. Dong et al., J. Clin. Invest. 125, 234 (2015).
10. P. V. Migues et al., J. Neurosci. 36, 3481 (2016).
11. C. Mullins et al., Neuron 89, 1131 (2016). Mitochondrion
12. K. Staras et al., Neuron 66, 37 (2010). CO2 CO2
13. H. Hsieh et al., Neuron 52, 831 (2006).
14. S. Alfonso et al., Eur. J. Neurosci. 39, 1225 (2014).
15. A.-M. D’Cruz et al., Neuropsychology 27, 152 (2013). Natural situation Synthetic bypass
Plant cell Photorespiration high Photorespiration reduced
10.1126/science.aaw1675 CO2 loss Promotes CO2 assimilation

32 4 JANUARY 2019 • VOL 363 ISSUE 6422 sciencemag.org SCIENCE

Published by AAAS
South et al. revisited two previously estab- were introduced into the model crop tobacco, ATOMIC PHYSICS
lished synthetic bypasses of photorespiration which was investigated not only in growth
(6, 7) and tested a newly designed pathway
in genetically modified tobacco plants. These
pathways aim to completely metabolize the
chambers and greenhouses, but also in field
trials. Thus, the yield gains manifested in an
agriculturally relevant scenario and not only
Really cool
photorespiratory metabolite glycolate, which
is generated from 2-PGlycolate by phospho-
in controlled environments.
Importantly, the synthetic pathways open neutral
glycolate phosphatase within the chloroplast.
They release CO2 close to RuBisCO (not in mi-
tochondria, as in natural photorespiration)
new avenues for reevaluating long-standing
hypotheses regarding the importance of
photorespiration beyond detoxification of
plasmas
to increase the ratio of CO2 to O2 fixation.
Alternative pathway (AP) 1 originates from
2-PGlycolate. Photorespiration is considered
indispensable for photosynthesis in an O2-
Properties of laser-cooled
the bacterium Escherichia coli and uses five containing atmosphere, and mutants defec- neutral plasmas can be
enzymes that oxidize glycolate via glyoxylate
and tartronic semialdehyde to glycerate (6).
tive in photorespiration can only survive in a
high-CO2 atmosphere (10). Genetic suppres-
used to model high–energy-
The second bypass, AP2, uses three enzymes sor screens on such mutants have been un- density plasmas
that convert glycolate via glyoxylate and ma- successful to date. The study of South et al.
late to acetyl–coenzyme A (CoA). AP2 also demonstrates that a photorespiratory pheno-
requires the expression of catalase for de- type (repression of PLGG1) can be suppressed By Scott Bergeson
toxification of hydrogen peroxide that results by metabolic engineering. The true reason or

Downloaded from http://science.sciencemag.org/ on January 3, 2019


P
from conversion of glycolate to glyoxylate by reasons for the indispensability of photorespi- lasmas are supposed to be hot. Hy-
glycolate oxidase (7). AP1 and AP2 were previ- ratory metabolism are intensely debated and drogen nuclei undergo fusion in the
ously shown to increase biomass (6, 7). AP3 include the detoxification of 2-PGlycolate; Sun because plasma temperatures
was newly designed by South et al. In AP3, carbon salvage; biosynthesis of the amino and pressures are so high. On page
only two transgenes had to be introduced into acids glycine and serine (11); generation of 61 of this issue, Langin et al. (1) re-
the plant chloroplast: a glycolate dehydroge- activated C1-units; and protection from pho- port on a completely different kind
nase that converts glycolate into glyoxylate toinhibition and dissipation of excess excita- of plasma by photoionizing a laser-cooled
derived from the green alga Chlamydomonas tion energy (2, 12, 13). The work of South et al. gas of strontium atoms. The ion tempera-
reinhardtii was redirected to tobacco chloro- indicates that plant metabolism adapts to the ture is a chilly 0.05 K, so thermal speed of
plasts, and similar to AP2, a malate synthase synthetic pathways and compensates for re- the ions is equivalent to a person taking a
was expressed to convert glyoxylate to malate duced flux through the peroxisomal and mi- brisk walk. Surprisingly, the properties of
and eventually to acetyl-CoA via the native tochondrial parts of native photorespiration. this low-density, low-temperature plasma
chloroplast-resident nicotinamide adenine This implies that 2-PGlycolate detoxification provide clues about the workings of high–
dinucleotide phosphate (NADP)–malic en- and carbon recycling are the critical functions energy-density physics relevant for fusion
zyme (see the figure). Using the green algal of photorespiration. power research.
glycolate dehydrogenase instead of plant Recently, the optimization of a mecha- A very simple description of a plasma is
glycolate oxidase prevents production of nism that protects plants from excess light, that it is an ionized gas. In equilibrium, ion-
hydrogen peroxide, and hence additional ex- nonphotochemical quenching (NPQ), which ization occurs when the temperatures are
pression of catalase is unnecessary. is dissipation of excess excitation energy as high enough and when charged particles
Two important differences from the origi- heat, afforded appreciable yield gains (14). It in the plasma are moving fast enough that
nal pathway designs (6, 7) represent major is important to test whether a combination of collisions tear electrons away from their
advances. Besides introducing a synthetic by- engineered photorespiration with optimiza- parent atoms and ions. The Boltzmann
pass, South et al. also reduced the expression tion of NPQ will enable additive yield gains. equation is the main tool for modeling
of PLASTIDIAL GLYCOLATE/GLYCERATE Realizing the yield gains afforded by the syn- the plasma environment (2). With a hand-
TRANSPORTER 1 (PLGG1) (8). This modifica- thetic bypass in crops will require genetic ful of approximations and extensions, this
tion was suggested previously (9) to increase engineering because the required enzymes and related equations successfully describe
the potential of synthetic bypasses, because it are not present in plant genomes and hence processes used to create integrated circuits,
restricts the export of glycolate from chloro- cannot be targeted by breeding or genome light neon signs, and generate colorful
plasts and hence promotes its consumption editing technologies. j flames. This success is somewhat surprising
by the synthetic bypass. A larger portion of because the collisions occur through Cou-
REFERENCES
glycolate is decarboxylated within the chloro- lomb interactions, which are long-range
1. T. J. Erb, J. Zarzycki, Curr. Opin. Biotechnol. 49, 100 (2018).
plast by the synthetically engineered bypass, 2. H. Bauwe et al., Trends Plant Sci. 15, 330 (2010). interactions and lead to many-body effects,
leading to enhanced CO2 fixation activity of 3. P. F. South et al., Science 363, eaat9077 (2019). but the Boltzmann equation is based on
4. M. Eisenhut et al., Proc. Natl. Acad. Sci. U.S.A. 105, 17199
RuBisCO. This comes with an impressive yield (2008). two-body collisions in a low-density envi-
gain of more than 40%. Importantly, yield 5. A. Bar-Even, Plant Sci. 273, 71 (2018). ronment. However, effective collision cross
improvements positively correlated with the 6. R. Kebeish et al., Nat. Biotechnol. 25, 593 (2007). sections that include many-body effects can
7. A. Maier et al., Front. Plant Sci. 3, 12 (2012).
expression levels of the introduced enzymes, 8. T. R. Pick et al., Proc. Natl. Acad. Sci. U.S.A. 110, 3185 (2013). be calculated (with help from Chapman,
which highlights the importance of high and 9. A. P. Weber, A. Bräutigam, Curr. Opin. Biotechnol. 24, 256 Enskog, Bogoliubov, and others), so these
(2013).
balanced expression of the transgenes. Typi- 10. C. R. Somerville, Plant Physiol. 125, 20 (2001). kinetic theories can often give very accurate
cal annual yield gains in crop breeding are 11. R. M. Benstein et al., Plant Cell 25, 5011 (2013). results (3, 4).
below 2%; hence, the synthetic pathway holds 12. A. Kozaki, G. Takeba, Nature 384, 557 (1996).
13. M. Eisenhut et al., Mol. Plant 10, 47 (2017).
potential for a step change in yield improve- 14. J. Kromdijk et al., Science 354, 857 (2016). Department of Physics and Astronomy,
ment by genetic modification of crops. In Brigham Young University, Provo, UT 84602, USA.
contrast to earlier work (6, 7), the pathways 10.1126/science.aav8979 Email: scott.bergeson@byu.edu

SCIENCE sciencemag.org 4 JANUARY 2019 • VOL 363 ISSUE 6422 33


Published by AAAS
INSIGHTS | P E R S P E C T I V E S

The foundation of this treatment rests (5). In fusion-class plasmas, for example, shown how to laser-cool ions in a neu-
on a hierarchy of length scales. The Debye the non-ideal limit is approached in the tral plasma, which overcomes a critical
length lD is the distance over which elec- early stages of the plasma evolution dur- roadblock in the field of strongly coupled
trons rearrange their positions so that there ing compression and early heating of the plasma physics. Although photoionized
is zero electric field inside the plasma. This system, and G ~ 1. The traditional concept laser-cooled gases are initiated with essen-
length must be shorter than the extent of the of a collision becomes problematic because tially zero kinetic energy, the ions instantly
plasma but longer than the average distance lD ≈ aWS ≈ r0. experience strong accelerating forces
between ions in the plasma, the so-called The plasmas created by Langin et al. are from neighboring ions and heat up. This
Wigner-Seitz radius aWS. These constraints similar to high–energy-density plasmas be- “disorder-induced heating” limits G to val-
ensure that there are many particles in a lD- cause they have comparable values of G (6). ues near 2 (11), but laser-cooling the plasma
sized sphere so that Boltzmann’s statistical Thermodynamic properties of plasmas can ions makes it possible to manipulate the
assumptions about collisions will hold. The be expressed in terms of G, so all plasmas value of G. Thus, collision physics in this
Debye length must also be orders of magni- with a given value of G are thermodynami- system can serve as a check on benchmark
tude longer than the classic distance of clos- cally similar. Thus, these ultracold neutral calculations. It also means these low-
est approach r0, which can be thought of as plasmas can help probe the frontier of fu- temperature plasmas can be used as simu-
the minimum distance between two ions in sion science (see the figure). Measurements lators for high–energy-density plasmas.
a head-on collision. of collision properties (momentum trans- In what seems like a paradox, the ultra-
Treatments like the Boltzmann equa- fer, thermal relaxation, diffusion, collision cold neutral plasmas of Langin et al. can
tion are valid when lD >> aWS >> r0. This cross sections, Coulomb logarithms, and help us understand collision parameters in
high–energy-density plasma science. Un-

Downloaded from http://science.sciencemag.org/ on January 3, 2019


der dense fusion plasma conditions, these
What cold plasmas can say about hot ones parameters are nearly impossible to mea-
The properties of neutral plasmas created by Langin et al. inform models of plasmas at higher temperature and sure directly. Even with the best computer
pressure when they have similar values of the strong-coupling parameter G. simulations, it is challenging to compute
the values of these parameters with confi-
Cold-atom plasma Fusion dence. Extensions of kinetic theories into
the strongly coupled regime, which are vali-
dated through modeling of plasmas, will fa-
Laser-driven Laser cilitate computer modeling of more complex
Computational ignition and technologically interesting plasmas.
modeling
As laser-cooled plasmas become physically
larger or reach longer confinement times, it
⌫ Hydrogen
may be possible to initiate and study clas-
ice
sic plasma instabilities (12) or to initiate
Laser cooling and and characterize bump-on-tail distribution
High temperature
interrogation relaxations (13). These systems could also
and pressure
Making cold measurements Modeling hot problems
lead to higher-brightness focused-ion beam
Spectroscopic studies of cold neutral plasmas allow These parameters improve models of laser-driven sources (14), which perhaps could be use-
measurement of many parameters that are difcult nuclear fusion because the two plasmas have ful in ion implantation or x-ray source de-
to obtain from high–energy-density plasmas. similar parameterized collision rates. sign. For very large values of G = 172, the
ions will form a Coulomb crystal. Perhaps
regime is that of “ideal” plasmas, and all related quantities) can be made in these in that configuration, it will be possible to
plasmas that obey these conditions are low-temperature, low-density plasmas and engineer massively entangled states useful
similar. An equivalent way to express these then directly applied to computer models of for quantum computation or for high-preci-
foundational assumptions in plasma sci- plasmas with similar values of G. sion metrology. j
ence uses characteristic energies instead These plasmas do not constitute the first
REFERENCES
of lengths. The average kinetic energy per laser-cooled ions, which were reported by
1. T. K. Langin, G. M. Gorman, T. C. Killian, Science 363, 61
particle is approximately KE ≈ kBT, where the groups of Dehmelt (7), Wineland (8), (2019).
kB is Boltzmann’s constant and T is the and others in the 1970s. Nor are these the 2. P. L. Bhatnagar, E. P. Gross, M. Krook, Phys. Rev. 94, 511
plasma temperature. For singly charged coldest ions reported; the ion trapping and (1954).
3. S. D. Baalrud, J. Daligault, Phys. Rev. Lett. 110, 235001
ions, the average nearest-neighbor electri- quantum information community achieve (2013).
cal potential energy per particle is U = e2/ mean temperatures approaching the zero- 4. L. G. Stanton, M. S. Murillo, Phys. Rev. E 93, 043203 (2016).
(4p«0aWS), where e is the electron charge point energy of the trap (9). Ultracold neu- 5. R. P. Drake, High-Energy-Density Physics (Springer, ed. 2,
Heidelberg, 2018).
and «0 is the permittivity of free space. The tral plasmas have also been reported, and 6. T. K. Langin et al., Phys. Rev. E 93, 023201 (2016).
ratio of these two energy scales is called Killian and co-workers have contributed 7. W. Neuhauser, M. Hohenstatt, P. Toschek, H. Dehmelt,
the strong-coupling parameter G ; U/KE to the development of this field (10). These Phys. Rev. Lett. 41, 233 (1978).
8. D. J. Wineland, R. E. Drullinger, F. L. Walls, Phys. Rev. Lett.
= r0/aWS, basically the cube root of density are, however, the coldest neutral plasmas 40, 1639 (1978).
divided by temperature. The basic assump- yet reported, and neutrality means that the 9. T. Rosenband et al., Science 319, 1808 (2008).
GRAPHIC: C.BICKEL/SCIENCE

tion of kinetic plasma theories is that G << strong laboratory fields associated with ion 10. T. C. Killian et al., Phys. Rev. Lett. 83, 4776 (1999).
11. Y. C. Chen et al., Phys. Rev. Lett. 93, 265003 (2004).
1, that is, conditions of low density and high trapping are absent.
12. P. W. Terry, Rev. Mod. Phys. 72, 109 (2000).
temperature. The presence of those fields typically 13. D. V. Dylov, J. W. Fleischer, Phys. Rev. Lett. 100, 103903
When the foregoing hierarchy of length dominates the ion motion for trapped (2008).
or energy scales is not met, the plasma is ions and obscures the underlying inter- 14. D. Murphy et al., Nat. Commun. 5, 4489 (2014).

said to be “non-ideal” or “strongly coupled” esting plasma physics. Langin et al. have 10.1126/science.aau7988

34 4 JANUARY 2019 • VOL 363 ISSUE 6422 sciencemag.org SCIENCE

Published by AAAS
Commitments have been made to improve
tracking of products from tuna (such as
Atlantic bluefin tuna) from vessel to final buyer.

action and indirect appeals to countries or


intergovernmental bodies to adopt ocean
governance reforms. By November 2018, the
number of contributions registered through
the UN’s registry of voluntary commitments
(8), a web-based site that remains open for
new registrations and updating on progress,
had grown to 1478.
The pledging of voluntary commitments
across government, civil society, and the pri-
vate sector also stands at the heart of the Our
Ocean conferences. Although not directly
P OLICY FORUM linked to the 2030 Agenda, the Our Ocean
Conference series is complementing efforts of
the UN process and has a strong topical rela-
OCEAN GOVERNANCE tionship to SDG 14 (9). In total, 305 commit-

Downloaded from http://science.sciencemag.org/ on January 3, 2019


ments for action were announced at the 2018

From voluntary commitments conference, covering six topical strands: ma-


rine protected areas, climate change, sustain-
able fisheries, marine pollution, sustainable
to ocean sustainability blue economy, and maritime security (10). At
the Our Ocean Conference 2017, hosted by
the European Union in Malta, 437 announce-
A common pledge and review system is needed ments for “tangible and measurable commit-
ments” had been made toward ocean health
By Barbara Neumann and Sebastian Unger A SURGE OF OCEAN COMMITMENTS and sustainability (9, 11), including a large
The UN Ocean Conference had encouraged number from the private sector. Although

V
oluntary commitments by states, gov- state and nonstate actors to submit com- smaller in the number of commitments than
ernmental or nongovernmental orga- mitments to advance implementation of the UN process, the Our Ocean conferences
nizations, and other actors, aiming to Sustainable Development Goal (SDG) 14 succeed particularly in mobilizing financial
deliver outcome-oriented activities, and associated targets (4). Part of a compre- resources or pledges for creation of new ma-
have become a well-recognized mech- hensive framework of 17 interlinked goals rine protected areas.
anism in international sustainability under the UN’s 2030 Agenda for Sustain-
policy (1–3). For ocean governance, the call- able Development (5), SDG 14 calls on states A TRANSFORMATIVE TOOL?
ing for and pledging of voluntary commit- and the global community to “conserve and Though not replacing state measures to im-
ments could become a game changer, with sustainably use the oceans, seas and marine plement legally binding agreements, we be-
two major international processes harness- resources for sustainable development.” It is lieve that voluntary commitments hold great
ing such voluntary contributions in recent underpinned by 10 specific targets address- additional potential for driving transforma-
years: the Our Ocean conferences, an annual ing marine pollution, conservation, ocean tive change for the ocean. They mobilize ac-
high-level series initiated by U.S. Secretary acidification, fisheries, benefits for Small Is- tions and means for improving ocean health,
of State John Kerry in 2014, and the United land Developing States, small-scale fisheries, support the creation of new partnerships
Nations (UN) Ocean Conference, which took scientific knowledge and marine research, across different sectors and actor groups, and
place for the first time in June 2017. Such and international law. facilitate learning processes and exchange
calls and commitments provide opportuni- More than 1300 voluntary commitments of innovative practice. By lowering barriers
ties to raise awareness, promote engage- for ocean action, such as measures for com- to address complex cross-cutting problems,
ment, and catalyze political will for action bating marine pollution or strengthening the nonbinding nature of voluntary commit-
on the part of states as well as public and capacity for marine research, were made at ments also helps to overcome established but
private sectors. However, without effective the UN Ocean Conference by governments, problematic sectorial approaches in ocean
and transparent review systems, it is diffi- the UN system, civil society organizations, governance. Voluntary commitments also
PHOTO: RICHARD HERRMANN/MINDEN PICTURES

cult to link pledged commitments to actual academia, the scientific community, and the create normative pressure (1, 12) and increase
implementation. Quality control and ensur- private sector (6). Despite the open call for expectations to play an active role in improv-
ing that commitments are effective and im- contributions, the majority of commitments ing ocean health.
pactful will be difficult to achieve. A uniform registered were still made by governmental However, central oversight is needed to
global process is required to register and as- actors and civil-society organizations (7). ensure that promises are kept. Without a
sess commitments, including consistent re- But they also include innovative initiatives transparent and rigorous pledge and review
porting and monitoring systems with clear from the private sector and philanthropic system for all ocean-related commitments,
targets, baselines, and review systems. organizations such as the Tuna 2020 Trace- there is a risk of double-announcing in vari-
ability Declaration or the Seafood Business ous forums or creating a flurry of low-impact
Institute for Advanced Sustainability Studies (IASS), 14467 for Ocean Stewardship (SeaBOS) platform, or short-term activities that do not deliver
Potsdam, Germany. Email: sebastian.unger@iass-potsdam.de which seek change both through collective progress on targets. Other critical challenges

SCIENCE sciencemag.org 4 JANUARY 2019 • VOL 363 ISSUE 6422 35


Published by AAAS
INSIGHTS | P O L I C Y F O RU M

associated with voluntary commitment pro- other ocean-related SDGs and targets. ments should be reported to and assessed
cesses are accountability, enforcement, effec- To identify trends and to measure distance by the UN’s High-level Political Forum on
tiveness, and progress accounting (2, 13). and progress to targets, this global registry Sustainable Development and reflected in
The pledging processes under the UN should be linked to baseline data in exist- the Global Sustainable Development Report.
Ocean Conference and the Our Ocean series ing databases and assessment processes on The registry should also seek synergies with
seek to address these challenges to a certain the state of the marine environment. For reporting systems for other goal-based policy
extent through their individual registrations example, the World Database on Protected frameworks such as the UN Paris Agreement
procedures that request the formulation of Areas, which is run by the UN Environment on climate change.
commitments along defined criteria. Our World Conservation Monitoring Centre Both the UN Ocean Conference process
Ocean 2018, for the first time, published a (UNEP-WCMC) and the International Union and the Our Ocean series will continue to col-
report seeking to describe progress on com- for Conservation of Nature (IUCN), the UN’s lect voluntary commitments toward the next
mitments made under previous Our Ocean World Ocean Assessment, or the UN Food UN Ocean Conference planned for 2020 and
conferences (14), and the UN’s registry of and Agriculture Organization’s world fishery the upcoming Our Ocean conferences in Nor-
voluntary commitments invites pledging en- and aquaculture statistics could provide the way (2019) and Palau (2020). And there have
tities to provide updates on progress through necessary information. been first discussions of possible coordina-
their website (8). But the two registry systems In addition, independent scientific data tion of the two commitment systems, a prom-
are neither harmonized in terms of the data and assessments such as the Ocean Health ising prospect for developing an orchestrated
gathered nor in the standards for acceptance Index (15) or the MPAtlas of the Marine Con- post-2020 strategy for ocean sustainability
and registration of commitments. This lack servation Institute could be taken into ac- with a uniform global pledge and review sys-
of robust and consistent tracking and report- count. The UN Decade of Ocean Science for tem for voluntary ocean commitments. j

Downloaded from http://science.sciencemag.org/ on January 3, 2019


ing processes, and missing links to existing Sustainable Development (2021 to 2030), an RE FERENCES AND NOTES
environmental baseline data, impede assess- upcoming global effort to boost international 1. B. Guy, Econ. Soc. Rev. (Irel.) 45, 223 (2014).
ments of transformative effects and overall cooperation in ocean sciences, could help to 2. P. Pattberg, O. Widerberg, Ambio 45, 42 (2016).
3. M. Beisheim, A. Ellersiek,“Partnerships for the 2030 Agenda
progress toward goals. further strengthen the knowledge base of the for Sustainable Development: Transformative, inclusive and
A centralized registry, however, is needed review process. accountable?” (SWP Research Paper, Berlin, 2017).
to learn whether voluntary commitments Under the proposed strategy and a central 4. United Nations,“Voluntary Commitments for the implemen-
tation of Goal 14” (2017); https://sustainabledevelopment.
produce desired outcomes on the ground, registry, pledging of voluntary commitments un.org/content/documents/12816The%20Ocean%20
to identify trends, and to facilitate adjust- could take place throughout the year and be Conference%20-%20Guidance%20on%20Voluntary%20
Commitments%20final.pdf.
ments of policies. If kept separately, a com- highlighted on an annual basis at the Our 5. United Nations,“Transforming our world: The 2030
petition between pledging systems with Ocean conferences or other high-level meet- Agenda for Sustainable Development. UNGA Resolution A/
diverging objectives, different standards, ings of states and relevant actors such as the RES/70/1” (Resolution adopted by the General Assembly on
25 September 2015 70/1, New York, 2015).
and a general lack of monitoring and ac- UN Environment Assembly. Comparability of 6. IISD,“Summary of The Ocean Conference: 5-9 June 2017”
countability may obscure their potential for commitments and assessment of impact and (Earth Negotiations Bulletin, vol. 32, 2017); http://enb.iisd.
org/oceans/sdg14conference/enb/.
improving ocean health and governance. progress would be facilitated through com- 7. Division for Sustainable Development, M. Vierros, R.
mon reporting formats. The registry would Buonomo,“In-depth analysis of Ocean Conference
BUILDING BLOCKS FOR POST-2020 be evaluated and commitments assessed Voluntary Commitments to support and monitor their
implementation. 14 Life Below Water” [Department of
As 5 of 10 SDG 14 targets mature in 2020 every 3 years at the UN Ocean Conference, Economic and Social Affairs (DESA)], United Nations, New
and—possibly with the exception of the tar- providing an accountability moment for the York, 2017); https://sustainabledevelopment.un.org/con-
tent/documents/17193OCVC_in_depth_analysis.pdf.
get to conserve at least 10% of coastal and global community. This would also aid the 8. United Nations,“The Ocean Conference Registry of
marine areas (7)— will most likely not be steering of calls for action into directions Voluntary Commitments” (2018); https://oceanconference.
achieved by then, the coming years will be where topical or geographical gaps have been un.org/commitments/.
9. European Commission,“Our Ocean Conference 2017. Final
critical for achieving the ocean goal. A cred- identified, and the aligning of actions on report” (2017); www.ourocean2017.org/sites/default/files/
ible post-2020 strategy is therefore needed international, regional, and national scales. ooc-2017-report.pdf.
10. Ministry of Marine Affairs and Fisheries, Republic of
to support the implementation of SDG 14, Bringing together these different types of Indonesia,“Our Ocean Commitments” (2018); https://
ideally harmonized with the post-2020 bio- data and information, such a common pledge ourocean2018.org/?l=our-ocean-commitments.
diversity framework currently developed and review system could determine whether 11. European Commission,“Our Ocean 2017 commitments”
(2017); www.ourocean2017.org/sites/default/files/
under the Convention on Biological Diversity the global community is on track to achieve ooc-2017-list-of-commitments_en.pdf.
(CBD). One of the key building blocks for the goals set for the ocean and help to orches- 12. M. Stafford-Smith et al., Sustain. Sci. 12, 911 (2017).
13. J. Foti,“Promises kept: Ensuring ambition and account-
such a strategy could be a unified and com- trate further action. ability through a Rio+ 20 ‘compendium of commitments’”
prehensive global registry for voluntary com- The registry should be hosted by an in- (Working paper, WRI, 2012).
mitments. The existing pledging schemes ternational body and be maintained and 14. Ministry of Marine Affairs and Fisheries, Republic
of Indonesia,“Progress of Our Ocean Conference
and registries of voluntary commitments updated regularly in close cooperation with Commitment” (2018); https://ourocean2018.org/assets/
under the UN Ocean and the Our Ocean competent global and regional organizations, files/progress_commitment.pdf.
15. B. S. Halpern et al., PLOS ONE 12, e0178267 (2017).
conferences would lend themselves as strong ensuring transparent access to data and
starting points to developing such a global information. This could be supplemented ACKNOWL EDGMENTS
registry and reporting mechanism. by independent reviews from scientific in- We thank participants of the 2017 Potsdam Ocean Governance
The role of this new system would be to stitutions and nongovernmental organiza- Workshop for their contributions on the topic, and are grateful to
the following experts for their input and reflections: M. Caldwell,
take stock of voluntary commitments; report tions. The registry would provide grounds J. Hammersland, D. Herr, M. Knigge, M. Kobayashi, A. Mondré, H.
on progress on implementation; provide for developing and applying indicators and Schopmans, and T. Thiele. We thank L. von Pogrell, J. Pütz, and S.
transparency and independent verification; analytical frameworks for monitoring and Heinecke for support in researching data. This work is supported
by the German Federal Ministry of Education and Research
provide joint quality criteria for voluntary evaluating performance and impacts, and as- (BMBF) through its Research for Sustainable Development
commitments; identify trends and highlight sist in sharing of good practices. program (FONA), and the Federal State of Brandenburg.
thematic and geographical gaps; and ana- Regular assessments of the pledge and
lyze distance and progress to SDG 14 and review process for voluntary ocean commit- 10.1126/science.aav5727

36 4 JANUARY 2019 • VOL 363 ISSUE 6422 sciencemag.org SCIENCE

Published by AAAS
NATO’s efforts stopped short of confronting the
environmental degradation caused by warfare.

another round of environmental research,


with obvious strategic applications.
After the rise of Ronald Reagan and Mar-
garet Thatcher led NATO to again de-empha-
size environmental research, the collapse of
the Soviet Union led the CCMS to support
efforts to rehabilitate defunct Cold War mili-
tary bases. Environmental research at NATO
lives on but faces challenges amid the alli-
ance’s increasing focus on the “cybersphere.”
In the end, Turchetti convincingly argues
not only that militaries fostered the emer-
gence of modern environmental sciences but
also that they long set the agenda for ma-
B O OKS et al . jor research programs in its disciplines. His
analysis of the American role within NATO
is especially compelling. Far from a Cold War

Downloaded from http://science.sciencemag.org/ on January 3, 2019


hegemon, the United States in Greening the
HISTORY OF SCIENCE Alliance could only achieve its objectives
with the cooperation of often-reluctant allies.

A military alliance goes green Skeptics will note, however, that American
officials repeatedly determined when, and
how, NATO would pursue environmental re-
Seeking solutions to Cold War divisions, in the mid-20th search and policy.
The protagonists of Greening the Alliance
century NATO embraced environmentalism are scientists in the upper echelons of Cold
War military and diplomatic institutions.
By Dagomar Degroot search with obvious strategic applications, This focus makes for a richly detailed story of
it actually exacerbated divisions among political maneuvering and high-minded ide-

W
ar and preparation for war have the allies. als, yet it also deprives Turchetti’s narrative
long led militaries to exploit, In 1966, Turchetti argues, growing dissat- of context that might have given it greater
transform, and degrade environ- isfaction with NATO’s science program came significance. Politicians and military officers
ments. How ironic, then, that at to a head. The rise of environmentalism, the are rarely mentioned by name, and ordinary
the height of the Cold War, the sinking of the tanker SS Torrey Canyon, and people who may have shaped the course of
North Atlantic Treaty Organiza- the political opportunism of Richard Nixon scientific research, such as North Sea fisher-
tion (NATO)—the most powerful military all led to an American push for a new kind of men resistant to early oceanographic surveys,
alliance ever assembled—emerged as a lead- environmental research at NATO. Enter the rarely receive much attention.
ing proponent of environmental- “Committee on the Challenges of Key scientific controversies discussed in
ism. Simone Turchetti’s Greening Modern Society” (CCMS), estab- Greening the Alliance—the possibility of nu-
the Alliance is the first book to lished in 1969 to fund research clear winter, for example—frequently appear
explain the surprising rise, re- into toxicology, devastated ecosys- with little explanation, and Turchetti opts not
peated revision, and possible tems, and environmental moni- to compare NATO’s environmental programs
decline of NATO’s environmental toring. Research pioneered by with similar and simultaneous efforts in
research program. the committee steadily advanced other western institutions. (Neil Maher has
Turchetti organizes his book a brand of environmentalism recently revealed that NASA similarly strug-
chronologically. After insightful that prized scientific rationalism gled to implement an “environmental turn”
passages on sources and meth- Greening the Alliance rather than the radical counter- in the 1970s, for example.) Moreover, because
Simone Turchetti
ods, he traces the diplomatic University of Chicago culture of the grassroots environ- Turchetti rarely explains the scope and sig-
tensions and maneuverings that, Press, 2018. 263 pp. mentalist movement. nificance of NATO’s environmental science
in 1958, led representatives of Yet, Turchetti explains that Eu- program within the broader development
the United States and Britain to cooperate ropean allies repeatedly stalled CCMS initia- of 20th-century science, it is difficult for the
in securing support for a new NATO Sci- tives, which in any case never confronted reader to know just how important the activi-
ence Committee. Supporting environmen- the environmental impact of military activi- ties of the CCMS really were.
tal research, they hoped, would promote ties. When the CCMS exposed new divisions Written in workmanlike prose, Green-
parallel diplomacy to repair deepening di- within NATO, American support withered, ing the Alliance is therefore a book that will
PHOTO: WIKIMEDIA COMMONS

visions among the alliance’s 12 signatories. and the alliance’s commitment to environ- primarily appeal to a relatively small group
Yet because the committee sponsored re- mentalism seemed to fade. By that time, of historians and political scientists. Yet for
however, emerging weapons systems in the those specialists, it succeeds in telling a new
United States and the Soviet Union increas- and critically important story. j
The reviewer is at the Department of History,
Georgetown University, Washington, DC 20057, USA. ingly demanded constant environmental
Email: dd865@georgetown.edu surveillance. This new reality encouraged 10.1126/science.aav1863

SCIENCE sciencemag.org 4 JANUARY 2019 • VOL 363 ISSUE 6422 37


Published by AAAS
INSIGHTS | B O O K S

ECONOMICS

Robots, telework, and the jobs of the future


Globalization and AI are primed to disrupt tomorrow’s workplace, argues an economist

By Jon Peha will now have to compete with accountants The Globotics Upheaval
around the world. An accountant whose Globalization, Robotics,
and the Future of Work

I
n the conference room of a popular San primary advantage is the ability to detect
Francisco–based magazine, journal- complex patterns in financial data will have Richard Baldwin
Oxford University Press,
ists and editors walk through the door, to compete with machine-learning software 2019. 300 pp.
gathering for a staff meeting. One col- that never sleeps or asks for a raise.
league, however, rolls in on two large For people hoping to choose a profession
motorized wheels. that won’t soon be replaced, Baldwin recom-
“EmBot” is a human-sized robot that mends those that require physical proximity fast for society to absorb. Baldwin portrays
shows live video of Emily Dreyfus, a staff and that take advantage of distinctly human the progress of telepresence and AI as sud-
writer who lives 3000 miles away. But qualities, such as creativity, social awareness, denly becoming rapid, but these technolo-
EmBot is more than a face on a screen. It ethics, and empathy. AI robots cannot (yet) gies have been progressing for decades.

Downloaded from http://science.sciencemag.org/ on January 3, 2019


can turn toward whomever is speaking or write articles for Science, for example, and Thanks to the vast expansion of un-
chase a colleague of Dreyfus’s down the they are terrible preschool teachers. dersea fiberoptic cables in the 1990s,
hall. EmBot is an example of the telep- Disruptive change can lead to backlash. widespread adoption of the Internet, and
resence technology that Richard continuous improvement in col-
Baldwin, author of The Globotics laboration software, we already live
Upheaval, believes will cost many with many effects of telepresence.
workers in wealthy nations their Multinational companies routinely
jobs, allowing them to be replaced hire the most competitive workers
with “telemigrants” from abroad. anywhere in the world and use this
But even telemigrants face stiff technology to move jobs to work-
competition in the emerging econ- ers rather than moving workers to
omy. EmBot has software-based jobs. Similarly, AI algorithms have
cousins that use artificial intelli- already replaced humans in many
gence (AI) to perform tasks we once endeavors, including monitor-
thought required highly skilled hu- ing everything from surveillance
mans, from searching for the legal video to credit card purchases, just
precedents of a patent dispute to as websites have all but replaced
spotting cancer in a magnetic reso- travel agents.
nance image. So far, there has been workplace
Baldwin’s thesis is that globaliza- change but little true upheaval. Both
tion and AI robots constitute a “glo- telepresence and AI technology are
botics” tidal wave that will shake the still making impressive progress,
foundation of middle-class prosper- but The Globotics Upheaval pro-
ity in wealthy nations. This, he ar- vides no way to judge whether the
gues, will lead to social upheaval, just pace of advancement will eventually
as 19th-century steam engines and exceed what society can absorb.
mechanical looms created workplace A remote reporter for the Toronto Star greets a co-worker. Nonetheless, Baldwin presents
disruptions that brought workers to a compelling view of the future
the streets in sometimes violent protest. Baldwin argues that 2016 vote outcomes of work and the serious challenges ahead
Although globotics will improve produc- favoring Brexit in the United Kingdom while there is still time to prepare. He
tivity and create new jobs, by some estimates and Donald Trump in the United States wisely argues that we must protect work-
cited in the book, it could also replace more were backlashes to globotics. Although ers, without necessarily protecting specific
PHOTO: RICK MADONIK/TORONTO STAR/GETTY IMAGES

than half of current jobs in a developed econ- this was not a period of high unemploy- jobs as they become outdated, and that we
omy. The effects will be uneven. ment—Trump was elected after 7 years of must do more to help those who’ve been
Some skilled workers will prosper as they solid economic growth that drove the U.S. displaced by technology reenter the work-
gain the ability to compete for jobs across unemployment rate from 10 to 4.6%—it is force and offer such individuals a strong
the globe; others will become obsolete. An possible that globotics could have contrib- safety net along the way.
accountant whose primary competitive ad- uted to low growth in wages. I would add education reform to the
vantage is that she lives within easy driving Although the book offers valuable in- prescription: Moving forward, schools and
distance of a commercial hub, for example, sights into the long-term impact that glo- universities should teach students to work
balization and AI will have on workers, with emerging technology rather than
The reviewer is at the Department of Engineering and Public the case that globotics will bring upheaval compete against it. j
Policy and the Department of Electrical and Computer
Engineering, Carnegie Mellon University, Pittsburgh, PA 15213, is less convincing. Upheaval occurs when
USA. Email: peha@cmu.edu technology advances at a pace that is too 10.1126/science.aav6273

38 4 JANUARY 2019 • VOL 363 ISSUE 6422 sciencemag.org SCIENCE

Published by AAAS
RESEARCH
Fluorinated aryl groups couple
to form nanographenes
Kolmer et al., p. 57

IN S CIENCE JOURNAL S Edited by Stella Hurtley

VIROLOGY mutually exclusive binding of


Sec63 and the ribosome to the
Mobile detection channel. —SMH
of Lassa virus Science, this issue p. 84
Lassa fever is a hemorrhagic viral
disease endemic to West Africa.
CHEMICAL PHYSICS
Usually, each year sees only a
smattering of cases reported, but C60 at high resolution
hospitalized patients risk a 15% It generally takes more energy
chance of death. Responding to for molecules to vibrate than to
fears that a 10-fold surge in cases rotate. A vibrational absorption
in Nigeria in 2018 signaled an band thus encompasses many
incipient outbreak, Kafetzopoulou distinct concurrent rotational
et al. performed metagenomic transitions, but these tend to blur
nanopore sequencing directly together when the molecules
from samples from 120 patients have more than a few atoms.
(see the Perspective by Bhadelia). Changala et al. succeeded in cool-
Results showed no strong ing C60 fullerenes sufficiently to
evidence of a new strain emerg- obtain rotational resolution within
ing nor of person-to-person a C–C stretching band. Success
transmission; rather, rodent hinged on careful optimization
contamination was the main of argon buffer gas flow. Such
source. To prevent future escala- quantum state–resolved features
tion of this disease, we need to could aid characterization of
understand what triggers the fullerene-type compounds in
irruption of rodents into human exotic environments such as
dwellings. —CA interstellar space. —JSY
Science, this issue p. 74; Science, this issue p. 49
see also p. 30

ATOMIC PHYSICS
PROTEIN TRANSLOCATION
Making a strongly
Posttranslational
CREDITS: (TOP TO BOTTOM) KOLMER ET AL.; DYLAN BUELL /STRINGER/GETTY IMAGES

Runners moving down Columbus Drive at the Chicago Marathon, October 2017 coupled plasma
translocon architecture Plasmas—gases of ionized
About a third of proteins are atoms and electrons—are
CROWD DYNAMICS
transported into endoplasmic naturally formed at high temper-
A crowd that flows like water reticulum by the universally
conserved Sec61 protein-
atures, such as those reached in
the interiors of stars. Describing

T
he behavior of large numbers of insects, animals, and
conducting channel. Itskanov plasmas theoretically is tricky
other flocks is often based on rules about individual inter-
and Park determined a cryo– when they are in the strongly
actions. Bain and Bartolo applied a fluid-like model to the
electron microscopy structure coupled regime; reaching that
behavior of marathon runners as they walked up to the
of the Sec complex from yeast, regime in the laboratory would
start line of the Chicago Marathon (see the Perspective by
which mediates posttranslational provide a valuable benchmark
Ouellette). They observed nondamping linear waves with the
translocation of many secretory for theory. To that end, Langin
same speed for different starting corrals of runners and at dif-
proteins across the endoplasmic et al. worked with a cold plasma
ferent races around the world. Their model should apply both
reticulum membrane. The study created out of atoms of stron-
to this type of polarized crowd as well as to other groups, which
reveals how Sec63 activates tium that were ionized by laser
may help guide crowd management. —BG
the Sec61 channel for substrate light (see the Perspective by
Science, this issue p. 46; see also p. 27 polypeptide insertion. The Bergeson). They used lasers to
structure also explains the cool the ions down to about 50

SCIENCE sciencemag.org 4 JANUARY 2019 • VOL 363 ISSUE 6422 39


Published by AAAS
RESEARCH | I N S C I E N C E J OU R N A L S

millikelvin, reaching the desired number, and proportion of the


strongly coupled regime. —JS population murdered, even when Edited by Caroline Ash
Science, this issue p. 61; compared to other 20th-century IN OTHER JOURNALS and Jesse Smith
see also p. 33 genocides. —PJB
Sci. Adv. 10.1126/
sciadv.aau7292 (2018).
PALEONTOLOGY
A proto-mammalian giant
Early terrestrial amniotes evolved PROKARYOTIC IMMUNITY
into two groups: the sauropsids,
which led to the bird and dinosaur
Additional, diverse
lineages, and the synapsids, CRISPR systems
which led to mammals. Synapsids CRISPR systems have been
were diverse during the Permian revolutionizing molecular biol-
but were greatly reduced after the ogy. Mining the metagenomic
end-Permian extinction (about database, Yan et al. system-
252 million years ago). The few atically discovered additional
groups that survived into the subtypes of type V CRISPR-Cas
Triassic were mostly small and systems. The additional Cas12
retained a sprawling gait. Sulej effectors displayed a range of
and Niedźwiedzki, however, activities, including target and
describe a dicynodont from collateral cleavage of single-
the Late Triassic of Poland that stranded RNA and DNA, as well as
is as large as some coexisting double-stranded DNA nicking and
dinosaurs and appears to have cleavage. These diverse nuclease
had an erect gait—like modern activities suggest how an ancient A Raggiana bird-of-paradise
mammals. Thus, megaherbivores transposase may have evolved from the Southern Highlands,
in the Triassic were not only dino- into various type V effectors and Papua New Guinea
saurs. —SNV expand the nucleic acid detec-
Science, this issue p. 78 tion and genome-editing toolbox.
—SYM HUMAN GENETICS Sinclair et al. studied plants that
are unable to deliver Zn into their
SOCIAL SCIENCES
Science, this issue p. 88
Alzheimer’s disease own xylem. The plant shoots were
Deadliest 100 days in admixed people thus internally starved regardless
DRUG DEVELOPMENT Several genes have been identi- of whether Zn was available from
of the Holocaust A long-lasting fied that increase the risk of the root. The Zn-starved shoots

PHOTOS: (LEFT TO RIGHT) SHAWSHOTS/ALAMY STOCK PHOTO; NATIONAL GEOGRAPHIC IMAGE COLLECTION/ALAMY STOCK PHOTO
More than 25% of the approxi- late-onset genetic disorders, signaled to roots to increase Zn
mately 6 million Jews murdered poison scavenger such as Alzheimer’s disease supplies. In response, the roots
during the Holocaust were killed Nerve agents are neurotoxic (AD). Specifically, the ApoE «4 up-regulated expression of the
in one 100-day period in 1942. compounds found in pesticides allele is associated with a higher genes encoding metal transport/
Stone used an unusual dataset and chemical weapons. They risk of developing AD. However, tolerance protein 2 (MTP2) and
of railway transportation records act by blocking the transmis- individuals of African ancestry heavy metal ATPase 2 (HMA2).
to show that during this period, sion of nerve impulses to the that carry this variant appear Local Zn deficiency in roots left
the Nazis murdered more than muscles, and exposure can be to be less prone to developing these same genes unaffected. It
1.47 million Jews, a kill rate that fatal within minutes. Zhang et al. AD. Rajabli et al. examined AD seems that Zn taken up in lateral
is 10 times higher than previous developed a nanoparticle-based cases and controls in admixed roots is transported into the
estimates. Contradicting contem- bioscavenger that breaks down individuals of Puerto Rican endoplasmic reticulum by MTP2,
porary analyses of the Holocaust, organophosphate nerve agents and African-American descent thus gaining access to the inter-
the author shows that Operation into innocuous compounds. and found that individuals who cellular symplastic network. The
Reinhard was exceptionally Prophylactic treatment of rats carried an African ApoE «4 Zn then progresses from outer
violent in its extreme kill rate, and guinea pigs confirmed background had less risk of epidermal cells toward the core
low immunogenicity developing the disease. It seems of the root, where it is exported
and good biodistribu- the African variant of ApoE «4 by HMA2 into the xylem for trans-
tion. Treated animals contains protective genetic port to the shoot. The shoot asks
were protected from variants. —LMZ for what it needs, and the root
repeated exposure PLOS Genet. 14, e1007791 (2018). delivers. —PJH
to the nerve agent Plant Cell 30, 2463 (2018).
sarin over 7 days. This
PLANT SCIENCE
nanoscavenger might
SKIN
thus help prevent nerve- Essential metal for plants
agent poisoning in Although zinc (Zn) is an essen- Roots of acne
Transport records have been analyzed to at-risk subjects. —MM tial micronutrient for plants and Most people experience a bout
estimate the number of Jews murdered by the Sci. Transl. Med. 11, humans, much of the world’s of acne at some stage in their
Nazis in 1942. eaau7091 (2019). agricultural land is deficient in Zn. life. For an unlucky few, the skin

40 4 JANUARY 2019 • VOL 363 ISSUE 6422 sciencemag.org SCIENCE

Published by AAAS
more than 48 days. The pres-
EVOLUTION ence of the smaller nanoparticles
in muscle tissue suggests that
Sing on high, dance the particles can cross epithelial
membranes. —JFU
on the floor Environ. Sci. Technol. 52, 14480 (2018).

T
he frugivorous, polygamous, and
wildly glamorous birds of para-
RELATIONSHIP SCIENCE
dise are a puzzle to evolutionary
biologists. What is sexual selection Ending a relationship
acting on to result in such extremely When deciding to end a relation-
visual, behavioral, and aural diversity ship, people may consider the
among these related species? Ligon et feelings of their partners as well as
al. analyzed 961 video clips, 176 audio their own. Joel et al. investigated
clips, and 393 museum specimens. They whether decisions to break up
concluded that females are selecting on are driven in part by perceptions
the combined sensory assault from song, of a partner’s dependence on the
display, and plumage color, resulting in relationship. They found that par-
a “courtship phenotype.” Although all ticipants were less likely to initiate
elements are required for successful a breakup with their partners when
courtship, there is room for variation they felt that their partners were
depending on environmental constraints. more dependent on the relation-
Song predominates in the canopy, where ship for psychological well-being,
it is unimpeded by twigs and branches, even when participants were
unsatisfied in the relationship. Even
whereas flashy behavioral display is most
participants who were actively
effective on the gloomy forest floor. —CA
considering breaking up with their
PLOS Biol. 16, e2006962 (2018).
partners were less likely to do so if
they felt their partners depended
on the relationship. These results
condition feels relentless and at predicted environmental whereas smaller nanoparticles suggest that people exhibit costly,
can evade treatment. Petridis concentrations. The authors use are dispersed through the entire prosocial preferences in relation-
et al. performed a DNA study of radiocarbon labeling to track the scallop body. After exposure to ships even when they may wish to
individuals with acne vulgaris nanoplastics within the scallop nanoplastics ceased, smaller leave them. —TSR
and found that those affected tissues. Uptake differs depending nanoparticles were no longer J. Pers. Soc. Psychol. 115, 805 (2018).
share similar, but surprising, on particle size: Larger nanopar- detected after 14 days, but some
genetic mutations. Homing in ticles accumulate in the intestine, larger nanoparticles persisted for
on 15 regions of the genome, OPPORTUNITY DENIED
they identified a series of culprit
genes that controlled hair
The inequality
growth and follicle formation. of innovation
This discovery lends weight to A lack of social capital can
the idea that hair follicle shape undermine a child’s likelihood of
creates a milieu susceptible becoming an inventor, regard-
to bacterial colonization and less of her inventive ability.
inflammation. —PNK Using U.S. patent records for
Nat. Commun. 9, 5075 (2018). 1.2 million inventors, combined
with tax records and other data,
Bell et al. show how children
PLASTIC POLLUTION from high-income families are
several times more likely to
Scallops seasoned become inventors than those
PHOTO: NATURE PICTURE LIBRARY/ALAMY STOCK PHOTO

with nanoplastics from lower-income families, even


Microplastics are present in when they have comparable
marine environments worldwide. math abilities. Children who grow
As these particles break down up in areas where innovation and
further, they form nanoplastics, patenting are more common are
which are harder to detect. more likely to patent as well, and
Nanoplastics also can enter the particularly in the same class
environment directly from com- of technologies that had a high
mercial products such as paints innovation rate in their childhood
and cosmetics. Al-Sid-Cheikh communities. —BW
et al. investigate the uptake of The great scallop (Pecten maximus) reveals details about the uptake of Quart. J. Econ. 10.1093/
such nanoplastics by scallops nanoplastics by marine organisms. qje/qjy028 (2018).

SCIENCE sciencemag.org 4 JANUARY 2019 • VOL 363 ISSUE 6422 41


Published by AAAS
RESEARCH

ALSO IN SCIENCE JOURNALS Edited by Stella Hurtley

OPTICS IMMUNOLOGY NANOMATERIALS cortex and have a modulatory


role on cortical responses to
Exceptional points in Commensal-specific Nanographenes on oxides visual stimuli. Beltramo and
The growth of nanographene
optics T cells are flexible islands and ribbons on metal
Scanziani found a visual cortical
Many complex systems operate Barrier tissues, like the skin, are area that is entirely dedicated
surfaces can be accomplished
with loss. Mathematically, these sites where noninvasive com- to the superior colliculus. This
on single-crystal metal surfaces
systems can be described as mensal microbes constantly area can discriminate moving
through carbon-carbon coupling
non-Hermitian. A property of interact with resident T cells. visual stimuli that the “classical”
reactions, but the surfaces of
such a system is that there can These encounters can result primary visual cortex cannot.
oxides do not assist these reac-
exist certain conditions—excep- in commensal-specific T cell Thus, the superior colliculus, a
tions. Kolmer et al. show that
tional points—where gain and responses that promote, for phylogenetically ancient struc-
fluorinated aryl groups can be
loss can be perfectly balanced example, host defense and tis- ture, has its own projection in
coupled to form nanographenes
and exotic behavior is predicted sue repair. Harrison et al. show neocortex that provides this area
on the rutile surface of titanium
to occur. Optical systems gener- that subsets of skin-resident with exquisite feature-detection
oxide. The fluorine substitution
ally possess gain and loss and so commensal-specific interleukin- abilities not found in the classical
of the aryl groups was selected
are ideal systems for explor- 17A–producing CD4+ and CD8+ primary visual cortex. —PRS
so that as the carbon-fluorine
ing exceptional point physics. T cells have a dual nature: Science, this issue p. 64
bonds were thermally activated,
Miri and Alù review the topic of They coexpress transcription
a stepwise process sequentially
exceptional points in photonics factors that direct antagonistic
added aromatic rings around CLIMATE CHANGE
and explore some of the possible antimicrobial (type 17) and
a central aryl group until it was
exotic behavior that might be antiparasite and pro–tissue
completely substituted. —PDS
Deep Pacific cooling
expected from engineering such repair (type 2) programs. When Earth’s climate cooled consider-
Science, this issue p. 57
systems. —ISO skin is damaged, epithelial cell ably across the transition from
Science, this issue p. 42 alarmins license type 17 T cells the Medieval Warm Period to
to turn on type 2 cytokines. MESOSCOPIC PHYSICS the Little Ice Age about 700
Thus, commensal-specific type years ago. Theoretically, owing
NEUROSCIENCE 17 T cells can direct antimicro-
A backward current to how the ocean circulates, this
Two-dimensional materials in a
bial activity under homeostatic cooling should be recorded in
Forgetting and receptor conditions but rapidly turn on
magnetic field can exhibit the so-
Pacific deep-ocean tempera-
called quantum Hall effect. This
removal tissue repair in the context of
regime is characterized by cur-
tures, where water that was on
The trafficking of AMPA recep- injury. —STS the surface then is found today.
rents running along the edge of
tors to and from the surface Science, this issue p. 43 Gebbie and Huybers used an
the sample in the “downstream”
of postsynaptic membranes ocean circulation model and
direction determined by the sign
regulates synaptic strength observations from both the end
of the magnetic field. Lafont et
and underlies learning and PLANT SCIENCE of the 19th century and the end
al. studied electrical transport in
memory. Awasthi et al. found of the 20th century to detect
that the integral membrane
Fixing photosynthetic GaAs-AlGaAs heterostructures,
and quantify this trend. The
focusing on a previously less-
protein synaptotagmin-3 (Syt3) inefficiencies studied spin-unpolarized state
ongoing deep Pacific is cooling,
is predominantly found on In some of our most useful which revises Earth’s overall heat
in the fractional quantum Hall
postsynaptic endocytic zones crops (such as rice and wheat), budget since 1750 downward by
regime. By considering various
of neurons, where it promotes photosynthesis produces toxic 35%. —HJS
experimental configurations,
AMPA receptor internaliza- by-products that reduce its Science, this issue p. 70
they observed a component of
tion (see the Perspective by efficiency. Photorespiration
the charge current flowing in the
Mandelberg and Tsien). In Syt3 deals with these by-products,
opposite, “upstream” direction.
overexpressing or knockdown converting them into metaboli- EVOLUTION
—JS
neurons, synaptic transmis- cally useful components, but at
sion and short-term plasticity the cost of energy lost. South et
Science, this issue p. 54 DNA breakage and
were unchanged. However, in al. constructed a metabolic path- adaptation
neurons from Syt3 knock- way in transgenic tobacco plants NEUROSCIENCE Adaptation to new environments
out mice, synaptic long-term that more efficiently recaptures often occurs in similar ways
depression was abolished and the unproductive by-products
Another primary visual across different colonization
decaying long-term potentiation of photosynthesis with less cortex events. Stickleback fish repre-
endured. In Syt3 knockout mice, energy lost (see the Perspective Most functional studies in the sent a classic example of this, in
spatial learning was unaltered; by Eisenhut and Weber). In field visual system have focused on which repeated colonizations of
however, these animals showed trials, these transgenic tobacco the cortical representation of freshwater have resulted in the
signs of impaired forgetting and plants were ~40% more produc- the geniculo-striate pathway loss of pelvic hind fins. Previous
relearning during the water maze tive than wild-type tobacco that links the retina to the work has shown that a pelvic
spatial memory task. —PRS plants. —PJH cortex. The parallel collicular enhancer gene is involved. Xie et
Science, this issue p. 44; Science, this issue p. 45; pathway is believed to sparsely al. now show that this gene lies
see also p. 31 see also p. 32 project throughout the visual within a region of the genome

41-B 4 JANUARY 2019 • VOL 363 ISSUE 6422 sciencemag.org SCIENCE

Published by AAAS
that is prone to double-stranded a common monogenic etiol-
DNA breakage owing to a high ogy for the “white plague.” The
thymine-guanine content. This current frequency of the P1104A
enhanced region of breakage allele in European popula-
could lead to enhanced mutation tions is significantly decreased
rates that facilitate repeated compared with its frequency in
adaptations to new environ- ancient European DNA samples.
ments. —SNV These findings suggest that
Science, this issue p. 81 negative selection against the
TYK2 P1104A allele by endemic
tuberculosis in Europe may have
CONSERVATION contributed to a slow genetic
purge of this susceptibility allele
The distinctive sound of a during recent millennia. —IW
biodiverse forest Sci. Immunol. 3, eaau8714 (2018).
Assessing the state of
biodiversity in a forest is a time-
consuming task that typically CANCER
requires detailed on-the-ground
surveys. In a Perspective,
Altering membrane
Burivalova et al. explain that potential for cancer
recordings of soundscapes Polymorphisms in the G pro-
can provide an easier route to tein–coupled receptor GPR35
this information. By record- are associated with increased
ing soundscapes from a forest risk for certain inflammatory
over time and comparing them diseases that can progress to
to a regional baseline, scien- cancer. Schneditz et al. found
tists can determine whether a that GPR35 promoted the activ-
forest’s ecosystem is healthy ity of Na+- and K+-dependent
or not. If the soundscape of adenosine triphosphatase
a forest spared from conver- (Na+,K+-dependent ATPase),
sion becomes impoverished a transmembrane pump that
and altered, an on-the-ground sets the membrane potential in
survey would be warranted. This cells. This effect was enhanced
approach may be particularly by a disease-associated GPR35
useful for companies interested variant. Stimulation of Na+,K+-
in sustainability certification ATPase activity by GPR35
or zero-deforestation commit- increased glycolysis and pro-
ments. —JFU liferation in intestinal epithelial
Science, this issue p. 28 cells. Na+,K+-ATPase deficiency
or treatment with a pepducin
targeting GPR35 decreased
TUBERCULOSIS tumor burden in mouse models
of intestinal cancer. —WW
Faulty kinase purged by Sci. Signal. 12, eaau9048 (2019).
tuberculosis?
Rare mutations in genes involved
in interferon-g–dependent
immunity underpin human
genetic susceptibility to severe
mycobacterial diseases,
including primary tuberculosis.
Boisson-Dupuis et al. investi-
gated whether two common
missense variants of the TYK2
Janus kinase that have impaired
catalytic activity conferred an
increased risk of tuberculosis.
Individuals homozygous for
the P1104A (proline to alanine
substitution at residue 1104)
variant of TYK2 are markedly
predisposed to developing
primary tuberculosis, defining

SCIENCE sciencemag.org 4 JANUARY 2019 • VOL 363 ISSUE 6422 41-C


Published by AAAS
R ES E A RC H

◥ lating the modal content of multimode lasers. In


REVIEW SUMMARY addition, adiabatic parametric evolution around
exceptional points provides interesting schemes
for topological energy transfer and designing
OPTICS
mode and polarization converters in photonics.
Lately, non-Hermitian degeneracies have also
Exceptional points in optics been exploited for the design of laser systems,
new nonlinear optics phenomena, and exotic

and photonics scattering features in open systems.

OUTLOOK: Thus far, non-Hermitian systems


Mohammad-Ali Miri and Andrea Alù* have been largely disregarded owing to the
dominance of the Hermitian theories in most
BACKGROUND: Singularities are critical points in photonics, given that optical gain and loss areas of physics. Recent advances in the theory
for which the behavior of a mathematical model can be integrated as nonconservative ingre- of non-Hermitian systems in connection with
governing a physical system is of a fundamentally dients to create artificial materials and struc- exceptional point singularities has revolution-
different nature compared to the neighboring tures with altogether new optical properties. ized our understanding of such complex sys-
points. Exceptional points are spectral singu- tems. In the context of optics and photonics,
larities in the parameter space of a system in ADVANCES: As we introduce gain and loss in in particular, this topic is highly important be-
which two or more eigenvalues, and their cor- a nanophotonic system, the emergence of ex- ◥
cause of the ubiquity of
ON OUR WEBSITE

Downloaded from http://science.sciencemag.org/ on January 7, 2019


responding eigenvectors, simultaneously co- ceptional point singularities dramatically alters nonconservative elements
alesce. Such degeneracies are peculiar features the overall response, leading to a range of exotic Read the full article
of gain and loss. In this
of nonconservative systems that exchange functionalities associated with abrupt phase at http://dx.doi. regard, the theoretical de-
energy with their surrounding environment. transitions in the eigenvalue spectrum. Even org/10.1126/ velopments in the field
In the past two decades, there has been a though such a peculiar effect has been known science.aar7709 of non-Hermitian physics
..................................................

CREDITS: IMAGE IN (A) BASED ON A CONCEPT FROM H. HODAEI ET AL., SCIENCE 346, 975 (2014); IMAGE IN (D) BASED ON CONCEPTS FROM W. CHEN ET AL., NATURE 548, 192 (2017).
growing interest in investigating such non- theoretically for several years, its controllable have allowed us to revisit
conservative systems, particularly in connec- realization has not been made possible until re- some of the well-established platforms with a
tion with the quantum mechanics notions of cently and with advances in exploiting gain and new angle of utilizing gain and loss as new
parity-time symmetry, after the realization loss in guided-wave photonic systems. As shown degrees of freedom, in stark contrast with the
that some non-Hermitian Hamiltonians ex- in a range of recent theoretical and experimental traditional approach of avoiding these elements.
hibit entirely real spectra. Lately, non-Hermitian works, this property creates opportunities for On the experimental front, progress in fabri-
systems have raised considerable attention ultrasensitive measurements and for manipu- cation technologies has allowed for harnessing
gain and loss in chip-scale photonic systems.
B Pump 1 Pump 2 C These theoretical and experimental develop-
ments have put forward new schemes for
a controlling the functionality of micro- and
µ nanophotonic devices. This is mainly based on
x the anomalous parameter dependence in the
response of non-Hermitian systems when op-
erating around exceptional point singularities.
µ Such effects can have important ramifications
A in controlling light in new nanophotonic device
designs, which are fundamentally based on en-
gineering the interplay of coupling and dis-
sipation and amplification mechanisms in
Eigenvalue

EP multimode systems. Potential applications of


E D
CCW such designs reside in coupled-cavity laser
sources with better coherence properties, cou-
CW pled nonlinear resonators with engineered dis-
r2
Parameter 1 Paramete persion, compact polarization and spatial mode
converters, and highly efficient reconfigurable
diffraction surfaces. In addition, the notion of
the exceptional point provides opportunities
Frequency to take advantage of the inevitable dissipation
in environments such as plasmonic and semi-
Ubiquity of non-Hermitian systems, supporting exceptional points, in photonics. (A) A conductor materials, which play a key role in
generic non-Hermitian optical system involving two coupled modes with different detuning, ±w1,2, optoelectronics. Finally, emerging platforms such
and gain-loss values, ±g1,2, coupled at rate of m. The real part of the associated eigenvalues in a two- as optomechanical cavities provide opportunities
dimensional parameter space of the system, revealing the emergence of an exceptional point (EP) to investigate exceptional points and their asso-
singularity. a1 and a2 are the modal amplitudes. (B to E) A range of different photonic systems, which
are all governed by the coupled-mode equations. (B) Two coupled lasers pumped at different rates.
ciated phenomena in multiphysics systems.

(C) Dynamical interaction between optical and mechanical degrees of freedom in an optomechan- The list of author affiliations is available in the full article online.
*Corresponding author. Email: aalu@gc.cuny.edu
ical cavity. (D) A resonator with counter-rotating whispering gallery modes. CW, clockwise; CCW, Cite this article as M.-A. Miri and A. Alù, Science 363,
counterclockwise. (E) A thin metasurface composed of coupled nanoantennas as building blocks. eaar7709 (2019). DOI: 10.1126/science.aar7709

Miri et al., Science 363, 42 (2019) 4 January 2019 1 of 1


R ES E A RC H

◥ theory of resonances in the context of atomic, mo-


REVIEW lecular, and nuclear reactions (11). Early exper-
iments on microwave cavities revealed the peculiar
topology of eigenvalue surfaces near exceptional
OPTICS points (12, 13). The emergence of spectral singular-
ities was also pointed out in the analysis of multi-
mode laser cavities (14, 15) and in time-modulated
Exceptional points in optics complex light potentials for matter waves (16).
Recently, interest in these peculiar spectral
and photonics degeneracies has been sparked in a particular
family of non-Hermitian Hamiltonians, the so-
called parity-time (PT) symmetric systems. A
Mohammad-Ali Miri1,2,3 and Andrea Alù4,3,5,1*
Hamiltonian is PT symmetric as long as it com-
mutes with the PT operator, that is, ½H; PT  ¼ 0,
Exceptional points are branch point singularities in the parameter space of a system at which
where the parity operator P represents a reflection
two or more eigenvalues, and their corresponding eigenvectors, coalesce and become
with respect to a center of symmetry and the time
degenerate. Such peculiar degeneracies are distinct features of non-Hermitian systems, which
operator T represents complex conjugation. It has
do not obey conservation laws because they exchange energy with the surrounding
been realized that PT-symmetric Hamiltonians,
environment. Non-Hermiticity has been of great interest in recent years, particularly in
despite being non-Hermitian, can support entirely
connection with the quantum mechanical notion of parity-time symmetry, after the realization
real eigenvalue spectra (17). More interestingly, it
that Hamiltonians satisfying this special symmetry can exhibit entirely real spectra. These
has been realized that commuting with the PT
concepts have become of particular interest in photonics because optical gain and loss can be

Downloaded from http://science.sciencemag.org/ on January 7, 2019


operator is not sufficient to ensure a real spec-
integrated and controlled with high resolution in nanoscale structures, realizing an ideal
trum, as formally PT-symmetric Hamiltonians can
playground for non-Hermitian physics, parity-time symmetry, and exceptional points. As we
undergo a phase transition to the spontaneously
control dissipation and amplification in a nanophotonic system, the emergence of exceptional
broken symmetry regime, in which complex eigen-
point singularities dramatically alters their overall response, leading to a range of exotic optical
values appear. The phase transition happens as a
functionalities associated with abrupt phase transitions in the eigenvalue spectrum. These
result of a parametric variation in the Hamiltonian.
concepts enable ultrasensitive measurements, superior manipulation of the modal content of
Quite interestingly, the symmetry-breaking thresh-
multimode lasers, and adiabatic control of topological energy transfer for mode and
old point exhibits all properties of an exceptional
polarization conversion. Non-Hermitian degeneracies have also been exploited in exotic
point singularity (17–23).
laser systems, new nonlinear optics schemes, and exotic scattering features in open systems.
Although these theoretical explorations origi-
Here we review the opportunities offered by exceptional point physics in photonics, discuss
nated in the realm of quantum mechanics, optics
recent developments in theoretical and experimental research based on photonic exceptional
and photonics have proven to be the ideal plat-
points, and examine future opportunities in this area from basic science to applied technology.
form to experimentally observe and utilize the

H
rich physics of exceptional points (24–27). Owing
ermiticity is a property of a wide variety Hamiltonian. Generally, nonconservative phenome- to the abundance of nonconservative processes,
of physical systems, under the assump- na are introduced as small perturbations to photonics provides the necessary ingredients to
tions of being conservative and obeying otherwise Hermitian systems. Thus, the overall realize controllable non-Hermitian Hamiltonians.
time-reversal symmetry. Hermitian oper- behavior of non-Hermitian systems has been large- Indeed, dissipation is ubiquitous in optics, be-
ators play a key role in the theory of linear ly extracted from their Hermitian counterparts. cause it arises from material absorption as well
algebraic and differential operators (1–4), and However, recent investigations have revealed that as radiation leakage to the outside environment.
they are known to exhibit real-valued eigenvalues, non-Hermitian phenomena can drastically alter In addition, gain can be implemented in a locally
a property that stems from energy conservation. the behavior of a system compared to its Hermi- controlled fashion through stimulated emission,
For a set of dynamical equations described through tian counterpart. The best example of such devi- which involves optical or electrical pumping of
a Hermitian operator, the relation between initial ation is the emergence of singularities, so-called energy through an external source, or through
and final states is governed by a unitary operation. exceptional points, at which two or more eigen- parametric processes. Therefore, photonics pro-
Hermiticity has long been considered one of the values, and their associated eigenvectors, simul- vides a fertile ground to systematically investigate
pillars of mathematical and physical models, such taneously coalesce and become degenerate (5). non-Hermitian Hamiltonians and exceptional
as in quantum mechanics and electromagnetics. The term “exceptional point” was first intro- points. Recent theoretical developments in the
The elegance of such theories lies in powerful prop- duced in studying the perturbation of linear non- area of non-Hermitian physics have opened ex-
erties, including the completeness and orthogonality Hermitian operators (6), described by a general citing opportunities to revisit fundamental con-
of the eigenbasis of the governing operators (1). class of matrices H(z) parameterized by the com- cepts in nonconservative photonic systems with
However, these models are based on idealizations, plex variable z = x + iy, where x is the real part, gain and loss, such as lasers, sensors, absorbers,
like the assumption of complete isolation of a i is the imaginary unit, and y is the imaginary and isolators. In these systems, exceptional points
system from its surrounding environment. In prin- part. The eigenvalues sn(z) and eigenvectors open pathways for totally new functionalities and
ciple, nonconservative elements arise ubiquitously jyn ðzÞi of H can be represented as analytic func- performance. The interested reader may find
in various forms; thus, a proper description of a tions except at certain singularities z = zEP (EP, detailed overviews of non-Hermitian and, in par-
realistic physical system requires a non-Hermitian exceptional point). At such exceptional points, ticular, PT-symmetric systems in the context of
two eigenvalues coalesce, and the matrix H can optics and photonics in recent review papers
1
Department of Electrical and Computer Engineering, no longer be diagonalized. The physical impor- (28–32). In the present work, we discuss instead
The University of Texas at Austin, Austin, TX 78712, USA.
2
Department of Physics, Queens College of the City University
tance of exceptional points was pointed out in more broadly the concept of exceptional points
of New York, Queens, NY 11367, USA. 3Physics Program, early works (7, 8), in which the terminology of non- in non-Hermitian systems. In the following, we
Graduate Center of the City University of New York, New York, Hermitian degeneracy was used to distinguish provide an introduction to exceptional point
NY 10016, USA. 4Photonics Initiative, Advanced Science such critical points from regular degeneracies oc- physics and explain some of the fundamental
Research Center, City University of New York, New York, NY
10031, USA. 5Department of Electrical Engineering, City College
curring in Hermitian systems (9, 10). In addition, concepts associated with such critical points.
of The City University of New York, New York, NY 10031, USA. exceptional points were referred to as branch- We then draw the connection with optics and
*Corresponding author. Email: aalu@gc.cuny.edu point singularities in investigating the quantum photonics and show the universal occurrence of

Miri et al., Science 363, eaar7709 (2019) 4 January 2019 1 of 11


R ES E A RC H | R E V IE W

exceptional points in optical settings. Finally, we where w is the resonance frequency of the two coupling. Assuming, harmonic solutions of the
review recent theoretical and experimental ef- coupled modes, m is the coupling coefficient, and form ða1 ; a2 Þ ¼ ða1 ; a2 Þeisx , the eigenvalues of
forts in observing exceptional points in optics g is their decay rate. This particular choice of the system are
and their peculiar functionalities in practical Hamiltonian system, shown in Fig. 1A, represents
qffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffi
devices, presenting an outlook for the future of a large class of structures and devices of large
this exciting area of research. relevance in photonics, examples of which are sT ¼ wave  igave T m2 þ ðwdiff þ igdiff Þ2 ð2Þ
given in Fig. 1, such as coupled cavities (Fig. 1B)
Theoretical background (33), coupled waveguides (Fig. 1C) (34), polar- where wave = (w1 + w2)/2 and gave = (g1 + g2)/2,
We begin by investigating exceptional points in a ization states in the presence of small pertur- respectively, represent the mean values of res-
generic two-level system. Assuming that a1,2 are bations in an optical waveguide (Fig. 1D) (35), onance frequencies and loss factors, whereas
the modal amplitudes of two states that evolve counter-propagating waves in Bragg gratings wdiff = (w1 − w2)/2 and gdiff = (g1 + g2)/2 are the
with the variable x, representing the evolution (Fig. 1E) (36), wave mixing in nonlinear crystals differences between their resonance frequencies
time or propagation distance, the coupled mode (Fig. 1F) (37), coupled optical and mechanical and loss factors.
equations can be generally written as modes in an optomechanical cavity (Fig. 1G) (38), The Hamiltonian in Eq. 1 is a function of mul-
! ! and a two-level atom in a cavity (Fig. 1H) (39). tiple parameters. In Fig. 2, A and B, we evaluate
d a1 w1  ig1 m a1 In the case of coupled optical resonators, for the evolution of real and imaginary parts of the
ð Þ ¼ i instance, w1,2 in Eq. 1 represent the individual eigenvalues in the parameter space (wdiff, gdiff),
dx a2 m w2  ig2 a2
frequencies of each element, g1,2 describe their assuming a constant coupling coefficient m. An
ð1Þ loss or gain rate, and m represents the mutual exceptional point occurs when the square-root
term in Eq. 2 is zero, as the two eigenvalues co-
alesce. Assuming a real coupling constant, this

Downloaded from http://science.sciencemag.org/ on January 7, 2019


happens for (wdiff = 0; gdiff = ±m). Figure 2, A and
B, highlights the interesting topology of the
branch point singularity at the exceptional point,
which has important implications in the optical
response of the system around this parameter
point, as we discuss in the following sections.
The two-body problem investigated here is the
simplest case of a non-Hermitian system. In gen-
eral, exceptional points appear ubiquitously in
systems with spatially discrete or continuous
degrees of freedom of multiple dimensionalities.
In principle, when more than two eigenvalue
surfaces are involved, it is also possible that more
than two surfaces simultaneously collapse at one
point, creating a higher-order exceptional point
(40, 41). A third-order exceptional point, for
example, is formed when three eigenvalues simul-
taneously coalesce. In this scenario, the square-
root dependence of the eigenvalues around the
exceptional point in Eq. 2 is replaced by a cubic
root. It is worth stressing that at an exceptional
point, the coalescing eigenvalues do not support
independent eigenvectors, implying that, in dis-
crete systems described by a matrix Hamiltonian,
the Jordan form is no longer diagonal (42). This is
notably different from accidental degeneracies,
which occur when two eigenvalues with different
eigenvectors cross. In a two-dimensional parameter
space, such accidental degeneracies appear when
two eigenvalue surfaces form a double cone or
“diablo,” forming diabolic points (43). In contrast
with exceptional points, at the diabolic points, the
eigenvectors remain linearly independent. Diabolic
points emerge in various Hermitian systems,
Fig. 1. A generic two-level system and its different realizations in optics and photonics. most notably in molecular reactions (44) and
(A) A schematic representation of a generic two-level system composed of two coupled entities. in the electronic band diagram of graphene (45).
(B) Two coupled optical cavities with spatially separated resonator modes. (C) Two evanescently Exceptional point singularities are closely
coupled optical waveguides with spatially separated waveguide modes. (D) Coupled orthogonal related to the phenomenon of level repulsion,
polarization states in an optical waveguide. (E) Counter-propagating waves in a volume Bragg grating. which has been originally explored in the con-
(F) Signal and idler frequency components in a parametric amplifier. (G) Photonic and phononic degrees text of quantum chaos, because it explains the
of freedom in an optomechanical cavity. (H) Coupling between a two-level atom and an optical cavity scarcity of closely spaced levels in Wigner dis-
mode. The different platforms represented in (B) to (H) can be treated under a unified model depicted tributions (46). In photonics, level repulsion is
schematically in (A).The universality of nonconservative processes in these settings calls for a systematic of great interest because it marks strong cou-
understanding of non-Hermiticity in a basic two-level system as a first step toward a rigorous bottom-up pling and hybridization between states, which is
approach for designing complex photonic systems in the presence of gain and loss. The arrows indicate manifested as a repulsion between closely spaced
electromagnetic waves, and different colors indicate different frequencies. eigenvalues when a parameter is adiabatically

Miri et al., Science 363, eaar7709 (2019) 4 January 2019 2 of 11


R ES E A RC H | R E V IE W

change their behavior despite the fact that the


governing evolution operator preserves its sym-
metry. The behavior of the eigenvalues of a PT-
symmetric system is shown in Fig. 3A, highlighting
the bifurcation associated with the spontaneous
symmetry breakdown at the exceptional point.
In Eq. 1, we assumed that the coupling m is a real
parameter, whereas in principle, it can become
complex, involving dissipation. For instance, in
several scenarios, coupling between two states
is mediated through a continuum of radiation
modes, for which the energy partially leaks to
the outside environment (51). Examples include
radiative coupling between subwavelength nano-
particles (52) as well as channel-mediated coupling
of microring lasers (53). Independent of the cou-
pling mechanism, exceptional points also arise in
this case. According to Eq. 2, assuming a purely
imaginary coupling m = imi, exceptional points
emerge for (wdiff = ±mi; gdiff = 0). In this case, the
exceptional point arises for a frequency detuning

Downloaded from http://science.sciencemag.org/ on January 7, 2019


equal to the mutual coupling between cavities.
The discussion on exceptional points pre-
sented so far has been built on Hamiltonian sys-
tems, or, in broader terms, on dynamical systems,
that evolve in time and space through a linear
operator. A large body of photonic systems,
however, are open, coupled to a continuum of
radiation modes, as in the case of optical wave-
Fig. 2. Exceptional points in a non-Hermitian two-level system. (A and B) Evolution of the real guides coupled to cavities or finite-sized scat-
(A) and imaginary (B) parts of the eigenvalues of the system described by Eq. 1 in the two- terers illuminated by impinging optical fields.
dimensional parameter space (wdiff, gdiff). These panels illustrate the exotic topology of the eigenvalue Such systems are better described through a
surfaces near an exceptional point singularity. (C to E) Eigenvalues versus wdiff for different values of scattering matrix, which directly relates outgoing
gdiff, that is, cross sections of the surfaces depicted in (A) and (B). Owing to the presence of the waves and incoming waves. The scattering matrix
exceptional point (gdiff = gEP; wdiff = wEP), depending on the value of the secondary parameter, can be compared with the time-evolution oper-
different parameter dependence is observed for the eigenvalues. (C) For gdiff > gEP, level repulsion ator, that is, U ¼ expðiHxÞ in Hamiltonian
occurs in the real part of the eigenvalues, whereas the imaginary parts cross. (D) For gdiff = gEP, the systems. Indeed, in a scattering medium without
real and imaginary parts coalesce at wdiff = wEP. (E) For gdiff < gEP, level crossing governs the real parts material gain or loss, the scattering matrix is
of the eigenvalues, whereas the imaginary parts repel each other. unitary, with all its eigenvalues located on the
unit circle (54). In the presence of loss and/or
gain, however, the norms are not preserved,
tuned (47). They typically occur near an excep- In the context of exceptional points, an espe- and the eigenvalues can, in general, be located
tional point in the real or complex parameter cially relevant class of non-Hermitian two-level inside or outside the unit circle. Quite interest-
space. For instance, Fig. 2, C to E, shows cross systems are those satisfying PT symmetry. In the ingly, similar to Hamiltonian systems, excep-
sections of the eigenvalue surfaces in Fig. 2, A context of quantum mechanics, a Hamiltonian tional points can also emerge in the scattering
and B, for different values of gdiff, highlighting H is PT symmetric when ½H; PT  ¼ 0, where P matrix formalism when two or more eigenvalues
level repulsion in either their real (Fig. 2C) or and T respectively represent parity and time and their associated eigenvectors coalesce (55).
imaginary part (Fig. 2E) for values of gdiff re- operators. In photonics, this corresponds to the A basic example is a PT-symmetric Fabry-Perot
spectively larger or smaller than the critical value case in which loss in one region is balanced by resonator involving two materials with balanced
gdiff = gEP, corresponding to the exceptional gain in another symmetric region (50). For the gain and loss (Fig. 3B). At a given frequency, for
point condition (Fig. 2D). Level repulsion in the two-level system of Eq. 1, considering that the an increasing gain and loss contrast, the scattering-
real (imaginary) part is accompanied by level parity and time operators respectively act as matrix eigenvalues bifurcate from the unit circle
crossing of the imaginary (real) part, as shown Pða; bÞ ¼ ðb; aÞ and T ða; bÞ ¼ ða ; b Þ, where a at an exceptional point singularity, as shown in
in Fig. 2, C to E (48, 49). At the critical condition and b are two variables, the conditions of PT Fig. 3B. Here, the exceptional point marks the
gdiff = gEP, both real and imaginary parts of the symmetry are satisfied for w1 ¼ w2 ≡ w and onset of the broken symmetry regime, in which
eigenvalues coalesce, and an exceptional point g1 ¼ g2 ≡ g. The response of this system is amplification of the wave excitation becomes the
is achieved. The different behavior in the three governed by the interplay of two major processes: dominant response of the PT-symmetric scatterer.
cases is determined by the topology of the in- the gain and loss contrast g and the mutual cou-
volved Riemann surfaces at the given cross sec- pling m. An exceptional point arises at the critical Exceptional points in photonics
tion. As a special case, level repulsion can arise condition m = g. Here, the exceptional point Exceptional points arise in several optical and
also in Hermitian systems, such as in the case of marks the onset of a transition from purely real photonic systems. In the previous section, we
two lossless optical resonators, in which level eigenvalues, associated with oscillatory solutions introduced a general class of two-level systems
repulsion occurs as we detune their resonance expðTijsT jxÞ, where x is the evolution variable, to described through coupled-mode equations, point-
frequency (33). Consistent with Fig. 2C, this purely imaginary eigenvalues associated with ing out the conditions to achieve a second-order
phenomenon is associated with an exceptional growing or decaying solutions expðTjsT jxÞ. This exceptional point. Integrated photonic waveguides
point in the complex parameter space, as we transition is often referred to as spontaneous and cavities, in particular, provide a controlla-
operate at gdiff = 0 < gEP. symmetry breaking, because the eigenvalues ble platform to observe exceptional points. In

Miri et al., Science 363, eaar7709 (2019) 4 January 2019 3 of 11


R ES E A RC H | R E V IE W

the photonic bandgap closes, whereas the coupling


between counter-propagating waves becomes un-
idirectional (67). Unidirectional invisibility has
been observed in different settings, including in
integrated semiconductor waveguide gratings
(68), organic composite films (69), time-domain
lattices (59), and coupled acoustic resonators
(70). Similar ideas have been utilized in micror-
ing resonators to create integrated laser devices
supporting modes with definite angular momen-
tum when the system is biased at an exceptional
point (71). In addition, it has been shown that
properly engineered defects in microring reso-
nators can create an exceptional point that in-
stead induces chirality between counter-rotating
modes (72–74). It has also been shown that non-
Hermitian scattering systems operating around
the exceptional points can induce other interest-
ing phenomena, such as negative refraction (75)
and unidirectional cloaking (76, 77).
Fig. 3. PT symmetry in closed and open systems. PT-symmetric systems form an interesting Coherently prepared, multilevel warm atomic

Downloaded from http://science.sciencemag.org/ on January 7, 2019


class of non-Hermitian settings, which share certain similarities with Hermitian systems. vapors provide another controllable platform
In the case of a two-level system (Fig. 1), PT symmetry is realized for w1 ¼ w2 ≡w and g1 ¼ g2 ≡g, to realize complex optical potentials. In such sys-
that is, when the individual levels share the same real part but exhibit opposite values of the tems, strong pump laser beams can create wave-
imaginary parts (gain and loss). (A) A PT-symmetric system of two coupled waveguides (top) guiding effects for weak probe beams where,
with gain (red) and loss (blue), and the corresponding eigenvalues (bottom) versus the gain-loss under proper detuning, both gain and loss can
contrast g. This figure reveals a transition in the eigenvalues from purely real (exact PT symmetry) be achieved in Raman-active systems (78). In this
to purely imaginary (broken PT symmetry). Interestingly, the PT symmetry–breaking threshold regard, the realization of complex potentials
point reveals all the properties of an exceptional point singularity. In this figure, the arrows represent supporting exceptional points have been theo-
the intensity of the eigenmodes in both the exact and broken PT regimes. (B) A PT-symmetric retically proposed in three- and four-level atoms
Fabry-Perot resonator (top) and the eigenvalues of its scattering matrix (bottom) evolving (79, 80) and experimentally demonstrated in
as a function of the frequency of excitation. In this case, an exceptional point marks a transition coupled atomic vapor cells (81), as well as in PT-
in the eigenvalue evolution, breaking away from the unit circle. The geometries of (A) and (B) symmetric optical lattices (82).
represent examples of Hamiltonian and scattering settings. Even though the discussion here is primarily
focused on linear operators, it is important to
integrated photonic platforms, exceptional points The peculiar properties of exceptional points also stress the relevance of exceptional points
and phase transitions have been observed in have also been investigated in open scattering in nonlinear systems. The connection of non-
coupled passive optical waveguides, where con- systems involving gain and loss. In particular, Hermiticity to nonlinear systems is multifold:
trollable loss in one of the channels was utilized it has been shown that a PT-symmetric Fabry- First, most nonlinear configurations in optics
(56) (Fig. 4, A and B). In the context of PT sym- Perot cavity, similar to the one discussed in Fig. and photonics are accompanied by losses, and
metry, spontaneous symmetry breaking at the 3B, can simultaneously act as a laser and a co- second, active devices are, by nature, nonlinear.
exceptional point was demonstrated in a coupled herent perfect absorber at the exceptional point Therefore, lasers, amplifiers, and saturable ab-
arrangement of optical waveguides with balanced (55, 62). This interesting behavior, occurring as sorbers are all examples of devices in which
gain and loss (50). In other works, coupled optical a result of the coalescence of a pair of poles and nonlinearity and non-Hermiticity coexist. In ad-
cavities with gain and loss were utilized to observe zeroes of the scattering matrix eigenvalue, has dition, nonlinear optical effects can create inter-
a PT-symmetric phase transition (57, 58) (Fig. 4, been recently demonstrated in an integrated actions between different wave components. A
D and E). The first demonstration of exceptional semiconductor resonator with active and passive high-intensity pump, for example, initiates energy
points in periodic structures was achieved in regions (63). Non-Hermitian optical gratings with exchange between lower-intensity wave compo-
time-domain lattices (59) (Fig. 4C), induced alternating layers of materials with different levels nents that are governed by a linearized operator.
through the propagation of short laser pulses of loss or gain reveal another interesting aspect Such an operator is, by essence, non-Hermitian,
in two coupled fiber loops of a slightly different of exceptional points (64, 65). In such systems, given the energy exchange between pump and
lengths with alternating gain and loss. This prop- whereas reciprocity enforces equal transmission probe through the nonlinearity.
agation creates a quantum walk of pulses gov- in both directions, the reflection coefficients can The interplay of nonconservative and non-
erned by PT-symmetric evolution equations, be completely different. In a Hermitian system, linear effects is of special interest, given that
described through a peculiar band structure as equal transmission coefficients also require equal optical materials with strong nonlinearities
in spatially periodic structures. In addition, ex- magnitude of the reflection coefficients, but in necessarily suffer from large absorption (83).
ceptional points have been demonstrated in pho- non-Hermitian systems, this is not the case. The Therefore, concepts from non-Hermitian
tonic crystal slabs (60), in which out-of-plane contrast in reflection amplitudes is maximized at physics are sought to provide strategies to take
radiation losses due to the finite thickness of the exceptional point, where the reflection from advantage of losses in such nonlinear materials.
the dielectric slab result in the merging of two one direction becomes zero and the reflection In this regard, the conjunctive use of nonlinear
eigenfrequency bands, inducing a ring of excep- from the other direction can be very large, thus processes with gain and loss have been sug-
tional points in the wave number space. Among inducing unidirectional invisibility (65). In a gested as a viable route to achieve optical non-
other realizations, exceptional points have also similar fashion, it has been shown that a two- reciprocity (84, 85). In addition, it has been
been experimentally demonstrated in chaotic layer structure with gain and loss can exhibit shown that laser systems exhibit exotic behavior
optical cavities (61). In all these photonic sys- one-way reflectionless behavior at a particular such as anomalous pump dependence near the
tems, operation around the exceptional points frequency, thus inducing an anisotropic trans- exceptional point singularity (86, 87), as well as
enables a singular optical response. mission resonance (66). At the exceptional point, reduced lasing threshold with increased losses

Miri et al., Science 363, eaar7709 (2019) 4 January 2019 4 of 11


R ES E A RC H | R E V IE W

Fig. 4. Experimental demonstration of exceptional points in various band merging effect at the exceptional point was experimentally demon-

Downloaded from http://science.sciencemag.org/ on January 7, 2019


optical settings. (A and B) Coupled integrated photonic waveguides (A) strated. PM represents a phase modulator that creates an effective
fabricated through a multilayer AlxGa1−xAs heterostructure (B), for which potential for the light pulses. (D and E) Coupled microring resonators with
thin layers of chromium of different widths were utilized to impart different gain and loss have been used to probe the exceptional point through the
amount of losses in one of the waveguides (56). In this setting, couplers mode splitting of the resonance eigenmodes (57, 58). In (D), the numbers
with different losses on one arm were used to observe mode symmetry indicate the four ports that are used to probe the system, and orange and
breaking beyond the critical loss contrast associated with the exceptional green arrows represent waves propagating in forward and backward
point. (C) The propagation of laser pulses in coupled fiber loops of slightly directions, respectively. [Credits: (A) and (B) reprinted with permission
different lengths (D L) with alternating gain and loss creates a quantum from (56), copyright 2009 by the American Physical Society; (C), (D),
walk of pulses which is governed by a PT-symmetric operator (59). In this and (E) reprinted from (59), (57), and (59), respectively, with permission
temporal lattice, the onset of complex eigenvalues associated with the from Springer Nature]

(88). The impact of non-Hermiticity on non- which goes from being real to complex valued. standard perturbation theory, however, does not
linear waves in bulk and periodic systems has Other well-known examples of exceptional points apply at such points. The perturbation problem
been also explored, after the realization that PT- in the wave number space are the cut-off fre- can be introduced as H ¼ H0 þ eH1 where we
symmetric potentials support optical solitons (89). quency of a closed waveguide or the edge of a want to find the behavior of the eigenvalues sn(e)
Indeed, although dissipative nonlinear systems photonic bandgap in periodic structures. In and eigenvectors jyn ðeÞi of H for e≪ 1, where e is
have been largely investigated (90), recent de- addition, a volume Bragg grating, in which alter- the perturbation parameter. In general, such a
velopments in the area of PT symmetry have nating layers of two different materials with perturbation problem can be divided into regular
sparked interest in the exploration of new in- refractive indices n1 and n2 create a photonic and singular problems (96). In the regular case, a
tegrated nonlinear systems combining gain and bandgap for a range of incoming frequencies, power-series solution with integral powers of e
loss (29, 91, 92). In addition, solitary waves in supports an exceptional point. In this structure, X

exists, that is, sðeÞ ¼ s0 þ cn en, where cn are
PT-symmetric potentials have been experimen- the wave number of the counter-propagating n¼1
tally demonstrated in time-domain lattices (93). waves follows a square-root dispersion in terms the series coefficients, with a finite radius of
Nonlinear wave-mixing processes, such as sum of the incoming wave frequency. Whereas in the convergence. However, in the case of an excep-
and difference frequency generation and optical propagation band the wavenumber is real, inside tional point singularity, such a solution does not
parametric amplification, are other examples of the bandgap it becomes complex, and an excep- converge. At a singularity, the exact solution at
non-Hermitian systems in which external cou- tional point marks this transition. Similar to the e = 0 is of a fundamentally different nature
pling through a pump beam mediates the inter- exceptional points emerging in complex poten- compared with its neighboring points e → 0
actions (94). tials, the photonic bandgap in gratings exhibits (96). At a second-order exceptional point, the
At this point, it is worth stressing that ex- interesting properties, such as a vanishing group series solution
ceptional points are not necessarily difficult to velocity (95). X
1
find in optical setups because they occur ubiq-
Applications in nanophotonics sT ðeÞ ¼ s0 þ ðT1Þn cn en=2 ð3Þ
uitously in the wave number space, even in con-
n¼1
servative systems in which no gain or loss is The exotic properties of exceptional points open
involved. In these scenarios, a part of a Hermitian interesting possibilities for advanced light ma- exists, where s0 is the eigenvalue at the ex-
system can be considered non-Hermitian, be- nipulation. In this section, we present an overview ceptional point. The radius of convergence of
cause it exchanges energy with the rest of the of some of the recent theoretical and experimental this series in the complex e plane is deter-
system. Possibly the best-known example of developments in the exploration of exceptional mined by the nearest exceptional point. In a
these trivial exceptional points is the total in- points for applications in photonics. As in other similar manner, for a kth-order exceptional
ternal reflection at the interface of two materials. areas of physics, in photonics, perturbation theory point the nth term in the perturbation series
In this case, light transmitted at the interface of is an important mathematical tool to tackle a is en/k, with a dominant first-order term of e1/k.
two media critically depends on the incidence range of problems without having to deal with For small perturbations, this term is considera-
angle of the impinging light. In particular, at a complex full-wave equations. Owing to the sin- bly larger than the linear term e, which occurs
critical angle, a phase transition occurs in the gularity at exceptional points, as well as the di- at regular points, enabling extra sensitivity to
propagation wave number of the second medium, mensionality collapse in the eigenvector space, the parameter e of a system when biased at the

Miri et al., Science 363, eaar7709 (2019) 4 January 2019 5 of 11


R ES E A RC H | R E V IE W

exceptional point singularity. This property has (100) (Fig. 5B). Although it has been pointed out laser cavities (104). A common issue in laser
been proposed to achieve enhanced mode split- that enhanced sensitivity at the exceptional point systems is that often several transverse or long-
ting between counter-propagating whispering does not necessarily correspond to enhanced itudinal modes may simultaneously lase. In this
gallery modes of a microring resonator in the precision in sensing instruments (101) and that regard, it has been suggested to complement the
presence of nanoparticles (97). The prospect of quantum noise should be considered to assess active multimode laser cavity with a passive ca-
utilizing exceptional points for enhanced mode the ultimate performance of these exceptional vity that ideally exhibits an equal amount of loss.
splitting has been experimentally demonstra- point sensors (102), sensors appear to be an In this scenario, the overall level of loss is in-
ted in microtoroid cavities (98, 99) (Fig. 5A). In interesting application area for these concepts. creased in the entire system, given that each mode
addition, integrated microring resonators with In this area, it has also been shown that a scaled overlaps with the loss region, and thus the gain
externally controllable perturbations have been form of PT symmetry can be used for enhanced threshold is expected to increase. However, a large
utilized to induce second- and third-order excep- sensor telemetry (103). discrimination between lasing thresholds of dif-
tional points, where ½ and ⅓ power-law expo- Another interesting application of exceptional ferent modes is obtained at the exceptional point
nents in mode splitting have been demonstrated points is mode discrimination in multimode supported by this PT-symmetric system. In this
case, the modes are split into two classes that are
equally distributed between the active and pas-
sive regions, as well as modes that are localized
either in the gain or loss cavity. The first class of
modes remains neutral, whereas the modes lo-
cated in the gain enter the gain regime. As a result,
the passive cavity prevents some of the modes
from lasing. More interestingly, this structure

Downloaded from http://science.sciencemag.org/ on January 7, 2019


creates a large discrimination between the lasing
thresholds of the fundamental mode with its
closest competing counterpart. Assuming g0 and
g1 to be the gain coefficients for fundamental and
competing modes, respectively, in the coupled-
cavity system, the discrimination is governed by
pffiffiffiffiffiffiffiffiffiffiffiffiffiffiffi
g02  g12, which can be considerably larger than
g0 − g1 in a single laser cavity. This approach has
Fig. 5. Demonstration of enhanced perturbation near an exceptional point singularity. been utilized to enforce single longitudinal-
(A) Sensing a nanoparticle with a microtoroid resonator biased at an exceptional point (99). Blue mode operation in coupled microring lasers
arrows and curve indicate light pulses propagating in counter-rotating whispering gallery modes, and (105) (Fig. 6A) and in single rings with embedded
the red arrow and curve indicate a backscattering pulse due to the presence of additional scatterers active-passive gratings (106) (Fig. 6B). Similar
(shown with two gray circles), which help to bias the system at an exceptional point. (B) Three strategies have been utilized to filter out trans-
coupled microring resonators creating a third-order exceptional point (100).k represents the verse modes in ring resonators with large cross
strength of coupling between adjacent microrings. [Credits: (A) and (B) reprinted from (99) and sections (107), in optically and electrically pumped
(100), respectively, with permission from Springer Nature] stripe lasers (108, 109) (Fig. 6C), and in microdisc

Fig. 6. PT-symmetric laser arrangement


and its different realizations. (A) Coupled
active-passive microring resonators (105),
with a scanning electron microscope (SEM)
image shown at the bottom. (B) SEM image
of a microring resonator with an embedded
gain-loss grating (106). (C) SEM image of
coupled stripe lasers (109). (D) A schematic
of integrated coupled microring lasers (left)
and a photograph of the fabricated system
(right), where the scale bar represents 200 mm
(111). PM, phase modulator; SOA, semi-
conductor optical amplifier. [Credits: (A)
and (B) reprinted from (105) and (106),
respectively, with permission; (C) reprinted
from (109) with permission from John Wiley
and Sons; (D) reprinted from (111) with
permission from Springer Nature]

Miri et al., Science 363, eaar7709 (2019) 4 January 2019 6 of 11


R ES E A RC H | R E V IE W

lasers (110). In addition, integrated coupled mi- pological properties. That their optical properties also been presented (118). An interesting prob-
croring lasers have been demonstrated with are related to a topological feature makes the lem in this context is to adiabatically change the
single-mode operation at telecommunication wave- response inherently robust to disorder and im- parameters of a non-Hermitian system such that
lengths (111) (Fig. 6D). perfections. Analogously, exceptional points rep- the exceptional point is dynamically encircled, as
As illustrated in Fig. 7A, an interesting aspect resent an interesting example of topological depicted in Fig. 7B. In a Hermitian system, when
of exceptional points consists of their exotic features arising in simple coupled dynamical adiabatically changing the parameters along a
topological features in the parameter space. This systems as a result of the interplay between closed path, the two eigenvectors are bound to
discussion falls into the broad context of topo- interaction and dissipation. According to Fig. 7A, return to their original form, apart from acquir-
logical photonics, an area of optics research that a loop of eigenvalues that encircle a base point ing a possible geometric phase (120). In the case
has produced considerable excitement in recent identifies a topological object, given that it can- of non-Hermitian systems, instead, parametric
years. Inspired by the unusual physics of topo- not be continuously deformed to a single point cycling an exceptional point interchanges the
logical insulators in condensed-matter physics, without crossing the base point. instantaneous eigenvectors, whereas only one
topological phenomena in photonics have been The rigorous analysis of these features can be picks up the geometric phase (13, 121–123). In
shown to arise in sophisticated periodic struc- carried out using results from condensed-matter principle, this behavior does not occur, even for
tures, ranging from gyromagnetic photonic crys- physics, in which the topological band theory of arbitrarily slow dynamic cycling of the excep-
tals (112), arrays of helical waveguides (113), arrays non-Hermitian Hamiltonians has been rigorously tional point, given that the adiabatic theorem
of microring resonators (114), bianisotropic or investigated in (118). Specifically, it was shown breaks down in case of non-Hermitian systems.
magnetized metacrystals (115), dielectric chiral that non-Hermitian band structures exhibit a Indeed, under such conditions, depending on
metasurfaces (116), and time-modulated lattices topological invariant associated with the gra- the direction of rotation, one of the two eigen-
(117). In these systems, highly unusual photon dient of the band in momentum space (119). states dominates at the end of the parametric
transport, characterized by one-way propagation Inspired by the periodic table of topological cycle. This interesting topological response pro-

Downloaded from http://science.sciencemag.org/ on January 7, 2019


along the edges of the sample, arises within insulators, a systematic classification of topo- vides a scheme for topologically robust energy
bandgaps delimited by bands with distinct to- logical phases of non-Hermitian systems has conversion between different states.
On the basis of this principle, topological
energy transfer has been recently demonstra-
ted in a multimode optomechanical cavity in
which two mechanical modes of a membrane
are coupled and coherently controlled through
a laser beam (124) (Fig. 7C). In addition, dynam-
ical cycling of exceptional points is explored in a
microwave waveguide in which a robust asym-
metric transmission between even and odd modes
is demonstrated (125) (Fig. 7D). In addition, it has
been shown that this concept can provide op-
portunities for polarization manipulation (126, 127).
In particular, one can create an omnipolarizer in
which the output light is polarized along a
specific direction irrespective of the polarization
of the input state (Fig. 7E). For propagation along
the opposite direction, on the other hand, the out-
put is populated in the orthogonal polarization.

Conclusions and outlook


The peculiar features of exceptional points, as-
sociated with their unusual parameter dependence
in the eigenvalue spectrum of non-Hermitian
systems, enable exciting opportunities for a wide
range of applications. These applications arise in
scenarios in which interaction among different
modes in the presence of dissipation and/or amp-
lification is involved. In such circumstances,
coupling and gain-loss mechanisms can be
Fig. 7. Chiral mode conversion through dynamically cycling an exceptional point. (A) The engineered and utilized to induce and control
eigenvalue surfaces near an exceptional point (left). Although a loop of eigenvalues containing exceptional points, to take advantage of the strong
a base point can be continuously deformed into a circle, it cannot be shrined into a point without and anomalous parameter dependence of the
crossing the base point (right) (118, 119). p1 and p2 represent two parameters. (B) Two different system around them.
possibilities of encircling an exceptional point (EP) cycling along opposite directions. (C) The We envision future opportunities to exploit
experimental probing of the complex eigenvalues of two mechanical oscillators driven adiabatically these singular responses in photonics for ad-
through optical fields (124). The cross indicates the location of the exceptional point. (D) Asymmetric vanced dispersion engineering. As a relevant
conversion between the even and odd modes of a waveguide, when the loss and detuning are recent example, level repulsion in the group
adiabatically controlled in order to encircle an exceptional point (125). Blue and red curves indicate velocity dispersion between coupled cavities has
two modes of the waveguide, and the arrow indicates the direction of propagation. (E) An adiabatic been used to control the modal dispersion of an
conversion between orthogonal polarization states (126). Green arrows show the propagation individual cavity. This has been utilized to create
direction, yellow arrows indicate the polarization state, P is the pumping, and w is the channel width. anomalous dispersion, which is of great impor-
[Credits: (A) reprinted with permission from (118), copyright 2018 by the American Physical Society, tance in four-wave mixing and parametric fre-
and (119); (C) and (D) reprinted from (124) and (125) with permission from Springer Nature; (E) quency comb generation (128–130). However,
reprinted with permission from (126), copyright 2017 by the American Physical Society] the full potential of coupled waveguide or cavity

Miri et al., Science 363, eaar7709 (2019) 4 January 2019 7 of 11


R ES E A RC H | R E V IE W

arrangements for dispersion manipulation is dress the current challenges in integrated laser different spatial orders (135). As a result, adia-
still largely unexplored, and multiple coupled sources by taking advantage of the strong pa- batic tapering of the waveguide width along the
cavities or metamaterials may be envisioned to rameter dependence of such structures near propagation direction can efficiently convert
take full advantage of exceptional points in the exceptional points. polarization states as well as spatial-mode orders
context of dispersion engineering. Mode conversion in a compact integrated (136, 137). As shown schematically in Fig. 8C, the
In a similar fashion, coupled-cavity arrange- photonic device is another important function- inclusion of selective gain and loss in such
ments offer exciting prospects to design new ality that can largely benefit from exceptional geometries provides an alternative degree of
semiconductor lasers with highly desired func- points, in terms of reduced footprint and inherent freedom to control the mode-conversion ef-
tionalities. Although modern semiconductor laser robustness to disorder. Even though rigorous op- ficiency. In addition, hybridization between mul-
sources exist in the entire optical spectrum, their timization techniques allow for inverse design tiple modes through higher-order exceptional
coherence properties are not sufficient for many of such structures, often resulting in complex points can initiate the simultaneous conversion
applications. In particular, key requirements for structures that require advanced fabrication among a large number of modes. The full ram-
laser sources, such as stable and narrowband fre- technologies, alternative designs with reduced ifications of these concepts become very pow-
quency operation, as well as frequency tunability, complexity are highly desirable. In this vein, erful new tools in photonic engineering.
can be achieved through coupled-cavity geo- adiabatic perturbation of a structural parameter The quest for integration of optical setups on a
metries (131–134) (Fig. 8B). Even though this inducing an exceptional point–induced control- chip requires integrated implementation of
scheme has been previously applied to semi- lable level repulsion can provide a simple ap- fundamental elements such as laser sources
conductor lasers at specific frequencies, it re- proach for hybridization and adiabatic exchange with critical power and coherence demands, iso-
mains to be explored in other, arguably more of modes. Recently, it has been shown that in lators and circulators, mode convertors, and so
practical, sources and at different frequencies. optical ridge waveguides with different cladding on. In this regard, multimode structures have
In this regard, coupled-cavity techniques in and buffer materials, varying the waveguide proven to provide a great opportunity to achieve

Downloaded from http://science.sciencemag.org/ on January 7, 2019


conjunction with non-Hermitian designs pro- width induces a strong coupling between trans- desired functionalities and realize compact de-
vide an exciting strategy to systematically ad- verse electric and magnetic polarizations of vices. This trend naturally calls for a bottom-up
approach in designing photonic devices in an
abstract modal picture in which three ingre-
dients are relevant: (i) modal detuning, (ii) mode
coupling, and (iii) modal gain and/or loss. The
role of the first two processes has been largely
explored in the past in the context of coupled-
mode theory. The third mechanism, on the other
hand, has been largely unexplored. As we dis-
cussed in this survey, the interplay of these
phenomena can result into totally new oppor-
tunities for photonics, associated with the emer-
gence of exceptional points that notably alter
the eigenvalue surfaces. Therefore, notions from
exceptional point physics can provide new de-
signs for realizing multimode integrated photonic
devices. This creates opportunities for theoretical
and experimental research focused on exploring
the fundamental bounds of accessible perform-
ance, such as bandwidth and sensitivity, of
photonic devices operating at exceptional points.
It is worth stressing that inducing exceptional
points through gain and loss imposes difficulties
in experimental photonics. This is because op-
tical gain is limited to certain materials and is
not generally compatible with all platforms, and
loss is generally undesired for various purposes.
At the same time, suitable settings for investigat-
Fig. 8. Application of exceptional points in multimode photonic integrated circuits and new ing and fruitfully exploiting exceptional points
platforms to investigate exceptional points. (A to C) Applications. (A) Hybridization of arise in systems that inherently involve optical
eigenfrequencies in coupled microring resonators (top) creates two branches with strong dispersion gain or loss, such as semiconductor lasers, sat-
(bottom) (130). The anomalous dispersion can be utilized for frequency comb generation. (B) urable absorbers, and plasmonic structures, among
Wavelength manipulation in three coupled-cavity lasers through a strong dispersion at a third-order others.
exceptional point (133). (C) Level repulsion of modes with different polarization provides an Along different lines, remaining to be inves-
opportunity for compact polarization mode conversion (135, 136). A parametric evaluation of the tigated are the interesting physics arising from
eigenmodes of a rib waveguide (top left) versus the waveguide width reveals a level repulsion the propagation of classical light at exceptional
between transverse electric (TE) and transverse magnetic (TM) polarizations (bottom). Therefore, point singularities. Recent theoretical investiga-
tapering of the waveguide width over a finite distance (top right) can result in an adiabatic tions, for example, suggest dynamical slowing
polarization conversion. (D to F) New platforms. (D) Multimode optomechanical cavities provide and stopping of light in coupled waveguides at
a flexible platform for investigating exceptional points. (E) Exciton-polaritons in semiconductor exceptional points (138), as well as photonic
cavities offer an alternative multiphysics structure for realizing exceptional points. (F) Coupled catastrophe in optical lattices (139). In addition,
nanoantennas can be designed as non-Hermitian building blocks of optical metasurfaces. a point of interest would be to explore these
[Credits: (A) reprinted from (130) with permission from Springer Nature; (B) reprinted from phenomena in new platforms. An emerging play-
(133) with permission from AIP Publishing; (C) reprinted with permission from (135) and (136), ground to explore the rich physics of exceptional
copyright 2011 and 2012, respectively, Optical Society of America] points is provided by hybrid photonic platforms

Miri et al., Science 363, eaar7709 (2019) 4 January 2019 8 of 11


R ES E A RC H | R E V IE W

that integrate other degrees of freedom beyond 11. N. Moiseyev, Quantum theory of resonances: Calculating 36. H. Kogelnik, Coupled wave theory for thick hologram
optics, exploiting the interaction between dif- energies, widths and cross-sections by complex scaling. gratings. Bell Syst. Tech. J. 48, 2909–2947 (1969).
Phys. Rep. 302, 212–293 (1998). doi: 10.1016/S0370-1573 doi: 10.1002/j.1538-7305.1969.tb01198.x
ferent phenomena. In particular, cavity optome- (98)00002-7 37. R. Stolen, J. Bjorkholm, Parametric amplification and
chanics, relying on the strong coupling between 12. E. Persson, I. Rotter, H. Stöckmann, M. Barth, Observation frequency conversion in optical fibers. IEEE J.
optics and mechanical motion, offers a reconfig- of resonance trapping in an open microwave cavity. Quantum Electron. 18, 1062–1072 (1982). doi: 10.1109/
urable, inherently non-Hermitian platform that Phys. Rev. Lett. 85, 2478–2481 (2000). doi: 10.1103/ JQE.1982.1071660
PhysRevLett.85.2478; pmid: 10978086 38. M. Aspelmeyer, T. J. Kippenberg, F. Marquardt, Cavity
can be externally controlled through pump lasers 13. C. Dembowski et al., Experimental observation of the optomechanics. Rev. Mod. Phys. 86, 1391–1452 (2014).
with proper intensity and phase (140) (Fig. 8D). topological structure of exceptional points. Phys. Rev. Lett. doi: 10.1103/RevModPhys.86.1391
Operating in the red and blue sideband detuning 86, 787–790 (2001). doi: 10.1103/PhysRevLett.86.787; 39. M. Fox, Quantum Optics: An Introduction (Oxford Univ.
of the pump beam can effectively control loss or pmid: 11177940 Press, 2006).
14. H. Wenzel, U. Bandelow, H. J. Wunsche, J. Rehberg, 40. E. M. Graefe, U. Günther, H. J. Korsch, A. E. Niederle,
gain for the optical modes involved, opening ex- Mechanisms of fast self pulsations in two-section DFB lasers. A non-Hermitian PT-symmetric Bose–Hubbard model:
citing opportunities for PT symmetry and ex- IEEE J. Quantum Electron. 32, 69–78 (1996). doi: 10.1109/ Eigenvalue rings from unfolding higher-order exceptional
ceptional points in a low-noise nanophotonic 3.481922 points. J. Phys. A Math. Theor. 41, 255206 (2008).
integrated environment. Similarly, cavity polar- 15. M. V. Berry, Mode degeneracies and the Petermann excess- doi: 10.1088/1751-8113/41/25/255206
noise factor for unstable lasers. J. Mod. Opt. 50, 63–81 41. G. Demange, E.-M. Graefe, Signatures of three coalescing
itons, because of their inherent non-Hermitian eigenfunctions. J. Phys. A Math. Theor. 45, 025303 (2012).
(2003). doi: 10.1080/09500340308234532
properties, can provide another platform for in- 16. S. Bernet et al., Matter waves in time-modulated complex doi: 10.1088/1751-8113/45/2/025303
vestigating and utilizing exceptional points (141) light potentials. Phys. Rev. A 62, 023606 (2000). 42. J. Franklin, Matrix Theory (Dover Publications, 1993).
(Fig. 8E). doi: 10.1103/PhysRevA.62.023606 43. M. V. Berry, M. Wilkinson, Diabolical points in the spectra
17. C. M. Bender, S. Boettcher, Real spectra in non-Hermitian of triangles. Proc. R. Soc. London Ser. A 392, 15–43 (1984).
Finally, it is worth mentioning the potential doi: 10.1098/rspa.1984.0022
Hamiltonians having PT symmetry. Phys. Rev. Lett. 80,
of utilizing exceptional point singularities in op- 5243–5246 (1998). doi: 10.1103/PhysRevLett.80.5243 44. D. R. Yarkony, Diabolical conical intersections. Rev. Mod.
tical scattering problems, where the coupling 18. G. Lévai, M. Znojil, Systematic search for PT-symmetric Phys. 68, 985–1013 (1996). doi: 10.1103/RevModPhys.68.985

Downloaded from http://science.sciencemag.org/ on January 7, 2019


between discrete localized metastable states and potentials with real energy spectra. J. Phys. Math. Gen. 33, 45. A. H. Castro Neto, F. Guinea, N. M. R. Peres, K. S. Novoselov,
7165–7180 (2000). doi: 10.1088/0305-4470/33/40/313 A. K. Geim, The electronic properties of grapheme.
a continuum of radiation states is concerned. Rev. Mod. Phys. 81, 109–162 (2009). doi: 10.1103/
19. Z. Ahmed, Real and complex discrete eigenvalues in an
Interest in photonic bound states embedded in exactly solvable onedimensional complex PT-invariant RevModPhys.81.109
the continuum is increasing, owing to their in- potential. Phys. Lett. A 282, 343–348 (2001). doi: 10.1016/ 46. H.-J. Stockmann, Quantum Chaos: An Introduction
teresting properties (142–144). Such settings can, S0375-9601(01)00218-3 (Cambridge Univ. Press, 1999).
20. C. M. Bender, D. C. Brody, H. F. Jones, Complex extension of 47. L. Novotny, Strong coupling, energy splitting, and level
in general, be treated as non-Hermitian prob- crossings: A classical perspective. Am. J. Phys. 78,
quantum mechanics. Phys. Rev. Lett. 89, 270401 (2002).
lems, for which a point of interest would be to doi: 10.1103/PhysRevLett.89.270401; pmid: 12513185 1199–1202 (2010). doi: 10.1119/1.3471177
explore the connection between radiation leak- 21. A. Mostafazadeh, Pseudo-Hermiticity versus PT symmetry: 48. W. D. Heiss, Repulsion of resonance states and exceptional
age and exceptional points emerging in the con- The necessary condition for the reality of the spectrum of a points. Phys. Rev. E Stat. Phys. Plasmas Fluids
non-Hermitian Hamiltonian. J. Math. Phys. 43, 205–214 Relat. Interdiscip. Topics 61, 929–932 (2000). doi: 10.1103/
tinuum, as observed in recent experiments (145). PhysRevE.61.929; pmid: 11046343
(2002). doi: 10.1063/1.1418246
In addition, similar concepts can be utilized in 22. M. Bender, Making sense of non-Hermitian Hamiltonians. 49. P. von Brentano, M. Philipp, Crossing and anticrossing of
designing coupled optical nanoantennas as non- Rep. Prog. Phys. 70, 947–1018 (2007). doi: 10.1088/ energies and widths for unbound levels. Phys. Lett. B 454,
Hermitian building blocks of metasurfaces in 0034-4885/70/6/R03 171–175 (1999). doi: 10.1016/S0370-2693(99)00378-0
23. N. Moiseyev, Non-Hermitian Quantum Mechanics (Cambridge 50. C. E. Rüter et al., Observation of parity-time symmetry in
order to create scattering surfaces with desired optics. Nat. Phys. 6, 192–195 (2010). doi: 10.1038/nphys1515
Univ. Press, 2011).
phase, frequency, and polarization response 24. R. El-Ganainy, K. G. Makris, D. N. Christodoulides, 51. A. I. Magunov, I. Rotter, S. I. Strakhova, Avoided level crossing
(Fig. 8F). In addition to the radiative losses of Z. H. Musslimani, Theory of coupled optical PT-symmetric and population trapping in atoms. Physica E 9, 474–477
dielectric inclusions, the inherent loss in metallic structures. Opt. Lett. 32, 2632–2634 (2007). doi: 10.1364/ (2001). doi: 10.1016/S1386-9477(00)00247-2
OL.32.002632; pmid: 17767329 52. S. Steshenko, F. Capolino, “Single dipole approximation for
inclusions at optical frequencies can be turned modeling collections of nanoscatterers,” in Theory and
25. K. G. Makris, R. El-Ganainy, D. N. Christodoulides,
into an opportunity to realize and exploit excep- Z. H. Musslimani, Beam dynamics in PT symmetric optical Phenomena of Metamaterials, F. Capolino, Ed. (CRC Press, 2009).
tional points in properly designed geometries lattices. Phys. Rev. Lett. 100, 103904 (2008). doi: 10.1103/ 53. C. M. Gentry, M. A. Popović, Dark state lasers. Opt. Lett. 39,
(146). We envision exciting opportunities in trans- PhysRevLett.100.103904; pmid: 18352189 4136–4139 (2014). doi: 10.1364/OL.39.004136; pmid: 25121670
26. S. Klaiman, U. Günther, N. Moiseyev, Visualization of branch 54. R. E. Collin, Field Theory of Guided Waves (Wiley-IEEE
lating the concepts of exceptional point physics
points in PT-symmetric waveguides. Phys. Rev. Lett. 101, Press, ed. 2, 1991).
to quantum nanophotonic and low-photon hybrid 080402 (2008). doi: 10.1103/PhysRevLett.101.080402; 55. Y. D. Chong, L. Ge, A. D. Stone, PT-symmetry breaking and
systems. pmid: 18764593 laser-absorber modes in optical scattering systems.
27. S. Longhi, Bloch oscillations in complex crystals with PT Phys. Rev. Lett. 106, 093902 (2011). doi: 10.1103/
symmetry. Phys. Rev. Lett. 103, 123601 (2009). doi: 10.1103/ PhysRevLett.106.093902; pmid: 21405622
RE FE RENCES AND N OT ES PhysRevLett.103.123601; pmid: 19792436 56. A. Guo et al., Observation of PT-symmetry breaking in
1. N. J. Dunford, J. T. Schwartz, Linear Operators, Parts I and II 28. A. A. Zyablovsky, A. P. Vinogradov, A. A. Pukhov, complex optical potentials. Phys. Rev. Lett. 103,
(Wiley, 1988). A. V. Dorofeenko, A. A. Lisyansky, PT-symmetry in optics. 093902 (2009). doi: 10.1103/PhysRevLett.103.093902;
2. M. Morse, H. Feshbach, Methods of Theoretical Physics Phys. Uspekhi 57, 1063–1082 (2014). doi: 10.3367/ pmid: 19792798
(McGraw-Hill, 1953). UFNe.0184.201411b.1177 57. B. Peng et al., Parity–time-symmetric whispering-gallery
3. C. R. Wylie, Advanced Engineering Mathematics 29. V. V. Konotop, J. Yang, D. A. Zezyulin, Nonlinear waves in microcavities. Nat. Phys. 10, 394–398 (2014). doi: 10.1038/
(McGraw-Hill, ed. 2, 1960). PT-symmetric systems. Rev. Mod. Phys. 88, 035002 (2016). nphys2927
4. G. Strang, Introduction to Linear Algebra (Wellesley- doi: 10.1103/RevModPhys.88.035002 58. L. Chang et al., Parity–time symmetry and variable optical
Cambridge Press, ed. 2, 1993). 30. L. Feng, R. El-Ganainy, L. Ge, Non-Hermitian photonics isolation in active–passive-coupled microresonators.
5. W. D. Heiss, The physics of exceptional points. J. Phys. A based on parity–time symmetry. Nat. Photonics 11, 752–762 Nat. Photonics 8, 524–529 (2014). doi: 10.1038/
Math. Theor. 45, 444016 (2012). doi: 10.1088/1751-8113/45/ (2017). doi: 10.1038/s41566-017-0031-1 nphoton.2014.133
44/444016 31. S. Longhi, Parity-time symmetry meets photonics: A new 59. A. Regensburger et al., Parity-time synthetic photonic
6. T. Kato, Perturbation Theory of Linear Operators (Springer, twist in non-Hermitian optics. EPL 120, 64001 (2018). lattices. Nature 488, 167–171 (2012). doi: 10.1038/
1966). doi: 10.1209/0295-5075/120/64001 nature11298; pmid: 22874962
7. M. V. Berry, D. H. J. O’Dell, Diffraction by volume gratings 32. R. El-Ganainy et al., Non-Hermitian physics and PT symmetry. 60. B. Zhen et al., Spawning rings of exceptional points out of
with imaginary potentials. J. Phys. Math. Gen. 31, 2093–2101 Nat. Phys. 14, 11–19 (2018). doi: 10.1038/nphys4323 Dirac cones. Nature 525, 354–358 (2015). doi: 10.1038/
(1998). doi: 10.1088/0305-4470/31/8/019 33. H. A. Haus, W. Huang, Coupled-mode theory. Proc. IEEE 79, nature14889; pmid: 26352476
8. W. D. Heiss, Phases of wave functions and level repulsion. 1505–1518 (1991). doi: 10.1109/5.104225 61. S.-B. Lee et al., Observation of an exceptional point in a chaotic
Eur. Phys. J. D 7, 1–4 (1999). doi: 10.1007/s100530050339 34. A. Yariv, Coupled-mode theory for guided-wave optics. optical microcavity. Phys. Rev. Lett. 103, 134101 (2009).
9. M. V. Berry, Physics of nonhermitian degeneracies. IEEE J. Quantum Electron. 9, 919–933 (1973). doi: 10.1109/ doi: 10.1103/PhysRevLett.103.134101; pmid: 19905515
Czech. J. Phys. 54, 1039–1047 (2004). doi: 10.1023/ JQE.1973.1077767 62. S. Longhi, PT-symmetric laser absorber. Phys. Rev. A 82,
B:CJOP.0000044002.05657.04 35. J. P. Gordon, H. Kogelnik, PMD fundamentals: 031801 (2010). doi: 10.1103/PhysRevA.82.031801
10. W. D. Heiss, Exceptional points of non-Hermitian operators. Polarization mode dispersion in optical fibers. Proc. Natl. 63. Z. J. Wong et al., Lasing and anti-lasing in a single cavity.
J. Phys. Math. Gen. 37, 2455–2464 (2004). doi: 10.1088/ Acad. Sci. U.S.A. 97, 4541–4550 (2000). doi: 10.1073/ Nat. Photonics 10, 796–801 (2016). doi: 10.1038/
0305-4470/37/6/034 pnas.97.9.4541; pmid: 10781059 nphoton.2016.216

Miri et al., Science 363, eaar7709 (2019) 4 January 2019 9 of 11


R ES E A RC H | R E V IE W

64. M. Kulishov, J. Laniel, N. Bélanger, J. Azaña, D. Plant, 87. M. Brandstetter et al., Reversing the pump dependence of a 112. Z. Wang, Y. Chong, J. D. Joannopoulos, M. Soljacić,
Nonreciprocal waveguide Bragg gratings. Opt. Express 13, laser at an exceptional point. Nat. Commun. 5, 4034 (2014). Observation of unidirectional backscattering-immune
3068–3078 (2005). doi: 10.1364/OPEX.13.003068; doi: 10.1038/ncomms5034; pmid: 24925314 topological electromagnetic states. Nature 461, 772–775
pmid: 19495203 88. B. Peng et al., Loss-induced suppression and revival of lasing. (2009). doi: 10.1038/nature08293; pmid: 19812669
65. Z. Lin et al., Unidirectional invisibility induced by Science 346, 328–332 (2014). doi: 10.1126/science.1258004; 113. M. C. Rechtsman et al., Photonic Floquet topological
PT-symmetric periodic structures. Phys. Rev. Lett. 106, pmid: 25324384 insulators. Nature 496, 196–200 (2013). doi: 10.1038/
213901 (2011). doi: 10.1103/PhysRevLett.106.213901; 89. Z. H. Musslimani, K. G. Makris, R. El-Ganainy, nature12066; pmid: 23579677
pmid: 21699297 D. N. Christodoulides, Optical solitons in PT periodic 114. M. Hafezi, S. Mittal, J. Fan, A. Migdall, J. M. Taylor, Imaging
66. G. Castaldi, S. Savoia, V. Galdi, A. Alù, N. Engheta, PT potentials. Phys. Rev. Lett. 100, 030402 (2008). topological edge states in silicon photonics. Nat. Photonics 7,
metamaterials via complex-coordinate transformation optics. doi: 10.1103/PhysRevLett.100.030402; pmid: 18232949 1001–1005 (2013). doi: 10.1038/nphoton.2013.274
Phys. Rev. Lett. 110, 173901 (2013). doi: 10.1103/ 90. N. Akhmediev, A. Ankiewicz, Dissipative Solitons (Springer, 2005). 115. X. Ni et al., Spin- and valley-polarized one-way Klein tunneling
PhysRevLett.110.173901; pmid: 23679728 91. A. E. Miroshnichenko, B. A. Malomed, Y. S. Kivshar, in photonic topological insulators. Sci. Adv. 4, eaap8802
67. M.-A. Miri, A. B. Aceves, T. Kottos, V. Kovanis, Nonlinearly PT-symmetric systems: Spontaneous symmetry (2018). doi: 10.1126/sciadv.aap8802; pmid: 29756032
D. N. Christodoulides, Bragg solitons in nonlinear PT- breaking and transmission resonances. Phys. Rev. A 84, 116. M. A. Gorlach et al., Far-field probing of leaky topological
symmetric periodic potentials. Phys. Rev. A 86, 033801 012123 (2011). doi: 10.1103/PhysRevA.84.012123 states in all-dielectric metasurfaces. Nat. Commun.
(2012). doi: 10.1103/PhysRevA.86.033801 92. S. Nixon, L. Ge, J. Yang, Stability analysis for solitons in PT- 9, 909 (2018). doi: 10.1038/s41467-018-03330-9;
68. L. Feng et al., Experimental demonstration of a unidirectional symmetric optical lattices. Phys. Rev. A 85, 023822 (2012). pmid: 29500466
reflectionless parity-time metamaterial at optical frequencies. doi: 10.1103/PhysRevA.85.023822 117. R. Fleury, A. B. Khanikaev, A. Alù, Floquet topological
Nat. Mater. 12, 108–113 (2013). doi: 10.1038/nmat3495; 93. M. Wimmer et al., Observation of optical solitons in PT- insulators for sound. Nat. Commun. 7, 11744 (2016).
pmid: 23178268 symmetric lattices. Nat. Commun. 6, 7782 (2015). doi: 10.1038/ncomms11744; pmid: 27312175
69. Y. Yan, N. C. Giebink, Passive PT symmetry in organic doi: 10.1038/ncomms8782; pmid: 26215165 118. Z. Gong et al., Topological phases of non-Hermitian systems.
composite films via complex refractive index modulation. 94. R. W. Boyd, Nonlinear Optics (Academic Press, 2003). Phys. Rev. X 8, 031079 (2018). doi: 10.1103/
Adv. Opt. Mater. 2, 423–427 (2014). doi: 10.1002/ 95. J. P. Dowling, M. Scalora, M. J. Bloemer, C. M. Bowden, The PhysRevLett.120.146402; pmid: 29694133
adom.201400021 photonic band edge laser: A new approach to gain 119. H. Shen, B. Zhen, L. Fu, Topological band theory for
70. R. Fleury, D. Sounas, A. Alù, An invisible acoustic sensor enhancement. J. Appl. Phys. 75, 1896–1899 (1994). non-Hermitian Hamiltonians. Phys. Rev. Lett. 120,
based on parity-time symmetry. Nat. Commun. 6, 5905 doi: 10.1063/1.356336 146402 (2018). doi: 10.1103/PhysRevLett.120.146402;

Downloaded from http://science.sciencemag.org/ on January 7, 2019


(2015). doi: 10.1038/ncomms6905; pmid: 25562746 96. C. M. Bender, S. A. Orszag, Advanced Mathematical Methods pmid: 29694133
71. P. Miao et al., Orbital angular momentum microlaser. for Scientists and Engineers I: Asymptotic Methods and 120. M. V. Berry, Quantal phase factors accompanying adiabatic
Science 353, 464–467 (2016). doi: 10.1126/science.aaf8533; Perturbation Theory (McGraw-Hill, 1978). changes. Proc. R. Soc. London Ser. A 392, 45–57 (1984).
pmid: 27471299 97. J. Wiersig, Enhancing the sensitivity of frequency and doi: 10.1098/rspa.1984.0023
72. J. Wiersig et al., Nonorthogonal pairs of copropagating optical energy splitting detection by using exceptional points: 121. C. Dembowski et al., Encircling an exceptional point.
modes in deformed microdisk cavities. Phys. Rev. A 84, Application to microcavity sensors for single-particle Phys. Rev. E Stat. Nonlin. Soft Matter Phys. 69, 056216
023845 (2011). doi: 10.1103/PhysRevA.84.023845 detection. Phys. Rev. Lett. 112, 203901 (2014). doi: 10.1103/ (2004). doi: 10.1103/PhysRevE.69.056216; pmid: 15244913
73. B. Peng et al., Chiral modes and directional lasing at PhysRevLett.112.203901 122. A. A. Mailybaev, O. N. Kirillov, A. P. Seyranian, Geometric
exceptional points. Proc. Natl. Acad. Sci. U.S.A. 113, 98. Z. P. Liu et al., Metrology with PT-symmetric cavities: phase around exceptional points. Phys. Rev. A 72, 014104
6845–6850 (2016). doi: 10.1073/pnas.1603318113; Enhanced sensitivity near the PT-phase transition. (2005). doi: 10.1103/PhysRevA.72.014104
pmid: 27274059 Phys. Rev. Lett. 117, 110802 (2016). doi: 10.1103/ 123. R. Uzdin, N. Moiseyev, Scattering from a waveguide by
74. M. Kim, K. Kwon, J. Shim, Y. Jung, K. Yu, Partially PhysRevLett.117.110802; pmid: 27661674 cycling a non-Hermitian degeneracy. Phys. Rev. A 85, 031804
directional microdisk laser with two Rayleigh scatterers. 99. W. Chen, Ş. Kaya Özdemir, G. Zhao, J. Wiersig, L. Yang, (2012). doi: 10.1103/PhysRevA.85.031804
Opt. Lett. 39, 2423–2426 (2014). doi: 10.1364/ Exceptional points enhance sensing in an optical microcavity. 124. H. Xu, D. Mason, L. Jiang, J. G. E. Harris, Topological energy
OL.39.002423; pmid: 24979009 Nature 548, 192–196 (2017). doi: 10.1038/nature23281; transfer in an optomechanical system with exceptional
75. R. Fleury, D. L. Sounas, A. Alù, Negative refraction and planar pmid: 28796206 points. Nature 537, 80–83 (2016). doi: 10.1038/nature18604;
focusing based on parity-time symmetric metasurfaces. 100. H. Hodaei et al., Enhanced sensitivity at higher-order pmid: 27454555
Phys. Rev. Lett. 113, 023903 (2014). doi: 10.1103/ exceptional points. Nature 548, 187–191 (2017). 125. J. Doppler et al., Dynamically encircling an exceptional
PhysRevLett.113.023903; pmid: 25062184 doi: 10.1038/nature23280; pmid: 28796201 point for asymmetric mode switching. Nature 537,
76. X. Zhu, L. Feng, P. Zhang, X. Yin, X. Zhang, One-way invisible 76–79 (2016). doi: 10.1038/nature18605; pmid: 27454554
101. W. Langbein, No exceptional precision of exceptional-point
cloak using parity-time symmetric transformation optics. 126. A. U. Hassan, B. Zhen, M. Soljačić, M. Khajavikhan,
sensors. Phys. Rev. A 98, 023805 (2018).
Opt. Lett. 38, 2821–2824 (2013). doi: 10.1364/OL.38.002821; D. N. Christodoulides, Dynamically encircling exceptional
doi: 10.1103/PhysRevA.98.023805
pmid: 23903152 points: Exact evolution and polarization state conversion.
102. M. Zhang, W. Sweeney, C. W. Hsu, L. Yang, A. D. Stone,
77. D. L. Sounas, R. Fleury, A. Alù, Unidirectional cloaking Phys. Rev. Lett. 118, 093002 (2017). doi: 10.1103/
L. Jiang, Quantum noise theory of exceptional point sensors.
based on metasurfaces with balanced loss and gain. PhysRevLett.118.093002; pmid: 28306295
arxiv:1805.12001 [quant-ph] (30 May 2018). 127. S. N. Ghosh, Y. D. Chong, Exceptional points and asymmetric
Phys. Rev. Appl. 4, 014005 (2015). doi: 10.1103/ 103. P.-Y. Chen et al., Generalized parity–time symmetry
PhysRevApplied.4.014005 mode conversion in quasi-guided dual-mode optical
condition for enhanced sensor telemetry. Nat. Electron. 1,
78. M. Fleischhauer, A. Imamoglu, J. P. Marangos, waveguides. Sci. Rep. 6, 19837 (2016). doi: 10.1038/
297–304 (2018). doi: 10.1038/s41928-018-0072-6
Electromagnetically induced transparency: Optics in coherent srep19837; pmid: 27101933
104. M.-A. Miri, P. LiKamWa, D. N. Christodoulides, Large area 128. Y. Liu et al., Investigation of mode coupling in normal-
media. Rev. Mod. Phys. 77, 633–673 (2005). doi: 10.1103/ single-mode parity-time-symmetric laser amplifiers.
RevModPhys.77.633 dispersion silicon nitride microresonators for Kerr frequency
Opt. Lett. 37, 764–766 (2012). doi: 10.1364/OL.37.000764; comb generation. Optica 1, 137–144 (2014). doi: 10.1364/
79. C. Hang, G. Huang, V. V. Konotop, PT symmetry pmid: 22378386
with a system of three-level atoms. Phys. Rev. Lett. 110, OPTICA.1.000137
105. H. Hodaei, M.-A. Miri, M. Heinrich, D. N. Christodoulides, 129. S. Ramelow et al., Strong polarization mode coupling in
083604 (2013). doi: 10.1103/PhysRevLett.110.083604; M. Khajavikhan, Parity-time-symmetric microring lasers. microresonators. Opt. Lett. 39, 5134–5137 (2014).
pmid: 23473145 Science 346, 975–978 (2014). doi: 10.1126/science.1258480; doi: 10.1364/OL.39.005134; pmid: 25166092
80. J. Sheng, M.-A. Miri, D. N. Christodoulides, M. Xiao, PT- pmid: 25414308 130. S. Kim et al., Dispersion engineering and frequency comb
symmetric optical potentials in a coherent atomic medium. 106. L. Feng, Z. J. Wong, R. M. Ma, Y. Wang, X. Zhang, generation in thin silicon nitride concentric microresonators.
Phys. Rev. A 88, 041803 (2013). doi: 10.1103/ Single-mode laser by parity-time symmetry breaking. Nat. Commun. 8, 372 (2017). pmid: 28851874
PhysRevA.88.041803 Science 346, 972–975 (2014). doi: 10.1126/science.1258479; 131. W. T. Tsang, N. A. Olsson, R. A. Logan, Stable single-
81. P. Peng et al., Anti-parity–time symmetry with flying atoms. pmid: 25414307 longitudinal-mode operation under high-speed direct
Nat. Phys. 12, 1139–1145 (2016). doi: 10.1038/nphys3842 107. H. Hodaei et al., Single mode lasing in transversely multi‐ modulation in cleaved-coupled-cavity GaInAsP
82. Z. Zhang et al., Observation of parity-time symmetry in moded PT‐symmetric microring resonators. Laser Photonics semiconductor lasers. Electron. Lett. 19, 488–490 (1983).
optically induced atomic lattices. Phys. Rev. Lett. 117, 123601 Rev. 10, 494–499 (2016). doi: 10.1002/lpor.201500292 doi: 10.1049/el:19830331
(2016). doi: 10.1103/PhysRevLett.117.123601; pmid: 27689270 108. Z. Gu et al., Experimental demonstration of PT‐symmetric 132. L. Coldren, T. Koch, Analysis and design of coupled-cavity
83. M. J. Weber, Handbook of Optical Materials (CRC Press, stripe lasers. Laser Photonics Rev. 10, 588–594 (2016). lasers—Part I: Threshold gain analysis and design guidelines.
2002). doi: 10.1002/lpor.201500114 IEEE J. Quantum Electron. 20, 659–670 (1984). doi: 10.1109/
84. H. Ramezani, T. Kottos, R. El-Ganainy, D. N. Christodoulides, 109. R. Yao, C.-S. Lee, V. Podolskiy, W. Guo, Electrically injected JQE.1984.1072438
Unidirectional nonlinear PT-symmetric optical structures. parity time–symmetric single transverse–mode lasers. 133. P. Pellandini et al., Dual-wavelength laser emission from a
Phys. Rev. A 82, 043803 (2010). doi: 10.1103/ Laser Photonics Rev. 10.1002/lpor.201800154 (2018). coupled semiconductor microcavity. Appl. Phys. Lett. 71,
PhysRevA.82.043803 doi: 10.1002/lpor.201500114 864–866 (1997). doi: 10.1063/1.119671
85. P. Aleahmad, M. Khajavikhan, D. Christodoulides, P. LiKamWa, 110. N. Zhang et al., Quasiparity‐time symmetric microdisk laser. 134. Z. Gao, S. T. M. Fryslie, B. J. Thompson, P. S. Carney,
Integrated multi-port circulators for unidirectional optical Laser Photonics Rev. 11, 1700052 (2017). doi: 10.1002/ K. D. Choquette, Parity-time symmetry in coherently coupled
information transport. Sci. Rep. 7, 2129 (2017). doi: 10.1038/ lpor.201700052 vertical cavity laser arrays. Optica 4, 323–329 (2017).
s41598-017-02340-9; pmid: 28522872 111. W. Liu et al., An integrated parity-time symmetric doi: 10.1364/OPTICA.4.000323
86. M. Liertzer et al., Pump-induced exceptional points in lasers. wavelength-tunable single-mode microring laser. 135. D. Dai, J. E. Bowers, Novel concept for ultracompact polarization
Phys. Rev. Lett. 108, 173901 (2012). doi: 10.1103/ Nat. Commun. 8, 15389 (2017). doi: 10.1038/ncomms15389; splitter-rotator based on silicon nanowires. Opt. Express 19,
PhysRevLett.108.173901; pmid: 22680867 pmid: 28497784 10940–10949 (2011). doi: 10.1364/OE.19.010940; pmid: 21643354

Miri et al., Science 363, eaar7709 (2019) 4 January 2019 10 of 11


R ES E A RC H | R E V IE W

136. D. Dai, Y. Tang, J. E. Bowers, Mode conversion in tapered 141. T. Byrnes, N. Y. Kim, Y. Yamamoto, Exciton–polariton 145. A. Regensburger et al., Observation of defect states in
submicron silicon ridge optical waveguides. Opt. Express 20, condensates. Nat. Phys. 10, 803–813 (2014). doi: 10.1038/ PT-symmetric optical lattices. Phys. Rev. Lett. 110, 223902
13425–13439 (2012). doi: 10.1364/OE.20.013425; pmid: 22714370 nphys3143 (2013). doi: 10.1103/PhysRevLett.110.223902;
137. Z. Zhang, X. Hu, J. Wang, On-chip optical mode exchange 142. Y. Plotnik et al., Experimental observation of optical bound pmid: 23767725
using tapered directional coupler. Sci. Rep. 5, 16072 (2015). states in the continuum. Phys. Rev. Lett. 107, 183901 146. J. B. Khurgin, How to deal with the loss in plasmonics and
doi: 10.1038/srep16072; pmid: 26530728 (2011). doi: 10.1103/PhysRevLett.107.183901; metamaterials. Nat. Nanotechnol. 10, 2–6 (2015).
138. T. Goldzak, A. A. Mailybaev, N. Moiseyev, Light pmid: 22107630 doi: 10.1038/nnano.2014.310; pmid: 25559961
stops at exceptional points. Phys. Rev. Lett. 120, 143. A. Kodigala et al., Lasing action from photonic bound states
013901 (2018). doi: 10.1103/PhysRevLett.120.013901; in continuum. Nature 541, 196–199 (2017). doi: 10.1038/ AC KNOWLED GME NTS
pmid: 29350937 nature20799; pmid: 28079064 Funding: This work was supported by the Office of Naval Research,
139. S. Longhi, Exceptional points and photonic catastrophe. 144. H. M. Doeleman, F. Monticone, W. den Hollander, the Simons Foundation, the Air Force Office of Scientific
Opt. Lett. 43, 2929–2932 (2018). doi: 10.1364/ A. Alù, A. F. Koenderink, Experimental observation Research, and the National Science Foundation. Competing
OL.43.002929; pmid: 29905726 of a polarization vortex at an optical bound state interests: None declared.
140. E. Verhagen, A. Alù, Optomechanical nonreciprocity. in the continuum. Nat. Photonics 12, 397–401 (2018).
Nat. Phys. 13, 922–924 (2017). doi: 10.1038/nphys4283 doi: 10.1038/s41566-018-0177-5 10.1126/science.aar7709

Downloaded from http://science.sciencemag.org/ on January 7, 2019

Miri et al., Science 363, eaar7709 (2019) 4 January 2019 11 of 11


R ES E A RC H

◥ the context of tissue challenges such as chitin


RESEARCH ARTICLE SUMMARY injection or insect bites, commensal-specific
RORgt+ T cells were able to produce type 2
cytokines (IL-5 and IL-13). The spontaneous
IMMUNOLOGY
release of type 2 cytokines by these cells was
also observed in the context of local defects
Commensal-specific T cell in immune regulation associated with impaired
regulatory T cell function. Alarmins associated

plasticity promotes rapid tissue with tissue damage and inflammation, such
as IL-1, IL-18, IL-25, and IL-33, were able to
superimpose a type 2 effector program on
adaptation to injury ON OUR WEBSITE

both TC17 and TH17 cells
in the context of T cell re-
Oliver J. Harrison, Jonathan L. Linehan, Han-Yu Shih, Nicolas Bouladoux, Read the full article ceptor engagement. Using
Seong-Ji Han, Margery Smelkinson, Shurjo K. Sen, Allyson L. Byrd, Michel Enamorado, at http://dx.doi. an IL-17A fate-mapping
org/10.1126/ strategy, we found that
Chen Yao, Samira Tamoutounour, Francois Van Laethem, Charlotte Hurabielle,
science.aat6280 IL-17A–committed RORgt+
Nicholas Collins, Andrea Paun, Rosalba Salcedo, John J. O’Shea, Yasmine Belkaid* ..................................................
T cells and their IL-17A−
+
INTRODUCTION: Barrier tissues are con- challenges relies on rapid and coordinated local RORgt counterparts both produced type 2
stitutive targets of environmental stressors responses tailored to both the microenviron- cytokines in response to tissue alarmins. Such

Downloaded from http://science.sciencemag.org/ on January 7, 2019


and are home to a highly diverse microbiota. ment and the nature of the instigating injury. cellular plasticity allows commensal-specific
When the immune system encounters these Our study explored whether commensal-specific type 17 cells to promote IL-17A–mediated
noninvasive microbes, one possible result is T cells can act as tissue sentinels, allowing rapid antimicrobial defense under homeostatic con-
the induction of cognate T cell responses that adaptation to defined injuries, and how dys- ditions, as well as tissue repair in an IL-13–
control various aspects of tissue function, in- regulation of these responses may have path- dependent manner in the context of tissue
cluding antimicrobial defense and tissue re- ogenic consequences. injury.
pair. Given the extraordinary number of antigens
expressed by the microbiota, a substantial frac- RESULTS: Homeostatic encounters with com- CONCLUSION: Our work describes a tissue
tion of barrier tissue–resident T cells are ex- mensal microbes promoted the induction of checkpoint that relies on the remarkable
pected to be commensal-specific, accumulating commensal-specific interleukin-17A (IL-17A)– plasticity and adaptability of tissue-resident
over time in response to successive exposure to producing T cells [CD4+ (TH17) and CD8+ (TC17)] commensal-specific T cells. We propose that
new commensals. Because barrier tissues are that persisted as tissue-resident memory cells. this feature may also have important implica-
defined by the constitutive coexistence of com- Surprisingly, commensal-specific T cells were tions in the etiology of tissue-specific inflam-
mensals and commensal-reactive lymphocytes, characterized by coexpression of classically an- matory disorders. The extraordinary number
any understanding of tissue homeostasis, re- tagonistic transcription factors (RORgt and of both commensal-derived antigens and T cells
sponse to injury, and tissue-specific pathologies GATA-3) that control the respective expression at barrier sites suggests that the ability of
must occur in the context of this fundamental of type 17 and type 2 programs. Consequently, commensal-specific T cells to functionally
dialog. commensal-specific T cells displayed a hybrid adapt to injury may play a fundamental role in

RATIONALE: The skin serves as a primary


chromatin landscape that underlies the co-
expression of a broad type 2 transcriptome,
controlling tissue physiology.

interface with the environment and is conse- including the type 2 effector cytokines IL-5
The list of author affiliations is available in the full article online.
quently a constitutive target of environmental and IL-13. Notably, during homeostasis, RORgt+ *Corresponding author. Email: ybelkaid@niaid.nih.gov
stressors mediated by physical damage or in- T cells expressed type 2 cytokine mRNA without Cite this article as O. J. Harrison et al., Science 363, eaat6280
vasive pathogens. Tissue protection from these subsequent protein translation. By contrast, in (2019). DOI: 10.1126/science.aat6280

Homeostasis Tissue injury Impaired regulation


Microbiota

Antimicrobial Poised type 2 Wound Tissue


defense immunity repair Inflammation

Il5, Alarmins
IL-17A IL-13
Il13 mRNA IL-1 IL-5
IL-18 IL-13
IL-25
IL-33
Commensal-specific Alarmin-licensed Foxp3+ Treg
CD4+ and CD8+ T cells T cell plasticity

Poised type 2 immunity of commensal-specific T cells promotes rapid adaptation to tissue injury. Commensal-specific T cells produce
IL-17A under homeostatic conditions for antimicrobial defense while harboring a poised type 2 transcriptome. Tissue injury licenses type 2
immune potential of commensal-specific type 17 T cells, thereby promoting tissue repair. Impaired immune regulation unleashes type 2
cytokine production from commensal-specific CD8+ TC17 cells.

Harrison et al., Science 363, 43 (2019) 4 January 2019 1 of 1


R ES E A RC H

◥ defined injury remains unknown. Here, we ex-


RESEARCH ARTICLE plored the unique features of commensal-specific
T cells and how their distinct wiring might
promote physiological or pathological tissue
IMMUNOLOGY adaptation.

Acute injury licenses type 2 cytokine


Commensal-specific T cell production from commensal-specific
type 17 T cells
plasticity promotes rapid tissue The skin is home to a number of resident lympho-
cytes, some of which recognize the microbiota

adaptation to injury (4, 6–8). We first assessed whether commensal-


specific T cells could develop as nonrecirculat-
ing tissue-resident memory cells (TRM), a subset
Oliver J. Harrison1, Jonathan L. Linehan1*, Han-Yu Shih2, Nicolas Bouladoux1,3, of memory T cells previously shown to accumu-
Seong-Ji Han1, Margery Smelkinson4, Shurjo K. Sen5, Allyson L. Byrd1*, late in tissues upon pathogen encounter and
Michel Enamorado1, Chen Yao2, Samira Tamoutounour1, Francois Van Laethem6†, promote local immunity (9). Staphylococcus
Charlotte Hurabielle1,7, Nicholas Collins1, Andrea Paun8, Rosalba Salcedo9, epidermidis colonization of the skin promotes
John J. O’Shea2, Yasmine Belkaid1,3‡ the noninflammatory accumulation of both CD4+
[T helper 1 (TH1) and TH17] and CD8+ T cells
Barrier tissues are primary targets of environmental stressors and are home to the largest [T cytotoxic 1 (TC1) and TC17] (4). A large fraction

Downloaded from http://science.sciencemag.org/ on January 7, 2019


number of antigen-experienced lymphocytes in the body, including commensal-specific (>80%) of these S. epidermidis–specific poly-
T cells. We found that skin-resident commensal-specific T cells harbor a paradoxical clonal CD8+ T cells are nonclassically restricted
program characterized by a type 17 program associated with a poised type 2 state. Thus, (6). S. epidermidis–specific CD8+ T cells can be
in the context of injury and exposure to inflammatory mediators such as interleukin-18, tracked via the use of a peptide–major histocom-
these cells rapidly release type 2 cytokines, thereby acquiring contextual functions. Such patibility complex (MHC) tetramer (f-MIIINA:
acquisition of a type 2 effector program promotes tissue repair. Aberrant type 2 responses H2-M3) (6) and newly generated T cell receptor
can also be unleashed in the context of local defects in immunoregulation. Thus, (TCR)–transgenic mice (BowieTg). Both tools
commensal-specific T cells co-opt tissue residency and cell-intrinsic flexibility as a means recapitulate the S. epidermidis–specific polyclonal
to promote both local immunity and tissue adaptation to injury. CD8+ T cell response, including cytokine po-
tential, skin-homing, and distribution of the tis-

B
sue residency markers CD69 and CD103 (9) (Fig. 1,
arrier tissues are constitutive targets of T cell responses (1–4). This tonic recognition pro- A to C). To assess tissue residency, we generated
environmental stressors as well as primary motes a highly physiological form of adaptive S. epidermidis–colonized parabiotic mice, which
sites of exposure to symbiotic and patho- immunity that can control distinct aspects of establish chimerism through joint circulation
genic microbes. As such, under homeosta- tissue function, including antimicrobial defense (10) (fig. S1A). In contrast to lymphoid organs,
sis, barrier tissues are home to vast numbers and tissue repair (5, 6). Because of the extraor- where cells equilibrated, f-MIIINA:H2-M3+ CD8+
of antigen-experienced lymphocytes. The numer- dinary number of antigens expressed by the T cells within the skin were host-derived (97.1 ±
ous and diverse microbes that colonize these microbiota, a substantial fraction of barrier tissue- 2.4%) and coexpressed CD103 and CD69 (Fig. 1,
tissues, referred to as the microbiota, play a fun- resident T cells are expected to be commensal- D and E). Thus, commensal-specific T cells can
damental role in the induction and quality of specific, accumulating over time in response to develop as long-lived tissue-resident memory
these local immune responses, including those successive exposure to new commensals. This T cells.
that are directed at the microbiota itself (1–4). understanding of host-microbiota interactions Given the fundamental role of the skin as a
Indeed, far from being ignored, microbes at all has important implications for our understand- protective barrier, we sought to determine the
barrier surfaces are actively recognized by the ing of host immunity and pathologies. Because impact of environmental stressors on commensal-
immune system. Encounters with noninvasive barrier tissues are defined by the constitutive specific tissue-resident T cells. After colonization,
symbionts can lead to the induction of cognate coexistence of commensals (and associated anti- S. epidermidis–specific polyclonal CD8+ T cells
gens) and commensal-reactive lymphocytes, our were identified as T-bet + CCR6 − TC1 cells or
1
Mucosal Immunology Section, Laboratory of Parasitic Diseases,
understanding of tissue homeostasis, response to RORgt+CCR6+ TC17 cells [of which ~30% have
National Institute of Allergy and Infectious Diseases, Bethesda, injury, and tissue-specific pathologies must occur interleukin (IL)–17A production potential] (Fig.
MD 20892, USA. 2Molecular Immunology and Inflammation in the context of this fundamental dialog. 1, F and G). Although the intradermal injection
Branch, National Institute of Arthritis and Musculoskeletal and The skin serves as a primary interface with of chitin or sand fly (Lutzomyia longipalpis)
Skin Diseases, Bethesda, MD 20892, USA. 3NIAID Microbiome
Program, National Institute of Allergy and Infectious Diseases,
the environment and is consequently a consti- bites had no impact on the potential for IL-17A
Bethesda, MD 20892, USA. 4Biological Imaging, Research tutive target of environmental stressors medi- and interferon (IFN)–g production by TC17 and
Technology Branch, National Institute of Allergy and Infectious ated by physical damage, invasive pathogens, TC1 cells, respectively (Fig. 1H), both stressors
Diseases, Bethesda, MD 20892, USA. 5Leidos Biomedical impaired immune regulation, or the nutritional revealed a surprising potential for the produc-
Research Inc., Basic Science Program, Cancer and Inflammation
Program, Frederick National Laboratory for Cancer Research,
state of the host. Tissue protection from these tion of IL-5 and IL-13 from S. epidermidis–
Bethesda, MD 20892, USA. 6Experimental Immunology Branch, challenges relies on rapid and coordinated local elicited TC17 cells, including f-MIIINA:H2-M3+
National Cancer Institute, Bethesda, MD 20892, USA. 7Inserm responses tailored to both the microenvironment CD8+ T cells (Fig. 1, H and I, and fig. S1, B and
Unité 976, Hôpital Saint-Louis, Paris, France. 8Intracellular and the nature of the instigating injury. Recently, C). Increased type 2 cytokine production after
Parasite Biology Section, Laboratory of Parasitic Diseases,
National Institute of Allergy and Infectious Diseases, Bethesda,
the discovery that cells such as innate lymphoid chitin or sand fly challenge was also observed
MD 20892, USA. 9Cancer and Inflammation Program, National cells (ILCs) can rapidly respond to mediators from RORgt-expressing CD4 + T cells (TH17)
Cancer Institute, Bethesda, MD 20892, USA. released during tissue damage has provided a elicited by S. epidermidis (fig. S1D). Thus, RORgt+
*Present address: Department of Cancer Immunology, Genentech, framework to begin to understand this phenom- T cells (both CD8+ and CD4+ T cells) elicited
South San Francisco, CA 94080, USA. †Present address: Institut
de Génétique Moléculaire de Montpellier, University of Montpellier,
enon. Whether tissue-resident T cells, particu- by encounter with a commensal may have the
CNRS, Montpellier, France. ‡Corresponding author. Email: larly those specific to commensals, can also act unexpected potential to produce type 2 cytokines
ybelkaid@niaid.nih.gov as tissue sentinels allowing rapid adaptation to in response to defined tissue challenges.

Harrison et al., Science 363, eaat6280 (2019) 4 January 2019 1 of 11


R ES E A RC H | R E S EA R C H A R T I C LE

A Polyclonal B Polyclonal
CD8+ T cells BowieTg T cells f-MIIINA:H2-M3+ T cells CD8+ T cells BowieTg T cells f-MIIINA:H2-M3+ T cells
23±3 2±1 20±4 2±1 18±2 3±1 18±2 66±6 19±3 73±8 11±1 72±5

CD103
IL-17A

22±5 24±2 26±4 10±4 7±5 12±4

IFN-γ CD69
C CD8α CD45.1 CD8α CD45.1

150µm 50µm

CD49f DAPI CD8a CD45.1 (BowieTg)

Downloaded from http://science.sciencemag.org/ on January 7, 2019


D E F G
f-MIIINA:H2-M3+ T cells CD8+ T cells CD8+ T cells CD8+ T cells
f-MIIINA:H2-M3+ (% Host)

100 7±2 88±2


Tc17 16±5
75
CD103

45±4
RORγt

RORγt

IL-17A
Tc17
50
Tc1 47±5
25 34±8
41±5
0 7±1
0
en

in

CD69 T-bet CCR6 CCR6


N
Sk
SL
le
Sp

H 30 30 10 ** 6 **
8 ** **
IL-17A+ (%)

IL-13+ (%)
IFN-γ+ (%)

IL-5+ (%)

20 20 4
6

4
10 10 2
2

0 0 0 0
fly

fly
nd in

nd n
i.d PB l

i.d . PB l

fly

fly
.C S

.C S

fly

fly

nd in

nd n

fly

fly
nd in

nd n

nd in

nd in
i.d PB l

. P rl
. r

i.d PB l

i.d . PB l

i.d PB l

i.d PB l
.C S

.C S
.C S

.C S

.C S

.C S
Sa hiti

. r
. r

. r

. r
i.d Ct

i.d Ct

Sa hiti
Sa hit

Sa iti

i.d Ct

i.d Ct
i.d Ct

i.d Ct

i.d Ct

i.d Ct
Sa hit
Sa hit

Sa hit

Sa hit
i.d B
h

Tc1 Tc17 Tc1 Tc17 Tc1 Tc17 Tc1 Tc17

Fig. 1. Acute injury licenses type 2


I CD8+ T cells CD8+ T cells
cytokine production from commensal- i.d. PBS i.d. Chitin i.d. PBS i.d. Chitin
specific type 17 cells. (A to C) S. epidermidis–
41±7 0.4±0.3 43±5 4±2 43±6 0.2±0.1 41±4 2±1
specific TCR-transgenic CD8+ T cells (BowieTg)
were adoptively transferred to wild-type mice
CCR6

CCR6

before colonization with S. epidermidis. (A)


Representative contour plots of IL-17A and
IFN-g production potential; (B) expression of
tissue residency markers CD69 and CD103 by 0.2±0.1 0.4±0.3 0.1±0.1 0.4±0.2
indicated CD8+ T cell populations; (C) repre-
IL-5 IL-13
sentative confocal imaging volume projected
along the z axis of epidermal skin from S. epidermidis–colonized mice. (D and E) colonized wild-type mice were exposed to bites from sand flies (L. longipalpis)
Conjoined pairs of S. epidermidis–colonized CD45.1 and CD45.2 mice were or injected intradermally (i.d.) with PBS or chitin. (H) Frequencies of TC1
analyzed 90 days after parabiosis surgery for cellular origin and phenotype. and TC17 cells with cytokine-producing potential from the skin of S.
(D) Frequency of host-derived f-MIIINA:H2-M3+ CD8+ T cells in indicated epidermidis–colonized wild-type mice after skin injury. (I) Representative
tissues; SLN, skin-draining lymph nodes. (E) Representative contour plot of contour plots of IL-5 and IL-13 production potential by CD8+ T cells from
CD69 and CD103 expression by skin f-MIIINA:H2-M3+ CD8+ T cells. (F) the skin of S. epidermidis–colonized wild-type mice after skin injury.
Representative contour plot of RORgt and T-bet expression by CD8+ T cells Numbers in representative plots indicate means ± SD. Bar graphs show
from the skin of S. epidermidis–colonized wild-type mice. (G) Representative means ± SD. Data represent at least two experiments with four to six mice
contour plots of RORgt, CCR6, and IL-17A expression by CD8+ Tcells from the per group. **P < 0.01 (one-way ANOVA with Holm-Šidák multiple-
skin of S. epidermidis–colonized wild-type mice. (H and I) S. epidermidis– comparison test).

Harrison et al., Science 363, eaat6280 (2019) 4 January 2019 2 of 11


R ES E A RC H | R E S EA R C H A R T I C LE

Fig. 2. Local defects A S. epidermidis - CD8+ T cells C


in immunoregulation
51±5 0.7±0.3 5±2 48±5
unleash type 2
immunity from

RORγt

RORγt
commensal-specific
T cells. (A) Represent-
ative contour plots of 0.8±0.3 9±2
RORgt and GATA-3
Isotype GATA-3 Foxp3 DAPI CD8α
expression by skin
CD8+ T cells from B D E
S. epidermidis–colonized S. epidermidis C. albicans Foxp3YFP-CreGata3fl/wt Foxp3YFP-CreGata3fl/fl
100 RORγt
wild-type mice. (B) Rep-

Foxp3+ LDTF+ (%)


Iso Iso *** GATA-3 27±4 36±5 21±3 13±5
Th17 Th17 80
resentative histogram T-bet

Foxp3
% max

plots of GATA-3 60

expression by RORgt+ 40

CD4+ TH17 cells from 20


3±2 8±4
the skin of commensal- 0

in

Lu T
ng
M LP
e
ym P
M s
AT
Sp LN
en
PP

Li N

M d
LN
BM
Bl er
colonized wild-type CD25

oo
cl
VA
GATA-3

Th siL

PL
Sk

v
le
c

S
us
mice. (C) Representa-
tive confocal imaging F G H I

Downloaded from http://science.sciencemag.org/ on January 7, 2019


volume-projected YFP-Cre YFP-Cre 15 15 50 15 ** 100 Foxp3YFP-CreGata3fl/fl
Foxp3 Foxp3 ** ** **

Eosinophils (%)
along the z axis of
CD4+ IL-5+ (%)

Skin inflammation
CD4+ IL-13+ (%)

Basophils (%)

penetrance (%)
fl/wt fl/fl 40
Gata3 Gata3
epidermal skin from 10 10 30
10
S. epidermidis–colonized 50
SLN 20
Foxp3gfp mice. (D) Fre- 5 5 5
10
quencies of Foxp3+ Treg Foxp3YFP-CreGata3fl/wt
MLN
0 0 0 0
cells coexpressing PLN 0
Skin Skin Skin Skin 0 100 200 300
lineage-defining Spleen
Age (days)
YFP-Cre fl/wt YFP-Cre fl/fl
transcription factors Foxp3 Gata3 Foxp3 Gata3
(LDTFs) within indicated
tissues of naïve wild- J K L Foxp3YFP-CreGata3fl/wt Foxp3YFP-CreGata3fl/fl
type mice. VAT, visceral Foxp3YFP-CreGata3fl/wt Foxp3YFP-CreGata3fl/wt Foxp3YFP-CreGata3fl/fl
adipose tissue; cLP, 2.5 *** 2.5 ***

CD8+ IL13+ (x103)


20±3 0.4±0.3 26±5 7±2
colonic lamina propria; 2.0 2.0CD8+ IL-5+ (x103)
CD8β

siLP, small intestinal 1.5 1.5


lamina propria; MAT, 1.0 *
1.0
mesenteric adipose *
0.5 0.5
tissue; SLN, skin- 3±1 3±2
draining lymph node; 0 0
YFP-Cre fl/fl
Foxp3 Gata3 IL-5 Naïve S. epi Naïve S. epi
PP, Peyer’s patch; PLN,
para-aortic lymph
node; MLN, mesenteric
M Foxp3YFP-CreGata3fl/wt Foxp3YFP-CreGata3fl/fl Foxp3YFP-CreGata3fl/wt Foxp3YFP-CreGata3fl/fl

lymph node; BM, bone 51±5 0.6±0.3 52±6 5±2 44±5 0.7±0.5 46±6 4±3

marrow. (E) Represent-


Recipient

Recipient
+
CD8 T cells
CCR6
CCR6

ative contour plots of


95±4
Foxp3 and CD25
expression by skin
Host

0.3±0.1 0.5±0.3 0.5±0.4 0.7±0.5


CD4+ T cells from naïve
Foxp3 YFP-Cre
Gata3 fl/wt
4±2 54±4 0.5±0.2 50±7 4±3 49±7 0.5±0.4 48±9 4±2
and Foxp3YFP-CreGata3fl/fl
BowieTg Donor

BowieTg Donor

mice. (F) Representative BowieTg


cutaneous lymphadeno-
pathy in Foxp3YFP-Cre-
Gata3fl/fl compared to 0.3±0.1 0.2±0.1 0.7±0.4 0.3±0.1
Foxp3YFP-CreGata3fl/wt
IL-5 IL-13
control mice. (G) Fre-
quencies of IL-5– and IL-13–producing skin CD4+ T cells from naïve of IL-5– and IL-13–producing CD8+ T cells from the skin of S. epidermidis–
Foxp3YFP-CreGata3fl/wt and Foxp3YFP-CreGata3fl/fl mice. (H) Frequencies colonized Foxp3YFP-CreGata3fl/wt and Foxp3YFP-CreGata3fl/fl mice.
of skin eosinophils and basophils from naïve Foxp3YFP-CreGata3fl/wt and (M) Representative contour plots of IL-5 and IL-13 production by CD8+ Tcells in
Foxp3YFP-CreGata3fl/fl mice. (I) Cumulative incidence of skin inflammation Foxp3YFP-CreGata3fl/wt and Foxp3YFP-CreGata3fl/fl mice adoptively transferred
among naïve Foxp3YFP-CreGata3fl/wt and Foxp3YFP-CreGata3fl/fl mice. with BowieTg T cells before colonization with S. epidermidis. Numbers in
(J) Representative histological micrograph of skin tissue from naïve representative plots indicate means ± SD. Each dot represents an individual
Foxp3YFP-CreGata3fl/wt and Foxp3YFP-CreGata3fl/fl mice. Scale bars, 250 mm. mouse. Data represent at least two experiments with three to seven mice per
(K) Representative contour plots of CD8b expression and IL-5 production group. Cumulative skin inflammation data (I) represent 25 mice per genotype.
potential by TCRb+ T cells from the skin of S. epidermidis–colonized *P < 0.05, **P < 0.01, ***P < 0.001 as calculated using Student t test [(G), (H)]
Foxp3YFP-CreGata3fl/wt and Foxp3YFP-CreGata3fl/fl mice. (L) Total numbers or one-way ANOVA with Holm-Šidák multiple comparison test [(D), (L)].

Harrison et al., Science 363, eaat6280 (2019) 4 January 2019 3 of 11


R ES E A RC H | R E S EA R C H A R T I C LE

Local defects in immunoregulation vealed colocalization of S. epidermidis–induced were associated with discrete elevated fre-
unleash type 2 immunity from CD8+ T cells and Foxp3+ Treg cells (Fig. 2C). quencies and absolute numbers of eosinophils
commensal-specific T cells As such, we assessed the possibility that skin and basophils in the skin of Foxp3YFP-CreGata3fl/fl
Flow cytometric analysis revealed that TC17 cells Foxp3+ Treg cells could limit type 2 cytokine mice relative to control mice (Fig. 2H and fig.
coexpressed GATA-3, the lineage-defining tran- production by commensal-specific type 17 cells. S2L). Of note, and in agreement with a skin-
scription factor (LDTF) for both TH2 cells and Because complete ablation of Foxp3+ Treg cells specific defect, naïve Foxp3YFP-CreGata3fl/fl mice,
group 2 ILC (ILC2) (Fig. 2A). Such a phenotype results in severe local and systemic inflamma- with an endogenous skin microbiota but not
was also detected among the very few CD8+ tory responses and aberrant accumulation of S. epidermidis, spontaneously developed severe
T cells present in the skin of naïve mice (fig. TC1 cells within the skin (11) (fig. S2, D and E), we skin inflammation (but not systemic inflamma-
S2A), and coexpression of RORgt and GATA-3 used an approach allowing for a tissue-specific tion) with ~70% penetrance by 8 months of age
by S. epidermidis–specific BowieTg CD8+ T cells defect in immunoregulation. Within the skin, (Fig. 2, I and J).
was restricted to the skin and not detectable Treg cells express high levels of GATA-3 (but not To assess the possibility that T cells producing
in secondary lymphoid organs; these findings other LDTFs) (Fig. 2D and fig. S2F), a factor type 2 cytokines within the skin of these mice
suggested that GATA-3 expression is imprinted that contributes to Treg cell stability and fitness are commensal-specific, we colonized young
within the tissue microenvironment (fig. S2B). (12–15). In mice in which Treg cells were condi- Foxp3YFP-CreGata3fl/fl mice (before inflammation)
This phenotype was conserved across T cell tionally deleted of GATA-3 (Foxp3YFP-CreGata3fl/fl), and control mice with S. epidermidis and tracked
lineages and distinct microbial exposures. Nota- Foxp3+ cells were reduced in frequency and ex- the fate of S. epidermidis–specific T cells. Adop-
bly, TH17 cells elicited by skin colonization with hibited decreased Foxp3 and CD25 expression tively transferred BowieTg CD8+ T cells (as well
S. epidermidis or Candida albicans also expressed in the skin, but not in other tissues (Fig. 2E as host polyclonal S. epidermidis–induced CD8+
GATA-3 (Fig. 2B and fig. S2C). Thus, homeostatic and fig. S2, G and H). Consistent with this ob- T cells) expressed IL-5 and IL-13 proteins in the
encounter with bacterial or fungal commensal servation, by 10 weeks of age, skin-draining skin of Foxp3YFP-CreGata3fl/fl mice but not con-

Downloaded from http://science.sciencemag.org/ on January 7, 2019


microbes can lead to the development of cells lymph nodes (but not other lymphoid structures) trol mice (Fig. 2, K to M). By contrast, the ability
with a paradoxical phenotype characterized by were enlarged, and the skin compartments (but of S. epidermidis–elicited CD8+ T cells to produce
the coexpression of classically antagonistic tran- not other tissues) of these mice were charac- IL-17A or IFN-g was unaffected (fig. S2M). Nota-
scription factors. terized by a selective increase in the number bly, type 2 cytokine production by S. epidermidis–
The skin is highly enriched in Foxp3+ regu- of T cells producing IL-5 and IL-13 (Fig. 2, F and specific polyclonal and adoptively transferred
latory T (Treg) cells (5), and confocal imaging re- G, and fig. S2, I to K). Enhanced type 2 responses BowieTg CD8+ T cells remained restricted to cells

A B C
Global ATAC-seq analysis Ifng Il17a Il17f
200 350
Tc1 Tc17 Naïve Memory
ATAC

ATAC
Tc17 Tc17
Enriched 200 350
motifs Tc1 Tc1
100 250
RNA

RNA
Tc17 Tc17
100 250
Tc17 specific RORγt Tc1 Tc1
Tc1 specific
T-bet
Eomes D E
Canonical CD8 Rad50 Il5 Il4 Il13
100 25
ATAC
ATAC

Tc1 and Tc17 Tc17 Tc17


100 25
Tc1 Tc1
50 75
Tc17
RNA

Tc17
RNA

50 75
Tc1 Tc1
-1kb 0 +1kb

GATA-3 binding motif GATA-3 binding motif


Eo 6

Il1 21
Tb g

G 3

F G
Il1 2
Kl es

Il1 b
Il1 r
R a

C f

C
2r
Il2

Il1 c

at
m

Pr 1
Ifn
x

Il1
7r
rg
or

cr

cr
b

a3
r l1
7

Il5
3

f1

Il13 Promoter/TSS (RPM)

*
Il5 Promoter/TSS (RPM)

−1
80 * 60

Tc1 60
40
0
40
20
1 Tc17 20

0 0
type 17 type 1 type 2 17 c1 17 Tc1
Tc T Tc

Fig. 3. S. epidermidis–specific TC17 cells express a broad type 2 the right. (B to E) Genomic tracks of ATAC-seq and RNA-seq signal profiles
signature. TC17 (CD8+CCR6+) and TC1 (CD8+CCR6−) cells were isolated in TC17 and TC1 cells across signature cytokine genes. Genomic location of
by FACS from the skin of S. epidermidis–colonized wild-type mice for TC17-specific regulatory elements with GATA-3 binding motifs are denoted by
transcriptomic and epigenetic analysis by RNA-seq and ATAC-seq. ATAC-seq red triangles. (F) Heat map of lineage-specific signature genes expressed
signals from canonical naïve and memory CD8+ T cells were from lymphoid by TC17 and TC1 populations. (G) Chromatin accessibility at transcription
tissue. (A) Global comparison of ATAC-seq signals in S. epidermidis–induced start site (promoter ± 500 bp) of Il5 and Il13 in TC17 and TC1 cells. Bar graphs
TC17 and TC1 and canonical naïve and memory CD8+ T cells. Representative show means ± SD. Sequencing data represent two or three independent
transcription factor binding motifs enriched in indicated groups are listed on biological replicates. *P < 0.05 (Student t test).

Harrison et al., Science 363, eaat6280 (2019) 4 January 2019 4 of 11


R ES E A RC H | R E S EA R C H A R T I C LE

A B Ccr6 Rorc Tbx21

Merge IL-17AFM+ Tc17


40
tSNE 2

20 Il17a Il13 Il5


40
0
20

tSNE 2
−20 0
CCR6- Tc1 IL-17AFM- Tc17
−40 −20 0 20 40 −20
tSNE 1
−40 −20 0 20 40
tSNE 1

C Tc17 D
IFN-γ IL-17A IL-5 IL-13 Tc17 Tc17

IL-17A Protein
IL-17A Protein
1±1 2±1 11±3 19±4 0.3± 0.2±0.1 0.2± 0 28±5 0.2±0.1 27±6 4±2
0.2 0.1
Protein

Downloaded from http://science.sciencemag.org/ on January 7, 2019


0.5±0.3 5±1 12±3 10±2 0.3±0.1 16±5

mRNA IL-5 Protein IL-5 mRNA


E Tc17 Tc17 F
mRNA relative expression

Il5 Il13 Il17a


IL-17A Protein

CreERT2Gata3 fl/fl
IL-17A Protein

28±4 0.3±0.2 23±5 4±2 30 30 90


* * ** ** * Vehicle
20 20 60
Tamoxifen

10 10 30

0.4±0.3 14±3
0 0 0
IL-13 Protein IL-13 mRNA Tc1 Tc17 Tc1 Tc17 Tc1 Tc17

Fig. 4. S. epidermidis–specific TC17 cells harbor a poised type 2 tran- production potential and Il5 or Il13 mRNA expression by TC17 cells from the
scriptome. (A and B) TC1 (CD8+CCR6−), IL-17AFM+ TC17 (CD8+CCR6+eYFP+), skin of S. epidermidis–colonized wild-type mice. (F) S. epidermidis–colonized
and IL-17AFM− TC17 (CD8+CCR6+eYFP−) cells were isolated by FACS from the CreERT2Gata3fl/fl mice received tamoxifen or vehicle control before cell
skin of S. epidermidis–colonized Il17aCreR26ReYFP (IL-17AFM) mice and sorting of skin TC1 and TC17 cells. Gene expression in the indicated
analyzed by scRNA-seq. (A) tSNE plots of scRNA-seq expression highlighting populations was assessed by quantitative reverse transcription polymerase
TC1 (gray), IL-17AFM+ TC17 (orange), and IL-17AFM− TC17 (blue) populations. chain reaction (qRT-PCR). Numbers in representative plots indicate means ±
(B) Expression of LDTFs and cytokine genes projected onto a tSNE plot. SD. Flow cytometric data represent at least two experiments with four to
(C) Representative dot plots of cytokine protein production potential and six mice per group. qRT-PCR data represent three biological replicates
mRNA expression by TC17 cells from the skin of S. epidermidis–colonized of eight pooled mice per group. *P < 0.05, **P < 0.01 (one-way ANOVA with
wild-type mice. (D and E) Representative dot plots of IL-17A and IL-5 or IL-13 Holm-Šidák multiple-comparison test).

expressing CCR6; this result shows that in the tissue (16). Regulatory elements unique to skin relative to TC1 cells (Fig. 3, D to G, and fig. S3C).
context of local immune defects, type 2 cytokines TC17 or TC1 cells were enriched in binding sites Furthermore, TC17 cells expressed a broad type 2
can be unleashed from RORgt-committed T cells for RORgt, and for T-bet and Eomes, respectively transcriptome, including a LDTF (Gata3) and
(Fig. 2M). Thus, impaired local immunoregu- (Fig. 3A), consistent with subset-specific expres- cytokine and chemokine receptors (Ccr8, Il1rl1,
lation promotes type 2 cytokine production by sion of these LDTFs (Fig. 1F). Elevated chroma- and Il17rb), but neither Il4 nor Il10 mRNA, as
commensal-specific type 17 cells—a property that tin accessibility and transcript abundance of the previously described for tissue-derived TH2 cells
may predispose tissue to inflammation. signature cytokines Ifng, Il17a, and Il17f also (18) (Fig. 3F and fig. S3D). The type 2–associated
confirmed the clear distinction between TC1 and cytokine amphiregulin (Areg) was detectable in
S. epidermidis–specific TC17 cells harbor TC17 cell subsets (Fig. 3, B and C, and fig. S3, A both cell subsets, albeit at higher abundance in
a poised type 2 transcriptome and B). Among regulatory elements unique to TC17 cells (fig. S3D). As such, commensal-specific
To gain insight into the transcriptional and epi- TC17 cells, we identified previously described TC17 cells express a broad type 2 transcriptome
genetic landscape of commensal-specific T cells GATA-3–binding sites within Il13 and the Rad50/ under homeostatic conditions.
under homeostatic conditions, we identified TH2 locus control region (17) (Fig. 3, D and E). Of S. epidermidis–induced TC17 cells, ~30%
global regulatory elements shared between, and Consequently, TC17 cells demonstrated elevated displayed the potential for IL-17A production
unique to, S. epidermidis–specific polyclonal TC17 chromatin accessibility at type 2 immune gene (Fig. 1G), supporting the idea of possible pheno-
(CCR6+) and TC1 (CCR6−) cells from the skin and loci encoding Il5 and Il13 and expressed ele- typic heterogeneity. However, using cells from IL-
naïve and memory CD8+ T cells from lymphoid vated levels of Il5 and Il13 mRNA transcripts 17A fate-mapping mice (IL-17AFM–Il17aCreR26ReYFP)

Harrison et al., Science 363, eaat6280 (2019) 4 January 2019 5 of 11


R ES E A RC H | R E S EA R C H A R T I C LE

and single-cell RNA sequencing (scRNA-seq), IL-1a significantly increased the ex vivo pro- are found during allergic asthma and helminth
t-distributed stochastic neighbor embedding duction of IL-17A from TC17 cells in the context infection (25–29). Previous studies also demon-
(tSNE) projection of TC1, IL-17AFM+ TC17, and of TCR stimulation (Fig. 5A). As previously re- strated plasticity of effector TH17 cells to convert
IL-17AFM− TC17 cells demonstrated consider- ported, IL-18 and IL-33 promoted IFN-g pro- to TH1, follicular helper (TFH), and Treg cell
able transcriptional overlap between IL-17AFM+ duction by TC1 cells (23, 24) (Fig. 5B). Notably, phenotypes in a context-dependent manner
and IL-17AFM− TC17 cell fractions, with type 2 several alarmins promoted the production of (26, 30, 31). Our work supports the idea that
cytokine mRNA–expressing cells present in both IL-5 (IL-18, IL-25, and IL-33) or IL-13 (IL-1a, such plasticity may be a fundamental fea-
fractions (Fig. 4, A and B, and fig. S4A). Thus, IL-1b, IL-18, and IL-33) (Fig. 5, C and D). IL-25 ture of tissue-resident commensal-specific T
commensal-specific TC17 cells, including those potently promoted the production of IL-5 but cells. To specifically address this point, we used
already committed to IL-17A production, can be not IL-13 (Fig. 5, C and D), supporting the idea IL-17AFM mice to assess in vivo the heritage of
superimposed with the expression of a type 2 that distinct classes of injury may have differ- TC17 cells licensed for type 2 cytokine produc-
transcriptome. Furthermore, in situ hybridiza- ent impacts on commensal-specific T cell re- tion. In line with the finding that both IL-
tion for mRNA detection by flow cytometry sponses. Strikingly, IL-18, a cytokine widely 17AFM− and IL-17AFM+ TC17 cells display poised
revealed that Il5 and Il13 transcripts, but not linked to the initiation of type 1 responses, was Il5 and Il13 mRNA expression (Fig. 4, B to E),
protein, were expressed selectively by TC17 cells particularly potent at eliciting the release of IL-18 triggered type 2 cytokine production
from the skin of S. epidermidis–colonized mice both IL-5 and IL-13 from TC17 cells ex vivo from both TC17 and TH17 cells regardless of
(Fig. 4C and fig. S4B). In line with our scRNA- (Fig. 5, C and D). IL-18 also promoted IL-17A whether they had previously expressed IL-17A
seq data (Fig. 4B and fig. S4A), Il5+ and Il13+ production by TC17 cells, further supporting (IL-17AFM+ and IL-17AFM−) (Fig. 6, A and B).
cells were found within both IL-17A–producing the idea that this alarmin can superimpose Thus, within commensal-induced TC17 and TH17
and IL-17A–nonproducing fractions of TC17 cells type 2 responses upon a precommitted type 17 cell populations, plasticity among IL-17AFM+ cells
(Fig. 4, D and E); this suggests that during ho- program (Fig. 5A). Under these conditions, IL- and local licensing of IL-17AFM− cells both con-

Downloaded from http://science.sciencemag.org/ on January 7, 2019


meostasis, commensal-specific TC17 cells express 4 and IL-10 were undetectable (fig. S5B), but tribute to alarmin-mediated induction of type 2
type 2 cytokine mRNA without subsequent pro- both TC1 and TC17 cells produced amphiregu- cytokine production.
tein translation. The inducible deletion of Gata3 lin upon TCR stimulation, a response that was Although a few reports have suggested that
at the peak of the CD8+ T cell response to S. also enhanced by IL-18 (fig. S5C). Type 2 re- IL-18 can potentially promote type 2 and reg-
epidermidis revealed that sustained GATA-3 ex- sponses to IL-18 were not restricted to CD8+ T ulatory responses (32–34), this cytokine is more
pression by TC17 cells was required for the consti- cells nor to S. epidermidis–elicited cells. Indeed, widely considered to promote type 1 immunity.
tutive expression of Il5 and Il13, but, as expected, skin CD4+ T cells induced by S. epidermidis or In support of a major role for IL-18 in the
not for Il17a (Fig. 4F). Thus, S. epidermidis–specific C. albicans colonization (including TH17 cells) promotion of skin type 2 responses, IL-18 in-
TC17 cells express a poised type 2 transcriptome also produced higher levels of IL-5 and IL-13 jection promoted type 2 cytokine production
dependent on continued GATA-3 expression. upon IL-18 and TCR stimulation in vitro (fig. S5, not only by T cells but also by ILC2, as re-
Accordingly, type 2 cytokine competency D to F). Thus, such poised type 2 potential may cently described (Fig. 6C) (35). In contrast to
(mRNA expression) and licensing (stimuli- be the norm for type 17 commensal-specific T transient ILC2 responses, induction of type 2
induced protein production) are temporally cells raised under homeostatic conditions. In cytokine expression by T cells was sustained
decoupled in S. epidermidis–elicited TC17 cells— this context, local inflammatory factors includ- up to 4 days after injection (Fig. 6C). Thus,
a process likely involving the posttranscriptional ing IL-1, IL-18, IL-25, and IL-33 can superimpose type 2 cytokine licensing by IL-18 may have a
regulation of cytokine mRNA stability and pro- a type 2 effector program. profound effect on skin physiology via the
tein translation. Under inflammatory conditions, To assess the impact of a single defined broad impact of a defined alarmin on both
previous work revealed that distinct stimuli alarmin on commensal-specific T cells, we next tissue-resident commensal-specific T cells and
can govern competency and licensing of type 2 focused on the impact of IL-18 in vivo. A single ILC2 (35). Indeed, IL-18 injection promoted
immunity within injured tissues, ensuring injection of IL-18 licensed both IL-5 and IL-13 an IL-5–dependent eosinophil accumulation
tissue-restricted effector function during path- protein production by S. epidermidis–elicited within the skin compartment of S. epidermidis–
ogen infection (19). Recent findings also suggest TC17 (including f-MIIINA:H2-M3+ cells) and colonized mice (Fig. 6D and fig. S6A). Thus,
that IFN-g production by CD8+ T cells is actively CD4+ T cells (including TH17 cells) (Fig. 5, E to tissue-resident commensal-specific type 17 T
regulated at the level of translation, thereby G, and fig. S5, G and H). Type 2 cytokine li- cells can adapt to defined injury by direct sen-
preventing chronic immune activation (20–22). censing by IL-18 occurred at the expense of sing of alarmins and inflammatory mediators.
IL-17A production, suggesting dynamic regu- Because of the known contribution of type 2
Alarmins license type 2 cytokine lation of cytokine production by commensal- immunity and IL-13 in particular to tissue re-
production by commensal-specific specific TC17 and TH17 cells in vivo (Fig. 5, E pair, we next used a model of skin wounding
TC17 cells to G). The ability of TC17 and TH17 cells to pro- to assess the potential contribution of commensal-
Our work proposes that such a phenomenon duce type 2 cytokines in response to IL-18 was specific type 2 cytokine licensing to this funda-
may also apply to commensal-specific T cells dependent on T cell–intrinsic IL-18R1 signaling mental process. Although IL-13 did not contribute
generated under homeostatic conditions. To (Fig. 5, H and I) and was sustained up to 60 days to the healing process in unassociated mice,
identify the factors capable of licensing poised after colonization (fig. S5I). After chitin injection, IL-13 neutralization or genetic Il13 deficiency
type 2 immunity from commensal-specific T cells, type 2 licensing of TC17 and TH17 cells was also impaired S. epidermidis–accelerated wound re-
we used an ex vivo screening approach, stimu- IL-18R1 signaling–dependent (Fig. 5, H and I); pair (Fig. 6, E and F). Adoptive transfer of wild-
lating TC17 and TC1 cells with cytokines and these findings support the idea that in defined type BowieTg CD8+ T cells rescued this defect
alarmins previously shown to be associated with inflammatory settings, IL-18 alone may be suf- in an IL-13–dependent manner (Fig. 6F). In agree-
tissue damage. Cytokine stimulation alone did ficient to impose this response. ment with the role of IL-13 in tissue repair
not promote type 2 cytokine production by skin (36), whole-tissue RNA-seq of skin after wound-
T cells, demonstrating that these cells cannot be Commensal-specific T cell plasticity and ing revealed an IL-13–dependent transcriptional
licensed in a TCR-independent manner (fig. S5A). IL-13 production promote wound repair signature dominated by pathways associated
Because commensal microbes persist within The co-production of cytokines associated with with muscle contractility and extracellular matrix
the skin, this result is consistent with the ex- distinct T cell subsets can occur during inflam- reorganization (Fig. 6G and fig. S6B). Notably, in
pectation that exposure to alarmins will occur mation. For example, IL-17A+IFN-g+ cells are line with the fact that punch biopsies can trigger
in the context of antigen exposure. However, present during intestinal and central nervous the release of numerous factors able to license
in line with the role of IL-1 within the skin (4), system inflammation, and IL-17A+IL-4+ cells type 17 cells (Fig. 5, C and D), IL-18 was insufficient

Harrison et al., Science 363, eaat6280 (2019) 4 January 2019 6 of 11


R ES E A RC H | R E S EA R C H A R T I C LE

A B C ** D
** *
2.0 150 200
** 500 **
* ** *
IL-17A (ng/ml)

** *

IFN-γ (ng/ml)
400

IL-13 (pg/ml)
*

IL-5 (pg/ml)
1.5 150
100
300
1.0 100
200
50
0.5 50
100

0 0 0 0

IL α
IL ia

IL 8
IL 5
TS 33
LP
IL β
IL α

IL α

IL α
IL ia

IL 8
IL 5
TS 33
LP

IL ia

IL 8
IL 5
TS 3
LP

IL ia

IL 8
IL 5
TS 3
LP
IL β

IL β

IL β
-1
-1
-1
-2
-1
-1
-1
-2

-1
-1
-1
-2
-3

-1
-1
-1
-2
-3
ed
ed

ed

ed
-
-

M
M

Tc17 Tc1 Tc17 Tc17

E Tc17 F CD4+ CCR6+ CD4+ CCR6+ CD4+ CCR6- CD4+ CCR6-


i.d. PBS i.d. IL-18 i.d. PBS i.d. IL-18 i.d. PBS i.d. IL-18
25±4 0.2±0.1 16±5 4±2 22±4 1±0.3 10±3 3±2 3±1 0 2±1 0.3±0.1

IL-17A
IL-17A

Downloaded from http://science.sciencemag.org/ on January 7, 2019


0.6±0.3 15±3 2±1 17±5 3±1 18±4

IL-5 IL-5

G * H
20 ** 30 25 i.d. PBS 20 * 8
*
** 10

IL-5+ Tc17 (%)

IL-13+ Tc17 (%)


20 i.d. IL-18 *
IL-17A+ (%)

15 * 6
IFN-γ+ (%)
IL-13+ (%)
IL-5+ (%)

15 20
15
10 5 10 4
10
10
5 5 2
5

0 0 0 0 0 0
Tc1 Tc17 Tc1 Tc17 Tc1 Tc17 Tc1 Tc17 PBS IL-18 Chitin PBS IL-18 Chitin
fl/fl
Il18r1 Cd4 Il18r1fl/fl Cre
Fig. 5. Tissue alarmins license type 2 cytokine production from commensal-specific
I 20 8
T cells. (A to D) TC17 (CD8+CCR6+) and TC1 (CD8+CCR6−) cells were isolated from * *

IL-13+ Th17 (%)


the skin of S. epidermidis–colonized wild-type mice and cultured in vitro with agonistic
IL-5+ Th17 (%)

15 * 6 *
anti-CD3e mAb and the indicated cytokines. Cell culture supernatants were assayed
for cytokine production after 24 hours of culture. (E) Representative contour plots 10 4
of IL-5 and IL-17A production potential by S. epidermidis–induced TC17 cells after i.d.
injection with PBS or IL-18. (F) Representative contour plots of IL-5 and IL-17A production 5 2
potential by skin CD4+Foxp3− T cells from S. epidermidis–colonized wild-type mice after
i.d. injection with PBS or IL-18. (G) Frequencies of TC17 and TC1 cells with indicated 0 0
cytokine production potential from the skin of S. epidermidis–colonized wild-type mice PBS IL-18 Chitin PBS IL-18 Chitin
after i.d. injection of PBS or IL-18. (H and I) Frequencies of TC17 (H) and TH17 (I) cells with
Il18r1fl/fl Cd4CreIl18r1fl/fl
indicated cytokine production potential from the skin of S. epidermidis–colonized
Cd4 Il18r1
Cre fl/fl
and control mice after i.d. injection with PBS, IL-18, or chitin. Numbers in
representative plots indicate means ± SD. Bar graphs show means ± SD. Data represent at least two experiments with three to six mice per group.
*P < 0.05, **P < 0.01 as calculated using one-way [(A) to (D), (G)] or two-way [(H), (I)] ANOVA with Holm-Šidák multiple-comparison test.

to promote these responses (fig. S6C). Thus, the Our results show that adaptation of tissue to and contextual functions including tissue repair.
poised type 2 immune potential of commensal- injuries can also be mediated by immunity to Thus, we describe a tissue checkpoint that relies
specific TC17 cells allows for local adaptation to the microbiota, a fundamental but poorly under- on the remarkable plasticity and adaptability of
injury, thereby promoting tissue repair. stood class of immunity. Notably, we found that tissue-resident commensal-specific T cells. We pro-
homeostatic immunity to bacteria or fungal com- pose that this feature may also have important
Conclusion mensals is characterized by the coexpression of implications in the etiology of tissue-specific
Barrier tissues are constitutively exposed to en- paradoxical programs, allowing commensal- inflammatory disorders. Given the extraordinary
vironmental stressors and are primary targets of specific T cells, when entering and persisting number of both commensal-derived antigens and
chronic inflammatory disorders. The mainte- within tissues, to adopt a type 17 program com- T cells at barrier sites, such a feature may represent
nance of tissue integrity and function represent patible with tissue homeostasis and immunity a fundamental component of host immunity.
a complex challenge that requires both resilience while maintaining a type 2–poised state. As such,
and adaptation. Under steady-state conditions, in the context of injury and consequent exposure Materials and methods
tissue resilience is, in part, mediated by innate to inflammatory mediators and cognate antigens, Mice
and adaptive immunity to the microbiota, which commensal-specific T cells rapidly release type 2 Wild-type (WT) C57BL/6 Specific Pathogen
reinforces barrier function and immunity (5). cytokines, allowing these cells to exert pleiotropic Free (SPF) mice were purchased from Taconic

Harrison et al., Science 363, eaat6280 (2019) 4 January 2019 7 of 11


R ES E A RC H | R E S EA R C H A R T I C LE

A i.d. PBS i.d. IL-18


IL-17AFM+ Tc17 B CD4+ CCR6+ IL-17AFM+
* IL-17A+ 30 ** IL-17A+
30
29±2 0.4±0.2 15±4 3±2 * IL-17A+IL-5+ IL-17A+IL-5+

Cytokine+ (%)
* IL-5+ ** IL-5+

Cytokine+ (%)
IL-17A
20 20
CD8+ T cells **
eYFP (Il17aFM)

10 10

0.6±0.4 12±4
0 0
IL-5 PBS IL-18 PBS IL-18

i.d. PBS i.d. IL-18 IL-17A FM-


Tc17 CD4 CCR6 IL17AFM-
+ +

30 IL-17A+ 30 IL-17A+
15±3 0.4±0.1 9±3 2±1 * IL-17A+IL-5+
IL-17A+IL-5+ **

Cytokine+ (%)
CCR6

Cytokine+ (%)
* IL-5+ IL-5+
IL-17A

20 * 20

**
10 10 **
0.5±0.3 15±4
0 0
IL-5 PBS IL-18 PBS IL-18

C D E

Epidermal tongue (x 103 µm)


ILC2 Isotype

Downloaded from http://science.sciencemag.org/ on January 7, 2019


6 3 CD4+
4 * * Isotype 2.0 * * anti-IL-13
IL-13+ Cells (x103)
IL-5+ Cells (x103)

anti-IL-5

Eosinophils (x104)
Tc17 3 1.5
4 2
2 1.0
2 1
1 0.5

0 0 0 0
0 24 48 72 96 0 24 48 72 96 S. epidermidis
BS

i.d. IL-18
trl

hours post IL-18 injection hours post IL-18 injection


C
.P
i.d

F Naive S. epidermidis WT
G
Il13-/-
Epidermal tongue (×103 µm)

** *** * * IL-13-dependent pathways


2.0
Extracellular matrix organization
1.5 Striated muscle contraction

1.0 Muscle contraction


Degradation of extracellular matrix
0.5
-8 -6 -4 -2 0
0 Fig. 6. Commensal-specific T cell plasticity and IL-13 production
Enrichment score
Tg
+ promote wound repair. (A) Representative contour plots for gating
g + (Log10 p adjusted)
e pe ieT -13
no transfer
owi oty w -IL strategy of CCR6 and eYFP (enhanced yellow fluorescent protein)
B is B o t i
W
T T an expression by CD8+ T cells from the skin of S. epidermidis–colonized
W
Il17aCreR26ReYFP (IL-17AFM) mice after i.d. injection of PBS or IL-18.
Contour plots represent IL-5 and IL-17A production potential of IL-17AFM+ TC17 (CD8+CCR6+eYFP+) or IL-17AFM− TC17 (CD8+CCR6+eYFP−) T cells after
i.d. injection of PBS or IL-18. (B) Frequencies of TH17 cells with IL-17A– or IL-5–producing potential from the skin of S. epidermidis–colonized IL-17AFM
mice after i.d. injection of PBS or IL-18. (C) Absolute cell number of IL-5– and IL-13–producing lymphocyte subsets in the skin of S. epidermidis–colonized
wild-type mice after i.d. injection of IL-18. Data are means ± SD of five mice per group. (D) Absolute number of eosinophils from the skin of S. epidermidis–
colonized wild-type mice after i.d. injection with PBS or IL-18, and i.p. injection with anti–IL-5 or isotype control. (E and F) Naïve and S. epidermidis–colonized
wild-type and Il13−/− mice, with or without adoptive transfer of BowieTg CD8+ T cells before colonization and isotype or anti–IL-13 antibodies at the time of
wounding, were subjected to back-skin punch biopsy. Epithelial tongue length of wound bed–infiltrating keratinocytes was quantified 5 days after wounding.
(G) Pathway analysis using differentially expressed genes between d3 isotype and d3 anti–IL-13 wounding groups was performed using Enrichr and graphed
according to enrichment score for significant Reactome biological processes. Numbers in representative plots indicate means ± SD. Bar graphs show
means ± SD. Data represent at least two experiments with three to seven mice per group. *P < 0.05, **P < 0.01, ***P < 0.001 as calculated using one-way [(A),
(B), (D)] or two-way [(E), (F)] ANOVA with Holm-Šidák multiple-comparison test.

Biosciences. Gata3fl/fl (37), Foxp3YFP-Cre (38) and NIAID-Taconic Exchange. Tcra+/− mice were American Association for the Accreditation of
Il17aCre (26) have been previously described and generated by breeding Tcra−/− mice with C57BL/6 Laboratory Animal Care (AAALAC)–accredited
were generously provided by J. Zhu (NIAID, NIH), WT mice. Foxp3DTR (B6.129(Cg)-Foxp3tm3(DTR/GFP) animal facility at NIAID and housed in accord-
A. Rudensky (Memorial Sloan Kettering Cancer Ayr/J) (11) and R26ReYFP (B6.129X1-Gt(ROSA) ance with the procedures outlined in the Guide
Center), and B. Stockinger (Francis Crick Insti- 26Sortm1(EYFP)Cos/J) (43) mice were purchased for the Care and Use of Laboratory Animals. All
tute), respectively. Foxp3gfp (39), CD45.1 (B6.SJL- from The Jackson Laboratory. CD4CreIl18r1fl/fl experiments were performed at NIAID under an
Ptprca Pepcb/BoyJ), Tcra−/− (B6.129S2-Tcratm1Mom/J) and Il18r1fl/fl control mice were kindly provided Animal Study Proposal (LPD-11E or LPD-68E)
(40), CD45.1 Rag1−/−, Il13−/− (41), and CreERT2- by G. Trinchieri (NCI, NIH). All mice were bred approved by the NIAID Animal Care and Use
Gata3fl/fl mice (42) were purchased from the and maintained under SPF conditions at an Committee. Sex- and age-matched mice between

Harrison et al., Science 363, eaat6280 (2019) 4 January 2019 8 of 11


R ES E A RC H | R E S EA R C H A R T I C LE

6 and 35 weeks of age were used for each was removed and mice were joined at the joints. tured directly ex vivo in a 96-well U-bottom plate
experiment. The skin of the two animals was then connected in complete medium (RPMI 1640 supplemented
and sutured together. Animals were kept on oral with 10% fetal bovine serum, 2 mM L-glutamine,
Commensal culture and colonization antibiotics for 2 weeks and remained conjoined 1 mM sodium pyruvate, 1 mM nonessential amino
Staphylococcus epidermidis NIHLM087 (44) was for 90 to 95 days before analysis. Analysis was acids, 20 mM HEPES, 100 U/ml penicillin, 100 mg/
cultured for 18 hours in Tryptic Soy Broth at performed on ear pinnae skin tissue. ml streptomycin, and 50 mM b-mercaptoethanol)
37°C. Candida albicans (8) was cultured for and stimulated with 50 ng/ml of phorbol myris-
18 hours in Tryptic Soy Broth at 37°C (shaking Acute intradermal challenge tate acetate (PMA) (Sigma-Aldrich) and 5 mg/ml
180 rpm). For colonization with commensal S. epidermidis–colonized mice were anesthetized of ionomycin (Sigma-Aldrich) in the presence of
microbes, as before (45), each mouse was topically with ketamine-xylazine and injected intrader- brefeldin A (1:1000, GolgiPlug, BD Biosciences)
associated by placing 5 ml of culture suspension mally (10 ml per ear pinnae) with either sterile for 3 hours at 37°C in 5% CO2. After stimulation,
(approximately 109 CFU/ml) across the entire PBS (vehicle control), 250 ng of carrier-free re- cells were assessed for intracellular cytokine pro-
skin surface (approximately 36 cm2) using a sterile combinant IL-18 (R&D Systems), or 500 ng of duction as described below.
swab. Application of commensal microbes was chitin (Sigma-Aldrich). Unless otherwise indicated,
repeated every other day a total of four times. Skin skin tissue was analyzed for cytokine production Flow cytometric analysis
tissue was analyzed 14 days after initial coloniza- potential 48 hours after injury. Single-cell suspensions were incubated with com-
tion, unless otherwise indicated. binations of fluorophore-conjugated antibodies
Sand fly bite exposure against the following surface markers: CCR6 (29-
Inducible deletion of Gata3 S. epidermidis–colonized mice were exposed to 2L17), CD3e (145-2C11), CD4 (RM4-5), CD8b (53-
Deletion of Gata3 in CreERT2Gata3fl/fl mice was sand fly bites as described (48). Briefly, mice were 6.7), CD11b (M1/70), CD19 (6D5), CD44 (IM7),
induced by intraperitoneal injection of 5 mg anesthetized with ketamine-xylazine. Twenty fe- CD45 (30-F11), CD45.1 (A20), CD45.2 (104), CD69

Downloaded from http://science.sciencemag.org/ on January 7, 2019


tamoxifen in a corn oil–ethanol (90:10) mixture male Lutzomiya longipalpus were transferred to (H1.2F3), CD103 (2E7), MHCII (M5/114.15.2), TCRb
daily for 3 days before cellular isolation and sub- plastic vials (volume 12.2 cm2, height 4.8 cm, di- (H57-597), and/or Thy1.2 (30-H12) in Hank’s buf-
sequent analysis. ameter 1.8 cm) covered at one end with 0.25 mm fered salt solution (HBSS) for 20 min at 4°C (RT for
of nylon mesh. Specially designed clamps were 30 min for CCR6) and then washed. LIVE/DEAD
Global Treg cell depletion used to bring the mesh end of each vial flat Fixable Blue Dead Cell Stain Kit (Invitrogen Life
Naïve or S. epidermidis–colonized Foxp3DTR mice against the ear, allowing flies to feed on exposed Technologies) was used to exclude dead cells. Cells
received ~1 mg (50 mg/kg) of diphtheria toxin skin for a period of 1 hour in the dark at 26°C and were then fixed for 30 min at 4°C using BD Cytofix/
(Sigma-Aldrich) in phosphate-buffered saline 50% humidity. The number of flies with blood Cytoperm (Becton Dickinson) and washed twice.
(PBS), or PBS alone, by intraperitoneal (i.p.) meals was employed as a means of checking for For intracellular cytokine staining, cells were
injection on days 3, 5, 7, and 9 after initial S. equivalent exposure to bites among animals. At stained with fluorophore-conjugated antibodies
epidermidis colonization. Flow cytometric anal- indicated time points after exposure, tissues were against IFN-g (XMG-1.2), IL-5 (TRK5), IL-13
ysis of skin leukocytes was performed 12 days analyzed for cytokine production. (eBio13A), and IL-17A (eBio17B7) in BD Perm/Wash
after initial colonization. Buffer (Becton Dickinson) for 60 min at 4°C. For
Ex vivo cytokine screening transcription factor staining, cells were fixed and
Generation of BowieTg mice CD4+ and CD8+ T cell subsets from the skin of permeabilized with the Foxp3/Transcription Fac-
Tcra+/− mice were colonized with S. epidermidis, S. epidermidis– or C. albicans–colonized mice tor staining buffer set (eBioscience) and stained
and CD8+CCR6+ T cells were isolated from skin were isolated by FACS (> 97% purity) and cul- with fluorophore-conjugated antibodies against
tissue by fluorescence-activated cell sorting (FACS) tured for 24 hours in the presence of cytokines Foxp3 (FJK-16s), GATA-3 (L50-823 or TWAJ),
and subjected to single-cell sequencing of TCR a (IL-1a, IL-1b, IL-18, IL-25, IL-33, or TSLP; R&D RORgt (B2D), or T-bet (eBio4B10) for 45 min at
and b chains (46). Clonal TCR pairs were identified Systems) (10 ng/ml) and presence or absence of 4°C. Each staining was performed in the presence
and used in a hybridoma reconstitution screen- TCR stimulation (1 mg/ml plate bound anti-CD3 of purified anti-mouse CD16/32 (clone 93) and
ing assay to identify S. epidermidis–reactive TCR mAb, clone 145-2C11). Culture supernatants were purified rat gamma globulin (Jackson Immuno-
heterodimers. A single S. epidermidis–specific TCR assayed for cytokine production by FlowCytomix research). All antibodies were purchased from
pair was cloned into a hCD2-expression vector bead array (eBioscience). eBioscience, Biolegend, BD Biosciences, or Miltenyi
(47) and used to generate TCR-transgenic mice Biotec. Cell acquisition was performed on a BD
(BowieTg), to track S. epidermidis–specific T cells Tissue processing Fortessa X-20 flow cytometer using FACSDiVa
in vivo. Cells from the skin-draining lymph nodes, spleen, software (BD Biosciences) and data were analyzed
Tg +
and ear pinnae were isolated as described (6). using FlowJo software (TreeStar).
Adoptive transfer of Bowie CD8 T cells Cells from lymph nodes and spleen were mashed
BowieTg mice were backcrossed to a CD45.1 Rag1−/− through a 70-mm cell strainer to generate single- RNA staining
background to exclude the possibility of dual cell suspensions. Ear pinnae were excised and Skin tissue single-cell suspensions were analyzed
TCR expression and facilitate identification of separated into ventral and dorsal sheets. Ear for mRNA and protein expression using the
transferred cells. Recipient mice (CD45.2) re- pinnae were digested in RPMI 1640 media sup- PrimeFlow RNA assay (eBioscience) and standard
ceived 4 × 105 BowieTg CD45.1 Rag1−/− CD8+ T cells plemented with 2 mM L-glutamine, 1 mM sodium mouse probe sets for Ifng, Il5, Il13, and Il17a, as
by intravenous injection 24 hours before the first pyruvate, 1 mM non-essential amino acids, 50 mM per manufacturer’s instructions for 96-well-plate
application of S. epidermidis. b-mercaptoethanol, 20 mM HEPES, 100 U/ml of staining.
penicillin, 100 mg/ml of streptomycin, and
Parabiosis experiments and surgery 0.25 mg/ml of Liberase TL purified enzyme blend Tetramer-based cell enrichment
Congenically distinct, age- and weight-matched (Roche), and incubated for 90 min at 37°C and 5% f-MIIINA:H2-M3-specific CD8+ T cells from sec-
mice were co-housed for 2 weeks before coloniza- CO2. Digested skin sheets were homogenized ondary lymphoid organs were subjected to magnetic
tion with S. epidermidis. Both mice were colonized using the Medicon/Medimachine tissue homog- bead based enrichment, as previously described
to control for bacterial spread. Forty days after enizer system (Becton Dickinson). (49). Briefly, spleen and lymph node cells from
initial colonization, parabiosis surgery was per- parabiotic pairs were stained for 1 hour at room
formed as described (10). Briefly, mice were sedated In vitro restimulation temperature with f-MIIINA:H2-M3-streptavidin-
and longitudinal incisions were made from the For detection of basal cytokine potential, single- phycoerythrin (PE) tetramer. Samples were then
elbow to the knee joint of each mouse. Excess skin cell suspensions from various tissues were cul- incubated with anti-PE beads (Miltenyi Biotech)

Harrison et al., Science 363, eaat6280 (2019) 4 January 2019 9 of 11


R ES E A RC H | R E S EA R C H A R T I C LE

and enriched for bead-bound cells on magnetized Single-cell RNA sequencing analysis or 1 mg of anti–IL-5 monoclonal antibody (clone
columns. Sequence reads were processed and aggregated TRFK5, BioXCell) or rat IgG1 isotype control
using Cell Ranger software. Aggregated data were (clone TNP6A7, BioXCell), or 1 mg of anti–IL-18
RNA-sequencing and further analyzed using Seurat (55). monoclonal antibody [clone SK113AE-4 (57)] or
transcriptome analysis isotype control by i.p. injection 1 day before skin
T cells were isolated by flow cytometric cell sorting Confocal microscopy injury.
from the ear skin tissue of C57BL/6 mice 2 weeks Ear pinnae were split with forceps, fixed in 1%
after colonization with S. epidermidis NIHLM087. paraformaldehyde in PBS (Electron Microscopy Total tissue RNA-seq
Groups included: TC1 (Viable Lineage−CD45+ Sciences) overnight at 4°C, and blocked in 1% A ~1-mm skin region surrounding the wound
CD90.2+TCRb+CD8b+CCR6−) and TC17 cells (Viable BSA + 0.25% Triton X in PBS for 2 hours at room site was microdissected at indicated time points
Lineage−CD45+CD90.2+TCRb+CD8b+CCR6+). temperature. Tissues were first stained with anti- after wounding, submerged in RNAlater (Sigma-
Sorted cells were lysed in Trizol reagent and CD4 (RM4-5, eBioscience), anti-CD8a (clone 53- Aldrich), and stored at −20°C. Total tissue RNA
total RNA isolated by phenol-chloroform extrac- 6.7, eBioscience), anti-CD45.1 (A20, eBioscience), was isolated from skin tissue using the RNeasy
tion with GlycoBlue as a co-precipitant (7 mg per anti-CD49f (GoH3, eBioscience), and/or anti-GFP Fibrous Tissue Mini kit (Qiagen), as per manu-
sample; Life Technologies). Single-end libraries (A21311, Life Technologies) antibodies overnight facturer’s instructions. A 3′ mRNA sequencing
were prepared with 0.25 to 1 mg of total RNA at 4°C, washed three times with PBS and then library was prepared using 200 to 500 ng of total
using the TruSeq RNA Sample Preparation Kit stained with 4,6-diamidino-2-phenylindole (DAPI, input RNA with the QuantSeq 3′ mRNA-Seq
V2 and sequenced for 50 cycles with a HiSeq Sigma-Aldrich) overnight before being mounted Library Prep Kit FWD for Illumina (Lexogen) as
2500 instrument (4 to 6 samples multiplexed with ProLong Gold (Molecular Probes) antifade per manufacturer’s instructions. Libraries were
per lane; Illumina). Sequencing quality of the reagent. Ear pinnae images were captured on a quantified using an Agilent Tapestation (High
raw read data was assessed using FASTQC Leica TCS SP8 confocal microscope equipped Sensitivity D1000 ScreenTape) and Qubit (Thermo

Downloaded from http://science.sciencemag.org/ on January 7, 2019


v0.11.5. Using a custom Perl script, 10 bp were with HyD and PMT detectors and a 40× oil ob- Fisher Scientific). Libraries (n = 20) were pooled at
trimmed from the 3′ end of the 50-bp reads. Sub- jective (HC PL APO 40×/1.3 oil). Images were equimolar concentrations and sequenced on an
sequently, FASTQ files were used as input for analyzed using Imaris software (Bitplane). Illumina Nextseq 500 using the High Output v2
RSEM v1.3.0 (50) (internally configured to use kit (75 cycles). Resultant data was demultiplexed
the bowtie aligner, v1.1.1). Expected read counts Back-skin wounding and epifluorescence on Illumina Basespace server using blc2fastq
from RSEM were imported into the DESeq2 microscopy of back-skin wounds tool. The reads from the Illumina Next-seq se-
Bioconductor package (51), normalized using the Tissue wounding and quantitation of wound quencer in fastq format were verified for qual-
geometric-mean based approach built into this healing were performed as previously described ity control using FastQC software package,
package and then tested for differential expres- (56). Briefly, male mice in the telogen phase of aligned to mouse GRCM38 using RSEM package
sion between groups using a Wald test with mul- the hair cycle were anesthetized and punch biopsies (50) calling STAR aligner (52). The RSEM expected
tiple testing correction using Benjamini-Hochberg performed on back skin. Dorsal hair was shaved counts were rounded to the nearest integer value
false discovery. with clippers and a 6-mm biopsy punch was used and the transcripts with zero counts across all
to partially perforate the skin. Iris scissors were samples filtered out. Differential expression anal-
ATAC sequencing and epigenome analysis then used to cut epidermal and dermal tissue to ysis and principal components analysis was per-
T cells were isolated as for RNA sequencing. create a full thickness wound in a circular shape. formed using DESeq2 (51).
ATAC-seq was performed according to a published Back-skin tissue was excised 5 days after wound-
protocol (16). ATAC-seq reads from two biological ing, fixed in 4% paraformaldehyde in PBS, incu- Statistics
replicates for each sample were mapped to the bated overnight in 30% sucrose in PBS, embedded Groups were compared with Prism V7.0 software
mouse genome (mm10 assembly) using STAR (52). in OCT compound (Tissue-Tek), frozen on dry (GraphPad) using the two-tailed unpaired Stu-
Duplicate reads were removed using FastUniq ice, and cryo-sectioned (20-mm section thickness). dent t test, one-way analysis of variance (ANOVA)
(53), and reads mapping to mitochondrial loci Sections were fixed in 4% paraformaldehyde in with Holm-Šidák multiple-comparison test, or two-
removed based upon ENCODE blacklists. Regions PBS, rinsed with PBS, permeabilized with 0.1% way ANOVA with Holm-Šidák multiple-comparison
of open chromatin were identified by MACS Triton X-100 in PBS (Sigma-Aldrich), and blocked test where appropriate. Differences were considered
(version 1.4.2) using a P-value threshold of 1 × for 1 hour in blocking buffer (2.5% Normal Goat to be statistically significant when P < 0.05.
10−5. Only regions called in both replicates were Serum, 1% BSA, 0.3% Triton X-100 in PBS). Pri-
used in downstream analysis. Downstream mary antibody to Keratin 14 (chicken, Poly9060, REFERENCES AND NOTES
analysis and heatmap generation were per- 1:400, Biolegend) was diluted in blocking buffer 1. Y. Cong, T. Feng, K. Fujihashi, T. R. Schoeb, C. O. Elson, A
dominant, coordinated T regulatory cell-IgA response to the
formed with the Hypergeometric Optimization with rat gamma globulin and anti-CD16/32 and intestinal microbiota. Proc. Natl. Acad. Sci. U.S.A. 106,
of Motif EnRichment program (HOMER) ver- incubated overnight. After washing with PBS, a 19256–19261 (2009). doi: 10.1073/pnas.0812681106;
sion 4.8 (54). secondary antibody conjugated with Alexa647 pmid: 19889972
(goat anti-chicken, Jackson ImmunoResearch) 2. T. W. Hand et al., Acute gastrointestinal infection induces long-
Single-cell RNA sequencing lived microbiota-specific T cell responses. Science 337,
was added for 1 hour at room temperature. 1553–1556 (2012). doi: 10.1126/science.1220961;
T cells were isolated as for bulk RNA sequencing, Slides were washed with PBS, counterstained pmid: 22923434
from S. epidermidis–colonized IL-17A-fate-mapping with DAPI and mounted in Prolong Gold. Wound 3. Y. Yang et al., Focused specificity of intestinal TH17 cells
mice, with three groups: TC1 (Viable Lineage− images were captured with a Leica DMI 6000 towards commensal bacterial antigens. Nature 510, 152–156
(2014). doi: 10.1038/nature13279; pmid: 24739972
CD45+CD90.2+TCRb+CD8b+CCR6−), TC17 IL-17AFM− widefield epifluorescence microscope equipped 4. S. Naik et al., Commensal-dendritic-cell interaction specifies a
(Viable Lineage − CD45+ CD90.2+ TCRb+CD8b+ with a Leica DFC360X monochrome camera. Tiled unique protective skin immune signature. Nature 520, 104–108
CCR6+eYFP−), and TC17 IL-17AFM+ (Viable Lineage− and stitched images of wounds were collected (2015). doi: 10.1038/nature14052; pmid: 25539086
CD45+CD90.2+TCRb+CD8b+CCR6+eYFP+). Freshly using a 20×/0.4NA dry objective. Images were 5. Y. Belkaid, O. J. Harrison, Homeostatic Immunity and the
Microbiota. Immunity 46, 562–576 (2017). doi: 10.1016/
isolated cells were encapsulated into drop- analyzed using Imaris software (Bitplane). j.immuni.2017.04.008; pmid: 28423337
lets, and libraries prepared using Chromium 6. J. L. Linehan et al., Non-classical Immunity Controls Microbiota
Single Cell 3′ Reagent Kits v2 (10X Genomics). In vivo cytokine blockade Impact on Skin Immunity and Tissue Repair. Cell 172, 784–796.
The generated scRNA-seq libraries were seq- Naïve or S. epidermidis–colonized WT or Il13−/− e18 (2018). doi: 10.1016/j.cell.2017.12.033; pmid: 29358051
7. T. C. Scharschmidt et al., A Wave of Regulatory T Cells into
uenced using 26 cycles of Read 1, 8 cycles of i7 mice received 0.5 mg of anti–IL-13 monoclonal Neonatal Skin Mediates Tolerance to Commensal Microbes.
Index, and 98 cycles of Read2 with a HiSeq 3000 antibody (clone 262A-5-1, Genentech) or mouse Immunity 43, 1011–1021 (2015). doi: 10.1016/
(Illumina). IgG1 isotype control (clone MOPC-21, BioXCell), j.immuni.2015.10.016; pmid: 26588783

Harrison et al., Science 363, eaat6280 (2019) 4 January 2019 10 of 11


R ES E A RC H | R E S EA R C H A R T I C LE

8. V. K. Ridaura et al., Contextual control of skin immunity and responses. Nat. Immunol. 14, 372–379 (2013). doi: 10.1038/ 53. H. Xu et al., FastUniq: A fast de novo duplicates removal tool
inflammation by Corynebacterium. J. Exp. Med. 215, 785–799 ni.2552; pmid: 23475182 for paired short reads. PLOS ONE 7, e52249 (2012).
(2018). doi: 10.1084/jem.20171079; pmid: 29382696 31. N. Gagliani et al., Th17 cells transdifferentiate into regulatory doi: 10.1371/journal.pone.0052249; pmid: 23284954
9. J. M. Schenkel, D. Masopust, Tissue-resident memory T cells. T cells during resolution of inflammation. Nature 523, 221–225 54. S. Heinz et al., Simple combinations of lineage-determining
Immunity 41, 886–897 (2014). doi: 10.1016/ (2015). doi: 10.1038/nature14452; pmid: 25924064 transcription factors prime cis-regulatory elements
j.immuni.2014.12.007; pmid: 25526304 32. K. Nakanishi, T. Yoshimoto, H. Tsutsui, H. Okamura, required for macrophage and B cell identities. Mol. Cell
10. D. E. Wright, A. J. Wagers, A. P. Gulati, F. L. Johnson, Interleukin-18 regulates both Th1 and Th2 responses. 38, 576–589 (2010). doi: 10.1016/j.molcel.2010.05.004;
I. L. Weissman, Physiological migration of hematopoietic stem Annu. Rev. Immunol. 19, 423–474 (2001). doi: 10.1146/ pmid: 20513432
and progenitor cells. Science 294, 1933–1936 (2001). annurev.immunol.19.1.423; pmid: 11244043 55. A. Butler, P. Hoffman, P. Smibert, E. Papalexi, R. Satija,
doi: 10.1126/science.1064081; pmid: 11729320 33. O. J. Harrison et al., Epithelial-derived IL-18 regulates Th17 cell Integrating single-cell transcriptomic data across
11. J. M. Kim, J. P. Rasmussen, A. Y. Rudensky, Regulatory T cells differentiation and Foxp3+ Treg cell function in the intestine. different conditions, technologies, and species. Nat.
prevent catastrophic autoimmunity throughout the lifespan of Mucosal Immunol. 8, 1226–1236 (2015). doi: 10.1038/ Biotechnol. 36, 411–420 (2018). doi: 10.1038/nbt.4096;
mice. Nat. Immunol. 8, 191–197 (2007). doi: 10.1038/ni1428; mi.2015.13; pmid: 25736457 pmid: 29608179
pmid: 17136045 34. N. Arpaia et al., A Distinct Function of Regulatory T Cells in 56. B. E. Keyes et al., Impaired Epidermal to Dendritic T Cell
12. E. A. Wohlfert et al., GATA3 controls Foxp3+ regulatory T cell Tissue Protection. Cell 162, 1078–1089 (2015). doi: 10.1016/ Signaling Slows Wound Repair in Aged Skin. Cell 167,
fate during inflammation in mice. J. Clin. Invest. 121, j.cell.2015.08.021; pmid: 26317471 1323–1338.e14 (2016). doi: 10.1016/j.cell.2016.10.052;
4503–4515 (2011). doi: 10.1172/JCI57456; pmid: 21965331 35. R. R. Ricardo-Gonzalez et al., Tissue signals imprint ILC2 pmid: 27863246
13. M. Delacher et al., Genome-wide DNA-methylation landscape identity with anticipatory function. Nat. Immunol. 19, 57. M. Lochner, H. Wagner, M. Classen, I. Förster, Generation of
defines specialization of regulatory T cells in tissues. 1093–1099 (2018). doi: 10.1038/s41590-018-0201-4; neutralizing mouse anti-mouse IL-18 antibodies for inhibition of
Nat. Immunol. 18, 1160–1172 (2017). doi: 10.1038/ni.3799; pmid: 30201992 inflammatory responses in vivo. J. Immunol. Methods 259,
pmid: 28783152 36. S. A. Eming, T. A. Wynn, P. Martin, Inflammation and metabolism in 149–157 (2002). doi: 10.1016/S0022-1759(01)00505-1;
14. Y. Wang, M. A. Su, Y. Y. Wan, An essential role of the tissue repair and regeneration. Science 356, 1026–1030 (2017). pmid: 11730850
transcription factor GATA-3 for the function of regulatory doi: 10.1126/science.aam7928; pmid: 28596335
T cells. Immunity 35, 337–348 (2011). doi: 10.1016/ 37. J. Zhu et al., Conditional deletion of Gata3 shows its essential AC KNOWLED GME NTS
j.immuni.2011.08.012; pmid: 21924928 function in T(H)1-T(H)2 responses. Nat. Immunol. 5, 1157–1165 We thank the National Institute of Allergy and Infectious Diseases
15. D. Rudra et al., Transcription factor Foxp3 and its protein (2004). doi: 10.1038/ni1128; pmid: 15475959 (NIAID) animal facility staff; K. Holmes, E. Stregevsky, and

Downloaded from http://science.sciencemag.org/ on January 7, 2019


partners form a complex regulatory network. Nat. Immunol. 13, 38. Y. P. Rubtsov et al., Stability of the regulatory T cell lineage in T. Hawley (NIAID Flow Cytometry facility); G. Gutierrez-Cruz,
1010–1019 (2012). doi: 10.1038/ni.2402; pmid: 22922362 vivo. Science 329, 1667–1671 (2010). doi: 10.1126/ S. Dell’Orso, and H.-W. Sun (NIAMS Genome Analysis Core facility);
16. H. Y. Shih et al., Developmental Acquisition of Regulomes science.1191996; pmid: 20929851 J. Kehr for editorial assistance; K. Beacht and S. Mistry for
Underlies Innate Lymphoid Cell Functionality. Cell 165, 39. E. Bettelli et al., Reciprocal developmental pathways for the technical assistance; and I. Förster (University of Bonn) for
1120–1133 (2016). doi: 10.1016/j.cell.2016.04.029; generation of pathogenic effector TH17 and regulatory T cells. generous provision of the anti–IL-18 hybridoma. f-MIIINA:H2-M3-
pmid: 27156451 Nature 441, 235–238 (2006). doi: 10.1038/nature04753; tetramer reagents were obtained from the NIH Tetramer Core
17. G. R. Lee, P. E. Fields, T. J. Griffin IV, R. A. Flavell, Regulation of pmid: 16648838 Facility. This study used the Office of Cyber Infrastructure and
the Th2 cytokine locus by a locus control region. Immunity 19, 40. P. Mombaerts et al., Mutations in T-cell antigen receptor genes Computational Biology (OCICB) High Performance Computing
145–153 (2003). doi: 10.1016/S1074-7613(03)00179-1; alpha and beta block thymocyte development at different (HPC) cluster at NIAID and the high-performance computational
pmid: 12871646 stages. Nature 360, 225–231 (1992). doi: 10.1038/360225a0; capabilities of the Biowulf Linux cluster at NIH. Funding:
18. H. E. Liang et al., Divergent expression patterns of IL-4 and IL-13 pmid: 1359428 Supported by the NIAID Division of Intramural Research
define unique functions in allergic immunity. Nat. Immunol. 13, 41. G. J. McKenzie et al., Impaired development of Th2 cells in IL- (ZIA-AI001115, ZIA-AI001132) (Y.B.); the Division of Intramural
58–66 (2011). doi: 10.1038/ni.2182; pmid: 22138715 13-deficient mice. Immunity 9, 423–432 (1998). doi: 10.1016/ Research of the National Institute of Arthritis and Musculoskeletal
19. K. Mohrs, A. E. Wakil, N. Killeen, R. M. Locksley, M. Mohrs, A S1074-7613(00)80625-1; pmid: 9768762 and Skin Diseases (NIAMS; ZIA-AR041159, ZIA-AR041167) (J.J.O.);
two-step process for cytokine production revealed by IL-4 42. R. Yagi et al., The transcription factor GATA3 is critical for the a National Psoriasis Foundation Early Career Research Grant
dual-reporter mice. Immunity 23, 419–429 (2005). development of all IL-7Ra-expressing innate lymphoid cells. (O.J.H.); the National Institute of General Medical Sciences
doi: 10.1016/j.immuni.2005.09.006; pmid: 16226507 Immunity 40, 378–388 (2014). doi: 10.1016/ (NIGMS) Postdoctoral Research Associate (PRAT) fellowship
20. C. H. Chang et al., Posttranscriptional control of T cell effector j.immuni.2014.01.012; pmid: 24631153 program (J.L.L.); a European Molecular Biology Organization
function by aerobic glycolysis. Cell 153, 1239–1251 (2013). 43. S. Srinivas et al., Cre reporter strains produced by (EMBO) fellowship (S.T.); and Collège des Enseignants de
doi: 10.1016/j.cell.2013.05.016; pmid: 23746840 targeted insertion of EYFP and ECFP into the ROSA26 Dermatologie Français, Société Française de Dermatologie,
21. K. Araki et al., Translation is actively regulated during the locus. BMC Dev. Biol. 1, 4 (2001). doi: 10.1186/1471-213X-1-4; Philippe Foundation, and Fondation pour la Recherche Médicale
differentiation of CD8+ effector T cells. Nat. Immunol. 18, pmid: 11299042 (C.H.). Author contributions: O.J.H. and Y.B. designed the study,
1046–1057 (2017). pmid: 28714979 44. S. Conlan et al., Staphylococcus epidermidis pan-genome experiments, and wrote the manuscript; O.J.H. performed the
22. F. Salerno et al., Translational repression of pre-formed sequence analysis reveals diversity of skin commensal experiments and analyzed the data; J.L.L., S.-J.H., N.B., H.-Y.S.,
cytokine-encoding mRNA prevents chronic activation and hospital infection-associated isolates. Genome M.S., S.K.S., A.L.B., M.E., S.T., F.V.L., C.H., N.C., A.P., R.S., and
of memory T cells. Nat. Immunol. 19, 828–837 (2018). Biol. 13, R64 (2012). doi: 10.1186/gb-2012-13-7-r64; J.J.O. participated in performing experiments, provided intellectual
doi: 10.1038/s41590-018-0155-6; pmid: 29988089 pmid: 22830599 expertise, and helped to interpret experimental results; J.L.L.
23. W. V. Bonilla et al., The alarmin interleukin-33 drives protective 45. S. Naik et al., Compartmentalized control of skin immunity by generated BowieTg mice, performed wounding experiments, and
antiviral CD8+ T cell responses. Science 335, 984–989 (2012). resident commensals. Science 337, 1115–1119 (2012). analyzed data; H.-Y.S., S.K.S., A.L.B., and C.Y. assisted with
doi: 10.1126/science.1215418; pmid: 22323740 doi: 10.1126/science.1225152; pmid: 22837383 RNA-seq and ATAC-seq studies; N.B. and S.T. performed flow
24. I. Okamoto, K. Kohno, T. Tanimoto, H. Ikegami, M. Kurimoto, 46. P. Dash et al., Paired analysis of TCRa and TCRb chains at the cytometric analysis of skin immune cells; S.J.H. performed
Development of CD8+ effector T cells is differentially regulated single-cell level in mice. J. Clin. Invest. 121, 288–295 (2011). confocal microscopy analysis; M.S. performed epifluorescence
by IL-18 and IL-12. J. Immunol. 162, 3202–3211 (1999). doi: 10.1172/JCI44752; pmid: 21135507 microscopy of wounds; M.E. assisted with wounding experiments;
pmid: 10092771 47. G. Sun et al., The zinc finger protein cKrox directs CD4 lineage S.J.H. and N.C. performed parabiotic surgeries; F.V.L. shared
25. P. P. Ahern et al., Interleukin-23 drives intestinal inflammation differentiation during intrathymic T cell positive selection. Nat. expertise for the generation of TCR-expressing hybridomas and
through direct activity on T cells. Immunity 33, 279–288 Immunol. 6, 373–381 (2005). doi: 10.1038/ni1183; pmid: 15750595 TCR-transgenic mice; A.P. conducted sand fly exposures; and
(2010). doi: 10.1016/j.immuni.2010.08.010; pmid: 20732640 48. N. Kimblin et al., Quantification of the infectious dose of C.H. performed C. albicans experiments. Competing interests:
26. K. Hirota et al., Fate mapping of IL-17-producing T cells in Leishmania major transmitted to the skin by single sand flies. Authors declare no competing interests. Data and materials
inflammatory responses. Nat. Immunol. 12, 255–263 (2011). Proc. Natl. Acad. Sci. U.S.A. 105, 10125–10130 (2008). availability: Anti–IL-13 (clone 262A-5-1) is available under a
doi: 10.1038/ni.1993; pmid: 21278737 doi: 10.1073/pnas.0802331105; pmid: 18626016 material agreement with Genentech. Anti–IL-18 (clone SK113AE-4)
27. Y. H. Wang et al., A novel subset of CD4+ TH2 memory/effector 49. J. J. Moon et al., Naive CD4+ T cell frequency varies for is available from I. Förster under a material agreement
cells that produce inflammatory IL-17 cytokine and promote different epitopes and predicts repertoire diversity and with the University of Bonn. The accession number for
the exacerbation of chronic allergic asthma. J. Exp. Med. 207, response magnitude. Immunity 27, 203–213 (2007). the RNA-seq and ATAC-seq datasets is NCBI BioProject:
2479–2491 (2010). doi: 10.1084/jem.20101376; doi: 10.1016/j.immuni.2007.07.007; pmid: 17707129 PRJNA486019. All other data needed to evaluate the conclusions
pmid: 20921287 50. B. Li, C. N. Dewey, RSEM: Accurate transcript quantification in this paper are present either in the main text or the
28. M. Panzer et al., Rapid in vivo conversion of effector T cells into from RNA-Seq data with or without a reference genome. supplementary materials.
Th2 cells during helminth infection. J. Immunol. 188, 615–623 BMC Bioinformatics 12, 323 (2011). doi: 10.1186/1471-2105-12-323;
(2012). doi: 10.4049/jimmunol.1101164; pmid: 22156341 pmid: 21816040
SUPPLEMENTARY MATERIALS
29. C. Irvin et al., Increased frequency of dual-positive TH2/TH17 51. M. I. Love, W. Huber, S. Anders, Moderated estimation of fold
cells in bronchoalveolar lavage fluid characterizes a population change and dispersion for RNA-seq data with DESeq2. www.sciencemag.org/content/363/6422/eaat6280/suppl/DC1
of patients with severe asthma. J. Allergy Clin. Immunol. 134, Genome Biol. 15, 550 (2014). doi: 10.1186/s13059-014-0550-8; Figs. S1 to S6
1175–1186.e7 (2014). doi: 10.1016/j.jaci.2014.05.038; pmid: 25516281
pmid: 25042748 52. A. Dobin et al., STAR: Ultrafast universal RNA-seq aligner. 19 March 2018; accepted 9 November 2018
30. K. Hirota et al., Plasticity of Th17 cells in Peyer’s patches is Bioinformatics 29, 15–21 (2013). doi: 10.1093/bioinformatics/ Published online 6 December 2018
responsible for the induction of T cell-dependent IgA bts635; pmid: 23104886 10.1126/science.aat6280

Harrison et al., Science 363, eaat6280 (2019) 4 January 2019 11 of 11


R ES E A RC H

◥ into plasma membranes, but synaptotagmin-3


RESEARCH ARTICLE SUMMARY (Syt3) internalizes from postsynaptic membranes.
Stimulating AMPA (a-amino-3-hydroxy-5-methyl-
4-isoxazolepropionic) or NMDA (N-methyl D-
NEUROSCIENCE
aspartate) receptors induces internalization of
AMPA receptors (which mediate most of the
Synaptotagmin-3 drives AMPA fast synaptic transmission in the brain) and Syt3.
This raised the intriguing possibility that Syt3

receptor endocytosis, depression of mediates activity-induced internalization of recep-


tors to weaken synapses and cause forgetting.
We imaged Syt3 using an isoform-specific anti-
synapse strength, and forgetting body, tested its role in receptor trafficking using
electrophysiological methods in brain slices
Ankit Awasthi*, Binu Ramachandran*, Saheeb Ahmed, Eva Benito, Yo Shinoda, and neuronal cultures, and tested its role in
Noam Nitzan, Alina Heukamp, Sabine Rannio, Henrik Martens, Jonas Barth, forgetting using spatial memory tasks in mice.
Katja Burk, Yu Tian Wang, Andre Fischer, Camin Dean†
RESULTS: Syt3 is on postsynaptic membranes
at endocytic zones, which are clathrin-rich
INTRODUCTION: Memories are stored as mo- synaptic plasma membrane. These receptors regions close to the postsynaptic density. Syt3
lecular and cellular changes in the brain. Synap- mediate synaptic transmission by transduc- binds the GluA2 AMPA receptor subunit and

Downloaded from http://science.sciencemag.org/ on January 7, 2019


ses, the nodes of connection between neurons, ing presynaptically released neurotransmitters ◥ also binds AP2 and BRAG2,
ON OUR WEBSITE
can store memories by virtue of their ability to into an electrical signal. Neuronal activity two proteins implicated
tune the efficacy of communication between strengthens synapses by inserting receptors or Read the full article in activity-dependent in-
neurons. This property of synaptic plasticity weakens synapses by removing receptors at http://dx.doi. ternalization of AMPA
makes it possible for the brain to store and from the postsynaptic membrane. Receptor org/10.1126/ receptors via clathrin-
retrieve memories—to replay patterns of elec- trafficking is controlled through calcium in- science.aav1483 mediated endocytosis.
..................................................
trical activity that occurred during an impor- flux into the neuron; however, the calcium Syt3 does not affect basal
tant event. Forgetting leads to the inability to sensors mediating this control are not known. AMPA receptor trafficking. However, knock-
retrieve memories by making them latent or ing out Syt3—or expressing calcium-binding–
decaying them below any useful quality. How- RATIONALE: Synaptotagmin proteins sense deficient Syt3—abolishes AMPA receptor
ever, what determines whether a memory is calcium to trigger membrane fusion. Stimulat- internalization induced by AMPA, NMDA, or
forgotten? A mechanism is the regulation of ing neuronal cultures elicits a calcium-mediated electrophysiological stimulation of long-term
neurotransmitter receptor numbers on the post- externalization of most synaptotagmin isoforms depression of synaptic strength. It also blocks
the AMPA receptor internalization that nor-
Escape position 1 Escape position 2 Previous escape position AMPA receptor mally decays long-term potentiation of synap-
tic strength. These effects are mimicked in a
Recorded field EPSP (readout of synaptic strength) Dendritic spine Mouse
wild-type background through acute appli-
cation of the Tat-GluA2-3Y peptide, which
competitively inhibits binding of Syt3 to a
tyrosine-rich (3Y) motif on the cytoplasmic
tail of GluA2. In spatial memory tasks, mice in
Wild-type which Syt3 was knocked out (Syt3 knockout
mice) learn escape positions normally but
persevere to previously learned positions,
which can be explained by a lack of forget-
ting previously acquired memories. Inject-
ing the Tat-GluA2-3Y peptide in wild-type
mice mimics the lack of forgetting of spatial
memories, and this effect is occluded in
Syt3 knockout mice.

CONCLUSION: The persistence or degra-


Syt3 KO dation of memories is governed by a poorly
understood molecular machinery. We have
discovered a distinct synaptotagmin isoform
that triggers calcium-mediated internalization
of AMPA receptors, resulting in a weakening
of synaptic transmission and forgetting of
Syt3 knockout mice do not forget. Both wild-type mice and Syt3 knockout mice can learn
an escape position in the water maze, in which corresponding synapses are strengthened
spatial memories in mice.

through the increase of AMPA receptors. These synapses are weakened by the removal The list of author affiliations is available in the full article online.
of receptors if the memory is no longer needed—for example, when a new escape position is *These authors contributed equally to this work.
†Corresponding author. Email: c.dean@eni-g.de
learned. Syt3 knockout mice cannot remove receptors and therefore cannot forget previous Cite this article as A. Awasthi et al., Science 363, eaav1483
escape positions. (2019). DOI: 10.1126/science.aav1483

Awasthi et al., Science 363, 44 (2019) 4 January 2019 1 of 1


R ES E A RC H

◥ Results
RESEARCH ARTICLE Syt3 is on postsynaptic
plasma membranes
To examine the location of Syt3, we developed
NEUROSCIENCE a highly specific antibody (fig. S1, A and B) that
recognized a single band in brain homogenates,

Synaptotagmin-3 drives AMPA which was absent in Syt3 knockouts; an antibody


developed by Neuromab showed similar results
(Fig. 1A). Syt3 was most abundant in adipose
receptor endocytosis, depression of tissue, heart, and brain (fig. S1C), where it was
found in the hippocampus, cortex, thalamus, and

synapse strength, and forgetting striatum (fig. S1D). Expression in the brain began
embryonically and remained high throughout
adulthood (fig. S1E). Immunostains revealed Syt3
Ankit Awasthi1*, Binu Ramachandran1*, Saheeb Ahmed1†, Eva Benito2,3, Yo Shinoda1‡, signal on neuronal cell bodies and dendrites in
Noam Nitzan1, Alina Heukamp1§, Sabine Rannio1, Henrik Martens4, Jonas Barth2,3, the CA1 (Fig. 1B), CA3, and dentate gyrus (fig. S1F)
Katja Burk1, Yu Tian Wang5, Andre Fischer2,3, Camin Dean1¶ in wild-type, but not Syt3 knockout, hippocam-
pal slices.
Forgetting is important. Without it, the relative importance of acquired memories in a To localize Syt3 subcellularly, we expressed
changing environment is lost. We discovered that synaptotagmin-3 (Syt3) localizes to cytosolic green fluorescent protein (GFP) in cul-
postsynaptic endocytic zones and removes AMPA receptors from synaptic plasma tured hippocampal neurons and immunostained

Downloaded from http://science.sciencemag.org/ on January 7, 2019


membranes in response to stimulation. AMPA receptor internalization, long-term for Syt3 and MAP2 to distinguish dendrites (MAP2-
depression (LTD), and decay of long-term potentiation (LTP) of synaptic strength required positive) from axons (GFP-positive/MAP2-negative).
calcium-sensing by Syt3 and were abolished through Syt3 knockout. In spatial memory Syt3 signal was predominantly detected in den-
tasks, mice in which Syt3 was knocked out learned normally but exhibited a lack of drites (90.2 ± 3.0% of total signal) compared with
forgetting. Disrupting Syt3:GluA2 binding in a wild-type background mimicked the lack of axons (9.8 ± 5.1% of total signal) (P < 0.001) (Fig. 1C).
LTP decay and lack of forgetting, and these effects were occluded in the Syt3 knockout Syt3 exhibited a punctate pattern in dendrites
background. Our findings provide evidence for a molecular mechanism in which Syt3 and colocalized with the pre- and postsynaptic
internalizes AMPA receptors to depress synaptic strength and promote forgetting. markers synaptophysin, and PSD95 or GluA1,
respectively, at synapses (Fig. 1D); 70.6 ± 5.3%

A
of Syt3 signal was at excitatory synapses (fig.
fundamental property of the brain is the GluA2-containing AMPA receptors from the plas- S1G), and 29.4 ± 1.9% was at inhibitory synapses
ability to learn from experience by mod- ma membrane (8, 12, 13). Ca2+ influx into den- (P < 0.001) (fig. S1H). In subcellular fractions,
ulating the strength of synaptic connec- drites is critical for virtually all types of synaptic Syt3 was associated with synaptosomal plasma
tions between neurons. The trafficking of plasticity (4), including decay of LTP (14, 15) and membranes and not with synaptic vesicles (fig. S1I),
AMPA receptors to and from the surface active internalization of GluA2-containing AMPA which is in agreement with a previous report (20).
of postsynaptic membranes is a key determinant receptors (16, 17). The same signaling entity can Immuno-organelle isolation of synaptic vesicles
in the regulation of synaptic strength (1–3). High- have divergent consequences for the synapse: Fast, with antibodies to Syt1 or Syb2 further confirmed
frequency stimulation increases surface recep- high [Ca2+] influx can promote LTP, whereas that Syt3 is not present on synaptic vesicles (fig. S1J).
tors and promotes long-term potentiation (LTP) gradual, low [Ca2+] influx can promote LTD (4). We further tested whether Syt3 is specifically local-
of synaptic strength. Low-frequency stimulation Plasma membrane–localized Ca2+-binding pro- ized to postsynaptic membranes using a trypsin
removes receptors from the postsynaptic mem- teins are likely needed to remove or add receptors cleavage assay of synaptosomes (26). Synapto-
brane and causes long-term depression (LTD) of to the postsynaptic membrane through regulated somes form in such a way that the presynaptic
synaptic strength. This phenomenon has been endo- or exocytosis. Synaptotagmins (Syts) are terminal seals, trapping synaptic vesicles and
most extensively studied in N-methyl-D-aspartate candidates for such a function (18). This family other presynaptic components inside (Fig. 1E),
(NMDA)–receptor–dependent plasticity of CA3- of integral membrane proteins contain a short whereas the postsynaptic membrane does not re-
CA1 synapses in the hippocampus (4). LTP is luminal tail, transmembrane domain, and two seal. Presynaptic proteins were therefore protected
widely believed to underlie learning (5–7). Con- conserved cytoplasmic Ca2+-binding C2 domains from trypsin cleavage, whereas postsynaptic pro-
versely, weakening of potentiated synapses, and (19) that regulate Ca2+-dependent membrane re- teins, including Syt3, were cleaved (Fig. 1F).
LTD, can promote forgetting (5, 8, 9). cycling events.
Both LTD (10, 11) and the decay of LTP depend Of the 17 mammalian Syt isoforms, Syt3 is the Stimulation induces endocytosis of Syt3
on activity-dependent removal of postsynaptic third most abundant in the brain. Unlike Syt1 The presence of Syt3 on postsynaptic membranes
and Syt2, which are predominantly thought to be suggests it may regulate a post-synaptic re-
1
Trans-synaptic Signaling Group, European Neuroscience localized to synaptic vesicle membranes, Syt3 was cycling event. Time-lapse imaging of pHluorin-
Institute, 37077 Goettingen, Germany. 2German Center for reported to be localized to the plasma membrane Syt3 in transfected hippocampal neurons during
Neurodegenerative Disease, 37075 Goettingen, Germany. (20, 21) and to have a 10-fold higher Ca2+ affinity depolarization with 45 mM KCl (23) or field stim-
3
Department of Psychiatry and Psychotherapy, University
Medical Center Goettingen, 37075 Goettingen, Germany.
than that of Syt1 and Syt2 (22). In a pHluorin-Syt ulation revealed a calcium-dependent fluores-
4
Synaptic Systems GmbH, 37079 Goettingen, Germany. 5Brain screen of Syt isoforms in response to stimulation, cence decrease, requiring NMDA/AMPA receptors
Research Center and Department of Medicine, University of Syt3 exhibited distinct recycling properties: It was and L-type calcium channels, likely corresponding
British Columbia, Vancouver, BC V6T2B5, Canada. the only isoform to endocytose in response to to endocytosis (fig. S2, A to D). PHluorin-Syt3 also
*These authors contributed equally to this work.
†Present address: Department of Diagnostic and Interventional
stimulation and to recycle exclusively in den- exhibited calcium-dependent endocytosis in re-
Radiology, University Medical Center Goettingen, 37075 Goettingen, drites (23). Because the kinetics of stimulus- sponse to AMPA (Fig. 2A) and NMDA (Fig. 2B)—
Germany. induced pHluorin-Syt3 endocytosis resembled stimuli that promote AMPA receptor internalization
‡Present address: Department of Environmental Health, School of those of pHluorin-GluA2 (24, 25), we hypothe- —with kinetics similar to those of pHluorin-tagged
Pharmacy, Tokyo University of Pharmacy and Life Sciences, Tokyo
192-0392 Japan. §Present address: Department of Neurobiology,
sized that Syt3 may regulate Ca2+- and activity- AMPA receptors (24, 25).
Weizmann Institute of Science, 7610001 Rehovot, Israel. dependent postsynaptic receptor endocytosis to Because interpretation of pHluorin experiments

Corresponding author. Email: c.dean@eni-g.de affect synaptic plasticity. may be confounded by intracellular acidification

Awasthi et al., Science 363, eaav1483 (2019) 4 January 2019 1 of 14


R ES E A RC H | R E S EA R C H A R T I C LE

A Wt KO Wt KO B Syt3 MAP2 merge


GFP-Syt3 after stimulation with AMPA and
NMDA compared with that in control conditions
Wt (Fig. 2C).
AMPA receptor endocytosis is thought to occur
70 kD-
at postsynaptic endocytic zones—marked by flu-
55 kD-
orescently tagged Clathrin light chain—which is
adjacent to, but distinct from, postsynaptic den-
25 kD- KO sities marked by fluorescently tagged Homer
(28–31). To visualize these markers exclusively at
postsynaptic sites, neuronal cultures were sparse-
Syt3 NB Syt3 NT
ly transfected so that dendrites of transfected
Tubulin neurons can be identified and fluorescent marker
C colocalization quantified at postsynaptic sites in
Syt3 MAP2 GFP these dendrites. We first verified that Clathrin and
Homer can be distinguished; only 4.4 ± 1.1% of
Clathrin light chain-DsRed and Homer-myc
puncta overlapped (Fig. 2D). We further found
that only 4.0 ± 1.3% of GFP-Syt3 puncta co-
localized with Homer-myc at postsynaptic den-
sities, whereas 84.0 ± 1.8% of GFP-Syt3 puncta in
dendrites colocalized with Clathrin-DsRed at en-

Downloaded from http://science.sciencemag.org/ on January 7, 2019


docytic zones (Fig. 2D).

Syt3 internalizes AMPA receptors


D Syt3 Syp PSD95 merge Does Syt3 endocytose receptors? As a first test,
we pulled down binding partners of Syt3 from
brain homogenates. Recombinant Syt3 pulled
down GluA2 but not other receptor subunits and
Syt3 Syp GluA1 merge also pulled down the endocytic proteins AP-2
(32) and BRAG2 (10)—two proteins implicated in
receptor endocytosis—but not GRIP or PICK1
(Fig. 2E and fig. S3), which bind distinct regions
E F
tr

tr
´
´
´
´
´

´
´
´
´
´ of the GluA2 C-terminal tail (Fig. 2F) (1). Syt3
no
10
20
30
60
90

no
10
20
30
60
90

Syp PSD95 bound GluA2 in a calcium-dependent manner


and bound AP-2 and BRAG2 in the absence of
protected Syn Homer calcium, and at concentrations up to 10 mM in
cleaved
the case of AP2 (Fig. 2G). Because the nine–
Syb2 GluA1 amino acid 3Y tail of GluA2 is important for
Rab3a/ Syn
GluN1 receptor internalization, we tested whether
Piccolo Syp Rab3a
Syb2 Syt3 interacts with this region. Incubation of
SNAP25 Syx Syt1 Nrx brain lysates with 1 mM Tat-GluA2-3Y peptide—
which competitively inhibits protein binding
SNAP25 Nlg
Nrx Nlg GluA1 to the GluA2 3Y region and blocks activity-
GluN1 Syt3 Syx1A Syt3 NB dependent endocytosis of receptors (10, 13)—
Homer
PSD95 indeed disrupted Syt3:GluA2 binding (Fig. 2H).
Piccolo Syt3 NT Because Syt3 pulled down GluA2 receptors,
and GluA1/GluA2 heteromers comprise the ma-
Fig. 1. Syt3 is postsynaptic. (A) Syt3 antibodies recognize a specific band of the expected jority of AMPA receptors in the hippocampus
molecular weight in wild-type (WT) but not in Syt3 knockout (KO) mouse brain homogenates in (33), we examined internalization of GluA1- and
Western blots. Syt3 NB is a monoclonal antibody from Neuromab, and Syt3 NT is a polyclonal GluA2-containing receptors in response to stim-
antibody developed by Synaptic Systems. Tubulin is a loading control. (B) Syt3 immunoreactivity is ulation (17, 32, 34) in dissociated hippocampal
detected on pyramidal cell bodies and dendrites in the CA1 region of hippocampal slices but not neurons in which Syt3 was overexpressed or
in Syt3 knockouts. MAP2 marks dendrites. Scale bar, 50 mm. (C) Syt3 is predominantly in dendrites knocked down postsynaptically, using sparse
in hippocampal neurons transfected with GFP and immunostained with MAP2 to mark dendrites transfection. Surface epitopes of GluA1 or GluA2
(MAP2-positive) or axons (GFP-positive/MAP2-negative) (n = 20 neurons/3 cultures). Scale bar, in hippocampal cultures were labeled with pri-
20 mm (left), 5 mm (right). (D) Syt3 localizes to synapses marked by synaptophysin and PSD95 (top) mary antibodies, followed by stimulation with
or GluA1 (bottom) in hippocampal cultures. Scale bar, 5 mm. (E) Schematic of a synaptosome. The AMPA or NMDA to promote receptor internal-
presynaptic side reseals, whereas the postsynaptic side does not, leaving postsynaptic proteins ization. Surface receptors were then labeled with
accessible to trypsin cleavage. (F) Presynaptic proteins are protected from trypsin cleavage, whereas a secondary antibody of one color and internal-
postsynaptic proteins (including Syt3) are cleaved. ized receptors labeled with a second color after
permeabilization, whereby the ratio of internal/
in response to AMPA and NMDA stimulation remaining surface GFP-Syt3 with a secondary surface signal reports the extent of receptor
(27), we performed an additional assay to test antibody of one color, permeabilized cells, and internalization. Overexpression of GFP-Syt3 in-
internalization of Syt3. We expressed GFP-Syt3 labeled internalized GFP-Syt3 with a secondary creased internalization of GluA1 and GluA2,
in Syt3 knockout neurons and labeled surface antibody of another color so as to quantify Syt3 whereas Syt3 knockdown or expression of a
GFP-Syt3 with an antibody to GFP, stimulated internalized in response to stimulation. We calcium-binding–deficient mutant of Syt3 abol-
neurons with AMPA or NMDA, and then labeled found a significant increase in internalized ished stimulation-induced internalization of

Awasthi et al., Science 363, eaav1483 (2019) 4 January 2019 2 of 14


R ES E A RC H | R E S EA R C H A R T I C LE

A B
0s 100 s 300 s 0s 100 s 300 s

NH4Cl NH4Cl NMDA


140 NH4Cl 140 AMPA 140 NMDA 140 NH4Cl
AMPA
intensity (%) 120 120 0 Ca2+ 2 mM Ca2+ 120 120 0 Ca2+ 2mM Ca2+

intensity (%)
intensity (%)

intensity (%)
100 100 100 100
80 80 80 80
60 60 60 60
40 40 40 40
20 20 20 20
0 50 100 0 50 100
0 time (s) 0 time (s)
0 100 200 300 0 100 200 300
time (s) time (s)

C internalized GFP-Syt3 surface GFP-Syt3 merge *


2.0 **
control

internal/ surface Syt3


1.5

Downloaded from http://science.sciencemag.org/ on January 7, 2019


AMPA

1.0

0.5
NMDA

0.0

AM trl
PA

A
D
c

M
N
D Homer-GFP / CLC-DsRed GFP-Syt3 / CLC-DsRed GFP-Syt3 / Homer-myc

Homer-GFP GFP-Syt3 GFP-Syt3

CLC-DsRed CLC-DsRed Homer-myc

E F
+


ut

t3

t3
inp

Sy

Sy

GluA1 AP-2 NSF BRAG2 GRIP and PICK1


GluA2 C-tail
GluA2
GluA3 —EFCYFSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI
834 883
GluN1
a 2+

GluN2A
G H
a 2+
µM +

C
00 a 2
0 a 2+

GABAARα1
µM
10 M C

.
EG rl.

10 C

trl
10 +
ct

0
.c
µM
a2
TA

10
t

pu
g.
pu

AP-2
C

ne
ne

in
in

GRIP GluA2 GluA2


Pick1 AP2 Tat-GluA2-3Y: – +
BRAG2 BRAG2

Fig. 2. Syt3 endocytoses in response to stimulation and binds GluA2, GFP-Syt3/CLC-Dsred; 34/18 GFP-Syt3/Homer-myc from three cultures).
AP-2, and BRAG2. (A) pHluorin-Syt3 endocytoses in response to Scale bars, 5 mm. (E) Recombinant Syt3 C2AB pulls down GluA2, AP2, and
stimulation with AMPA or NMDA (B) in 2 mM calcium (left), but not in the BRAG2 from brain homogenates. Syt3– is beads only. (F). Binding sites,
absence of calcium (right) [n; ROI/neurons/cultures, AMPA 2 mM Ca2+ 37/ on the GluA2 C-terminal tail, of proteins implicated in receptor recycling
7/3 (left); 0 and 2 mM Ca2+ 42/6/3 (right); NMDA, 2 mM Ca2+ 35/3/3 and tested in pull downs. (G) Calcium-dependence of Syt3 C2AB pull
(left); 0 and 2 mM Ca2+ 40/3/3 (right)]. NH4Cl dequenches internalized down of GluA2, AP2, and BRAG2 from brain homogenate. In 0 Ca2+
pHluorin-Syt3 fluorescence. Scale bars, 5 mm. (C) GFP-Syt3 expressed conditions, brains were homogenized and solubilized in calcium-free
in Syt3 knockout hippocampal neurons internalizes in response to buffer, but endogenous buffered calcium in internal stores remains.
stimulation with AMPA and NMDA (n = 28, 25, and 26 neurons per 2 Addition of EGTA eliminates any potential effects of these additional
cultures for control, AMPA, and NMDA, respectively; one-way ANOVA, sources of calcium. (H) Western blot of GluA2 pulled down from brain
Tukey’s test). (D) GFP-Syt3 colocalizes with CLC (clathrin light chain)– homogenate by Syt3 C2AB in 100 mM calcium with or without
Dsred at postsynaptic endocytic zones, and not with Homer-myc preincubation with 1 mM Tat-GluA2-3Y peptide. Negative controls are
at PSDs (n; ROI/neurons, 34/20 Homer-GFP/CLC-DsRed; 29/19 beads only.

Awasthi et al., Science 363, eaav1483 (2019) 4 January 2019 3 of 14


R ES E A RC H | R E S EA R C H A R T I C LE

receptors [Fig. 3, A to C, and fig. S4, A to D; Syt3 Syt3 does not affect basal transmission wild-type and Syt3 knockout cultures and again
short hairpin RNA (shRNA) knockdown valida- We found no change in miniature excitatory found no difference in mEPSC amplitude or
tion is provided in fig. S4, E and F]. Manipulation postsynaptic current (mEPSC) amplitude, fre- frequency (frequency P = 0.2671; t test, Welch’s
of Syt3 did not affect surface versus internal quency, or decay time in Syt3 overexpressing correction) (fig. S5, E to G). After stimulation,
receptors in basal conditions. Syt3 knockout or knockdown neurons compared with GFP- however, mEPSC amplitude decreased in wild-
neurons yielded similar results; GluA2 receptors transfected controls (decay time GFP, 2.3 ± 0.2 ms; type but not in Syt3 knockout neurons, and this
were internalized in response to AMPA and GFP-Syt3, 2.1 ± 0.2 ms; Syt3 KD, 1.9 ± 0.2 ms) effect was rescued by reintroducing GFP-Syt3
NMDA stimulation in wild-type neurons but (fig. S5, A to D), further confirming that post- postsynaptically into knockout neurons (fig. S5H),
not in Syt3 knockout neurons or in wild-type synaptic Syt3 does not affect surface receptor confirming a lack of stimulation-induced inter-
neurons treated with the Tat-GluA2-3Y peptide number in basal conditions. To exclude pre- nalization of synaptic AMPA receptors in Syt3
(Fig. 3, D and E, and fig. S4G). synaptic effects, we also compared mEPSCs in knockouts.

A control AMPA
GFP GFP-Syt3 Syt3 KD Syt3 Ca2+ mut GFP GFP-Syt3 Syt3 KD Syt3 Ca2+ mut
EGFP

Downloaded from http://science.sciencemag.org/ on January 7, 2019


surface
GluA2
internal
GluA2

B C *
* *** **
2.0 * 2.0 GFP
*** GFP-Syt3
internal / surface GluA2

internal / surface GluA1

** ** Syt3 KD
1.5 *** 1.5 *** Syt3 Ca2+ mut
* *
1.0 ** 1.0
**
0.5 0.5

0.0 0.0
control AMPA NMDA control AMPA NMDA

D control AMPA E *
2.0
WT Syt3 KO WT Syt3 KO WT+GluA2-3Y **
internal / surface GluA2

1.5
surface
GluA2

WT
Syt3 KO
WT+ 3Y
1.0
internal
GluA2

0.5

0.0
control AMPA NMDA

Fig. 3. Syt3 internalizes AMPA receptors in response to stimulation. 64/69 ctrl, 68/46 AMPA, 28/47 NMDA; GFP-Syt3, 46/65 ctrl, 46/47 AMPA,
(A) Hippocampal neurons transfected with GFP, GFP-Syt3, Syt3 knockdown 23/43 NMDA; Syt3 KD, 51/41 ctrl, 69/38 AMPA, 23/24 NMDA; Syt3 Ca2+ mut,
(Syt3 KD), or Syt3 calcium-binding deficient mutant (Syt3 Ca2+ mut) 42/37 ctrl, 28/36 AMPA, 27/31 NMDA from six cultures). (D and E)
constructs in control and AMPA-stimulated conditions, immunostained for Stimulation-induced GluA2 internalization is abolished in Syt3 knockout
surface and internalized GluA2 receptors. (B) Stimulation-induced GluA2 and neurons, and in WTneurons treated with the Tat-GluA2-3Y peptide (n; Syt3 KO/
GluA1 (C) internalization is increased by overexpression of GFP-Syt3 and WTneurons, 31/29 ctrl, 24/22 AMPA, 18/17 NMDA; WT+GluA2-3Y, 18 AMPA,
blocked by Syt3 KD or Syt3 Ca2+ mut (n; neurons for GluA2/GluA1; GFP, from four cultures). Scale bars, 10 mm; two-way ANOVA, Dunnett’s test.

Awasthi et al., Science 363, eaav1483 (2019) 4 January 2019 4 of 14


R ES E A RC H | R E S EA R C H A R T I C LE

Basal synaptic transmission was also unchanged increased potentiation in Syt3 knockouts com- When the platform was shifted to the opposite
in Syt3 knockouts. Recordings of synaptic re- pared with wild-type slices (Fig. 4G). quadrant in reversal training, Syt3 knockout
sponses from CA1 neurons, elicited by Schaffer To test whether calcium-sensing by post- mice learned the new platform position as well
collateral stimulation in acute hippocampal synaptic Syt3 is important for receptor internal- as did wild-type mice in the probe test (probe test
slices, displayed no change in NMDA/AMPA, ization in these plasticity paradigms, we injected 3) (Fig. 5, B, C, and D) but continued to persevere
g-aminobutyric acid (GABA)/AMPA, or GABA/ wild-type or calcium-binding–deficient mutant to the original platform position during reversal
NMDA receptor–mediated response ratio in Syt3 Syt3 AAV1/2 postsynaptically into the dorsal CA1 training (fig. S7G) and in the probe test after
knockout compared with wild-type neurons region of the hippocampus of mice in which Syt3 reversal (Fig. 5F), exhibiting a lack of forgetting
(fig. S5, I to L). There was also no change in the had been knocked out (Syt3 knockout mice) of the previous platform position.
AMPA EPSC decay time (wild type, 19.4 ± 4 ms; (Fig. 4H). We found that LTD (Fig. 4I), decaying In a fourth cohort, we extended the training
knockout, 21.9 ± 4.6 ms) or GABA inhibitory 1XTET-induced LTP (Fig. 4J), and ZIP-mediated days after reversal (fig. S7H). Syt3 knockout mice
postsynaptic current (IPSC) decay time (wild type, decay of 3XTET LTP (Fig. 4K) were rescued by persevered to the previous platform position sig-
76 ± 4.9 ms; knockout, 58.8 ± 7 ms). In addition, expression of wild-type Syt3 but not calcium- nificantly more than did wild-type mice, even
we found no change in stimulus intensity versus binding–deficient Syt3. after 7 days of reversal training (Fig. 5G). Injec-
fEPSP (field excitatory postsynaptic potential) tion of Syt3 AAV1/2 specifically into the dorsal
slope or fiber volley amplitude (fig. S5, M and Syt3 knockout mice learn normally but CA1 (postsynaptic) region of the hippocampus
N) and no change in paired pulse ratio (fig. S5O), have impaired forgetting of Syt3 knockout mice rescued this perseverence
suggesting that Syt3 does not affect the number Because Syt3 knockout mice had normal LTP but phenotype, compared with Syt3 knockout or wild-
of synaptic inputs from CA3 onto CA1 neurons or lacked LTD, we hypothesized that they would type mice injected with control GFP AAV1/2
short-term presynaptic plasticity. learn normally but have deficits in forgetting. To (Fig. 5G).
test this, we used the water maze spatial memory To test whether the lack of forgetting exhibited

Downloaded from http://science.sciencemag.org/ on January 7, 2019


Syt3 promotes LTD and decay of LTP task that involves the CA1 hippocampal sub- by Syt3 knockouts is due to defective AMPA re-
LTD—which requires activity-dependent endo- region, in which mice learn to navigate to a hid- ceptor internalization, we trained wild-type and
cytosis of AMPA receptors—was abolished in Syt3 den platform position over sequential days of Syt3 knockout mice to learn a platform position
knockouts (Fig. 4A), which is consistent with training using visual cues. Syt3 knockout mice in the water maze, during habituation to daily
defective activity-dependent AMPA receptor en- showed no difference in anxiety or hyperactivity saline intraperitoneal injections (fig. S7I). We then
docytosis in the absence of Syt3. In wild-type (fig. S7, A to C) but had a 15% decrease in body injected the Tat-GluA2-3Y peptide (5 mmol/kg,
slices, application of the GluA2-3Y peptide, which weight and faster swim speed compared with intraperitoneally)—which disrupts Syt3:GluA2
disrupts Syt3 binding to the GluA2 cytoplasmic those of wild-type mice (fig. S7, D and E). We binding and blocks AMPA receptor internal-
tail, mimicked the Syt3 phenotype and abolished therefore plotted proximity to the platform in ization (11–13, 35)—1 hour before the probe test
LTD (Fig. 4A) (8, 11, 35). addition to the traditional escape latency after training to the initial platform position,
The decay of LTP induced by means of a parameter to control for possible effects of and then daily, 1 hour before reversal training
1XTET stimulation (a single tetanus of 16 pulses swim speed. The maximum average proximity to a new platform position in the opposite qua-
at 100 Hz) also depends on receptor internal- difference—between closest (after training of all drant. In the probe test after training to the
ization (13). LTP induced by means of a 1XTET mice to a platform position) and farthest possible initial platform position, peptide-injected wild-
stimulus decayed within 1 hour in wild-type proximity (by using the same data but calculat- type and Syt3 knockout mice showed a similar
slices (36) but was reinforced and remained po- ing proximity to a platform in the opposite lack of within-trial extinction and continued
tentiated in Syt3 knockouts (Fig. 4B); this form quadrant)—was 12.5 cm. Syt3 knockout and wild- to persevere to the platform position, whereas
of LTP was NMDA receptor–dependent in both type mice learned the position of the hidden saline-injected wild-type mice shifted to a dis-
wild-type and Syt3 knockout slices (fig. S6, A platform equally well; there was no significant persed search pattern near the end of the trial
and B). The GluA2-3Y peptide again mimicked difference in proximity to the platform (Fig. 5A) (Fig. 5H and fig. S7J). Similarly, in probe tests
the Syt3 knockout phenotype and reinforced or escape latency (fig. S7F) during training. When after reversal training to a new platform position,
decaying LTP (Fig. 4C). This reinforced decay- the platform was removed in probe tests after wild-type mice injected with the Tat-GluA2-3Y
ing LTP was insensitive to ZIP (PKMz inhib- training, to test how well the mice have learned peptide persevered to the original platform posi-
itory peptide) (Fig. 4C), which blocks the activity the platform position, the percentage of time tion significantly more than did saline-injected
of atypical protein kinases and has the unusual spent in the target quadrant was well above wild-type mice [P = 0.042; one-way analysis of
property of reversing LTP after induction, through chance level for both Syt3 knockout and wild- variance (ANOVA), Bonferroni’s correction] or
endocytosis of AMPA receptors (12, 13, 37, 38). type mice (Fig. 5B), and proximity to the plat- uninjected wild-type mice in previous cohorts
Reinforced decaying LTP in Syt3 knockouts was form position (Fig. 5C) and platform position (P = 0.039) and to a similar extent as did Tat-
similarly ZIP-insensitive (Fig. 4D). The GluA2-3Y crossings (Fig. 5D) were similar. Syt3 knockout GluA2-3Y peptide–injected Syt3 knockout mice
peptide had no effect on the reinforced decaying mice in cohort 1 (of two cohorts tested) had sig- (P = 0.096) or uninjected Syt3 knockout mice
LTP in Syt3 knockouts, confirming that Syt3 nificantly lower proximities and more platform in previous cohorts (P = 0.105) (Fig. 5I). Thus,
decays LTP by acting on the GluA2-3Y region crossings in the first probe test compared with Tat-GluA2-3Y peptide injection mimics the Syt3
(Fig. 4D). those of wild-type mice but no difference in the knockout phenotype. There was no difference
Nondecaying LTP, induced by means of 3XTET second probe test. Thus, Syt3 knockout mice in perseverence between Tat-GluA2-3Y–injected
stimulation (three tetanizing trains of 100 pulses learned the task as well or slightly faster than did and uninjected Syt3 knockouts in previous co-
at 100 Hz), was unchanged in Syt3 knockout wild-type mice. horts (P = 0.184), indicating that the effect of
hippocampal slices compared with wild-type We observed an indication of a lack of forget- Tat-GluA2-3Y peptide injection is occluded in
slices (Fig. 4E). However, ZIP promoted decay ting in the second probe test after learning. Syt3 Syt3 knockout mice.
of 3XTET-induced LTP in wild-type slices but knockout mice exhibited a lack of “within-trial” To further test whether the lack of forgetting
not in Syt3 knockout slices (Fig. 4F), further extinction. Wild-type mice showed maximal phenotype of Syt3 knockouts is due to a lack of
indicating a defect in activity-dependent recep- searching (proximity to the platform) in the first receptor internalization via Syt3:GluA2 interac-
tor internalization in Syt3 knockouts. Because 10 to 20 s of the probe test and then gradually tion, we tested spatial memory in the Barnes
ZIP had no effect on LTP in Syt3 knockout shifted to a dispersed search pattern of other maze, in which mice learn to navigate to 1 of 20
slices, it did not appear to cause excitotoxicity regions of the pool (41), whereas Syt3 knockout holes around the perimeter of a circular platform
or neural silencing (39, 40). Analysis of stimula- mice continued to persevere to the platform leading to an escape cage, using visual cues. Time
tion frequency–potentiation dependence revealed position even near the end of the trial (Fig. 5E). spent in the target hole area during training and

Awasthi et al., Science 363, eaav1483 (2019) 4 January 2019 5 of 14


R ES E A RC H | R E S EA R C H A R T I C LE

Fig. 4. LTD and decay of LTP is abolished in


A B
Syt3 knockouts. (A) LTD is abolished in Syt3 5 mV
5 ms
125 5 mV
150
KO, and Tat-GluA2-3Y peptide treated WT 5 ms

fEPSP (mV/ms) %
hippocampal slices (n; slices/mice, 12/8 Syt3

fEPSP (mV/ms) %
KO, 8/6 WT, and 8/5 WT + Tat-GluA2-3Y); 100 125
***P < 0.001 for Syt3 KO/WT; **P < 0.05 for WT
+GluA2-3Y/WT. (B) 1XTET-induced LTP is rein- 75 100
forced in Syt3 KO slices compared with WT
(n = 10/7 Syt3 KO, 10/10 WT); **P < 0.05. 50 Syt3 KO 75 Syt3 KO
1 µM GluA2-3Y WT
(C) 1XTET-induced LTP in WT slices treated with WT
WT + GluA2-3Y
the Tat-GluA2-3Y peptide is reinforced and 25 50
-20 0 20 40 60 80 -30 0 30 60 90 120
ZIP-insensitive (n = 7/7). (D) Reinforced 1XTET- time (min) time (min)
induced LTP in Syt3 KOs is unchanged by the C D
Tat-GluA2-3Y peptide and is ZIP-insensitive 5 mV
5 mV 5 ms
(n = 6/6 Syt3 KO, 7/7 Syt3 KO + GluA2-3Y 1 µM ZIP
200 5 ms 150
peptide, 7/7 Syt3 KO + ZIP). (E) 3XTET-induced 1 µM ZIP

fEPSP (mV/ms) %
175
fEPSP (mV/ms) %
LTP is unchanged in Syt3 KO compared with 125
WT (n = 6/6). (F) 3XTET-induced LTP in Syt3 150
KOs is ZIP-insensitive (n = 6/6); **P < 0.01. 125 100
(G) fEPSP changes in Syt3 KO and WT slices
100 1 µM GluA2-3Y Syt3 KO
induced by different stimulation frequencies, 75
WT + GluA2-3Y Syt3 KO + GluA2-3Y

Downloaded from http://science.sciencemag.org/ on January 7, 2019


recorded 30 min after stimulation [Syt3 KO/WT, 75 1 µM GluA2-3Y
WT + GluA2-3Y + ZIP Syt3 KO + ZIP
n = 9/12 (0.2 Hz), 9/12 (1 Hz), 12/7 (10 Hz), 50 50
and 14/14 (100 Hz)]. (H) GFP fluorescence in a -30 0 60 120 180 240 -30 0 60 120 180 240
hippocampal slice from a mouse injected with time (min) time (min)
AAV1/2 Syt3-P2A-GFP in the dorsal CA1 region. E F
(I) LTD in Syt3 KOs is rescued by hippocampal 200 5 mV 200 5 mV
5 ms 5 ms
CA1 AAV1/2 injection of WT Syt3 (n = 13/11) 1 µM ZIP

fEPSP (mV/ms) %
175 175
fEPSP (mV/ms) %

but not calcium-binding deficient Syt3 (Ca2+ mut)


150 150
(n = 8/6); **P < 0.01. (J) Decay of 1XTET-induced
LTP in Syt3 KOs is rescued by WT (n = 8/6) 125 125
but not Ca2+ mut Syt3 (n = 7/6 mice); **P<0.01. 100 100
(K) ZIP-mediated decay of 3XTET-induced LTP Syt3 KO Syt3 KO + ZIP
75 75
in Syt3 KOs is rescued by WT (n = 5/5) but WT WT + ZIP
not Ca2+ mut Syt3 (n = 6/6); *P < 0.05; 50 50
0 60 120 180 240 0 60 120 180 240
Mann-Whitney U test or Kruskal-Wallis test time (min) time (min)
with Dunn’s test for multiple comparisons;
G 160 I
n = slices/mice. Syt3 KO H 125
fEPSP (mV/ms) %
fEPSP (mV/ms) %

WT
140 ** 5 mV
AAV-Syt3-P2A-GFP 5 ms

120 CA1
100

100 *** CA3 DG


75
80
Syt3 KO + WT Syt3
60 Syt3 KO + Ca2+ mut Syt3
50
0.2 1 10 100 -20 0 20 40 60 80
frequency (Hz) time (min)
J 5 mV
K
5 ms 5 mV
150 200 5 ms

1 µM ZIP
fEPSP (mV/ms) %

175
fEPSP (mV/ms) %

125
150
100 125
100
75 Syt3 KO + WT Syt3
75 Syt3 KO + WT Syt3
Syt3 KO + Ca2+ mut Syt3 Syt3 KO + Ca2+ mut Syt3
50 50
-20 0 20 40 60 80 100 120 0 60 120 180 240
time (min) time (min)

in subsequent probe tests gives a readout of that (i) Syt3 knockout mice would exhibit a lack type of Syt3 knockouts; and (iii) injection of the
spatial memory. We tested four groups simulta- of forgetting—persevere more to the original GluA2-3Y peptide in Syt3 knockout mice would
neously: wild-type mice and Syt3 knockout mice, hole after reversal as compared with wild-type; have no effect on their lack of forgetting.
injected with saline or GluA2-3Y peptide, during (ii) disruption of Syt3:GluA2 interaction through In initial training, all four groups (injected
“reversal” training to a new hole after initial injection of the GluA2-3Y peptide in wild-type intraperitoneally daily with saline only, 1 hour
learning of an original hole position. We predicted mice would mimic the lack of forgetting pheno- before training) learned the target hole equally

Awasthi et al., Science 363, eaav1483 (2019) 4 January 2019 6 of 14


R ES E A RC H | R E S EA R C H A R T I C LE

A B C D

proximity to platform (cm)


Rev.

proximity to platform (cm)


50 WT 90 60 20 WT cohort 1
KO

% time target quadrant


Syt3 KO 80
* 18

platform crossings
45 70 50 16
WT cohort 2
* 14
KO

PT1

PT2
60

PT3
40
40 50 12
40 30 10
35 8
30 20 6
30 20
10 4
10 2
25 0 0 0
PT1 PT2 PT3 PT1 PT2 PT3 PT1 PT2 PT3
1
2
3
4
5
6
7
8
9
10
11
12
13
14
Days
E F
PT2:0-10s 10-20s 20-30s 30-40s 40-50s 50-60s 0-60s WT PT3 WT

proximity to platform (cm)


50 KO 50 KO

original platform (cm)


** **
WT

WT
45

proximity to
40
Syt3 KO

Syt3 KO
40

30
35

20 30

s
0

Downloaded from http://science.sciencemag.org/ on January 7, 2019


-2

-6
10

50
G H I
Day 22 Syt3 KO + GFP PT2:10-20s 50-60s 0-60s WT + sal. PT5 WT + sal.

KO + 3Y WT + 3Y WT+ sal.
WT + 3Y WT + 3Y
KO + 3Y WT + 3Y WT+ sal.

WT + GFP
KO + 3Y KO + 3Y
WT

Syt3 KO + Syt3
**
proximity to original platform (cm)

proximity to original platform (cm)


** * ** *
45
* ** ** 55 * 55 50

proximity to platform (cm)


* ** ** * *
rescue Syt3 KO

% time original TQ
40 50
*
***
45
45
40

35 30
35 40
30
20
35
25 25
30 10
20
15 25 0
s

s
17
18
19
20
21
22
23

60
-2

Days
10

50

J WT + sal. Rev. K WT+sal. WT + 3Y KO+sal. KO + 3Y L WT + sal.


WT + 3Y WT + 3Y
latency to current hole (s)

PT1-2

KO + sal.
100 KO + sal.
KO + 3Y
* KO + 3Y
0.8 * 0.8 *
Day 8-13 perseverence

75
** *
PT4-6 perseverence
Day 8-13

50 0.6 0.6

25 0.4 0.4
PT4-6

0
0.2 0.2
1
2
3
PT1
4
5
6
7
PT2
8
9
10
11
PT3
12
13
PT4
PT5
PT6

Days 0.0 0.0

Fig. 5. Syt3 knockout mice learn as well as wild-type mice but have KO+GFP, and 15 WT+GFP). (H) Injection of the Tat-GluA2-3Y peptide mimics
impaired forgetting. (A) Syt3 KO and WT mice had similar proximity to the the lack of within-trial-extinction in probe test 2 after initial training, and
platform during training (genotype effect, P = 0.1052; two-way ANOVA, (I) perseverence to the previous platform position in probe tests after reversal
Bonferroni’s test) and in probe tests exhibited similar percent of time in training, exhibited by Syt3 knockouts (n = 8 WT saline, 7 WT+3Y, and 10 Syt3
(B) target quadrant, (C) proximity to platform, and (D) platform crossings. KOs KO+3Y); one-way ANOVA, Bonferroni’s correction. (J) All mice learned
in cohort 1 had lower proximities than those of WT in probe tests (P = 0.027; (decreased latency to) the escape hole in the Barnes maze equally well during
Student’s t test). (E) Syt3 KO mice lack within-trial-extinction in time-binned training (two-way ANOVA, Tukey’s test) and (K) (top) in probe tests 1 and 2
average occupancy plots of all mice and proximity to the platform position after training. (Middle) In reversal training and (bottom) probe tests 4 to 6 after
(red in schematics) in probe test 2. (F) Syt3 KO mice persevere to the previous reversal training, WT saline mice learned the new hole position (red), but
platform position (orange) in the probe test after reversal training (to the WT+3Y, KO saline, and KO+3Y mice persevered to the previous hole position
red platform position) (n = 9/13 Syt3 KO and 10/14 WT mice for cohort (orange). (L) WT+3Y, KO saline, and KO+3Y mice had a higher perseverence
1/cohort 2); Student’s t test, Welch’s correction in (B), (C), (E), and (F) and ratio [time spent exploring original hole (orange) divided by total time spent
Mann-Whitney U test in (D). (G) Expression of Syt3 in the hippocampal exploring original and reversal (red) holes] as compared with that of WT
CA1 region rescues the perseverence phenotype of Syt3 KOs in training after saline mice (n = 10 WT saline, 11 WT+3Y, 11 Syt3 KO saline, 12 Syt3 KO+3Y;
reversal; two-way ANOVA, Tukey’s test. Black, red, and blue asterisks are P = 0.060 for WT saline/Syt3 KO+3Y in probe tests 4 to 6); one-way ANOVA,
significance between WT+GFP/Syt3 KO+Syt3, Syt3 KO+GFP/WT+GFP, and Bonferroni’s correction. All occupancy plots show average search path
Syt3 KO+GFP/Syt3 KO+Syt3, respectively (n = 10 Syt3 KO+Syt3, 7 Syt3 densities across all mice in a group.

Awasthi et al., Science 363, eaav1483 (2019) 4 January 2019 7 of 14


R ES E A RC H | R E S EA R C H A R T I C LE

well (Fig. 5J) and spent the majority of their time original hole region as compared with wild-type memory in the delayed matching to place (DMP)
exploring the target hole region in probe tests saline-injected mice throughout reversal training water maze task, in which the platform position
(Fig. 5K, top). Beginning on the day of probe test (Fig. 5K, middle) and in probe tests after reversal is moved to a new position each day (42). Each
2 and during reversal training, in which the training (Fig. 5, K, bottom, and L), which is in day, the mice have four trials to learn the new
target hole was positioned in a different quad- agreement with our prediction. platform position and forget the previous plat-
rant, mice were injected with saline or GluA2-3Y form position. We first trained the mice to a
peptide 1 hour before training each day. Saline- Syt3 knockouts have impaired working visible platform for 3 consecutive days, in which
injected Syt3 knockout mice and GluA2-3Y- memory owing to lack of forgetting Syt3 knockout and wild-type mice performed
injected wild-type and Syt3 knockout mice all To further test deficits in forgetting exhibited equally well (fig. S8A). Because swimming speed
showed a similar increased perseverence to the by Syt3 knockout mice, we examined working of Syt3 knockout mice was again faster than that

A Block 1 Block 2 Block 3 Block 4 trial 2


inter-trial interval = 5 min inter-trial interval = 75 min probe test

Day 1 Day 2 Day 3 Day 4 Day 5 Day 6 Day 7 Day 8 Day 9 Day 10 Day 11 Day 12 Day 13 Day 14 Day 15 Day 16
proximity savings (cm)

proximity savings (cm)

proximity savings (cm)

proximity savings (cm)


10 20 20 14
8
WT WT * WT ** 12
WT *
KO 15 KO 15 KO ** KO **
6 10
** 8 **
4 10 10
6
2 **

Downloaded from http://science.sciencemag.org/ on January 7, 2019


5 4
0 5
2
-2 0 0
0
1 2 3 4 1 2 3 4 1 2 3 4 1 2 3 4
Trial Trial Trial Trial

B WT Syt3 KO C
Day 4

40
% Trials classified as perseverance
to previous day’s platform position

WT
Syt3 KO

30
Day 6

20
Day 9

10

0
Day 14

10
11
12
13
14
15
16
1
2
3
4
5
6
7
8
9
V1
V2
V3

Training Day
D
WT
Day 16

Syt3 KO
Training Day
proximity norm.

V1
V2
V3

10
11
12
13
14
15
16
1
2
3
4
5
6
7
8
9
to WT (cm)
Probe test

0
-2
-4 * * * *
-6
Fig. 6. Syt3 knockout mice show deficits in the delayed matching to trials averaged across all mice on training days, and in the probe test after
place task because of impaired forgetting. (A) WT mice had a closer training, reveal impaired forgetting in Syt3 KO mice—higher perseverence to
proximity to the platform in trials 2 to 4 relative to trial 1 (higher proximity previous days’ platform positions as compared with that of WT. In maze
savings) as compared with that of Syt3 KO mice, indicating that Syt3 KOs had schematics, the current day’s platform is red, the previous day’s is orange, and
deficits in finding the platform when it appeared in a new position each day. the platform position 2 days previous is yellow. (C) Syt3 KOs have significantly
Hidden platform positions presented each day are indicated above the graphs. more perseverence trials compared with those of WT in strategy analysis (P =
Blue-outlined mazes indicate counter-balancing, in which half the cohort is 0.0383; unpaired t test, Welch’s correction). (D) In the probe test on day 16,
trained to one of the positions and the other half is trained to the other Syt3 KO mice persevere more (have closer proximity as compared with WT) to
position, to avoid biased search of inner- or outer-platform positions (n = 14 all previous positions. V1, V2, and V3 indicate visible platform training days;
Syt3 KO and 20 WT mice); Student’s t test. (B) Occupancy plots of individual two-way ANOVA for genotype effect, P < 0.0001; Bonferroni’s test, *P < 0.05.

Awasthi et al., Science 363, eaav1483 (2019) 4 January 2019 8 of 14


R ES E A RC H | R E S EA R C H A R T I C LE

of wild-type mice (fig. S8B), we quantified prox- PICK1 could sequester receptors internally after formaldehyde and immunostained with primary
imity savings in hidden platform training endocytosis (44) and act downstream of Syt3. antibodies, followed by secondary labeling with
(Fig. 6A). In the first 4 days of training, mice Alternatively, PICK1 could transiently bind GluA2 Alexa dyes for confocal imaging.
became accustomed to the task. In the second and then AP-2 after stimulation, to cluster AMPA Hippocampi from P0 mouse brains were dis-
4-day block, mice had learned the task, and wild- receptors at endocytic zones and promote their sected in ice cold dissection medium (HBSS (Gibco),
type mice performed significantly better than subsequent internalization (45). Thus, it is also 20 mM HEPES (Gibco), 1.5 mM CaCl2, 10 mM
Syt3 knockouts. In the third block, from day 10 possible that PICK1 acts upstream of or in concert MgCl2, pH adjusted to 7.4 with NaOH) and
onward, the intertrial interval between trial 1 and with Syt3 to bring GluA2 to endocytic zones. then incubated in a papain digestion solution
trial 2 was increased from 5 to 75 min, and wild- Blockade of postsynaptic expression of Syt1/ (dissection medium, 0.2 mg/ml L-Cysteine, 0.5 mM
type mice continued to perform better than Syt3 Syt7 was recently reported to abolish LTP but NaEDTA, 1 mM CaCl2, 3 mM NaOH, 1% Papain
knockout mice; this difference was most pro- have no effect on LTD (18). Thus, distinct Syts equilibriated in 37°C and 5% CO2 + 0.1 mg/ml
nounced in the fourth 4-day block of training may insert and remove receptors from the post- DNAseI) for 30 min at 37°C and 5% CO2. Papain
(Fig. 6A). Quantitation of escape latency savings synaptic membrane to mediate LTP and LTD, was inactivated with serum medium [DMEM,
(fig. S8D) and path savings (fig. S8E) yielded respectively. Syts may regulate both exo- and 2 mM Glutamax, 5% FBS, 1X Mito+ supplements
similar results. To test whether the poor perform- endocytosis (46) but be predisposed to one or (VWR), 0.5X MEM vitamins (Gibco)] + 2.5 mg/ml
ance of Syt3 knockouts was due to difficulty the other depending on their calcium affinity. BSA + 0.1 mg/ml DNAseI, followed by 3 washes
forgetting previous platform positions, we exam- Endocytosis occurs on slower time scales than with serum medium. After trituration in serum
ined perseverance to previous positions. Occu- does exocytosis. As calcium concentration de- medium, the cell suspension was centrifuged for
pancy plots indicated that Syt3 knockouts indeed clines, high-affinity Syts such as Syt3 (22) may 5 min at 500 × g at room temperature. The cell pellet
persevered to previous platform positions more remain active, whereas low-affinity Syts such was resuspended in plating medium (Neurobasal
than did wild-type mice throughout training and as Syt1 inactivate. Alternatively, Syts predisposed medium, 100 U/ml Pen/Strep, 2% B27, 0.049 mM

Downloaded from http://science.sciencemag.org/ on January 7, 2019


sampled most previous platform positions in the to endocytosis may interact with protein com- L-aspartate, 0.05 mM L-glutamate, 2 mM Gluta-
probe test, whereas wild-type mice adopted a more plexes that extend association with Ca2+ or bind max, 10% serum medium). Cells were plated at
random search pattern (Fig. 6B). Syt3 knockout proteins in resting conditions that are released 60,000 cells/cm2 on 12 mm diameter acid-etched
mice had significantly more trials classified as upon Ca2+ binding to cause endocytosis. glass coverslips coated with 0.04% Polyethylenei-
perseverence (43) to the previous day’s platform Although the ability to remember is often mine (PEI; Sigma). Glial growth was blocked on
position as compared with wild-type mice across regarded as the most important aspect of mem- DIV4 with 200 mM FUDR. 50% conditioned
all days of training (P = 0.0383, unpaired t test, ory, forgetting is equally important. Deficits in medium was replaced with feeding medium
Welch’s correction) (Fig. 6C). Neither Syt3 knockout forgetting can have severe consequences and lead (Neurobasal, 2 mM Glutamax, 100 U/ml Pen/
nor wild-type mice exhibited chaining (43), a to posttraumatic stress disorder, for example. Our Strep, 2% B-27) on DIV7.
nonspatial search strategy for platform positions data identify Syt3 as a molecule important for a For transfection of neurons on 12 mm cover-
at two fixed distances from the wall (fig. S8C). forgetting mechanism by which AMPA receptors slips in 24-well plates, the culture medium from
Syt3 knockout mice also had a significantly are internalized to promote LTD and decay of LTP. each well was exchanged with 400 ml Neurobasal
closer proximity to all previous platform posi- medium; the original culture medium was stored
tions in the probe test at the end of the 16-day Materials and methods at 37°C and 5% CO2. 1 mg DNA/50 ml Neurobasal
training period, compared with that of wild-type Animals medium and 1 ml Lipofectamine 2000 (Gibco)/
mice (Fig. 6D). Use of mice for experimentation was approved 50 ml Neurobasal medium were incubated sepa-
and performed according to the specifications of rately for 5 min, mixed, and incubated for 20
Discussion the Institutional Animal Care and Ethics Com- additional min, before adding the mixture to
We found that activity-dependent AMPA recep- mittees of Göttingen University (T10.31), and neurons in a well. Following incubation for
tor internalization, LTD, decay of LTP, and for- German animal welfare laws. Animal sample size 2 hours, neurons were washed once with Neuro-
getting of spatial memories requires Syt3. In was estimated by experimental literature and basal, and conditioned media was replaced.
rescue experiments, calcium-sensing by post- power analysis (G* Power version 3.1) to reduce
synaptic Syt3 was required for LTD and the animal number where possible while maintaining HEK cell culture, transfection,
decay of LTP. The GluA2-3Y peptide competi- statistical power. The Syt3 and Syt6 knock-out and immunostaining, and Western blots for
tively inhibited Syt3 binding to the 3Y region of Syt5 and Syt10 knock-in quadruple targeted muta- Syt3 knockdown validation
the GluA2 receptor tail. Introduction of this tion mice (B6;129-Syt6tm1Sud Syt5tm1Sud Syt3tm1Sud Human embryonic kidney (HEK) 293 cells (pur-
peptide in a wild-type background mimicked the Syt10tm1Sud/J, stock no. 008413) were obtained from chased from American Type Culture Collection
Syt3 knockout phenotypes of lack of activity- The Jackson Laboratory (www.jax.org/strain/008413). CRL-3216; not tested for mycoplasma) cultured
dependent AMPA receptor internalization, LTD, These mice were then crossed with Black6/J in DMEM supplemented with 10% FBS on 10 cm
decay of LTP, and forgetting. Effects of the pep- mice, obtained from Charles River, to isolate mice dishes were transfected at 60 to 80% confluence
tide were occluded in Syt3 knockout mice, with homozygous knock-out alleles of Syt3 but using the calcium-phosphate method: 20 mg plas-
implicating Syt3 in a GluA2-3Y–dependent mech- WT alleles of Syt5, Syt6 and Syt10. The genotypes mid DNA in 360 ml dH2O was mixed with 40 ml
anism of AMPA receptor internalization. of all breeder pairs and mice used for behavioral 2.5 M CaCl2, followed by addition of an equal
Our data give rise to a model in which Syt3 at experiments were confirmed by PCR. volume (400 ml) of transfection buffer (280 mM
postsynaptic endocytic zones is bound to AP-2 NaCl, 1.5 mM Na2HPO4, 50 mM HEPES, pH 7.05).
and BRAG2 in the absence of calcium. GluA2 Dissociated hippocampal culture and This mixture was incubated at room temper-
could then accumulate at endocytic zones by neuronal transfection ature for 20 min and 800 ml added per dish. 24 to
binding Syt3 in response to increased calcium Rat hippocampi were isolated from E18-19 Wistar 48 hours later cells were harvested for Western
during neuronal activity. This would potentially rats as described previously (47). Hippocampi blots in lysis buffer (50 mM Tris-HCl pH 7.5,
bring GluA2 into close proximity to BRAG2, were treated with trypsin (Sigma) for 20 min at 150 mM NaCl, 2 mM EDTA, 0.5% NP40, and
where a transient interaction could activate 37°C, triturated to dissociate cells, plated at protease inhibitors). For immunostaining, HEK cells
BRAG2 and Arf6, and promote endocytosis of 40,000 cells/cm2 on poly-D-lysine (Sigma)–coated growing on 12 mm coverslips were transfected
receptors via clathrin and AP-2 (10, 32). PICK1 is coverslips (Carolina Biologicals), and cultured in with Lipofectamine 2000 (Invitrogen) by incu-
also important for AMPA receptor endocytosis, Neurobasal medium supplemented with 2% B-27 bating 1 mg DNA/50 ml medium and 1 ml Lipo-
raising the question of the interplay of Syt3 and and 2 mM Glutamax (Gibco/Invitrogen). Cul- fectamine 2000/50 ml medium separately for
PICK1. Two possible mechanisms are conceivable. tures were fixed at 12 to 18 DIV with 4% para- 5 min, mixing the two solutions together, and

Awasthi et al., Science 363, eaav1483 (2019) 4 January 2019 9 of 14


R ES E A RC H | R E S EA R C H A R T I C LE

then incubating for an additional 20 min, before Daniel Choquet (30) (University of Bordeaux). pH 7.4 with NaOH) with 10 strokes at 900 rpm.
adding the mixture to wells of a 24-well plate. The calcium-binding deficient mutant of Syt3 was Samples were then centrifuged at 1000 × g for
generated by Genscript by mutagenesis of D386, 10 min. The supernatant (S1) was collected; the
Immunohistochemistry 388N and D520, 522 N, corresponding to the resulting pellet (P1) contains large cell frag-
Acute hippocampal slices were prepared from calcium-binding sites of syt1: D230, 232 N and ments and nuclei. S1 was then centrifuged at
8-week-old mice anesthetized with isoflurane D363, 365 N (48). Syt3 shRNA knockdown con- 15,000 × g for 15 min. The supernatant (S2) con-
and decapitated. The hippocampus was removed structs, transfected in equal amounts, were KD1; tains soluble proteins and the pellet (P2) contains
and 200 mm thick slices were cut transversely TGCTGTTGACAGTGAGCGACAAGCTCATCGGT- synaptosomes. The pellet was then carefully
using a tissue chopper (Stoelting) in ice-cold CAGATCAATAGTGAAGCCACAGATGTATTGAT- resuspended in 1 ml homogenization buffer, 9 ml
artificial cerebrospinal fluid (ACSF) containing, CTGACCGATGAGCTTGGTGCCTACTGCCTCGGA, ice-cold ddH20 was added and three strokes at
in mM 124 NaCl, 4.9 KCl, 1.2 KH2PO4, 2 MgSO4, KD2; TGCTGTTGACAGTGAGCGCAGGTGTCAA- 2,000 rpm were performed. 50 ml 1M HEPES and
2 CaCl2, 24.6 NaHCO3, and 10 D-glucose (saturated GAGTTCAACGAATAGTGAAGCCACAGATGTA- protease inhibitors were added. The lysate was
with 95% O2 and 5% CO2, pH 7.4, ~305 mOsm). TTCGTTGAACTCTTGACACCTATGCCTACTGC- centrifuged at 17,000 × g for 25 min to separate
Slices were fixed in 4% paraformaldehyde in PBS CTCGGA and KD3; TGCTGTGACAGTGAGCCAG synaptosomal membranes (LP2) from synapto-
for 30 min and washed 3 X 20 min in PBS. After GATTGTCAGAGAAAGAGAATAGTGAAGCCACA- somal cytosol (LS2). The LP2 pellet was resus-
washing, slices were incubated in antibody buffer GATGTATTCTCTTTCTCTGACAATCCTTTGCC- pended in 6 ml 40 mM sucrose and layered over a
(2% donkey serum, 0.1% Triton X-100 and 0.05% TACTGCCTCGGA in a pGIPZ vector co-expressing continuous sucrose gradient from 50 mM to
NaN3 in PBS) for 30 min at room temperature. turboGFP (Thermo Scientific Openbiosystems). 800 mM. The sucrose cushion was then centri-
Then slices were incubated with primary anti- fuged at 28,000 rpm for 2 hours. Following centri-
bodies in antibody buffer overnight at 4°C. Slices Receptor internalization assays fugation, the region between approximately
were then washed with PBS 3 X 20 min and Neurons were labeled with primary extracellular 200 mM and 400 mM sucrose was collected

Downloaded from http://science.sciencemag.org/ on January 7, 2019


incubated with fluorescently tagged secondary antibodies against GluA1 (rabbit PC246 Calbio- and separated by chromatography on controlled-
antibodies for 2 hours at room temperature. Slices chem) or GluA2 (mouse MAB397 Millipore) in pore glass beads (CPG column) and run overnight.
were washed 3 X 20 min in PBS and mounted on medium for 15 min at 37°C and 5% CO2, washed The first peak (PI) contained larger membrane
microscope slides with Fluoromount-G (Sigma) for 2 min in medium, and then stimulated with fragments and SVs were found in the second peak.
and sealed with nail polish. Images were collected 100 mM AMPA or NMDA for 2 min, followed by
using 10X air and 40X oil immersion objectives incubation in conditioned medium for an addi- Immuno-organelle isolation of
on a Zeiss A1 laser scanning confocal microscope tional 8 min at 37°C and 5% CO2, before fixing synaptic vesicles
with Zen software (Carl Zeiss). Digital images cells with 4% paraformaldehyde. Surface recep- Mouse monoclonal antibodies directed against
were processed using Adobe Photoshop software. tors were labeled with Alexa 647 secondary anti- Syb2 and Syt1 were coupled to Protein G mag-
bodies, then cells were permeabilized and internal netic Dynabeads (Invitrogen) in PBS for 2 hours
Antibodies and expression constructs receptors labeled with Alexa 546 secondary anti- at 4°C. Antibody-coated beads were added to
Antibodies used including species and catalog bodies. The internalization index was calculated as whole brain S1 fractions and incubated overnight
number were rabbit Syt3 105133 (Synaptic Sys- the ratio of internal to surface receptor fluores- at 4°C. Magnetic beads were separated from
tems) and mouse Syt3 N278/19 (NeuroMab), chick cence. Cultures in which control conditions did immuno-depleted supernatant and washed 3 times
MAP2 C-1382-50 (Biosensis), rabbit GFP ab290 not show an increase in internalization following with PBS. Bound vesicles were eluted in sample
(Abcam), mouse Synaptophysin (Syp) 101011, rabbit stimulation were excluded from analysis. buffer and analyzed by SDS–polyacrylamide gel
Synaptobrevin2 (Syb2) 104202, mouse Syt1 105101, electrophoresis (SDS-PAGE) and immunoblotting.
mouse SNAP25 111011, guinea pig Piccolo 142104, pHluorin imaging
guinea pig Homer 160004, guinea pig Beta3- Neurons were transferred to a live imaging cham- Syt3 pulldowns
tubulin 302304, rabbit VGluT1 135303, mouse ber (Warner Instruments) containing bath saline Recombinant His-tagged Syt3 C2AB (provided
VGAT 131011, mouse Rab-GDI 130011, mouse solution (140 mM NaCl, 5 mM KCl, 2 mM CaCl2, by Edwin Chapman, University of Wisconsin,
Gephyrin 147011, rabbit GluA1 182003, mouse GluA2 2 mM MgCl2, 5.5 mM glucose, 20 mM HEPES, Madison) was expressed in E. coli and purified
182111, rabbit GRIP 151003 (Synaptic Systems), 1 mM TTX, pH = 7.3). Transfected cells were as previously described (49). Recombinant Syt3
mouse GABAARa1 75136 (NeuroMab), rabbit selected, and images acquired at 1 s intervals and was incubated with solubilized rat brain homog-
GluA3 17311 (Epitomics), mouse PSD95 MA1- 500 ms exposure times, with 484/20nm excita- enate for 2 hours at 4°C. After incubation, Ni-beads
045 (Thermo Scientific), rabbit GluA1 PC246 tion and 517/20-nm emission filters, on a Zeiss were added and incubated for an additional
(Calbiochem), mouse GluA2 MAB397, rabbit GluN1 Axio Observer inverted microscope with a Photo- 2 hours at 4°C. The mixture was then poured into
AB9864, mouse GluN2A MAB5216 (Millipore), metric Evolve EMCCD camera, and Lambda a MT column from Biorad and washed 3 X with
rabbit PICK1 PA1073 (Thermo Scientific), mouse DG-4 fast-switching light source interfaced with wash buffer (20 mM Tris pH 7.4, 500 mM NaCl,
Synapsin (Syn), mouse Rab3a, mouse Syntaxin1A, Metamorph software. A baseline of at least 30 20 mM imidazole). Proteins bound to recombi-
rabbit EEA1 (provided by Reinhard Jahn, Max images was collected before addition of high nant Syt3 in the column were eluted with elution
Planck Institute for Biophysical Chemistry, potassium buffer (100 mM NaCl, 45 mM KCl, buffer (20 mM Tris pH 7.4, 500 mM NaCl, 400 mM
Goettingen, Germany), rabbit Neurexin (Nrx), rab- 2 mM CaCl2, 2 mM MgCl2, 5.5 mM glucose, 20 mM imidazole). For experiments testing inhibition of
bit Neuroligin (Nlg) (provided by Nils Brose, HEPES, 1 mM TTX, pH = 7.3), 100 mM AMPA, Syt3:GluA2 binding, 1 mM Tat-GluA2-3Y peptide
Max Planck Institute of Experimental Medicine, 100 mM NMDA, or field stimulation to depolarize (sequence YGRKKRRQRRR-869YKEGYNVYG877,
Goettingen, Germany), mouse AP-2 (provided by neurons. For AMPA stimulation, 50 mM AP5 was provided by Yu-Tian Wang, University of British
Pietro De Camilli, Yale School of Medicine, New included in the bath solution to block NMDA Columbia, Vancouver, Canada) was pre-incubated
Haven, CT, USA), and rabbit BRAG2 (10) (provided receptors; for NMDA stimulation, 20 mM CNQX with brain homogenate overnight prior to incu-
by Hans-Christian Kornau, Charité University of was included to block AMPA receptors. Dendritic bation with recombinant Syt3 and Ni-beads.
Medicine, Berlin, Germany). Mammalian expres- puncta were selected using Metamorph software Eluted proteins were loaded onto SDS-PAGE gels
sion constructs used were pHluorin-Syt3, as (Molecular Devices) and fluorescence intensity and analyzed by Western blot.
previously described (23). GFP-Syt3 and mCherry- normalized to baseline was plotted versus time.
Syt3 were subcloned by replacing the pHluorin in Synaptosome trypsin cleavage assay
pHluorin-Syt3 with GFP or mCherry, respectively. Subcellular fractionation from whole brain Synaptosomes were prepared and treated with
Homer-GFP, Homer-myc, and Clathrin light Rat brains were homogenized in ice-cold homog- trypsin as described previously (26). Purified syn-
chain (CLC)-DsRed constructs were provided by enization buffer (320 mM sucrose, 4 mM HEPES, aptosomes were centrifuged for 3 min at 8700 × g,

Awasthi et al., Science 363, eaav1483 (2019) 4 January 2019 10 of 14


R ES E A RC H | R E S EA R C H A R T I C LE

4°C. The pellet was resuspended in 320 mM sucrose, custom-made recording chamber in extracellular Apparatus, cat. no. 300060, 1.5 mm OD, 0.86 mm
5 mM HEPES, pH 8. For trypsin cleavage, a solution containing, in mM: 142 NaCl, 2.5 KCl, 10 ID) using a P-97 puller (Sutter Inst, Novato, CA).
0.1 mg/ml trypsin stock solution was added to HEPES, 10 D-Glucose, 2 CaCl2, 1.3 MgCl2 (295 P12-P17 male and female mouse pups were
yield a final protein-protease ratio of 100:1. Synap- mOsm, pH adjusted to 7.2 with NaOH). The anesthetized with isoflurane (Abbott, Wiesbaden,
tosomes were incubated for 10, 20, 30, 60, or temperature of the bath was maintained at 30 Germany), decapitated, and the brain extracted
90 min at 30°C with gentle agitation. This mix- to 32°C. To record miniature excitatory post- and transferred to cold NMDG buffer containing
ture was then centrifuged for 3 min at 8700 × g, synaptic currents (mEPSCs), 1 mM TTX (to block (in mM) 45 NMDG, 0.33 KCl, 0.4 KH 2PO 4 ,
and the resulting pellet resuspended in sucrose action potentials) and 50 mM picrotoxin (to inhibit 0.5 MgCl2, 0.16 CaCl2, 20 choline bicarbonate,
buffer containing 400 mM Pefabloc (Roche) to GABAA receptors) was added to the extracellular 12.95 glucose. 300 mm coronal hippocampal
stop trypsin cleavage activity. Samples were then solution. An Olympus upright BX51WI microscope slices were made with a Leica VT1200 vibratome
analyzed by SDS-PAGE and immunoblotting. equipped with a 40X water-immersion objective, (Wetzlar, Germany) and a stainless steel blade
fluorescent light source (Lumen 200Pro, Prior (Feather) in ice cold NMDG buffer. Slices were
AAV preparation and Scientific), and filters for GFP fluorescence imaging transferred to a preincubation chamber with a
hippocampal injections were used to visualize neurons transfected with mesh bottom filled with ACSF containing (in mM)
AAV ESYN-GFP-P2A-Syt3 or calcium-binding defi- GFP, GFP-Syt3 or Turbo GFP-expressing Syt3 124 NaCl, 4.4 KCl, 1 NaH2PO4, 26.2 NaHCO3, 1.3
cient mutant Syt3 (D386, 388N, and D520, 522N) knockdown constructs. Patch pipettes were pulled MgSO4, 2.5 CaCl2, and 10 D-Glucose, bubbled with
constructs were synthesized and subcloned by from borosilicate glass (1.5 mm OD, 0.86 mm ID, 95% O2/5% CO2 (carbogen) and incubated at 35°C
Genscript, and AAV1/2 viral particles prepared 3 to 6 megohms) using a P-97 micropipette puller for 0.5 hours followed by another 0.5 hours at room
by transfecting 10 cm dishes of 70-80% confluent (Sutter Instruments). The internal solution con- temperature. Hippocampi were then dissected
HEK293 cells with 12.5 mg of viral construct con- tained, in mM: 130 K-gluconate, 10 NaCl, 1 EGTA, using a Zeiss Stemi 2000 stereoscopic microscope.
taining Syt3 or calcium-binding deficient mutant 0.133 CaCl2, 2 MgCl2, 10 HEPES, 3.5 Na2-ATP,1 Na- A cut perpendicular to the CA3 pyramidal cell

Downloaded from http://science.sciencemag.org/ on January 7, 2019


Syt3, with 25 mg pFdelta6, 6.25 mg pRV1 and GTP (285 mOsm, pH adjusted to 7.4 with KOH). layer was made in the CA3 region and another
6.25 mg pH21 helper plasmids using calcium Whole-cell patch-clamp recordings were obtained cut perpendicular to the CA1 field at the medial
phosphate. Cell media was replaced after 6 hours using a HEKA EPC10 USB double patch clamp end of the slice was made to prevent recurrent
and cells incubated for 48 hours prior to virus amplifier coupled to Patchmaster acquisition activity. Slices were submerged in a chamber
harvesting. Viral particles were released by add- software. Signals were low pass filtered using a perfused with carbogen-bubbled ACSF maintained
ing 10% sodium deoxycholate and benzonase Bessel filter at 2.9 KHz and digitized at 5 KHz. at 30°C-32°C and CA1 neurons visualized with an
(Sigma-Aldrich), and purified in an Optiprep mEPSCs were recorded while holding neurons upright Zeiss Examiner D1 microscope equipped
(Sigma-Aldrich) step gradient by ultracentrifugation at –60 mV in the voltage-clamp mode, with fast with a 40X water-immersion objective. The intra-
for 90 min. The pure viral fraction was concen- and slow capacitance, and series resistance com- cellular pipette solution contained (in millimolar)
trated to approximately 500 ml through a 0.22 mm pensated. The series resistance was monitored 130 CsMeSO3, 2.67 CsCl, 10 HEPES, 1 EGTA, 4 Mg-
Amicon Ultra unit (Millipore/Merck), aliquoted during recording to ensure it did not change by ATP, 0.3 Na-GTP, 3 QX-314 Cl, 5 TEA-Cl, 15
and stored at –80°C. Virus was used at a titer more than ± 3 megohms and neurons were Phosphocreatine disodium, and 5 U/ml Creatine-
of 107 particles/ml. Mice were given metamizol recorded from only if uncompensated Rs < 20 phosphokinase (mOsm, 303; pH, 7.44). Whole-cell
(3ml/L) in drinking water for 2 days prior to megohms. MEPSCs were analyzed using Mini patch-clamp recordings were obtained using a NPI
surgery and up to 3 days after. On the day of Analysis software v6.0.3 (Synaptosoft Inc.) with an ELC-03XS patch clamp amplifier and digitized
surgery, mice were anesthetized with a single amplitude threshold of 3.5 X average RMS noise. using an InstruTECH ITC-18 data acquisition
intraperitoneal injection of ketamine/xylazine DIV13-19 mouse neurons were recorded from interface (HEKA). A custom written procedure
(80 and 10 mg/kg, respectively) and given a in the same conditions except the bath was at room (provided by Oliver Schlüter, European Neuro-
single subcutaneous injection of buprenorphine temperature, and 100 mM picrotoxin was added. science Institute Goettingen) in Igor Pro 6.12A
(0.1 mg/kg). Mice were fixed in a stereotaxic For AMPA stimulation, coverslips were transferred was used to visualize and store recorded data.
device (myNeuroLab Wetzlar, Germany), an inci- to 250 ml prewarmed medium containing 100 mM Signals were low pass filtered using a Bessel filter
sion was made to expose the bone and antero- S-AMPA (Abcam ab120005) and incubated at 37°C at 3 KHz and digitized at 10 KHz. Schaffer col-
posterior (–1.75mm) and mediolateral (±1.0 mm) and 5% CO2 for 2 min, followed by 8 min incu- laterals were stimulated at 0.1 Hz using a bipolar
coordinates from bregma were used for drilling bation in conditioned medium without AMPA, glass electrode filled with ACSF at the distal
holes bilaterally. A fine glass injection capillary as for receptor internalization assays. Whole cell dendritic region of the stratum radiatum close to
filled with 1.2 ml virus was then slowly lowered to recordings were performed on an upright micro- the border of the lacunosum-moleculare, and a
–1.5 (dorsoventral) and allowed to rest for 1 min. scope (Zeiss Examiner D1) equipped with a 40X minimum of 30 EPSCs were averaged. The fast
0.9 ml was then injected over 3 min. The needle water immersion objective with a fluorescent capacitance was compensated and slow capaci-
was allowed to rest in place for an additional light source (Zeiss Colibri) using an ELC-03XS tance and series resistance were not compensated.
minute after the injection and then slowly lifted patch clamp amplifier (NPI Electronics, Germany) Synaptic responses were first recorded at a holding
above bone level. This procedure was repeated for with custom written data acquisition scripts for potential of –56 mV, the measured average reversal
both hippocampi. Mice were then removed from IgorPro 6.12A software (Wavemetrics), from potential for Cl– in wild-type slices. GABA A
the stereotaxic device and tissue glue (Histoacryl, Oliver Schlüter (European Neuroscience Institute, receptor-mediated currents were then recorded
B Braun) was used to seal the wound. They were Goettingen). Signals were digitized at 10 KHz at 0 mV, the measured average reversal potential
then allowed to recover on a heat blanket and using an InstruTECH ITC-18 data acquisition of NMDA and AMPA receptors. 0.1 mM picro-
transferred to individual cages for post-operation interface (HEKA). The fast capacitance was com- toxin was then perfused while holding at –56 mV
recovery. Mice were given buprenorphin injec- pensated and slow capacitance and series resistance after which the elimination of GABA IPSCs at
tions up to 2 days after the operation and closely were not compensated. The series resistance did 0 mV was confirmed. The residual AMPA+NMDA
monitored for signs of distress or pain. Mice were not change by more than 10%, monitored every EPSC at 0 mV was then subtracted from the GABA
only used for subsequent experiment after a mini- 10 s. The experimenter was blinded to file names IPSC. The AMPA EPSCs subsequently recorded at
mum of 2 weeks post-operation. during analysis. –56 mV, which were free of any GABAA receptor
IPSC component, were used for analysis. The
Electrophysiological recordings from Whole-cell electrophysiology in acute AMPA+NMDA compound EPSC was then re-
dissociated hippocampal neurons hippocampal slices corded at +40 mV in the presence of 0.1 mM
Following transfection on DIV10, DIV13-20 rat Patch pipettes with a resistance of 2.5 to 5 megohms picrotoxin, where the amplitude of the EPSC
neurons growing on coverslips were placed in a were prepared from glass capillaries (Harvard approximately 60 ms after the peak of the AMPA

Awasthi et al., Science 363, eaav1483 (2019) 4 January 2019 11 of 14


R ES E A RC H | R E S EA R C H A R T I C LE

EPSC is considered to be purely NMDA receptor- All experimenters were blinded to genotype. Mice tracking data was analyzed using Matlab to
mediated, since the measured AMPA receptor were individually housed at the European Neuro- extract time-tagged xy-coordinate information
EPSC decay time constant t ≈ 20 ms. The input science Institute Göttingen, Germany animal and quantify escape latency, platform crossings,
and series resistance (Rs) were monitored every facility in standard environmental conditions proximity [mean distance of all tracked path
10 s. Recordings where Rs was > 25 megohms or (temperature, humidity), with ad libitum access points to platform center, which is reported to be
changed by more than ± 20% during recording to food and water and a 12 hours light/dark cycle. the most reliable parameter to quantify spatial
were excluded from analysis. Input resistances Mice were allowed to habituate to different hold- specificity of water maze search patterns (41)],
ranged from 100 to 400 megohms and did not ing rooms for behavioral experiments for two percent time spent in target quadrant, and aver-
change by more than ± 20% during the course of weeks before testing, and to experimenters for at age swimming speed. Occupancy plots were
the recording. Matlab was used to calculate cur- least three days before experiments . All experi- generated by super-imposing all path points
rent ratios and decay times. ments were performed during the light cycle. Video of all mice in a group. Densities of path points
tracking was done with the TSE monitoring system (normalized to total number of path points in a
Extracellular recordings from acute Videomot2. All behavioral experiments were ap- group of mice) within a grid size of 2.1 cm × 2.1 cm
hippocampal slices proved under project number G15.1794 by the (43) were calculated. Density data was smoothened
Acute hippocampal slices were prepared from Niedersächsisches Landesamt für Verbraucherschutz and interpolated to plot heat maps (Scattercloud
8 to 12-week-old male mice anesthetized with und Lebensmittelsicherheit (LAVES, Lower function, Matlab File ID 6037). Occupancy plot
isoflurane and decapitated. The hippocampus Saxony, Germany). color maps were linearly scaled using the global
was removed and 400 mm thick dorsal hippo- minimum and maximum densities for all groups,
campal slices were cut transversely using a tissue Open field, elevated plus maze to allow comparison between them. The last 0.5 s
chopper (Stoelting) in ice-cold artificial cerebro- In the open field test, mice were introduced near of the trial, when mice were on the platform and
spinal fluid (ACSF) containing, in mM: 124 NaCl, the wall of an empty, opaque square plexiglas not searching, was excluded in occupancy plots

Downloaded from http://science.sciencemag.org/ on January 7, 2019


4.9 KCl, 1.2 KH2PO4 , 2 MgSO 4, 2 CaCl2 , 24.6 box and allowed to freely explore the arena for 5 for Fig. 5G. To generate occupancy plots of probe
NaHCO3, and 10 D-glucose (saturated with 95% min. Before every trial, urine was removed with trials from two cohorts, in which the platform
O2 and 5% CO2 , pH 7.4, ~305 mOsm). Within Kimwipes, and the arena was cleaned with water was in different positions (Fig. 5, E and F), the
5 min of decapitation, slices were transferred and 70% EtOH. Time spent in the center (2 × 2 tracking data from one cohort was transposed
to a custom-built interface chamber and pre- grid in the middle of a 4 × 4 grid arena) relative and mirror imaged with respect to the center
incubated in ACSF for at least 3 hours. Following to near the walls, and the total path travelled was pool line and superimposed on data from the
pre-incubation, the stimulation strength was set recorded. second cohort. Circular areas encompassing plat-
to elicit 40% of the maximal field EPSP (fEPSP) For the elevated plus maze, mice were intro- forms of both cohorts in both original and rever-
slope. The slope of the rising phase of the fEPSP duced into the center quadrant of a 4-arm maze sal quadrants were defined as target areas.
was used to determine potentiation of synaptic with two open and two closed arms Before every Because forgetting cannot be analyzed in mice
responses. For stimulation, biphasic constant cur- trial, urine was removed with Kimwipes, and the that did not learn, mice in i.p. injected cohorts
rent pulses were used. A baseline was recorded for maze was cleaned with water and 70% EtOH. (which learned more slowly) were excluded from
at least 30 min before LTD or LTP induction. Four Time spent in the open arms was analyzed. analysis if (i) their swim speed was less than
averaged 0.2 Hz biphasic, constant-current pulses 6.2 cm/s for more than three consecutive days,
(0.1 ms per polarity) were used to test responses Reference memory water maze (ii) their proximity or escape latency failed to
post-tetanus for up to 4 hours. Näive mice from four independent cohorts were decrease between the first day of training and
LTD was induced by a single tetanus of 900 trained to find a 13 × 13 cm square hidden plat- the average of the last three days of training
pulses at 1 Hz. Nondecaying LTP was induced form (uninjected mice) or a 10 cm diameter before platform reversal, or (iii) they spent 0%
by a 3XTET high frequency stimulation with circular platform (injected mice) submerged 1.5 cm time in the target quadrant in the second probe
three stimulus trains of 100 pulses at 100 Hz, below the surface in a 1.1 m diameter circular test. These criteria were also met by all other
stimulus duration 0.2 ms per polarity with 10 min pool filled with white opaque water at 19 ± 1°C. cohorts tested. Daily i.p. injections (maximum
intertrain intervals (50). Decaying LTP was in- Mice were trained in 4 trials per day in succes- volume injected, 10 ml/g body weight) were per-
duced with a 1XTET single tetanus of 16 pulses sion where each trial lasted 1 min during which formed 1 hour before training (13). Mice were
at 100 Hz, stimulus duration 0.2 ms per polarity, the mice searched for the platform. A trial ended injected with saline (0.9% NaCl) during training
modified for mouse hippocampal slices from the when the mouse spent at least 2 s on the plat- to the first platform position and then injected
protocol consisting of 21 pulses used for rat form, after which they were left on the platform with saline or with Tat-GluA2-3Y peptide (5 mmol/kg
hippocampal slices (36). The Tat-GluA2-3Y peptide for 15 s prior to the start of the next trial. Four body weight) one hour before the second probe
(sequence YGRKKRRQRRR-869YKEGYNVYG877, shapes around the pool (star, square, triangle, test and daily after reversal. Probe tests following
provided by Yu-Tian Wang, University of British circle) served as visual cues. Mice that failed to reversal training of i.p. injected cohorts were
Columbia, Vancouver, Canada) was used at a con- find the platform after 1 min were guided to it performed on three consecutive days.
centration of 1 mM and ZIP (Tocris cat. no. 2549) and left on the platform for 15 s. Mice that failed
was dissolved in water, as recommended by the to swim (floaters) were excluded from analysis. Delayed matching to place water maze
manufacturer, and used at a concentration of Mice were placed into the pool facing the wall at The delayed matching-to-place task protocol was
1 mM (13). Control and experimental recordings the beginning of each trial, and the position of performed as previously described (42) with modi-
were interleaved as much as possible for com- pool entry from four different directions was fications. Mice were first habituated to the task by
parison of conditions. For each condition, the randomly shuffled daily. For probe tests, the plat- training to a visible platform (marked by a
corresponding control was repeated before and form was removed and mice were placed into the graduated cylinder coated with multi-colored
intermittently throughout experiments, to ensure pool near the wall in the quadrant opposite to paper on top of a submerged platform) placed
consistent recording conditions. that of the platform location and allowed to at a unique position every day for 3 days in a 1.1 m
search for the platform for 1 min. Two probe tests diameter circular pool filled with white opaque
Behavioral experiments were performed to monitor learning of the first water at 19 ± 1°C. The circular platform was
Behavioral experiments were performed on 3- to platform position and additional probe test(s) submerged 1.5 cm below the surface and had a
9-month-old male mice by a male experimenter, performed after reversal, i.e., switching the plat- radius of 5 cm. Four shapes around the pool (star,
except for the Barnes maze, where a male exper- form position to the opposite quadrant. Only square, triangle, circle) served as visual cues.
imenter performed intraperitoneal injections and data from coincident days of training from the After habituation, mice were trained to 16 unique
a female experimenter performed experiments. first 2 cohorts (Fig. 5, A to F) was pooled. Video hidden platform positions at two fixed distances

Awasthi et al., Science 363, eaav1483 (2019) 4 January 2019 12 of 14


R ES E A RC H | R E S EA R C H A R T I C LE

from the pool center (11 in an outer ring and 5 in an ≥50% of path points inside wider wall zone did not perform in the Barnes maze, but still
inner ring) over 16 days. Mice underwent 4 trials of starting 0.75 X pool radius; Random Search strat- received saline (maximum volume injected, 10 ml
2 min every day. The platform was shifted to a new egy: % pool area scanned ≥50%. 0.9% NaCl/g body weight) or GluA2-3Y (5 mmol/kg
random position every day in a different quadrant body weight) i.p. injections.
alternating between inner and outer rings as much Barnes Maze Three-point (head, center, tail) tracking data
as possible. A trial ended when the mouse spent at The Barnes maze consisted of a white circular was exported into Matlab for further analysis.
least 2 s on the platform, after which they were left platform made of plexiglass, 92cm in diameter, Occupancy plots were generated using Matlab as
on the platform for 15 s and then returned to their with 20 equally spaced holes (5 cm in diameter) described above for the water maze, except that
home cage. Mice were warmed with infrared along the perimeter. The platform was elevated head instead of center coordinates were used.
lamps after every trial. The drop-off points with 40 cm above the ground. An escape chamber Video tracking errors in which head and tail
respect to the platform position of that day were (15.5 × 9 × 6 cm3) was placed under one of the coordinates were erroneously swapped (mostly
in a random order. Mice were divided into two holes, defined as the target hole. To encourage close to hole regions) were detected by a distance
groups for counterbalancing in which each group mice to enter the escape chamber, it contained a threshold and excluded. Mice that did not find
experienced different alternations of platform plastic ramp to enable the mice to climb into it the original target hole in either of the first two
positions between inner and outer rings, to and an odorless paper towel, resembling nesting probe tests (did not learn the target hole) were
prevent non-spatial chaining search strategies material. Before every trial, urine was removed excluded from analysis of perseverance after
in which mice search for platforms within a with Kimwipes, and the arena was cleaned with reversal. Target area was defined as the area of
certain distance of the pool wall. Inter-trial water and 70% EtOH to eliminate olfactory cues. the target hole and its two neighboring holes
intervals were 5 min; from day 10 onwards, the For each trial a mouse was placed onto the mid- using center tracked coordinates, for calculation
inter-trial interval between trial 1 and trial 2 dle of the maze, such that the target hole was not of the perseverance ratio (time spent in reversal
was increased to 1 hour 15 min. Trial 2 on day distinguishable from any other hole and the target area divided by total time spent in original

Downloaded from http://science.sciencemag.org/ on January 7, 2019


16 was a probe trial, i.e., the platform was re- mouse had to rely on three visual cues (26 × 26 cm2 and reversal target areas).
moved and the exploratory behavior of mice in size) placed 5 cm from the edge of the platform
recorded for 2 min. Because the platform in this to identify the location of the target hole. The Statistical analysis
trial was missing, only the search path data be- platform was uniformly illuminated by bright LED All statistical analysis was done using GraphPad
fore the first crossing of the platform position light which served as a mildly aversive stimulus to Prism or Microsoft Excel. All reported values in
from trial 1 was used to calculate savings of motivate the mice to search for the target hole. statistical analysis represent the mean, error bars
proximity, escape latency and path length. All Daily i.p. injections (maximum volume injected, indicate SEM, and all Student's t tests are two-
mice were trained at the same time of the day as 10 ml/g body weight) were performed one hour tailed type 2, unless otherwise indicated. For all
far as possible, i.e., some mice were always trained before training (13). Mice were injected with statistical tests, data met the assumptions of the
in the morning while others were always trained in saline (0.9% NaCl) during training to the first test. All n numbers listed in Figure Legends refer
the evening. In all occupancy plots, the last 1.5 s of hole position and then injected with saline or to biological replicates.
the trial were excluded to enhance contrast in the with Tat-GluA2-3Y peptide (5 mmol/kg body
pool and avoid high occupancy densities on the weight) one hour before the second probe test
platform, since all mice spent the last 2 s of every and daily after reversal. REFERENCES AND NOTES
trial on the platform. On the day before training, mice were habi- 1. J. M. Henley, K. A. Wilkinson, Synaptic AMPA receptor
composition in development, plasticity and disease. Nat. Rev.
Quantitation of search strategy was modified tuated to the maze by placing them in a clear Neurosci. 17, 337–350 (2016). doi: 10.1038/nrn.2016.37;
from a previously described method (43). A Matlab plastic cylinder (15 cm in diameter) in the middle pmid: 27080385
script extracted time-tagged xy-coordinate infor- of the platform for 30 s, before gently guiding 2. J. D. Shepherd, R. L. Huganir, The cell biology of synaptic
mation from video tracking data of all trials and them to the target hole, where they were given plasticity: AMPA receptor trafficking. Annu. Rev. Cell Dev. Biol.
23, 613–643 (2007). doi: 10.1146/annurev.
classified individual trials as search strategies. 3 min to enter the escape chamber. If mice did cellbio.23.090506.123516; pmid: 17506699
The following parameters were used for classifi- not enter the escape chamber, they were gently 3. G. L. Collingridge, J. T. Isaac, Y. T. Wang, Receptor trafficking
cation of the indicated search strategies. Direct nudged with the cylinder into the chamber. All and synaptic plasticity. Nat. Rev. Neurosci. 5, 952–962 (2004).
swimming strategy: total path length ≤1.4 X mice spent 1 min in the escape chamber before doi: 10.1038/nrn1556; pmid: 15550950
4. R. C. Malenka, M. F. Bear, LTP and LTD: An embarrassment of
distance between drop-off point and platform being returned to their home cage. On subse- riches. Neuron 44, 5–21 (2004). doi: 10.1016/
center, ≥80% path points within a 30° goal corridor quent training days, mice were placed into an j.neuron.2004.09.012; pmid: 15450156
angle; Focal search strategy: mean proximity opaque plastic cylinder (15 cm in diameter) 5. S. Nabavi et al., Engineering a memory with LTD and LTP.
to platform center ≤0.35 X pool radius, mean covered by an opaque lid for 15 s to randomize Nature 511, 348–352 (2014). doi: 10.1038/nature13294;
pmid: 24896183
proximity to path centroid ≤0.4 X pool radius; starting orientation. Each trial, lasting 2 min, 6. T. J. Ryan, D. S. Roy, M. Pignatelli, A. Arons, S. Tonegawa,
Directed search strategy: ≥70% path points was initiated after lifting the cylinder. If the Memory. Engram cells retain memory under retrograde
within a 30° goal corridor angle; Perseverance mouse climbed into the escape chamber, the trial amnesia. Science 348, 1007–1013 (2015). doi: 10.1126/
strategy: mean proximity to previous platform was stopped and the mouse returned to its home science.aaa5542; pmid: 26023136
7. J. H. Choi et al., Interregional synaptic maps among engram
center ≤0.5 X pool radius, mean proximity to cage after remaining inside the escape chamber cells underlie memory formation. Science 360, 430–435
path centroid allowed for perseverance ≤0.6 X for 1 min. If the mouse did not climb into the (2018). doi: 10.1126/science.aas9204; pmid: 29700265
pool radius; Chaining strategy: ≥70% path points escape chamber within 2 min, it was gently guided 8. P. V. Migues et al., Blocking synaptic removal of GluA2-
inside annulus around the ring of platforms to the target hole with the clear plastic cylinder and containing AMPA receptors prevents the natural forgetting
of long-term memories. J. Neurosci. 36, 3481–3494
(inner or outer) containing the current day's given 3 min to climb into the escape chamber, (2016).
platform, by 0.01 to 0.02 X pool radius, annulus where it remained for 1 min, before being returned doi: 10.1523/JNEUROSCI.3333-15.2016; pmid: 27013677
for platforms in outer ring between 0.52 X pool to its home cage. 9. A. Hayashi-Takagi et al., Labelling and optical erasure of
radius and 0.73 X pool radius, annulus for In probe tests, the escape chamber was re- synaptic memory traces in the motor cortex. Nature 525,
333–338 (2015). doi: 10.1038/nature15257; pmid: 26352471
platforms in inner ring between 0.22 X pool moved, and mice were allowed to explore the 10. R. Scholz et al., AMPA receptor signaling through BRAG2 and
radius and 0.42 X pool radius; Scanning strategy: maze for 2 min. The “reversal” hole was located Arf6 critical for long-term synaptic depression. Neuron 66,
≥80% of path points inside scanning radius (a in an adjacent quadrant, since some mice showed 768–780 (2010). doi: 10.1016/j.neuron.2010.05.003;
circular area enclosing all platforms, 0.73 X pool a bias toward exploring the opposite quadrant pmid: 20547133
11. G. Ahmadian et al., Tyrosine phosphorylation of GluR2 is
radius), total % pool area scanned ≥10% and during initial training. Mice experienced one required for insulin-stimulated AMPA receptor endocytosis and
≤50%; Thigmotaxis: ≥30% of path points inside trial per day, and were given a one-day “break” LTD. EMBO J. 23, 1040–1050 (2004). doi: 10.1038/
closer wall zone starting 0.85 X pool radius and after the first three probe tests, during which they sj.emboj.7600126; pmid: 14976558

Awasthi et al., Science 363, eaav1483 (2019) 4 January 2019 13 of 14


R ES E A RC H | R E S EA R C H A R T I C LE

12. P. V. Migues et al., PKMzeta maintains memories by regulating potentiation. Neuron 63, 92–105 (2009). doi: 10.1016/ 47. G. A. Banker, W. M. Cowan, Rat hippocampal neurons in
GluR2-dependent AMPA receptor trafficking. Nat. Neurosci. 13, j.neuron.2009.05.025; pmid: 19607795 dispersed cell culture. Brain Res. 126, 397–42 (1977).
630–634 (2010). doi: 10.1038/nn.2531; pmid: 20383136 31. M. Rosendale, D. Jullié, D. Choquet, D. Perrais, Spatial and doi: 10.1016/0006-8993(77)90594-7; pmid: 861729
13. Z. Dong et al., Long-term potentiation decay and memory loss temporal regulation of receptor endocytosis in neuronal 48. J. Rizo, T. C. Südhof, C2-domains, structure and function of a
are mediated by AMPAR endocytosis. J. Clin. Invest. 125, dendrites revealed by imaging of single vesicle formation. universal Ca2+-binding domain. J. Biol. Chem. 273,
234–247 (2015). doi: 10.1172/JCI77888; pmid: 25437879 Cell Reports 18, 1840–1847 (2017). doi: 10.1016/ 15879–15882 (1998). doi: 10.1074/jbc.273.26.15879;
14. M. Y. Xiao, Y. P. Niu, H. Wigström, Activity-dependent decay of j.celrep.2017.01.081; pmid: 28228251 pmid: 9632630
early LTP revealed by dual EPSP recording in hippocampal 32. S. H. Lee, L. Liu, Y. T. Wang, M. Sheng, Clathrin adaptor AP2 49. A. Bhalla, M. C. Chicka, E. R. Chapman, Analysis of the
slices from young rats. Eur. J. Neurosci. 8, 1916–1923 (1996). and NSF interact with overlapping sites of GluR2 and play synaptotagmin family during reconstituted membrane fusion.
doi: 10.1111/j.1460-9568.1996.tb01335.x; pmid: 8921282 distinct roles in AMPA receptor trafficking and hippocampal Uncovering a class of inhibitory isoforms. J. Biol. Chem. 283,
15. D. M. Villarreal, V. Do, E. Haddad, B. E. Derrick, NMDA receptor LTD. Neuron 36, 661–674 (2002). doi: 10.1016/S0896-6273 21799–21807 (2008). doi: 10.1074/jbc.M709628200;
antagonists sustain LTP and spatial memory: Active processes (02)01024-3; pmid: 12441055 pmid: 18508778
mediate LTP decay. Nat. Neurosci. 5, 48–52 (2002). 33. W. Lu et al., Subunit composition of synaptic AMPA receptors 50. U. Frey, R. G. Morris, Weak before strong: Dissociating synaptic
doi: 10.1038/nn776; pmid: 11740500 revealed by a single-cell genetic approach. Neuron 62, tagging and plasticity-factor accounts of late-LTP.
16. M. D. Ehlers, Reinsertion or degradation of AMPA receptors 254–268 (2009). doi: 10.1016/j.neuron.2009.02.027; Neuropharmacology 37, 545–552 (1998). doi: 10.1016/
determined by activity-dependent endocytic sorting. Neuron 28, pmid: 19409270 S0028-3908(98)00040-9; pmid: 9704995
511–525 (2000). doi: 10.1016/S0896-6273(00)00129-X; 34. J. W. Lin et al., Distinct molecular mechanisms and divergent
pmid: 11144360 endocytotic pathways of AMPA receptor internalization. AC KNOWLED GME NTS
17. E. C. Beattie et al., Regulation of AMPA receptor endocytosis Nat. Neurosci. 3, 1282–1290 (2000). doi: 10.1038/81814; We thank R. Morris for recommendations of intertrial intervals in
by a signaling mechanism shared with LTD. Nat. Neurosci. 3, pmid: 11100149 the DMP task, H. Urbanke for the Barnes maze protocol, and
1291–1300 (2000). doi: 10.1038/81823; pmid: 11100150 35. Z. Dong et al., Hippocampal long-term depression mediates J. Schrader for technical assistance. Funding: This work was
18. D. Wu et al., Postsynaptic synaptotagmins mediate AMPA spatial reversal learning in the Morris water maze. supported by a Sofja Kovalevskaja grant from the Alexander von
receptor exocytosis during LTP. Nature 544, 316–321 (2017). Neuropharmacology 64, 65–73 (2013). doi: 10.1016/ Humboldt Foundation, European Research Council (ERC) starting
doi: 10.1038/nature21720; pmid: 28355182 j.neuropharm.2012.06.027; pmid: 22732443 grant SytActivity FP7 260916, and Deutsche
19. R. B. Sutton, B. A. Davletov, A. M. Berghuis, T. C. Südhof, 36. S. Sajikumar, S. Navakkode, J. U. Frey, Identification of Forschungsgemeinschaft (DFG) grants DE1951/1 and -3 and the
S. R. Sprang, Structure of the first C2 domain of compartment- and process-specific molecules required for Center for Nanoscale Microscopy and Molecular Physiology of the

Downloaded from http://science.sciencemag.org/ on January 7, 2019


synaptotagmin I: A novel Ca2+/phospholipid-binding fold. Cell “synaptic tagging” during long-term potentiation and long- Brain (CNMPB) to C.D.; DFG research group KFO241/PsyCourse
80, 929–938 (1995). doi: 10.1016/0092-8674(95)90296-1; term depression in hippocampal CA1. J. Neurosci. 27, Fi981-4/Fi981 11-1, DFG project 179/1-1/2013, ERC consolidator
pmid: 7697723 5068–5080 (2007). doi: 10.1523/JNEUROSCI.4940-06.2007; grant DEPICODE 648898, BMBF projects ENERGI (01GQ1421A),
20. S. Butz, R. Fernandez-Chacon, F. Schmitz, R. Jahn, pmid: 17494693 and Intergrament 01ZX1314D, and funds from the German Center
T. C. Südhof, The subcellular localizations of atypical 37. P. Tsokas et al., Compensation for PKMz in long-term for Neurodegenerative Diseases to A.F.; Canadian Institute for
synaptotagmins III and VI. Synaptotagmin III is enriched in potentiation and spatial long-term memory in mutant mice. Health Research grant FDN-154286 to Y.T.W.; and a Dorothea
synapses and synaptic plasma membranes but not in synaptic eLife 5, e14846 (2016). doi: 10.7554/eLife.14846; Schloezer fellowship to K.B. Author contributions: A.A.
vesicles. J. Biol. Chem. 274, 18290–18296 (1999). pmid: 27187150 coordinated the project; designed, conducted, and analyzed all
doi: 10.1074/jbc.274.26.18290; pmid: 10373432 38. Y. Yao et al., PKM zeta maintains late long-term potentiation by behavior experiments; designed and conducted receptor and Syt3
21. T. C. Südhof, Synaptotagmins: Why so many? J. Biol. Chem. N-ethylmaleimide-sensitive factor/GluR2-dependent trafficking internalization assays and immunocytochemistry experiments of
277, 7629–7632 (2002). doi: 10.1074/jbc.R100052200; of postsynaptic AMPA receptors. J. Neurosci. 28, 7820–7827 Syt3/endocytic zones and PSDs; conducted and analyzed
pmid: 11739399 (2008). doi: 10.1523/JNEUROSCI.0223-08.2008; pHluorin-Syt3 experiments; conducted and trained and supervised
22. S. Sugita, O. H. Shin, W. Han, Y. Lao, T. C. Südhof, pmid: 18667614 A.H. in mEPSC recordings; trained and supervised N.N. in
Synaptotagmins form a hierarchy of exocytotic Ca(2+) sensors 39. N. Sadeh, S. Verbitsky, Y. Dudai, M. Segal, Zeta Inhibitory whole-cell recordings from hippocampal slices and S.R. in Barnes
with distinct Ca(2+) affinities. EMBO J. 21, 270–280 (2002). Peptide, a candidate inhibitor of protein kinase Mz, is maze behavior experiments; and revised the manuscript. B.R.
doi: 10.1093/emboj/21.3.270; pmid: 11823420 excitotoxic to cultured hippocampal neurons. J. Neurosci. 35, designed, conducted, and analyzed all LTP, LTD, and field
23. C. Dean et al., Axonal and dendritic synaptotagmin isoforms 12404–12411 (2015). doi: 10.1523/JNEUROSCI.0976-15.2015; recording experiments and conducted all immunohistochemistry
revealed by a pHluorin-syt functional screen. Mol. Biol. Cell 23, pmid: 26354909 experiments. S.A. designed, conducted, and analyzed all
1715–1727 (2012). doi: 10.1091/mbc.e11-08-0707; pmid: 22398727 40. M. J. LeBlancq, T. L. McKinney, C. T. Dickson, ZIP It: Neural biochemistry experiments. E.B. designed behavior experiments,
24. L. W. Gong, P. De Camilli, Regulation of postsynaptic AMPA silencing is an additional effect of the PKM-z inhibitor zeta- trained A.A. in behavior experiments, and performed all
responses by synaptojanin 1. Proc. Natl. Acad. Sci. U.S.A. 105, inhibitory peptide. J. Neurosci. 36, 6193–6198 (2016). hippocampal viral injections. Y.S. designed, conducted, and
17561–17566 (2008). doi: 10.1073/pnas.0809221105; doi: 10.1523/JNEUROSCI.4563-14.2016; pmid: 27277798 analyzed immunocytochemistry experiments of Syt3 localization
pmid: 18987319 41. H. R. Maei, K. Zaslavsky, C. M. Teixeira, P. W. Frankland, What and all pHluorin-Syt3 experiments. N.N. conducted and analyzed
25. D. T. Lin, R. L. Huganir, PICK1 and phosphorylation of the is the most sensitive measure of water maze probe test whole-cell recordings from hippocampal slices. A.H. conducted and
glutamate receptor 2 (GluR2) AMPA receptor subunit regulates performance? Front. Integr. Nuerosci. 3, 4 (2009). analyzed mEPSC recordings. S.R. conducted and analyzed Barnes
GluR2 recycling after NMDA receptor-induced internalization. doi: 10.3389/neuro.07.004.2009; pmid: 19404412 maze behavior experiments. H.M. designed, developed, and
J. Neurosci. 27, 13903–13908 (2007). doi: 10.1523/ 42. K. Nakazawa et al., Hippocampal CA3 NMDA receptors are validated the Syt3 antibody. J.B. trained A.A. in and helped plan
JNEUROSCI.1750-07.2007; pmid: 18077702 crucial for memory acquisition of one-time experience. Neuron behavior experiments. K.B. performed biochemistry experiments.
26. J. Boyken et al., Molecular profiling of synaptic vesicle docking 38, 305–315 (2003). doi: 10.1016/S0896-6273(03)00165-X; Y.T.W. generated and validated the GluA2-3Y peptide and helped
sites reveals novel proteins but few differences between pmid: 12718863 plan behavior experiments. A.F. provided funding for J.B., and
glutamatergic and GABAergic synapses. Neuron 78, 285–297 43. A. Garthe, J. Behr, G. Kempermann, Adult-generated E.B. and helped plan behavior experiments. C.D. conceived and
(2013). doi: 10.1016/j.neuron.2013.02.027; pmid: 23622064 hippocampal neurons allow the flexible use of spatially precise coordinated the project; provided funding for A.A., B.R., S.A., Y.S.,
27. M. Rathje et al., AMPA receptor pHluorin-GluA2 reports NMDA learning strategies. PLOS ONE 4, e5464 (2009). doi: 10.1371/ and K.B.; conducted and analyzed receptor and Syt3 internalization
receptor-induced intracellular acidification in hippocampal journal.pone.0005464; pmid: 19421325 assays and immunocytochemistry of Syt3, endocytic zones, and
neurons. Proc. Natl. Acad. Sci. U.S.A. 110, 14426–14431 (2013). 44. A. Citri et al., Calcium binding to PICK1 is essential for the PSDs; and wrote and revised the manuscript. Competing interests:
doi: 10.1073/pnas.1312982110; pmid: 23940334 intracellular retention of AMPA receptors underlying long-term The authors declare no competing interests. Data and materials
28. T. A. Blanpied, D. B. Scott, M. D. Ehlers, Dynamics and depression. J. Neurosci. 30, 16437–16452 (2010). availability: All data are available in the manuscript or the
regulation of clathrin coats at specialized endocytic zones of doi: 10.1523/JNEUROSCI.4478-10.2010; pmid: 21147983 supplementary materials.
dendrites and spines. Neuron 36, 435–449 (2002). 45. M. Fiuza et al., PICK1 regulates AMPA receptor endocytosis via
doi: 10.1016/S0896-6273(02)00979-0; pmid: 12408846 direct interactions with AP2 a-appendage and dynamin. J. Cell SUPPLEMENTARY MATERIALS
29. J. Lu et al., Postsynaptic positioning of endocytic zones and Biol. 216, 3323–3338 (2017). doi: 10.1083/jcb.201701034;
www.sciencemag.org/content/363/6422/eaav1483/suppl/DC1
AMPA receptor cycling by physical coupling of dynamin-3 to pmid: 28855251
Figs. S1 to S8
Homer. Neuron 55, 874–889 (2007). doi: 10.1016/ 46. J. Yao, S. E. Kwon, J. D. Gaffaney, F. M. Dunning,
j.neuron.2007.06.041; pmid: 17880892 E. R. Chapman, Uncoupling the roles of synaptotagmin I during 18 August 2018; accepted 1 November 2018
30. E. M. Petrini et al., Endocytic trafficking and recycling maintain endo- and exocytosis of synaptic vesicles. Nat. Neurosci. 15, Published online 13 December 2018
a pool of mobile surface AMPA receptors required for synaptic 243–249 (2011). doi: 10.1038/nn.3013; pmid: 22197832 10.1126/science.aav1483

Awasthi et al., Science 363, eaav1483 (2019) 4 January 2019 14 of 14


Corrected 4 January 2019. See full text.
R ES E A RC H

◥ enzymes in the alternative pathway designs


RESEARCH ARTICLE SUMMARY were directed to the chloroplast. RNA inter-
ference (RNAi) was also used to down-regulate
a native chloroplast glycolate transporter in
PLANT SCIENCE
the photorespiratory pathway, thereby limiting
metabolite flux through the native pathway.
Synthetic glycolate metabolism The three pathways were introduced with

and without the trans-
ON OUR WEBSITE
pathways stimulate crop growth and Read the full article
porter RNAi construct
into tobacco, which is an
at http://dx.doi. ideal model field crop be-
productivity in the field org/10.1126/
science.aat9077
cause it is easily trans-
formed, has a short life
..................................................
Paul F. South, Amanda P. Cavanagh, Helen W. Liu, Donald R. Ort* cycle, produces large quan-
tities of seed, and develops a robust canopy
similar to that of other field crops.
INTRODUCTION: Meeting food demands for altered photorespiratory pathways within the
the growing global human population requires chloroplast have shown promising results, in- RESULTS: Using a synthetic biology approach
improving crop productivity, and large gains cluding increased photosynthetic rates and to vary promoter gene combinations, we gen-
are possible through enhancing photosynthetic plant size. erated a total of 17 construct designs of the

Downloaded from http://science.sciencemag.org/ on January 6, 2019


efficiency. Photosynthesis requires the carbox- three pathways with and without the trans-
ylation of ribulose-1,5-bisphosphate (RuBP) by RATIONALE: To determine if alternative pho- porter RNAi construct. Initial screens for pho-
ribulose-1,5-bisphosphate carboxylase-oxygenase torespiratory pathways could effectively im- toprotection by alternative pathway function
(RuBisCO), but photorespiration occurs in most prove C3 field crop productivity, we tested the under high–photorespiratory stress conditions
plants such as soybean, rice, and wheat (known performance of three alternative photorespi- identified three to five independent transfor-
as C3 crops) when RuBisCO oxygenates RuBP ratory pathways in field-grown tobacco. One mants of each design for further analysis. Gene
instead, requiring costly processing of toxic pathway used five genes from the Escherichia and protein expression analyses confirmed ex-
byproducts such as glycolate. Photorespiration coli glycolate oxidation pathway; a second path- pression of the introduced genes and suppres-
can reduce C3 crop photosynthetic efficiency way used glycolate oxidase and malate syn- sion of the native transporter in RNAi plants.
by 20 to 50%. Although various strategies exist thase from plants and catalase from E. coli; and In greenhouse screens, pathway 1 increased
for lowering the costs of photorespiration, the third pathway used plant malate synthase biomass by nearly 13%. Pathway 2 showed no
chamber- and greenhouse-grown plants with and a green algal glycolate dehydrogenase. All benefit compared to wild type. Introduction of
pathway 3 increased biomass by 18% without
RNAi and 24% with RNAi, which were con-
sistent with changes in photorespiratory me-
tabolism and higher photosynthetic rates.
Ultimately, field testing across two different
growing seasons showed >25% increase in
biomass of pathway 3 plants compared to wild
type, and with RNAi productivity increased by
>40%. In addition, this pathway increased the
light-use efficiency of photosynthesis by 17% in
the field.

CONCLUSION: Engineering more efficient


photorespiratory pathways into tobacco while
inhibiting the native pathway markedly in-
creased both photosynthetic efficiency and
vegetative biomass. We are optimistic that sim-
ilar gains may be achieved and translated into
increased yield in C3 grain crops because pho-
torespiration is common to all C3 plants and
higher photosynthetic rates under elevated CO2,
which suppresses photorespiration and in-
creases harvestable yield in C3 crops.

The list of author affiliations is available in the full article online.
*Corresponding author. Email: d-ort@illinois.edu
This is an open-access article distributed under the
terms of the Creative Commons Attribution license
Alternative photorespiratory pathways in tobacco. Three alternative pathways [1 (red), (https://creativecommons.org/licenses/by/4.0/), which
2 (dark blue), and 3(light blue)] introduced into tobacco chloroplasts for more efficient recycling permits unrestricted use, distribution, and reproduction in
any medium, provided the original work is properly cited.
of glycolate. RNAi suppresses the native glycolate/glycerate transporter PLGG1 to prevent glycolate Cite this article as P. F. South et al., Science 363, eaat9077
from leaving the chloroplast and entering the native pathway (gray). (2019). DOI: 10.1126/science.aat9077

South et al., Science 363, 45 (2019) 4 January 2019 1 of 1


Corrected 4 January 2019. See full text.
R ES E A RC H

◥ piratory alternative pathway (AP) designs, ex-


RESEARCH ARTICLE pressing as many as seven genes in single con-
structs (Fig. 1A and table S1). Tobacco is an
ideal model crop for these studies because of its
PLANT SCIENCE completely sequenced genome, short life cycle
(3 months from seed to seed), well established

Synthetic glycolate metabolism high-efficiency transformation protocols, and the


ability to form a fully closed canopy like other
crops in the field. The AP1 construct targets the
pathways stimulate crop growth and five genes of the Escherichia coli glycolate oxi-
dation pathway to the chloroplast (Fig. 1A) (14).

productivity in the field AP2 includes Arabidopsis glycolate oxidase (GO)


and Cucurbita maxima (pumpkin) malate syn-
thase (MS), along with a catalase (CAT) from
Paul F. South1,2, Amanda P. Cavanagh2, Helen W. Liu3*, Donald R. Ort1,2,3,4† E. coli (Fig. 1A) (15). AP3 also contains C. maxima
MS sequence but replaces the plant GO used in
Photorespiration is required in C3 plants to metabolize toxic glycolate formed when AP2 with Chlamydomonas reinhardtii glycolate
ribulose-1,5-bisphosphate carboxylase-oxygenase oxygenates rather than carboxylates dehydrogenase (CrGDH) to avoid hydrogen per-
ribulose-1,5-bisphosphate. Depending on growing temperatures, photorespiration can oxide production when glycolate is converted
reduce yields by 20 to 50% in C3 crops. Inspired by earlier work, we installed into to glyoxylate (Fig. 1A). With this modification,
tobacco chloroplasts synthetic glycolate metabolic pathways that are thought to be expression of E. coli CAT in the chloroplast is

Downloaded from http://science.sciencemag.org/ on January 6, 2019


more efficient than the native pathway. Flux through the synthetic pathways was unnecessary (17). Using multigene constructs
maximized by inhibiting glycolate export from the chloroplast. The synthetic pathways assembled from modular parts by Golden Gate
tested improved photosynthetic quantum yield by 20%. Numerous homozygous cloning, we generated multiple promoter gene
transgenic lines increased biomass productivity by >40% in replicated field trials. combinations and within-construct position ef-
These results show that engineering alternative glycolate metabolic pathways into fects to optimize AP performance. We generated
crop chloroplasts while inhibiting glycolate export into the native pathway can drive five iterations of AP1, three iterations of AP2, and
increases in C3 crop yield under agricultural field conditions. a single design of AP3 for testing (table S1). In

P
addition to the expression of the AP genes, we
opulation growth, increasing global afflu- oxygenation of RuBP by RuBisCO, which becomes designed a long hairpin RNA interference (RNAi)
ence, and an expanding bioeconomy are more prevalent at higher temperatures and under construct and added it to the library of multigene
conspiring to increase mid-century agri- drought conditions (6, 7). Toxic by-products of the constructs to reduce the expression of the chloro-
cultural demand by 60 to 120% over 2005 RuBisCO oxygenation reaction (2-phosphoglycolate plast glycolate-glycerate transporter PLGG1 with
levels, a challenge that current rates of crop and glycolate) and of the glycine decarboxylation the goal of minimizing glycolate flux out of the
productivity improvement averaging <2% per reaction (ammonia) are recycled by photorespi- chloroplast and into the native pathway (Fig. 1 and
year cannot meet (1–3). In the 45 years after ration into nontoxic products but at the expense table S1) (18, 19). In total, we successfully trans-
1960, global crop productivity increased 135% of energy and net loss of fixed carbon (6, 7). Some formed 17 different constructs of the three AP
from 1.84 to 3.96 metric tons per hectare (4). photosynthetic algae, bacteria, and plants have designs into tobacco with and without the in-
The increased use of pesticides, fertilizers and evolved mechanisms to reduce the oxygenation clusion of an RNAi module targeting the PLGG1
irrigation, and mechanization, along with the reaction by RuBisCO via carbon-concentrating transporter.
adoption of higher-yielding crop varieties that mechanisms (CCMs), including C4 photosynthesis
drove this remarkable global increase in produc- (8, 9), inspiring efforts to introduce CCMs into C3 Gene and protein analysis
tivity, are now largely optimized for major crops plants (8–12). Here we have taken an alterna- confirm chloroplast-localized
and are unlikely to generate sufficient yield in- tive approach of introducing non-native and transgene expression
creases to meet mid-century agricultural demand. synthetic metabolic pathways to recycle the pro- Transgene expression analysis conducted on three
However, photosynthetic efficiency remains stand- ducts of RuBisCO oxygenation more efficiently independent transformants of each AP design
ing as a determinant of yield potential with the (13). Previously, two alternative photorespiratory selected for further analysis confirmed strong
improvement capacity to double crop producti- pathways implemented in Arabidopsis improved expression of the transgenes along with ~80%
vity (1–3, 5, 6). In C3 crops such as wheat, rice, photosynthesis and plant size in chamber and RNAi suppression of PLGG1 expression (Fig. 1B
and soybeans, photorespiration reduces the pho- greenhouse experiments (14, 15). These results and fig. S1). Immunoblot analysis of whole-cell
tosynthetic conversion efficiency of light into inspired us to optimize these alternative photo- extract was normalized on the basis of total pro-
biomass by 20 to 50%, with the largest losses respiratory pathways in tobacco, a useful agri- tein content and verified using antibodies against
occurring in hot dry climates where yield in- cultural model crop, for field trials. Computer the RuBisCO large subunit and actin (fig. S2).
creases are sorely needed. Whereas ribulose-1,5- modeling of these alternative pathways revealed Immunoblot analysis of isolated intact chlo-
bisphosphate carboxylase-oxygenase (RuBisCO) the importance of optimized expression of non- roplasts from AP3 plants (Fig. 1C) verified that
carboxylates ribulose-1,5-bisphosphate (RuBP) dur- native genes to achieve maximum flux through the construct design of AP3 directs CrGDH and
ing photosynthesis, the unproductive and energy- the alternative pathway and thus maximize the MS protein to the chloroplast and that RNAi
intensive process of photorespiration results from benefits for crop plants under field conditions suppresses expression of the PLGG1 transporter
(16). Additionally, we sought to minimize flux protein. The cytoplasmic marker protein actin
1
Global Change and Photosynthesis Research Unit, United through the native photorespiratory pathway and was undetectable in the isolated chloroplast frac-
States Department of Agriculture–Agricultural Research
Service, Urbana, IL 61801, USA. 2Carl R. Woese Institute for
maximize flux through the introduced pathways tion, ensuring that the AP3 proteins in the chloro-
Genomic Biology, University of Illinois, Urbana, IL 61801, USA. by inhibiting glycolate export from the chloroplast. plast fraction was not a result of cytoplasmic
3
Department of Crop Sciences, University of Illinois, Urbana, IL contamination (Fig. 1C). Moreover, the chloro-
61801, USA. 4Department of Plant Biology, University of Illinois, Results plast marker PGL35 was only faintly detectable
Urbana, IL 61801, USA. Transgene assembly
*Present address: Department of Plant and Microbial Biology,
in the whole-leaf extracts but was greatly en-
University of California, Berkeley, CA 94720, USA. We transformed Nicotiana tabacum cv. Petite riched in the isolated chloroplast fraction (Fig.
†Corresponding author. Email: d-ort@illinois.edu Havana (tobacco) with three different photores- 1C). Whereas MS was also greatly enriched in the

South et al., Science 363, eaat9077 (2019) 4 January 2019 1 of 9


Corrected 4 January 2019. See full text.
R ES E A RC H | R E S EA R C H A R T I C LE

the three AP designs were assessed for resistance


to photorespiration stress in a high-throughput
chlorophyll fluorescence assay. Photorespiratory
mutants typically display impaired growth and
photosynthesis when transferred from elevated
CO2 concentrations ([CO2]) to ambient air, which
is accompanied by the onset of photoinhibition
that can be diagnosed by monitoring chlorophyll
fluorescence (19, 22–24). We hypothesized that
AP function would be photoprotective under high
photorespiratory stress, thus protecting photo-
system II operating efficiency (i.e., Fv′/Fm′) from
photodamage (19, 22). Previously, this method
of monitoring Fv′/Fm′ after illumination in low
[CO2] enabled identification of photorespiration
mutants that cause photoinhibition (19, 22, 24).
Using this protocol to monitor AP function,
we exposed thousands of single-insert homozy-
gous T2 seedling plants to 24 hours of high light
intensity (1200 mmol m−2 s−1) and very low [CO2]
(1 to 38 mbar CO2) and then compared Fv′/Fm′ in

Downloaded from http://science.sciencemag.org/ on January 6, 2019


the transformants with azygous wild-type (WT)
and empty vector (EV) controls (fig. S3). Many
independent transformants (66% of AP1, 54%
of AP2, and 84% of AP3 plants) were significantly
more photoprotective under this severe photo-
respiratory stress. Versions of AP1 and AP3
sustained 33 to 48% higher Fv′/Fm′ values com-
pared to WT and EV controls (Fig. 2, A and B, and
data set S1). Under ambient [CO2], there were no
observed differences in Fv′/Fm′ between the AP
and control lines. However, PLGG1 RNAi inhibi-
tion of glycolate efflux from the chloroplast reduced
Fv′/Fm′ when these plants were shifted from ele-
vated [CO2] to ambient (fig. S4). This photo-
inhibited phenotype of the PLGG1 RNAi plants
was not only rescued by transgenic complemen-
tation with AP1 or AP3 constructs, but was also
substantially more resistant to photoinhibition
than WT and EV controls (Fig. 2C and dataset S1).
Fig. 1. Alternative photorespiratory pathways. (A) Model of three alternative photorespiration
pathway designs. AP1 (red) converts glycolate to glycerate using five genes from the E. coli glycolate
AP plants show enhanced biomass
pathway encoding the enzymes glycolate dehydrogenase, glyoxylate carboligase, and tartonic semi-
accumulation in greenhouse
aldehyde reductase. AP2 (dark blue) requires three introduced genes encoding glycolate oxidase, malate
growth studies
synthase, and catalase (to remove hydrogen peroxide generated by glycolate oxidase). AP3 (blue) relies Following the initial photoprotection screen and
on two introduced genes: Chlamydomonas reinhardtii glycolate dehydrogenase and Cucurbita maxima expression analysis, we determined the impact
malate synthase. (B) qRT-PCR analysis of the two transgenes in AP3 and the target gene PLGG1 of the of the three APs on plant growth in greenhouse
RNAi construct. Results for three independent transformation events are shown with (1, 5, and 8) and growth studies. Both the AP1 and AP3 designs
without (8, 9, and 10) PLGG1 RNAi. Error bars indicate SEM. * indicates statistical difference at P < 0.05 significantly increased dry-weight biomass rela-
compared to WT based on one-way ANOVA. Actual P values are shown in supplementary data set 15. tive to the WT plants. Overall, AP1 plants in-
(C) Immunoblot analysis from whole leaves and isolated chloroplasts, including the insoluble membrane creased dry weight biomass by 13%, but the
fraction, using custom antibodies raised against the indicated target genes, cytosolic marker actin, and benefit was lost when the PLGG1 RNAi module
chloroplast-specific marker platoglobulin 35 (PGL35). Five micrograms of protein was loaded per lane. was present (Fig. 3B). AP2 introduction did not
Arrows indicate detected protein based on molecular weight. The kinetic properties of CrGDH, as well as significantly alter dry weight (Fig. 3B). Three
numerous malate synthase enzymes, have been previously characterized (table S3) (17). AP3 lines that sustained much higher Fv′/Fm′
values (200-8,9,10) compared to WT and EV
were taller (Fig. 3A) and showed the largest
chloroplast fraction, CrGDH appeared to be much 1C) and that CrGDH was enriched relative to increases in biomass in greenhouse studies,
less enriched in this fraction (Fig. 1C). Glycolate PGL35 in the membrane fraction. with a 24% increase with and 18% increase
dehydrogenases have be shown to strongly asso- without the PLGG1 RNAi module compared to
ciated with membranes in both chlorophytes and AP plants are resistant to WT (Fig. 3B). We also tested an AP3 line that
bacteria (20, 21) and thus may have been ineffi- photorespiration stress had the same Fv′/Fm′ as WT and EV (200-4),
ciently extracted from our chloroplast prepara- Following selection for construct expression by which showed no increase in biomass, and one
tion (17). Isolation of the insoluble membrane selectable marker screening [BASTA resistance line that had an intermediate Fv′/Fm′ (200-6)
fraction from the chloroplast extraction showed (bar) gene added to all constructs] (table S1) and that showed a small but statistically significant
that a large fraction CrGDH in tobacco chloro- genotyping selection for single-insert homozygous biomass increase in greenhouse studies (fig. S5,
plasts was associated with the membranes (Fig. transgenic plants, all independent constructs of A and C). Transcript expression analysis of AP3

South et al., Science 363, eaat9077 (2019) 4 January 2019 2 of 9


Corrected 4 January 2019. See full text.
R ES E A RC H | R E S EA R C H A R T I C LE

Fig. 2. AP plant lines are more photoprotective under photo-


respiration stress. (A) Representative photos of 9-day-old T2
transgenic tobacco lines during the chlorophyll fluorescence
photoprotection screen for AP pathway function showing AP3
protecting photosystem II from photodamage under severe
photorespiratory conditions. (B) Combined values of the three
AP construct designs with and without RNAi targeting the
glycolate-glycerate transporter PLGG1. Error bars indicate SEM.
* indicates statistical difference compared to WT based on
one-way ANOVA at P ≤ 0.05, ** P ≤ 0.001. Fvʹ/Fmʹ for
individual lines is described in supplementary data set 1.
Actual significant P values are shown in supplementary
data set 15.

events 200-4 and 200-6 revealed that CrGDH and tron transport (Jmax) in any AP design (fig. S6). from increased mesophyll conductance (gm; i.e., the
MS expression was greatly reduced compared Increases in Vcmax, which is a property of RuBisCO diffusion of CO2 into mesophyll cell chloroplasts)
to transgenic events 200-8,9,10 (fig. S5B). enzymatic activity, could be due to increased or from the direct release of photorespiratory
RuBisCO protein content or increased availabil- CO2 in the chloroplast by the decarboxylation of
AP3 plants have an altered

Downloaded from http://science.sciencemag.org/ on January 6, 2019


ity of CO2 as a substrate for RuBisCO. Immuno- malate and pyruvate in the plastid (Fig. 1A), both
photorespiratory metabolite profile blot analysis shows no difference in RuBisCO of which would result in observed increase in
We further investigated the AP3 plants that showed content on a per microgram protein basis (fig. S2), Vcmax determined from A/Ci curves (26). There
the greatest growth stimulation and gene expres- suggesting that the observed difference is based is no apparent reason to expect that the intro-
sion to determine the effect of AP3 enzymes on on increased availability of CO2 at the site of car- duction of these alternative pathways would de-
the leaf photorespiratory metabolite profile. We boxylation in the chloroplast. Increases in CO2 crease the resistance for the movement of CO2
performed gas chromatography followed by mass availability for RuBisCO carboxylation could arise from the mesophyll intercellular air space to the
spectrometry on leaf samples from greenhouse-
grown WT and AP3 plants to analyze the pho-
torespiratory intermediates glycolate, glyoxylate,
glycine, and serine and the AP3-specific inter-
mediate pyruvate (Fig. 4). AP3 introduction
with and without the RNAi module increased
glyoxylate and pyruvate concentration compared
to WT, suggesting altered native photorespira-
tion and possibly flux through the alternative
pathway (Fig. 4, B and F). AP3 plants with and
without the RNAi module also had decreased
concentrations of the photorespiratory inter-
mediates serine, for which photorespiration
is a major source (25), and glycerate, possibly due
to a diversion of carbon away from the native
photorespiratory pathway (Fig. 4, D and E).
Glycine concentrations were similar in AP3 and
WT plants (Fig. 4C). AP3 with the RNAi module
targeting the glycolate-glycerate transporter PLGG1
had increased glycolate accumulation compared to
WT in a manner similar to the Arabidopsis T-DNA
insertion mutant plgg1-1 (Fig. 4A) (18, 19).

AP3 plants exhibit increased


photosynthetic rate and
chloroplast [CO2]
To test if altered photorespiration due to intro-
duction of the AP3 design in plants affects rates
of photosynthesis, we compared CO2 assimila-
tion rates (A) as a function of intercellular CO2
concentrations (Ci) under saturating light in AP3
and WT plants. AP3 plant lines with and without
the PLGG1 RNAi module had increased rates of
photosynthesis compared to WT (Fig. 5A). Model-
ing of the A/Ci curves showed increases in the Fig. 3. Photorespiration AP lines increase biomass under greenhouse conditions. (A) Photos of
maximum rate of RuBisCO carboxylation (Vcmax) 6-week-old AP3 and WT plants grown in the greenhouse. Individual plant lines are indicated in the
visualized in the initial slope of the A/Ci curve in labels below the plant. (B) Percent difference in total dry weight biomass of the indicated combined
AP3 lines (Fig. 5, A and C). We observed no sta- plant lines. * indicate statistical difference based on one-way ANOVA. Error bars are SEM, n = 7
tistical differences in the maximum rate of elec- (plants measured), P < 0.05 values listed in data set 15.

South et al., Science 363, eaat9077 (2019) 4 January 2019 3 of 9


Corrected 4 January 2019. See full text.
R ES E A RC H | R E S EA R C H A R T I C LE

Fig. 4. Photorespiratory and AP3 metabolic intermediates. (A to F) Relative amount of the indicated
metabolite detected from ~40 mg of leaf tissue (fresh weight; FW) sampled in the late morning.

Downloaded from http://science.sciencemag.org/ on January 6, 2019


Metabolite concentrations were reported as concentrations relative to the internal standard, which is
the target compound peak area divided by peak area of hentriacontanoic acid: Ni (relative concentration) =
Xi (target compound peak area) * X−1IS (peak area of hentriacontanoic acid) per gram fresh
weight. Error bars indicate SEM, n = 4 leaf samples. Statistical differences between AP3 designs
and WT based on one-way ANOVA, with P values indicated. All P values are listed in dataset 15.
Fig. 5. Photosynthetic efficiency of
greenhouse-grown plants. Data are the
combined result of three independent trans-
chloroplast stroma or from the mitochondria to AP plants show increased formants (hereafter referred to as combined)
the chloroplast stroma. However, an increase in photosynthetic rates, quantum with and without PLGG1 RNAi. (A) CO2 assim-
gm contributing to increased CO2 availability efficiency, and biomass accumulation in ilation based on intercellular [CO2] (Ci).
within the AP3 plant chloroplast is difficult to replicated field trials (B) Combined apparent CO2 compensation
rule out, largely because modeling of gm requires In the 2016 growing season, we tested four in- point: Ci* calculated using the common inter-
knowledge of, or assumptions about, the con- dependent events of AP1, two independent events cept method and slope regression (29).
ductance of CO2 released from the mitochondria of AP2, and five independent transformation (C) Combined maximum rate of RuBisCO
during the conversion of glycine to serine to the events of AP3, along with two WT and two EV carboxylation (Vcmax). Vcmax values are
chloroplast, which is directly affected by the in- controls in the field, using a randomized single presented at 25°C and modeled from photo-
troduction of the alternative pathway. block design experiment (fig. S8). Biomass in- synthetic response under changing CO2 con-
Theory predicts that the release of photores- creased by 16% in AP1 lines and 10% in one of the centration. Gray bars indicate constant Ci*;
piratory CO2 in the chloroplast by the AP path- AP2 lines tested (fig. S9). The three AP3 lines that green bars indicate derived values based on
ways, instead of in the mitochondria through the showed the largest biomass increases in the green- measured Ci*. Error bars indicate SEM. P values
native photorespiratory pathway, would lower house consistently showed the largest increases for statistical comparison to WT based on
Ci*, the intercellular [CO2] at which the chloro- in dry-weight biomass, with total biomass increas- one-way ANOVA are given.
plast [CO2] reaches G*, the [CO2] in the chloro- ing by as much as 23% relative to WT (fig. S9).
plast at which the rates of RuBisCO oxygenation Independent AP3 events 200-4 and 200-6, in
and carboxylation are equal (27–29). To deter- which CrGDH and MS expression was signifi- five randomized replicate blocks of three AP3 in-
mine Ci*, we measured the internal [CO2] at cantly lower compared to other transgenic events dependent transformed lines with and without
which CO2 response curves measured at differ- (fig. S5B) and showed less or no improvement in the RNAi module targeting PLGG1 in compar-
ent subsaturating illumination intensities intersect greenhouse biomass (fig. S5C), also showed no ison to WT during the 2017 growing season (fig.
(29). AP3 plants with the RNAi module targeting increases in total biomass in the 2016 field season S12). The AP3 plant lines showed a 25% increase
PLGG1 showed a significant reduction of 10% in (fig. S9). We anticipated, owing to their lower en- in total dry-weight biomass (22% leaf, 44% stem),
Ci* and AP3 plants without the RNAi module ergetic requirements, that the AP pathways would and the inclusion of the PLGG1 RNAi module in
showed a significant reduction of 6.4% in Ci* improve the maximum quantum efficiency of net AP3 designs further increased leaf dry biomass
compared to WT (Fig. 5B). The observed decreases CO2 assimilation (Fa) relative to the native path- to 33%, stem dry biomass to 50%, and total dry
in Ci*, coupled with unaltered respiration (fig. S7), way. Fa increased in lines of all AP pathways, in biomass to 41% compared to WT (Fig. 6A). That
are consistent with elevated chloroplastic [CO2] many cases by >20%, including those containing AP3 plant lines with the RNAi module showed
due to decarboxylation of malate and pyruvate the RNAi module targeting the PLGG1 transport- a significant leaf and total dry weight biomass
within the introduced pathway (Figs. 1A and 5B er (fig. S10) but not in AP3 events 200-4 and 200-6 increase (12% and 17%, respectively) over the
and fig. S6), which would also explain the signifi- (fig. S11A). The high–biomass-producing AP3 plant AP3-only plants supports our hypothesis that
cantly higher values of Vcmax in AP3 plants com- lines exhibited an increased light-saturated rate forcing greater glycolate flux through the syn-
pared to WT plants (Fig. 5, A and C, and fig. S6). of assimilation compared to WT, to several AP1 thetic pathway by inhibiting flux through the
Accounting for the observed Ci* in A/Ci curve lines, and to all AP2 plant lines (fig. S10C) and to native photorespiratory pathway drove the in-
analysis reduces the apparent change in Vcmax AP3 events 200-4 and 200-6 (fig. S11). creased productivity. Total mid-day starch con-
further indicating that the difference in Vcmax was To validate the 2016 field results and improve tent in AP3 plants increased by ~70% and in AP3
not due to changes in RuBisCO content or activity the statistical power of comparisons with AP3 with PLGG1 RNAi by ~40% compared to the
but rather by increased chloroplastic [CO2] (Fig. 5C). plants under agricultural conditions, we tested WT control (Fig. 6B). The apparent quantum

South et al., Science 363, eaat9077 (2019) 4 January 2019 4 of 9


Corrected 4 January 2019. See full text.
R ES E A RC H | R E S EA R C H A R T I C LE

and field settings when the PLGG1 RNAi module


was added (Fig. 3 and fig. S9). Modeling (16)
predicted that directing the complete flux of gly-
colate through the AP1 pathway by inhibiting
glycolate export from the chloroplast would re-
sult in the largest increase in energy savings,
photosynthetic efficiency, and growth among all
designs. Elimination of the AP1 enhancements
by the PLGG1 RNAi module implies that this
introduced pathway may not have had sufficient
kinetic capacity to handle the full glycolate flux
under high rates of RuBisCO oxygenation. Fur-
ther optimization of expression of AP1 genes
and/or use of AP1 genes of different origins and
kinetic properties may lead to achieving the full
benefits that modeling predicts for this design.
The AP3 design containing C. maxima MS and
CrGDH reliably increased plant biomass and im-
proved photosynthetic efficiency (Figs. 3, 5, and 6),
and the phenotype is dependent on the level of
expression of the transgenes in the independent

Downloaded from http://science.sciencemag.org/ on January 6, 2019


transformation events (fig. S5). The inclusion of
an RNAi module to reduce expression of the
PLGG1 chloroplast glycolate-glycerate transporter
Fig. 6. Plant productivity and photosynthetic performance in 2017 field trials. (A) Percent in numerous independent transformant plant
difference from WT for stem, leaf, and total biomass of AP3 with and without the PLGG1 RNAi lines increased postharvest dry-weight biomass
module. Data are the combined result of three independent transformants with and without PLGG1 compared to AP3 introduction alone by 17% (P <
RNAi. * indicates significance compared to WT and ** indicates significance between WT and 0.001) (Figs. 3 and 6A and fig. S13). Without an
AP3-only lines compared to AP3 with RNAi lines. P values are shown in supplementary data alternative photorespiration pathway in place,
set 15. (B) Total combined accumulated leaf starch for indicated lines extracted from 10 mg of inhibition of PLGG1 expression by RNAi decreased
fresh weight leaf material. (C) Combined apparent quantum efficiency of photosynthesis (Fa) plant growth and led to photoinhibition (i.e., re-
determined by linear regression of assimilation based on available light-response curves. duced Fv′/Fm′) when these plants were transfer-
(D) Combined accumulated assimilation of CO2 (A′) based on diurnal analysis of photosynthesis. red from elevated [CO2] to ambient air (fig. S4),
(E) Combined accumulated electrons used in electron transport determined from assimilation as was reported previously for the plgg1-1 T-DNA
based on diurnal photosynthesis. Error bars indicate SD, and P values are indicated based on knockout line in Arabidopsis (23). Thus, the genet-
two-way ANOVA. ic complementation of the low-growth photo-
inhibited phenotype and the significant increase
in biomass in AP3 lines with RNAi over AP3 alone
efficiency of photosynthesis increased in both AP3 tions depicted in Fig. 1 include the stimulation of are consistent with the expected benefit of direct-
plant pathways; by 7% with and 17% without the rate of photosynthesis (Fig. 5) and improve- ing a greater proportion of the glycolate flux
PLGG1 RNAi for the 2017 field season (Fig. 6C ment of photosynthetic quantum yield (Fig. 6 and through the synthetic pathway in the chloro-
and fig. S13). Because plants with both AP3 de- fig. S10), the lowering of Ci* (Fig. 5) and increase plast and away from the native photorespiratory
signs exhibited increases in the quantum efficien- in the initial slope of an A/Ci relationship (Fig. 5) pathway outside of the chloroplast (18, 19). In-
cy of photosynthesis and decreases in Ci*, we that both indicate increased [CO2] in the chloro- deed, forcing greater glycolate flux through the
hypothesized that total daily net carbon gain plast, and the altered photorespiratory metab- synthetic pathway by inhibiting glycolate trans-
through photosynthesis would be higher com- olite profile (Fig. 4). In addition, the direct role port out of the chloroplast through PLGG1 into
pared to WT, resulting in the observed increases of this pathway in chloroplast glycolate metabo- the native photorespiratory pathway resulted in
in biomass over the growing season (Figs. 5B and lism is supported by its ability to prevent photo- growth stimulation in field trials of >40% for the
6, A and C). Indeed, modeled daily net carbon inhibition and rescue the reduced growth phenotype AP3 plants with RNAi. The glycolate-glycerate ex-
gain from measurements of photosynthesis over of PLGG1 RNAi tobacco lines (fig. S4). Moreover, change transporter PLGG1 works in tandem with
a diurnal time course in plants containing AP3 AP3 lines that contain the full transgene construct a second glycolate exporter BASS6 to stoichiomet-
showed an increase of 5 to 8% in CO2 assimila- but with reduced transgene expression showed rically balance the export of two glycolate mole-
tion (A′ ) and increases in electron use in photo- less, or no improvement in greenhouse (fig. S5C) cules with the import of one glycerate molecule
synthesis (J ′) compared to WT (Fig. 6, D and E). or field biomass (fig. S9), and Fa values similar during photorespiration (18). Thus, targeting the
to WT (fig. S11) provide evidence that the amount expression of both transporters may further test
Discussion of expression of the introduced alternative photo- AP3 kinetic capacity and may drive even greater
We showed that installing synthetic glycolate respiratory pathway drove the extent of im- growth stimulation. Recognizing that these alter-
metabolic pathways into tobacco chloroplasts proved growth and increased photosynthetic native pathways are intervening in the central
drove large increases in biomass accumulation in efficiency. metabolism of photosynthetic cells, it will be
both greenhouse conditions and in the field un- Of the two alternative pathways to photores- important to validate the biochemistry that is
der agricultural conditions. Because AP3 plants piration that inspired our designs (13, 14), AP2 occurring as AP pathway intermediates may well
exhibited the greatest growth stimulation, we showed limited improvements in plant produc- have destinations that are different from those
selected this pathway for more in-depth char- tivity, and 24% of the independent transgenic depicted in Fig. 1A.
acterization. In summary, the AP3 transgene pro- AP2 lines resulted in stunted growth and yellow Although inhibiting photorespiration under
ducts CrGDH and MS localized to the chloroplast leaves (fig. S14C). The AP1 design improved pro- normal oxygen-containing atmospheres invaria-
(Fig. 1C). Evidence that these transgene products ductivity in tobacco, but the enhancement asso- bly results in inhibited photosynthesis and growth
function in the chloroplast to catalyze the reac- ciated with AP1 was eliminated in both greenhouse (7), some evidence indicates that stimulating

South et al., Science 363, eaat9077 (2019) 4 January 2019 5 of 9


Corrected 4 January 2019. See full text.
R ES E A RC H | R E S EA R C H A R T I C LE

photorespiratory flux can enhance photosyn- timistic that use of alternative metabolic path- chamber (fig. S1). The light levels were increased
thetic rate and plant growth. Overexpression of ways to photorespiration will also lead to increases to 1200 mmol m−2 s −1 for 24 hours and [CO2] was
the H-protein in the glycine decarboxylase com- in seed yield. Indeed, in this work, the observed maintained below 38 mbar (fig. S1). For PLGG1
plex or overexpression of plant glycolate oxidase stimulation of whole-plant biomass production RNAi-only plants, which have strongly depressed
(GO) can lead to increased photosynthesis and was much larger than the stimulation of photo- photorespiratory capacity, T1 lines were germi-
biomass production (30, 31). In both of these re- synthesis on a leaf area basis (5 to 8% increase in nated on soil under elevated [CO2] conditions
ports, the overexpression of these photorespira- CO2 assimilation resulting in 25 to 41% increase for 9 days and transferred to ambient air for 3 days
tion genes was accompanied by an increase in in dry-weight biomass; compare Fig. 6A with Fig. prior to screening. Fv′/Fm′ was determined on
stomatal conductance that itself would be ex- 6, D and E), showing the benefit of compound each plate using the CF Imager Technologica
pected to increase photosynthesis and growth interest from creating greater leaf area earlier in (http://www.technologica.co.uk/). Maximum flash
under water-replete conditions. Conversely, four the growth cycle. intensity was 6800 mmol m−2 s−1 for 800 ms. Image
different photorespiration mutants (pglp1, shm1, values were obtained for each individual plant by
hpr1, and glyk1) partially lost stomatal respon- Materials and Methods detecting colonies within the fluorimager soft-
siveness to altered CO2 availability, possibly in- Plant genetic transformation ware program defining each position as described
dicating that alternative pathways could influence Nicotiana tabacum cv. Petite Havana was genet- (19, 22, 40).
plant adaptation through stomatal signaling (32). ically transformed using Agrobacterium tume-
We saw no statistical differences in stomatal con- faciens strain C58C1-mediated transformation Gene expression and protein detection
ductance (fig. S15, A and B) or the expression of (37). The 17 binary plasmids used in this study Plants were grown under greenhouse or field
GO (fig. S15C) in AP3 tobacco plants, indicating were assembled as described and listed in table conditions as described below. Five leaf discs
that neither of these contributed to the stimula- S1 (19). AP1 genes originated from E. coli (14). were harvested from three plants per line (2.9 cm2,
tions observed in AP3 plant lines. Whether the AP2 genes originated from Arabidopsis thaliana ~100 mg). RNA and protein were extracted from

Downloaded from http://science.sciencemag.org/ on January 6, 2019


installation of these alternative pathways may (glycolate oxidase) and Cucurbita maxima (malate the same leaf samples using the NucleoSpin RNA/
affect global changes in the transcriptome and synthase) and E. coli (catalase) sources as described Protein kit (Macherey-Nagel GmbH & Co.KG,
the proteome and if that may have secondary (15, 38). AP3 genes originated from Chlamydomo- Düren, Germany). cDNA was generated from
impacts on plant growth outside of changes to nas reinhardtii for glycolate dehydrogenase and as extracted RNA using the Quantinova reverse tran-
primary metabolism remain to be determined. described for AP2 for C. maxima malate synthase scriptase kit (QIAGEN, USA). A minimum of three
Energy demand calculations suggest that AP3 (15, 17). Targeting to the chloroplast was designed biological replicates, including three technical
would consume more adenosine 5´-triphosphate by the addition of either the Arabidopsis RuBisCO replicates each, were performed for all samples.
than native photorespiration, similar to AP2 (33). small subunit (RbcS) or phosphoglucomutase Gene expression was analyzed using a Bio-Rad
It is likely that CrGDH uses the electron trans- transit peptide sequence added to the N terminus CFX connect real-time PCR system (Bio-Rad Lab-
port chain as an electron acceptor (17), and the of the gene constructs. The RNAi module that oratories, USA). Relative changes in transcript
decarboxylation of malate and pyruvate generate targets the plastidic glycolate-glycerate trans- levels were determined using the DDCt method
reducing equivalents (Fig. 1). However, the global porter PLGG1 was designed using 300 base pairs with primers directed toward the transgene
effect of AP3 and PLGG1 repression on energy of exon sequence derived from the Sol genomics transcripts and the L25 gene as a standard con-
balance, as well as the possible fate of inter- network (https://solgenomics.net). All binary trol gene (41). cDNA was amplified using a SSO
mediates from AP3 in sucrose synthesis or the plasmids contained the BASTA resistance (bar) advanced SYBR green master mix (Bio-Rad), and
tricarboxylic acid cycle, will need to be assessed gene as a selectable marker for plant transfor- primer sequences are described in table S2.
(17, 33). mation. A minimum of 10 independent T0 trans- Total protein from AP3 was extracted using the
Tobacco was selected for these proof-of-concept formations were generated to produce T1 progeny. Nucleospin protein/RNA kit described above or
experiments not only for its ease of genetic trans- T-DNA copy number was determined on T1 plants from frozen leaf material ground in liquid nitro-
formation but also because it is an ideal model through quantitative reverse transcription– gen, resuspended in lysis buffer [50 mM HEPES
crop that is robust in the field, forms a fully closed quantitative polymerase chain reaction (qRT-PCR) (pH 7.6), 300 mM sucrose, 2 mM MgCl2] plus
canopy, and produces large quantities of seed, analysis (iDNA Genetics, Norwich UK) (dataset plant protease inhibitor cocktail (Sigma-Aldrich).
circumventing the need for numerous seed am- 17) (39). From these results, a minimum of five Protein was quantified using the protein quan-
plification generations, further accelerating the independent transformation events were selec- tification assay (Macherey-Nagel GmbH & Co.
timeline to field testing. The photorespiratory ted to self and produce T2 progeny. Copy-number KG, Düren, Germany). Unless indicated other-
mechanism is common to all C3 plants, although analysis was repeated to verify single insert homo- wise, 5 mg of protein was loaded per lane and
energetic costs and yield reductions depend on zygous lines for each transformation event. Non- separated by 10% SDS–polyacrylamide electro-
species-specific kinetic properties of RuBisCO, as single insert lines were not further characterized phoresis (SDS-PAGE). PAGE gels were transferred
well as the temperature and [CO2] under which (for a representative timeline of characterization to polyvinylidene difluoride (PVDF) membranes
the crop is growing. Previous work has demon- of AP3 lines see dataset 20). All WT controls used (Immobilon-P, Millipore, USA) using a Bio-Rad
strated that alternative photorespiration pathways in this study were azygous plants, which have semi-dry transfer system or the Bio-Rad Trans-
show a benefit to crop plants Camelina sativa (34) been through the transformation protocol but Blot turbo system. After blocking in a 6% milk
and potato (35) in greenhouse and chamber ex- lost the construct including the selectable marker TBS solution, membranes were incubated with
periments, but it remains to be seen whether the resistance during segregation. custom antibodies raised against the malate syn-
increase in vegetative biomass that we observed thase (MS) and PLGG1 (Agrisera, Vännäs, Sweden)
in tobacco with AP3 in the field can be translated Chlorophyll fluorescence measurements and glycolate dehydrogenase (GDH) (Genscript,
into increased seed or tuber production in crops Tobacco T2 seeds were germinated under am- USA). As a protein loading control, antibodies
such as soybean, cowpea, and potato. In green- bient air conditions on Murashige and Skoog raised against the large subunit of RuBisCO (RbcL)
house studies, only one AP3 line containing the (MS) plates with essential vitamins in a con- and actin were used (Agrisera, Vännäs, Sweden).
PLGG1 RNAi module showed a significant in- trolled environment chamber (Environmental After subsequent washing and incubation with
crease in total seed weight (fig. S13E), but seed Growth Chambers, Chagrin Falls, Ohio, USA) anti-rabbit secondary antibody (Bio-Rad, USA),
is not a major sink in tobacco as it is in grain with 14 hours day (25°C)/10 hours night (22°C) chemiluminescence was detected with the Image-
crops. However, because increased photosynthe- and light intensity of 500 mmol m−2 s −1. Eight Quant LAS4010 scanner (GE Healthcare Life
tic efficiency due to the suppression of photo- days after germination, seedling plates were Sciences, Pittsburgh, USA).
respiration in C3 crops grown in elevated [CO2] transferred to a custom assembled low-[CO2] Chloroplasts were isolated in a manner sim-
results in increased seed yield (5, 36), we are op- chamber inside the controlled environment growth ilar to that described (19), with tobacco-specific

South et al., Science 363, eaat9077 (2019) 4 January 2019 6 of 9


Corrected 4 January 2019. See full text.
R ES E A RC H | R E S EA R C H A R T I C LE

modifications following (42). Leaf tissue was col- Growth analysis (greenhouse) (Asat) was determined at 1200 mmol m−2 s−1 light
lected from 6-week-old WT and AP3 plants, Homozygous single-insert T2 seeds were germi- intensity at the indicated [CO2]. Leaf and stem
briefly homogenized in extraction buffer [50 mM nated on LC1 Sunshine mix (Sun Gro 202 Horti- biomass were determined for 16 plants per plot
MES-NaOH (pH 6.1), 0.33 M sorbitol, 2 mM EDTA, culture, Agawam, MA, USA). Ten days after at 7 weeks post planting. Aboveground biomass
2 mM MgCl2, 1 mM MnCl2, 20 mM NaCl, 2 mM germination, seedlings were transferred to 4L was harvested and separated into leaf and stem
isoascorbic acid, and 1% polyvinypyrrolidone- pots (400C, Hummert International, Earth City, fractions. Plant material was dried at 65°C to
40], filtered through three layers of Miracloth MO, USA) with LC1 Sunshine mix supplemented constant weight for a minimum of 2 weeks prior
(Calbiochem), and centrifuged at 4°C for 4 min with slow-release fertilizer (Osmocote Plus 15/9/ to biomass measurements.
at 2500g to pellet chloroplasts. Pelleted chloro- 12, The Scotts Company LLC, Marysville, OH, To increase the statistical power of the field
plasts were resuspended in 5 ml of buffer [50 mM USA). Pots were randomized within the green- experiment, the 2017 growing season focused on
HEPES-NaOH (pH 6.8), 0.33 M sorbitol, 2 mM house and positions were changed before each six independent transgenic AP3 lines. The field
EDTA, 2 mM MgCl2, 1 mM MnCl2, 5 mM iso- watering approximately every 4 to 5 days. Green- design consisted of five replicate blocks with
ascorbic acid, 1 mM sodium pyrophosphate, 5 mM house growth conditions are tabulated in sup- seven randomized 6 × 6 plants plots per block
glutathione] using a fine paintbrush, applied to a plementary dataset 12. Aboveground biomass was (fig. S11). The central 16 plants were the AP3
20-ml Percoll density gradient [top to bottom: harvested and dried for 2 weeks to attain constant transgenic line or WT surrounded by a WT
40% (v/v) and 90% (v/v) Percoll in resuspension weight, and dry weights determined for stem and border. The entire 35 plot-area was surrounded
buffer], and centrifuged at 4°C for 30 min at leaf fractions. Stem fractions included reproduc- by an additional row of WT as a border. Single-
2500g. Intact chloroplasts accumulated at the tive material developed at time of final harvest. insert homozygous T2 lines generated from the
40 to 90% interface and were removed by aspira- same harvest time were sown on LC1 Sunshine
tion, washed twice in 10 volumes of resuspension Field experiments mix and germinated for 7 days. After 7 days,
buffer, and collected by centrifugation for 10 min In 2016, five independent transformation events seedlings were transplanted to floating trays as

Downloaded from http://science.sciencemag.org/ on January 6, 2019


at 2500 g. of AP3, four events of AP1, and two independent described above. Fourteen days after transplant
Plastid proteins were extracted by lysing the transformations of AP2, with two wild type (WT) to floating trays, plants were transplanted at the
chloroplasts in a hypotonic buffer [10 mM Tricine- and two empty vector (EV) controls, were planted Energy Farm field station at the University of
NaOH (pH 8.0), 1% (v/v) plant protease inhibitor in a randomized single block design. Homozygous Illinois, Urbana, IL, USA, on 21 June 2017. Water-
cocktail (Sigma-Aldrich), and 5 mM dithiothreitol single-insert T2 seeds were germinated in pots ing was provided as needed using parallel drip
(DTT)], followed by two freeze-thaw cycles. In- containing soil mix (Sun Gro 202 Horticulture, irrigation. Photosynthesis measurements to deter-
soluble membrane fractions from the chloroplast Agawam, MA, USA) on 14 May 2016 and grown mine Fa were performed 2 to 5 July, 2017, and Fa
isolation were isolated by centrifugation at 10,000 g for 7 days before transferal to floating trays as was measured as described above. Measurements
for 5 min. The pellet was resuspended in 2× SDS described (43). Plants were transplanted at the of CO2 assimilation in response to light began pre-
sample buffer plus 10% DTT, then briefly soni- University of Illinois Energy Farm field station dawn and were conducted at light intensities
cated. The membrane fraction proteins were (40.11°N, 88.21°W, Urbana, IL, USA) on 6 June of 0, 10, 18, 25, 30, 40, 65, 120, 380, 1200, and
then precipitated using ice-cold acetone. After 2016 after the field was prepared as described 2000 mmol mol−1. Diurnal measurements of pho-
centrifugation (10,000 g for 5 min), the acetone (43). Each plot consisted of 6 × 6 plants spaced tosynthesis were performed starting pre-dawn
was removed, and the pellet was air dried. The 30 cm apart (fig. S8). The internal 16 plants per on 14 July 2017 and measured every 2 hours on
protein pellet was then resuspended in SDS sam- plot were the indicated transgenic plant lines two plants per plot per block. Light levels and
ple buffer plus 10% DTT. Protein concentration surrounded by a border of 20 WT plants. An ad- chamber temperature was set to ambient values
was then determined using a total protein quan- ditional two-row border of WT plants surrounded based on incoming light levels using a PAR sensor
tification kit (Macherey-Nagel GmbH & Co.KG, the full experiment that consisted of 26 plots. on the Li-Cor 6400XT and a built-in temperature
Düren, Germany). Watering was provided as needed from six water sensor. Reference [CO2] was maintained at 400
towers placed within the experiment. Weather mbar. Diurnal measurements were continued
Photorespiratory metabolite analysis data, including light intensity, air temperature, until after dusk. At 49 days post-germination,
Metabolite analysis was performed as described and precipitation, were measured for the 2016 eight plants per plot were harvested from all
(19). Briefly, ~40 mg of fresh leaf tissue was har- field season as described (43) (supplementary five replicate blocks. Aboveground biomass was
vested from 6-week-old greenhouse-grown plants data set 13). separated into leaf and stem fractions and dried
taken late morning (~10:00 to 11:00 a.m.) and Apparent quantum efficiency of photosynthesis in a drying oven for 2 weeks to constant weight
flash frozen in liquid nitrogen. Leaf material was (Fa) and the light-saturated rate of photosynthetic before biomass measurements. For starch analy-
crushed using a genogrinder (Biospec products) CO2 assimilation at ambient (400 mbar) and low sis, 10 mg of leaf material was collected on 14
and extracted in 100% ice-cold methanol. Samples (100 mbar) [CO2] were measured on the youngest July, frozen in liquid nitrogen, and stored at
were then submitted to the Metabolomics Center, fully expanded leaf 14 to 20 days after trans- −80°C. Starch was assayed using the Enzychrom
Roy J. Carver Biotechnology Center, University of planting in the field. Fa was determined from starch assay kit (Bioassay Systems, Hayward, CA,
Illinois at Urbana-Champaign and processed as assimilation measurements in response to light USA). Colorimetric measurements were per-
described (19). All known artificial peaks were levels at the indicated [CO2]. Gas exchange mea- formed on a Biotek Synergy HT plate reader
identified and removed. To allow comparison surements were performed using Li-Cor 6400XT (Biotek Winooski, VT, USA).
among samples, all data were normalized to the instruments with a 2-cm2 fluorescence measuring
internal standard in each chromatogram and the cuvette for which chamber leaks were corrected Photosynthetic CO2 response
sample fresh weight. The spectra of all chromato- as outlined in the manual (LI-COR Biosciences, Photosynthetic compensation point (Ci*) measure-
gram peaks were evaluated using the AMDIS Lincoln, NE, USA). Measurements of CO2 as- ments were performed using a Li-Cor 6800 (Li-Cor
2.71 program (NIST). Metabolite concentrations similation were conducted at incidental light Biosciences) equipped with a fluorescence cham-
were reported as concentrations relative to the intensities of 1200, 380, 120, 65, 40, 30, 25, 18, ber. Ci* was determined using the common in-
internal standard, which was the target com- and 10 mmol m−2 s−1, and absorbed light was tersection method by measuring the CO2 response
pound peak area divided by peak area of hentria- calculated using an integrating sphere (Ocean- of photosynthesis under various subsaturating
contanoic acid: Ni (relative concentration) = Xi Optics, Largo, FL, USA) (23). Assimilation was irradiances (29, 44, 45). The common intersec-
(target compound peak area) * X−1IS (peak area recorded after a minimum of 120 s at each light tion was determined using slope–intercept regres-
of hentriacontanoic acid) per gram fresh weight. level. Fa was calculated from the slope of the sion to produce more accurate and consistent
The instrument variability was within the stan- initial linear response of CO2 assimilation at low values of Ci* (29). Plants were acclimated under
dard acceptance limit of 5%. light levels. The saturating rate of assimilation 250 mmol m−2 s−1 light at 150 mbar CO2 until

South et al., Science 363, eaat9077 (2019) 4 January 2019 7 of 9


Corrected 4 January 2019. See full text.
R ES E A RC H | R E S EA R C H A R T I C LE

photosynthesis reached steady state and then Sci. U.S.A. 107, 12052–12057 (2010). doi: 10.1073/ photosystem II by suppression of repair but not acceleration of
measured at 150, 120, 90, 70, 50, and 30 mbar pnas.0914216107; pmid: 20551223 damage processes in Arabidopsis. Plant Physiol. 144, 487–494
5. E. A. Ainsworth, S. P. Long, What have we learned from (2007). doi: 10.1104/pp.107.097253; pmid: 17400706
CO2 under light intensities of 250, 165, 120, 80,
15 years of free-air CO2 enrichment (FACE)? A meta-analytic 25. R. M. Benstein et al., Arabidopsis phosphoglycerate
and 50 mmol m−2 s−1. The x-intersection point review of the responses of photosynthesis, canopy dehydrogenase1 of the phosphoserine pathway is essential for
was converted to Ci* according to (29). properties and plant production to rising CO2. New Phytol. development and required for ammonium assimilation and
To determine the net photosynthetic assimila- 165, 351–371 (2005). doi: 10.1111/j.1469-8137.2004.01224.x; tryptophan biosynthesis. Plant Cell 25, 5011–5029 (2013).
pmid: 15720649 doi: 10.1105/tpc.113.118992; pmid: 24368794
tion rate from a CO2 dose response, the fifth leaf
6. H. Bauwe, M. Hagemann, A. R. Fernie, Photorespiration: 26. C. J. Bernacchi, E. L. Singsaas, C. Pimentel, A. R. Portis Jr.,
from the base of 7-week-old N. tabacum plants Players, partners and origin. Trends Plant Sci. 15, 330–336 S. P. Long, Improved temperature response functions for
was measured using a Li-Cor 6800 infrared gas (2010). doi: 10.1016/j.tplants.2010.03.006; pmid: 20403720 models of Rubisco‐limited photosynthesis. Plant Cell Environ.
analyzer (Li-Cor Biosciences, Lincoln, NE, USA) 7. C. Peterhansel, I. Horst, M. Niessen, C. Blume, R. Kebeish, 24, 253–259 (2001). doi: 10.1111/j.1365-3040.2001.00668.x
with leaf temperature controlled at 25°C and S. Kürkcüoglu, F. Kreuzaler, Photorespiration. The Arabidopsis 27. D. Tholen, G. Ethier, B. Genty, S. Pepin, X. G. Zhu,
Book, e0130 (2010). Variable mesophyll conductance revisited: Theoretical
light intensity set at 1500 mmol m−2 s −1. Leaves 8. G. D. Price et al., The cyanobacterial CCM as a source of genes background and experimental implications. Plant Cell Environ.
were acclimated at a [CO2] of 400 mbar to achieve for improving photosynthetic CO2 fixation in crop species. 35, 2087–2103 (2012). doi: 10.1111/j.1365-3040.2012.02538.x;
a steady-state rate of assimilation. The [CO2] of J. Exp. Bot. 64, 753–768 (2013). doi: 10.1093/jxb/ers257; pmid: 22590996
the response curve was set at 400, 200, 100, 50, pmid: 23028015 28. B. J. Walker et al., Uncertainty in measurements of the
9. U. Schlüter, A. P. Weber, The road to C4 photosynthesis: photorespiratory CO2 compensation point and its impact on
30, 400, 600, 800, 1000, 1500, 2000 mbar, and Evolution of a complex trait via intermediary states. models of leaf photosynthesis. Photosynth. Res. 132, 245–255
measurements were taken when assimilation Plant Cell Physiol. 57, 881–889 (2016). doi: 10.1093/pcp/ (2017). doi: 10.1007/s11120-017-0369-8; pmid: 28382593
reached a steady state rate. To determine the pcw009; pmid: 26893471 29. B. J. Walker, D. C. Skabelund, F. A. Busch, D. R. Ort, An
maximum rate of carboxylation (Vcmax) and max- 10. M. Matsuoka, R. T. Furbank, H. Fukayama, M. Miyao, Molecular improved approach for measuring the impact of multiple CO2
engineering of C4 photosynthesis. Annu. Rev. Plant Physiol. conductances on the apparent photorespiratory CO2
imum electron transport rate (Jmax), a model for Plant Mol. Biol. 52, 297–314 (2001). doi: 10.1146/annurev. compensation point through slope-intercept regression.
leaf photosynthesis with temperature corrections arplant.52.1.297; pmid: 11337400 Plant Cell Environ. 39, 1198–1203 (2016). doi: 10.1111/

Downloaded from http://science.sciencemag.org/ on January 6, 2019


was used assuming a mesophyll conductance of 11. M. L. Schuler, O. Mantegazza, A. P. Weber, Engineering pce.12722; pmid: 27103099
0.57 mol−2 s−1 bar−1 (46), then adjusted using the C4 photosynthesis into C3 chassis in the synthetic 30. L. L. Cui, Y. S. Lu, Y. Li, C. Yang, X. X. Peng, Overexpression of
biology age. Plant J. 87, 51–65 (2016). doi: 10.1111/tpj.13155; glycolate oxidase confers improved photosynthesis under high
determined value of Ci*. pmid: 26945781 light and high temperature in rice. Front. Plant Sci. 7, 1165
12. B. M. Long, B. D. Rae, V. Rolland, B. Förster, G. D. Price, (2016). doi: 10.3389/fpls.2016.01165; pmid: 27540387
Statistical analysis Cyanobacterial CO2-concentrating mechanism components: 31. P. E. López-Calcagno et al., Overexpressing the H-protein of
All statistical analysis was performed using Origin Function and prospects for plant metabolic engineering. the glycine cleavage system increases biomass yield in
Curr. Opin. Plant Biol. 31, 1–8 (2016). doi: 10.1016/ glasshouse and field-grown transgenic tobacco plants.
Pro 2016 (version 9.3.226, Origin Lab Corporation j.pbi.2016.03.002; pmid: 26999306 Plant Biotechnol. J. 10.1111/pbi.12953 (2018). doi: 10.1111/
Northampton, MA, USA). For Fv′/Fm′ measure- 13. M. Betti et al., Manipulating photorespiration to increase plant pbi.12953; pmid: 29851213
ments, each plate contained a minimum of 10 productivity: Recent advances and perspectives for crop 32. M. Eisenhut et al., Photorespiration is crucial for dynamic
seedlings and the data shown reflect the aver- improvement. J. Exp. Bot. 67, 2977–2988 (2016). doi: 10.1093/ response of photosynthetic metabolism and stomatal
jxb/erw076; pmid: 26951371 movement to altered CO2 availability. Mol. Plant 10, 47–61
aged values. Significance was evaluated by one- 14. R. Kebeish et al., Chloroplastic photorespiratory bypass (2017). doi: 10.1016/j.molp.2016.09.011; pmid: 27702693
way analysis of variance (ANOVA). Relative changes increases photosynthesis and biomass production in 33. C. Peterhansel, C. Blume, S. Offermann, Photorespiratory
in gene expression were analyzed by one-way Arabidopsis thaliana. Nat. Biotechnol. 25, 593–599 (2007). bypasses: How can they work? J. Exp. Bot. 64, 709–715
ANOVA with three technical replicates per bio- doi: 10.1038/nbt1299; pmid: 17435746 (2013). doi: 10.1093/jxb/ers247; pmid: 22996676
15. A. Maier et al., Transgenic introduction of a glycolate oxidative 34. J. Dalal et al., A photorespiratory bypass increases plant
logical replicate from either greenhouse- or field- cycle into A. thaliana chloroplasts leads to growth growth and seed yield in biofuel crop Camelina sativa.
grown samples. Greenhouse biomass experiments improvement. Front. Plant Sci. 3, 38 (2012). doi: 10.3389/ Biotechnol. Biofuels 8, 175 (2015). doi: 10.1186/s13068-015-
were analyzed by a one-way ANOVA with a min- fpls.2012.00038; pmid: 22639647 0357-1; pmid: 26516348
imum of five biological replicates. Biomass data 16. C. P. Xin, D. Tholen, V. Devloo, X. G. Zhu, The benefits of 35. G. Nölke, M. Houdelet, F. Kreuzaler, C. Peterhänsel,
photorespiratory bypasses: How can they work? S. Schillberg, The expression of a recombinant glycolate
from the 2016 field season were analyzed by a Plant Physiol. 167, 574–585 (2015). doi: 10.1104/ dehydrogenase polyprotein in potato (Solanum tuberosum)
one-way ANVOA with 16 biological replicates. Bio- pp.114.248013; pmid: 25516604 plastids strongly enhances photosynthesis and tuber yield.
mass data from the 2017 field season were 17. M. H. Aboelmy, C. Peterhansel, Enzymatic characterization Plant Biotechnol. J. 12, 734–742 (2014). doi: 10.1111/pbi.12178;
analyzed by a two-way ANOVA (genotype × block) of Chlamydomonas reinhardtii glycolate dehydrogenase pmid: 24605946
and its nearest proteobacterial homologue. 36. K. A. Bishop, A. M. Betzelberger, S. P. Long, E. A. Ainsworth, Is
with eight biological replicates per genotype per Plant Physiol. Biochem. 79, 25–30 (2014). doi: 10.1016/ there potential to adapt soybean (Glycine max Merr.) to future
block. Greenhouse photosynthetic measurements j.plaphy.2014.03.009; pmid: 24681750 [CO2]? An analysis of the yield response of 18 genotypes in
were analyzed by a one-way ANOVA, and three 18. T. R. Pick et al., PLGG1, a plastidic glycolate glycerate free-air CO2 enrichment. Plant Cell Environ. 38, 1765–1774
biological replicates per measurement and field transporter, is required for photorespiration and defines a (2015). doi: 10.1111/pce.12443; pmid: 25211487
unique class of metabolite transporters. Proc. Natl. Acad. 37. P. Gallois, P. Marinho, Leaf disk transformation using
photosynthetic measurements were analyzed by a
Sci. U.S.A. 110, 3185–3190 (2013). doi: 10.1073/ Agrobacterium tumefaciens-expression of heterologous genes
two-way ANOVA with two plant replicates per pnas.1215142110; pmid: 23382251 in tobacco. Methods Mol. Biol. 49, 39–48 (1995).
plot and five randomized replicate blocks. All 19. P. F. South et al., Bile acid sodium symporter BASS6 can pmid: 8563823
ANOVA testing was followed with a Tukey’s post- transport glycolate and is involved in photorespiratory 38. H. Fahnenstich, T. E. Scarpeci, E. M. Valle, U.-I. Flügge,
hoc test for means comparison. ANOVA tables for metabolism in Arabidopsis thaliana. Plant Cell 29, 808–823 V. G. Maurino, Generation of hydrogen peroxide in chloroplasts
(2017). doi: 10.1105/tpc.16.00775; pmid: 28351992 of Arabidopsis overexpressing glycolate oxidase as an
each analysis are included in supplementary data 20. B. B. Beezley, P. J. Gruber, S. E. Frederick, Cytochemical inducible system to study oxidative stress. Plant Physiol. 148,
set 15. localization of glycolate dehydrogenase in mitochondria of 719–729 (2008). doi: 10.1104/pp.108.126789; pmid: 18685041
chlamydomonas. Plant Physiol. 58, 315–319 (1976). 39. K. Głowacka et al., An evaluation of new and established
RE FE RENCES AND N OT ES doi: 10.1104/pp.58.3.315; pmid: 16659670 methods to determine T-DNA copy number and homozygosity
1. D. K. Ray, N. D. Mueller, P. C. West, J. A. Foley, Yield trends are 21. A.-K. J. Sallal, N. A. Nimer, The intracellular localization in transgenic plants. Plant Cell Environ. 39, 908–917 (2016).
insufficient to double global crop production by 2050. of glycolate oxidoreductase in Escherichia coli. FEBS Lett. doi: 10.1111/pce.12693; pmid: 26670088
PLOS ONE 8, e66428 (2013). doi: 10.1371/journal. 258, 277–280 (1989). doi: 10.1016/0014-5793(89)81673-4; 40. K. Oxborough, N. R. Baker, An instrument capable of imaging
pone.0066428; pmid: 23840465 pmid: 2689218 chlorophyll a fluorescence from intact leaves at very low
2. X. G. Zhu, S. P. Long, D. R. Ort, Improving photosynthetic 22. M. R. Badger, H. Fallahi, S. Kaines, S. Takahashi, Chlorophyll irradiance and at cellular and subcellular levels of organization.
efficiency for greater yield. Annu. Rev. Plant Biol. 61, fluorescence screening of Arabidopsis thaliana for CO2 Plant Cell Environ. 20, 1473–1483 (1997). doi: 10.1046/
235–261 (2010). doi: 10.1146/annurev-arplant-042809-112206; sensitive photorespiration and photoinhibition mutants. j.1365-3040.1997.d01-42.x
pmid: 20192734 Funct. Plant Biol. 36, 867–873 (2009). doi: 10.1071/FP09199 41. G. W. Schmidt, S. K. Delaney, Stable internal reference
3. D. R. Ort et al., Redesigning photosynthesis to sustainably 23. B. J. Walker, P. F. South, D. R. Ort, Physiological evidence for genes for normalization of real-time RT-PCR in tobacco
meet global food and bioenergy demand. Proc. Natl. Acad. plasticity in glycolate/glycerate transport during (Nicotiana tabacum) during development and abiotic
Sci. U.S.A. 112, 8529–8536 (2015). doi: 10.1073/ photorespiration. Photosynth. Res. 129, 93–103 (2016). stress. Mol. Genet. Genomics 283, 233–241 (2010).
pnas.1424031112; pmid: 26124102 doi: 10.1007/s11120-016-0277-3; pmid: 27251551 doi: 10.1007/s00438-010-0511-1; pmid: 20098998
4. J. A. Burney, S. J. Davis, D. B. Lobell, Greenhouse gas 24. S. Takahashi, H. Bauwe, M. Badger, Impairment of the 42. S. Wang, L. Yin, J. Mano, K. Tanaka, l. Yin, J. i. Mano,
mitigation by agricultural intensification. Proc. Natl. Acad. photorespiratory pathway accelerates photoinhibition of K. Tanaka, Isolation of chloroplast inner and outer envelope

South et al., Science 363, eaat9077 (2019) 4 January 2019 8 of 9


Corrected 4 January 2019. See full text.
R ES E A RC H | R E S EA R C H A R T I C LE

membranes. Bio Protoc. 5, e1405 (2015). doi: 10.21769/ ACKN OWLED GMEN TS included in the article that is credited to a third party; obtain
BioProtoc.1405 We thank D. Drag and B. Harbaugh for plant care and management authorization from the rights holder before using such material. Author
43. J. Kromdijk et al., Improving photosynthesis and crop in the greenhouse and field studies; and N. Ferrari, R. Field, contributions: P.F.S, D.R.O, and A.P.C. designed experiments; P.F.S,
productivity by accelerating recovery from photoprotection. G. Lambruschini, J. Ayers, M. Oraweic, R. Devries, R. Gossens, A.P.C., and H.W.L performed experiments; and P.F.S, D.R.O, A.P.C.,
Science 354, 857–861 (2016). doi: 10.1126/science.aai8878; K. Brown, R. Edquilang, and C. Keller for assistance during laboratory and H.W.L analyzed data and wrote the manuscript. Competing
pmid: 27856901 and field work. We thank M. Balasubmaranian for tobacco interests: The authors declare no competing interests Data materials
44. A. Brooks, G. D. Farquhar, Effect of temperature on the transformation. We thank C. Benjamin for graphic design. We also availability: The data reported in this paper have been tabulated in
CO2/O 2 specificity of ribulose-1,5-bisphosphate thank E. Ainsworth, S. Long, B. Walker, and R. Slattery for critical review the supplementary materials. Plants and constructs reported are
carboxylase/oxygenase and the rate of respiration in the light: of the manuscript. Funding: This work is supported by the research available from the University of Illinois for research purposes, subject to
Estimates from gas-exchange measurements on spinach. project Realizing Increased Photosynthetic Efficiency (RIPE) that is the conditions of the Uniform Biological Material Transfer Agreement.
Planta 165, 397–406 (1985). doi: 10.1007/BF00392238; funded by the Bill & Melinda Gates Foundation, Foundation for Food
pmid: 24241146 SUPPLEMENTARY MATERIALS
and Agriculture Research, and the Department for International
45. A. Laisk, Kinetics of photosynthesis and photorespiration in C3 Development under grant no. OPP1172157. This work is licensed under www.sciencemag.org/content/363/6422/eaat9077/suppl/DC1
plants. Nauka, Moscow (in Russian) (1977). a Creative Commons Attribution 4.0 International (CC BY 4.0) license, Figs. S1 to S15
46. S. von Caemmerer, J. R. Evans, Temperature responses of which permits unrestricted use, distribution, and reproduction in any Table S1 to S3
Data S1 to S20
mesophyll conductance differ greatly between species. medium, provided the original work is properly cited. To view a copy of
Plant Cell Environ. 38, 629–637 (2015). doi: 10.1111/pce.12449; this license, visit https://creativecommons.org/licenses/by/4.0/. This 17 April 2018; accepted 20 November 2018
pmid: 25224884 license does not apply to figures/photos/artwork or other content 10.1126/science.aat9077

Downloaded from http://science.sciencemag.org/ on January 6, 2019

South et al., Science 363, eaat9077 (2019) 4 January 2019 9 of 9


R ES E A RC H

◥ groups, including bird flocks (4–6), fish schools


REPORT (7, 8), sheep herds (9), and insect swarms (10).
Determining the movement of human crowds,
however, remains unsettled. Neither field mea-
CROWD DYNAMICS surements (11–15) nor laboratory experiments
(16–18) have converged toward a robust set of

Dynamic response and hydrodynamics interaction rules (19). A different strategy for
predicting collective motion ignores the individ-
ual interaction rules and instead describes the
of polarized crowds large-scale motions in creature groups as spon-
taneous flows of active materials (20–23). Exist-
ing active hydrodynamic theories successfully
Nicolas Bain* and Denis Bartolo*
account for a host of emergent patterns found in
assemblies of microscopic motile bodies such as
Modeling crowd motion is central to situations as diverse as risk prevention in mass events
swimming bacteria (24, 25), cell tissues (26–28),
and visual effects rendering in the motion picture industry. The difficulty of performing
and synthetic self-propelled particles (29–31). The
quantitative measurements in model experiments has limited our ability to model
success of the hydrodynamic approach has been
pedestrian flows. We use tens of thousands of road-race participants in starting corrals to
limited to microscopic bodies, and observations
elucidate the flowing behavior of polarized crowds by probing its response to boundary
of large-scale creature groups have not been quan-
motion. We establish that speed information propagates over system-spanning scales
titatively described hydrodynamically.
through polarized crowds, whereas orientational fluctuations are locally suppressed.
To establish an active hydrodynamic descrip-
Building on these observations, we lay out a hydrodynamic theory of polarized crowds and

Downloaded from http://science.sciencemag.org/ on January 7, 2019


tion of spontaneous motion of humans, we made
demonstrate its predictive power. We expect this description of human groups as active
experimental observations of individuals in a
continua to provide quantitative guidelines for crowd management.
crowd targeting the same direction. We dem-

M
onstrate that information propagates over system-
esmerizing impressions of virtually all response to physical, social, or biological imper- spanning scales in the form of hybrid waves
patterns observed in bird flocks, fish atives, however, remains a formidable challenge. combining density and speed fluctuations in this
schools, insect swarms, and even human Predictive models of collective motion have been polarized crowd. Guided by the spectral proper-
crowds are effectively rendered in silico developed following two opposite strategies. One ties of the velocity waves, we build on conserva-
by simple algorithms (1, 2). Going be- strategy identifies local interaction rules be- tion laws and symmetry principles to construct a
yond visual impressions and predicting the col- tween individuals (3). This method has been predictive theory of pedestrian flows without
lective dynamics of groups of living creatures in successful, to some extent, for some animal resorting to any behavioral assumption.

Fig. 1. Hybrid-wave propagation


in queuing crowds. (A) Picture
of the starting corrals of the
Bank of America Chicago
Marathon (2017) taken from
an elevated observation point
(32). Thousands of runners
progress toward the starting
line under the guidance of
race staff members. (B) The
chain formed by the race staff
advances with repeating sequences
of walks and stops. (C) Velocity
and density fields at three
successive times. At t ¼ 0 s,
the crowd is static and has
a uniform density r0 e 2 m1
(blue lines). At t > 0, as
the staff members displace
the downstream boundary of
the queuing crowd, a hybrid
wave packet that couples
velocity and density fluctuations
propagates upstream. x0  x
indicates the distance from the
starting line
located at x0 .

Bain et al., Science 363, 46–49 (2019) 4 January 2019 1 of 4


R ES E A RC H | R E PO R T

A good opportunity to study a polarized crowd


in a controlled setting comes from large-scale
running races. We made observations of thou-
sands of runners progressing toward the start of
the Bank of America Chicago Marathon (Fig. 1A
and movie S1). Starting areas of road races have a
number of advantages, starting with their simple
geometry. The participants are gathered in a start
corral that is 200 m long and 20 m wide (Fig. 1A).
The starting areas also offer the possibility to
repeat observations of either the same race
across several years or other races around the
world. Finally, these massive polarized crowds
respond to a standard excitation, as runners
are consistently guided toward the starting line
by staff members performing repeated sequences
of walks and stops (Fig. 1, A and B).
We treated the crowd as a continuum, ignor-
ing any specific behavior or interactions at the
individual level. We characterized their large- Fig. 2. Underdamped propagation of linear and nondispersive velocity waves. (A) Kymograph
scale motion by measuring their local density of the longitudinal velocity, averaged over the transverse direction (Chicago 2016). x0  x indicates

Downloaded from http://science.sciencemag.org/ on January 7, 2019


rðr; tÞ and velocity field, nðr; tÞ, in response to the distance from the starting line. A number of velocity waves are seen to propagate upstream
repeated translations of the boundary formed at the same speed. (B) Probability distribution function of wave speed, measured for all the studied
by the staff members (Fig. 1B). events. The typical wave speed hardly differs from one event to the other. The overall speed
At rest, we measured the density of queuing distribution is narrowly peaked around hci ¼ c0 ¼ 1:2 T 0:3 m s1 . A., Atlanta; C., Chicago; P., Paris.
(C) Black line: velocity of a chain of race-staff members xb ðtÞ, measured by direct tracking. The


crowds to be systematically homogeneous over


each entire observation window (Fig. 1C). The corresponding positions xb ðtÞ are reported as a black line on the kymograph in (A). As illustrated with
average density of r0 ¼ 2:2 T 0:05 m2 was re- the same color code on the kymograph (A), the colored curves correspond to the longitudinal
markably identical in all corrals and varied little velocity field measured
 along the curves  defined by the race staff position xb ðtÞ after four different
waiting times t0 : vx t þ t0 ; xb ðtÞ þ c0 t0 . Independently of the shape of the xb ðtÞ signal, the velocity


from one race to another (32). Boundary motion,


waves faithfully propagate the information of the boundary speed xb ðtÞ over system-spanning scales,


however, triggers density and velocity perturba-


tions that propagate with little attenuation over the at constant speed.
whole extent of the corrals (Fig. 1C and movie S2).
We systematically observed this coupled dynam-
ics in response to more than 200 walk-and-stop the fluctuations in the speed (where n ∼ nx, in our occurs along thex direction asa ¼ ðDx cos2 qÞq2 ¼
excitations triggered by the race staff, in four case) and in the orientation, n^ , of the crowd flow. Dx q2x , where the diffusivity Dx is a robust material
different races. We gathered a total of ~150,000 We determined the power spectrum [Cn ðw; q; qÞ] parameter: Dx ¼ 1 T 0:5 m2 s1 in all observed
individuals. The kymograph (Fig. 2A) indicates of the speed, where w indicates the pulsation, q crowds. This type of slow dynamics is usually
that, regardless of the width of the initial per- indicates the modulus of the wave vector, and q typical of hydrodynamic variables characterized
turbation, longitudinal-velocity waves propagate indicates its orientation (32). We found that Cn by long-lived fluctuations in the long wavelength
upstream at a constant speed (Fig. 2B). We found is peaked on a straight line that defines the dis- limit (20, 37). This observation is seemingly at
that the wave speed c0 ¼ 1:2 T 0:3 m s1 is a ro- persion relation of nondispersive speed waves, odds with the conservation laws obeyed by pe-
bust characteristic of information transfer in polar- w ¼ cðqÞq. We fitted the angular variations [cðqÞ] destrian crowds. Solid friction constantly ex-
ized crowds for all 200 measurements. We also by cðqÞºcos q, giving the dispersion relation w ¼ changes momentum between the pedestrians
found that the shape of both the density and c0 qx with the same propagation speed c0 as from and the ground. Momentum is not a conserved
velocity waves were identical to the imposed the kymograph (Fig. 2B). This confirmed that no quantity, unlike in conventional liquids. There-
displacements of the boundary (Fig. 2C). This speed information propagated in the transverse fore, the speed is expected to be a fast variable.
faithful response to a variety of different signals direction to the crowd orientation (Fig. 3C). To Before solving this apparent contradiction,
(in shape and amplitude) is the signature of the check whether this strong anisotropy is caused let us address the small orientational fluctua-
propagation of nondispersive linear waves. The by the homogeneous boundary perturbation, we tions of pedestrian flows. The correlations of n ^,
density and velocity waves we observed are analyzed separately the dynamics of freely walk- Cn^ ðt; q; qÞ, decay exponentially in less than 2 s for
the result of the linear response of crowds and ing crowds in the absence of guiding staff. The all wavelengths and do not display any sign of
are therefore intrinsically different from the non- crowds responded to localized and spontaneous oscillations (Fig. 3G). The corresponding damp-
linear stop-and-go waves that have been ex- congestions forming in the starting funnel (movie ing rate an^ ðq; qÞ, varies as an^ ðq; qÞ ¼ a⊥ þ OðqÞ
tensively studied in pedestrian and car-traffic S2). The corresponding power spectrum (Fig. 3B, (Fig. 3H). Unlike the flow speed, orientational in-
models; see, e.g., (11, 33–35). inset) is identical to that of the runners in the formation does not propagate in queuing crowds.
The velocity fluctuations in the crowds we crowd, establishing that polarized crowds solely Instead, it relaxes in a finite time a1 ⊥ , which
observed were mainly longitudinal (Fig. 3A). support longitudinal modes. Their damping hardly depends on the direction of the wave vec-
This contrasts with other examples of polarized dynamics is measured from the time decay of tor (Fig. 3I). This behavior contrasts with that
ensembles of self-propelled bodies (flocks), in Cv ðt; q; qÞ (32) (Fig. 3, D and E). For all wave observed in bird flocks (5, 38) and in all active
which velocity fluctuations were mainly trans- vectors, we defined a single damping time scale systems in which the emergence of directed mo-
verse (31, 36). We therefore describe separately a1 from a best fit of the form Cn ðt; q; qÞ∼ tion arises from a spontaneous symmetry break-
exp½aðq; qÞtcos½cðqÞt. In all cases, we found ing (20, 31, 39). In the race corrals, all participants
diffusively damped speed waves attenuated at are aware of the race direction and align their
Laboratoire de Physique, ENS de Lyon, Université de Lyon,
a rate that scales as aðq; qÞ ¼ DðqÞq2 (Fig. 3F). In- body accordingly. Rotational symmetry is explic-
Université Claude Bernard, CNRS, F-69342 Lyon, France.
*Corresponding author. Email: nicolas.bain@ens-lyon.fr (N.B.); specting the angular variations of DðqÞ (Fig. 3G), itly broken, and no Goldstone mode exists. The a⊥
denis.bartolo@ens-lyon.fr (D.B.) we consistently found that damping primarily contribution to the damping rate stems from this

Bain et al., Science 363, 46–49 (2019) 4 January 2019 2 of 4


R ES E A RC H | R E PO R T

explicit symmetry breaking. The variations of an^ depends in principle on the local crowd phenomenologically constructed in the spirit of a
with q around a⊥ , however, are consistent with a density, velocity, and orientation (32). Pedes- Landau expansion. At lowest order in gradients,
quadratic increase of the form a⊥ þ DðqÞq2 (32) trians are polar bodies, and we classically the frictional body force is given by
(Fig. 3H). Such variations suggest that interac- quantify the level of local alignment between
tions between pedestrians penalize deformations the individuals by a polarization field pðr; tÞ F ðfrg; fngÞ ¼ G∥ ½n  n0 ðrÞ x̂ þ Oð∇Þ ð2Þ
of the flow field as would viscosity in a Newtonian (20). In (32), we built on a systematic theoret-
fluid or orientational elasticity in polar active ical framework to simplify this hydrodynamic and represents the self-propulsion mechanism
fluids (36). description. In short, we take advantage of three of the polarized crowd. The density-dependent
The consistency between data collected from robust key observations. First, given the mea- speed n0 ðrÞ quantifies the active frictional force
four different crowd-gathering events hints sured densities, the crowd is far from a jammed driving the flow along x ̂ , and G∥ is a friction
toward a unified hydrodynamic description of regime (15, 17). We therefore ignore elastic coefficient that constrains the longitudinal veloc-
density and speed excitations. We elucidate the stresses arising from contact interactions. Sec- ity fluctuations to relax in a finite time. In the
dynamical response quantified in Fig. 2 and ond, the local direction of the flow, n̂ , quickly hydrodynamic limit, momentum conservation
Fig. 3 from this perspective without resorting relaxes toward the local orientation p̂ . Simply and Eq. 2 therefore   the fundamental
reduce to
to any behavioral assumption (32). Mass con- put, queuing pedestrians do not walk sideways. relation nðr; tÞ ¼ n0 rðr; tÞ þ Oð∇Þ (32). This
servation gives the first hydrodynamic equation: Third, the crowd is strongly polarized; all in- relation explains two of our main experimental
dividuals align toward the x ̂ direction. In the findings. It shows that the fast variable n in-
@t r þ ∇  ðrnÞ ¼ 0 ð1Þ
hydrodynamic limit, we can therefore safely herits the slow dynamics of the conserved den-
Momentum conservation, at lowest order in assume p̂ =n̂ =x ̂ . This simplification does not sity field, and it readily implies that the density
gradients, reduces to the balance between the allow the description of orientational fluctua- of static queuing crowds self-adjusts to a con-
local rate of change of momentum and the fric- tions, which we explain in (32). It conveys, stant value r0 ¼ n1 0 ð0Þ (Fig. 1C). In the limit of

Downloaded from http://science.sciencemag.org/ on January 7, 2019


tion experienced by the crowd on the ground, Dt however, a clear picture of the propagation of linear-response theory around the quiescent
½rðr; tÞnðr; tÞ ¼ F ðfrg; fng; fpgÞ þ Oð∇Þ, where underdamped density and speed excitations. To polarized state, the speed and density fluctua-
0
Dt stands for the material derivative, and the proceed, we need to prescribe the functional tions,dr, are linearly related bynðr; tÞ ¼ n0 ðr0 Þdr
0
body force F is a total friction force that form of F, which is a priori unknown but can be ðb=G∥ Þ@x dr, where n0 ðr0 Þ ¼ @r n0 ðr0 Þ < 0, and b

Fig. 3. Spectral properties of speed


waves in queuing crowds. (A) Probability
distribution function of the longitudinal
and transverse components of the velocity
field (Chicago 2016). The longitudinal
component dominates. (B) Power spectrum
of the flow speed, plotted for q ¼ p=4.
The spectrum is normalized at every wave
 
vector ∫Cn ðw; q; qÞdq ¼ 1 . The inset represents a
normalized speed spectrum for a crowd
in free-flow conditions. Data are from
the Chicago 2016 experiment. (C) Variations
of the celerity of the speed waves with the
direction of the wave vector q for all experiments.
Circles represent experimental data. The solid
line represents cosine fit. The excellent
fit shows that the dispersion relation is given
by w ¼ cqx. (D) Normalized speed correlations
plotted versus time for all experiments
(q ¼ p=4, wave vector q ¼ 0:5 m1 ). (E) Damping
rate of the speed waves, a, plotted for all
wave vectors along q ¼ p=4. Circles represent
experimental data. Solid lines represent
best quadratic fits. (F) Variations of the
speed diffusivity Dx with the direction of
propagation. Circles represent experimental
data. Solid lines represent squared cosine
fits. (G) Normalized orientational correlations
plotted versus time for all experiments
(q ¼ p=4, q ¼ 0:5 m1 ). (H) Damping rate
of the orientational fluctuations an^ plotted
as a function of the wave vector (q ¼ p=4).
Circles represent experimental data. Solid lines
represent best quadratic fits ∼a⊥ þ Dn^ q2 ,
with Dn^ ¼ 1:2 T 0:5 m2 s1 . (I) Inverse
relaxation time a⊥ plotted as a function
of the direction of the wave vector q.
No significant angular variation is observed.

Bain et al., Science 363, 46–49 (2019) 4 January 2019 3 of 4


R ES E A RC H | R E PO R T

is the crowd longitudinal compressibility (32). We show that reorienting the direction of mo- 21. R. L. Hughes, Annu. Rev. Fluid Mech. 35, 169–182 (2003).
Together with mass conservation, this con- tion of a polarized crowd at once is impossible 22. R. Ni, J. G. Puckett, E. R. Dufresne, N. T. Ouellette,
Phys. Rev. Lett. 115, 118104 (2015).
stitutive relation defines the analog of the Navier- when relying only on locally accessible signals. 23. R. Ni, N. T. Ouellette, Phys. Biol. 13, 045002 (2016).
Stokes equations for polarized crowds: Orientational cues must be provided to the en- 24. H. Wioland, F. G. Woodhouse, J. Dunkel, J. O. Kessler,
tire assembly to change its direction of motion. R. E. Goldstein, Phys. Rev. Lett. 110, 268102 (2013).
0 r0 b 2 We also predict the time it takes to set in mo- 25. H. H. Wensink et al., Proc. Natl. Acad. Sci. U.S.A. 109,
@t v þ r0 n0 ðr0 Þ@x v  @ v¼0 ð3Þ 14308–14313 (2012).
G∥ x tion, or to stop, a crowd of a given extent by 26. G. Duclos et al., Nat. Phys. 14, 728–732 (2018).
providing information at its boundary. Beyond 27. T. B. Saw et al., Nature 544, 212–216 (2017).
Equations 1 and 3 effectively predict the dy- these predictions, the description of crowds as 28. S. Banerjee, K. J. C. Utuje, M. C. Marchetti, Phys. Rev. Lett. 114,
namical response we observed in our experi- continua should be useful to elucidate their re- 228101 (2015).
29. A. Zöttl, H. Stark, J. Phys. Condens. Matter 28, 253001
ments. The linear stability analysis of Eqs. 1 and sponse to large-amplitude perturbations and their (2016).
3 readily shows that polarized crowds support transitions from flowing liquids to amorphous 30. A. Morin, D. Bartolo, Phys. Rev. X 8, 021037 (2018).
unidirectional and nondispersive speed wave prop- solids, two situations where crowd dynamics be- 31. D. Geyer, A. Morin, D. Bartolo, Nat. Mater. 17, 789–793
0
agating downstream at a speed c0 ¼ r0 n0 ðr0 Þ. come hazardous. (2018).
32. Materials and methods are available as supplementary
Equations 1 and 3 also predict that their damp- materials.
ing rate varies as q2x , in agreement with our RE FERENCES AND NOTES
33. D. Helbing, A. Johansson, J. Mathiesen, M. H. Jensen,
experimental measurements (Fig. 3, E and F). 1. C. W. Reynolds, ACM SIGGRAPH Computer Graphics, vol. 21 A. Hansen, Phys. Rev. Lett. 97, 168001 (2006).
(ACM, 1987), pp. 25–34. 34. Y. Sugiyama et al., New J. Phys. 10, 033001 (2008).
Unlike in conventional fluids, the (weak) attenua- 2. D. Helbing, P. Molnár, Phys. Rev. E Stat. Phys. Plasmas Fluids 35. A. Tordeux, G. Costeseque, M. Herty, A. Seyfried,
tion of the speed waves does not originate from Relat. Interdiscip. Topics 51, 4282–4286 (1995). SIAM J. Appl. Math. 78, 63–79 (2018).
viscous stresses but instead from the competition 3. T. Vicsek, A. Zafeiris, Phys. Rep. 517, 71–140 (2012). 36. J. Toner, Y. Tu, Phys. Rev. E Stat. Phys. Plasmas Fluids Relat.
between substrate friction and compressive stresses 4. A. Cavagna, I. Giardina, Annu. Rev. Condens. Matter Phys. 5, Interdiscip. Topics 58, 4828–4858 (1998).
183–207 (2014).

Downloaded from http://science.sciencemag.org/ on January 7, 2019


in the crowd. In agreement with our observations, 37. P. M. Chaikin, T. C. Lubensky, Principles of Condensed
5. A. Cavagna, I. Giardina, T. S. Grigera, Phys. Rep. 728, 1–62 Matter Physics (Cambridge Univ. Press, 2000).
these hybrid waves coupling density and speed (2017). 38. A. Cavagna et al., Phys. Rev. Lett. 114, 218101 (2015).
fluctuations of opposite amplitude are the sole 6. D. J. Pearce, A. M. Miller, G. Rowlands, M. S. Turner, Proc. Natl. 39. J. Toner, Y. Tu, S. Ramaswamy, Ann. Phys. 318, 170–244
propagating modes supported by polarized crowds. Acad. Sci. U.S.A. 111, 10422–10426 (2014). (2005).
7. J. Gautrais et al., PLOS Comput. Biol. 8, e1002678 (2012).
In the hydrodynamic limit, the response of polarized 8. U. Lopez, J. Gautrais, I. D. Couzin, G. Theraulaz, Interface Focus AC KNOWLED GME NTS
crowds is strongly unidirectional, and speed in- 2, 693–707 (2012).
We thank D. Reithoffer for help with the Chicago Marathon’s
formation neither propagates nor diffuses along 9. F. Ginelli et al., Proc. Natl. Acad. Sci. U.S.A. 112, 12729–12734
observations and W. T. M. Irvine and E. R. Dufresne for valuable
the transverse direction (32). (2015).
comments and suggestions. Author contributions: D.B.
10. A. Attanasi et al., PLOS Comput. Biol. 10, e1003697 (2014).
From a more practical perspective, we can designed the research. D.B. and N.B. designed the experiments.
11. D. Helbing, A. Johansson, H. Z. Al-Abideen, Phys. Rev. E Stat.
infer the full set of hydrodynamic parameters N.B. performed the experiments and measurements. D.B.
Nonlin. Soft Matter Phys. 75, 046109 (2007).
and N.B. performed the theory, analyzed and discussed the
of Eq. 3 from the spectral properties of v. We 12. M. Moussaïd, D. Helbin, G. Theraulaz, Proc. Natl. Acad.
results, and wrote the paper. Competing interests: We declare
can show the predictive power of our hydro- Sci. U.S.A. 108, 6884–6888 (2011).
no competing interest. Data and materials availability: The
13. J. L. Silverberg, M. Bierbaum, J. P. Sethna, I. Cohen,
dynamic model, as calibrating the celerity of the data that support the plots within this paper and other
Phys. Rev. Lett. 110, 228701 (2013).
speed waves and the damping rate on a single findings of this study are available from the corresponding
14. I. Karamouzas, B. Skinner, S. J. Guy, Phys. Rev. Lett. 113,
authors upon request.
race in Paris is sufficient to quantitatively pre- 238701 (2014).
dict the dynamics of queuing crowds observed 15. A. Bottinelli, D. T. J. Sumpter, J. L. Silverberg, Phys. Rev. Lett. SUPPLEMENTARY MATERIALS
117, 228301 (2016).
in Chicago and Atlanta months later. In addition, 16. M. Moussaïd et al., PLOS Comput. Biol. 8, e1002442 (2012).
www.sciencemag.org/content/363/6422/46/suppl/DC1
our description of crowds as active continua Materials and Methods
17. J. M. Pastor et al., Phys. Rev. E Stat. Nonlin. Soft Matter Phys.
Supplementary Text
provides effective guidelines for the manage- 92, 062817 (2015).
Movies S1 to S3
ment of crowds. For instance, we show that 18. K. W. Rio, G. C. Dachner, W. H. Warren, Proc. Biol. Sci. 285,
References (40–48).
20180611 (2018).
stimulations from side boundaries are ineffi- 19. E. Cristiani, B. Piccoli, A. Tosin, Multiscale Modeling of 25 June 2018; resubmitted 21 July 2018
cient and that optimal information transfer is Pedestrian Dynamics, vol. 12 (Springer, 2014). Accepted 9 November 2018
achieved when guiding a crowd from its forefront. 20. M. C. Marchetti et al., Rev. Mod. Phys. 85, 1143–1189 (2013). 10.1126/science.aat9891

Bain et al., Science 363, 46–49 (2019) 4 January 2019 4 of 4


R ES E A RC H

CHEMICAL PHYSICS band, high-resolution absorption measurements


(28, 29). We have since made substantial changes
to the buffer-gas cooling conditions to permit the
Rovibrational quantum state preparation and detection of cold, gas-phase sam-
ples of even heavier molecules and have extended

resolution of the C60 fullerene the spectral window of this apparatus to the long-
wave IR (LWIR) region (30). We have targeted the
8.5-mm vibrational band because it is the lowest-
P. Bryan Changala1*, Marissa L. Weichman1, Kevin F. Lee2, energy IR active mode that falls within our ac-
Martin E. Fermann2, Jun Ye1* cessible wavelength region.
Figure 1A depicts a simplified view of the ap-
The unique physical properties of buckminsterfullerene, C60, have attracted intense research paratus used for C60 cooling and spectroscopy. A
activity since its original discovery. Total quantum state–resolved spectroscopy of isolated 950 K copper oven sublimates solid C60 samples,
C60 molecules has been of particularly long-standing interest. Such observations have, to date, generating gas-phase molecules with an average
been unsuccessful owing to the difficulty in preparing cold, gas-phase C60 in sufficiently high internal energy of 6 to 8 eV per molecule pop-
densities. Here we report high-resolution infrared absorption spectroscopy of C60 in the ulating 1026 to 1030 vibrational quantum states,
8.5-micron spectral region (1180 to 1190 wave number). A combination of cryogenic buffer-gas as shown in Fig. 1B. These hot molecules flow into
cooling and cavity-enhanced direct frequency comb spectroscopy has enabled the observation a cell anchored to a cryogenic cold finger, where
of quantum state–resolved rovibrational transitions. Characteristic nuclear spin statistical they are thermalized close to the cell-wall temper-
intensity patterns confirm the indistinguishability of the 60 carbon-12 atoms, while rovibrational ature via collisions with cold buffer-gas atoms
fine structure encodes further details of the molecule’s rare icosahedral symmetry. introduced through an annular slit inlet plate

Downloaded from http://science.sciencemag.org/ on January 7, 2019


surrounding the cell entrance aperture. We inter-

U
rogate the cold gas-phase molecules with CE-DFCS
nderstanding molecules as quantum me- troscopy has also played a central role in the by coupling a frequency comb into a high-finesse
chanical systems is a central objective of astronomical detection of C60 and its derivatives optical cavity surrounding the cold cell, which
chemical and molecular physics. The com- (21, 22). High-resolution IR absorption measure- enhances the absorption signal by a factor on the
plex internal dynamics of these systems ments may help resolve current uncertainties order of the cavity finesse (F = 6000). The LWIR
evolve over wide energy and time scales, as regarding the physical state of astronomical frequency comb light centered near 8.5 mm is
exhibited by the various electronic, vibrational, C60 (18). However, to date, there have been no produced by difference frequency generation
rotational, and spin degrees of freedom. Poly- reports of rovibrational quantum state–resolved (DFG) with two near-IR frequency combs orig-
atomic molecules, in particular, offer the pros- measurements of C60 molecules. The experiments inating from a single mode-locked fiber laser
pect of probing many-body physics in strongly reported here thus establish C60 as the largest (31). The comb contains narrow teeth at optical
interacting systems. The most comprehensive molecule, and the only example of rare icosahe- frequencies nm = m × frep + f0, where m is the
characterization of a molecular Hamiltonian, dral symmetry, for which a complete internal quan- integer mode index, frep is the repetition rate,
which governs intramolecular dynamics, is pro- tum state–resolved spectrum has been observed. and the offset frequency f0 can be introduced
vided with high-resolution spectroscopy. When a Although quantum state–resolved rovibrational via an external acousto-optic modulator before
polyatomic molecule is sufficiently cold to con- spectroscopy is routine for small, light molecules, the difference frequency step. The intensity of
centrate the population into, and thereby spec- systems as large and heavy as C60 are much less each comb tooth transmitted through the cavity
trally probe, a single rovibrational state, we achieve amenable to high-resolution characterization is read out using a broadband scanning-arm
the unimolecular equivalent of a pure quantum owing to several intrinsic and technical chal- Fourier transform interferometer (32, 33). Ad-
state at absolute zero in the rest frame of the mol- lenges. The increase in both the number of vibra- ditional experimental details are provided in
ecule. The precise measurement of transition tional modes and the magnitude of the moment the materials and methods (34).
energies between individual molecular eigen- of inertia for every additional atom results in Our first attempts at observing cold gas-phase
states yields detailed information about strong, considerably more rotation-vibration states pop- C60 with low-pressure helium buffer gas condi-
multibody interactions between atoms in a uni- ulated at a given internal temperature. Rovibra- tions similar to our previous work (26, 27) yielded
molecular polyatomic lattice, thus providing pro- tional states excited by an IR photon may be no detectable absorption. However, when the
found insights into complex molecular structure strongly coupled to a highly congested manifold vacuum chamber was flooded with a high pres-
and ensuing interaction dynamics. of background dark states, the density of which sure of helium buffer gas, a single broad, unre-
Here we report a rotationally resolved spec- grows rapidly with increasing internal energy, solved absorption feature appeared, as shown
trum of the 8.5-mm vibrational band of buckmin- leading to intramolecular vibrational redistrib- by the red trace in Fig. 2A. We attribute this
sterfullerene, C60. Following the discovery of C60 ution (IVR) (23). The Doppler broadening of spectrum to partially cooled C60 molecules that
by Kroto et al. in 1985 (1), infrared (IR) and 13C optical transitions due to finite translational tem- remain warm enough to occupy many vibra-
nuclear magnetic resonance spectroscopy con- perature serves only to exacerbate this spectral tional quantum states. This is not surprising: As
firmed its caged, icosahedral structure (2–7). Sub- congestion. Furthermore, the low gas-phase den- can be seen in Fig. 1B, even at room temperature,
sequent spectroscopic and analytical techniques, sities achievable for heavy, nonvolatile species the vibrational partition function is greater than
including x-ray and electron diffraction (8, 9), require high detection sensitivity. 103. This finding suggested that both a higher
optical Raman and neutron scattering (10–15), These various experimental challenges are number of collisions and more-efficient energy
matrix isolation IR spectroscopy [see (16–18) addressed by cooling the translational and in- transfer per collision would be required to ther-
and references therein], and photoelectron spec- ternal temperatures of gas-phase molecular sam- malize C60 to its ground vibrational state (35).
troscopy (19, 20), have greatly advanced our ples and probing them at lower internal energy Indeed, we ultimately produced a sufficiently
understanding of this unique molecule. Spec- with longer wavelength light. The method of dense, cold C60 sample by (i) increasing the
cryogenic buffer-gas cooling is particularly effec- buffer-gas mass by switching from helium to
1
JILA, National Institute of Standards and Technology and tive for large, heavy molecules (24, 25). We have argon and (ii) carefully optimizing the buffer-
University of Colorado, Department of Physics, University of recently demonstrated the integration of a buffer- gas flow and oven positioning relative to the
Colorado, Boulder, CO 80309, USA. 2IMRA America, Inc.,
Ann Arbor, MI 48105, USA.
gas cooling source with cavity-enhanced direct inlet slit. The spectrum acquired at these conditions
*Corresponding author. Email: bryan.changala@colorado.edu frequency comb spectroscopy (CE-DFCS) in the is shown by the blue trace in Fig. 2A and exhibits
(P.B.C.); ye@jila.colorado.edu (J.Y.) mid-IR (26, 27), which enables sensitive, broad- well-resolved rovibrational fine structure, with

Changala et al., Science 363, 49–54 (2019) 4 January 2019 1 of 5


R ES E A RC H | R E PO R T

Downloaded from http://science.sciencemag.org/ on January 7, 2019


Fig. 1. Cooling and comb spectroscopy of gas-phase C60. (A) Sub- with a scanning arm Fourier transform spectrometer (not pictured).
limated C60 vapor exits the oven source and enters a cryogenic cell, where (B) The vibrational partition function (blue dashed line) and average
it thermalizes via collisions with cold buffer gas introduced through an vibrational energy (red solid line) increase strongly as a function of temper-
annular slit inlet plate surrounding the entrance aperture (see enlarged ature. About 6 to 8 eV of vibrational energy must be removed per molecule to
area). Mid-IR frequency comb light is coupled to an optical enhancement cool C60 from the initial oven temperature to below 150 K, at which point
cavity surrounding the cell. The optical absorption spectrum is measured the vibrational partition function is approximately equal to unity.

narrow linewidths on the order of 20 MHz (fig. eigenfunctions of J2, ‘2, Jz, ‘z, and JZ . It is useful
S1). The peak absorption, near the band origin, is to define the “pure rotational” angular momen- Table 1. Fitted spectroscopic parameters
10% of the cavity-transmitted comb mode inten- tum R ¼ J  ‘, the eigenfunctions of which can of Eq. 6 for the R branch. The residuals
sity. From the magnitude of the integrated ab- be constructed by transforming the uncoupled (Fig. 4B) have a small root-mean-square
sorption cross section (17), we estimate the number product wavefunctions using standard angular error of 7.4 × 10−5 cm−1, slightly larger than
density of cold C60 to be 4 × 1011 cm−3. Observing momentum coupling relations (36). This yields the 1s line-center measurement uncertainty
the appearance and evolution between the broad total coupled rovibrational wavefunctions of the of 2.5 × 10−5 cm−1.
and narrow signals was greatly facilitated by the form jR; kR ; J; ‘; n; mi , where R is the angular
wide spectral bandwidth of the frequency comb, momentum quantum number of R and kR = Parameter Value (cm−1)
which covers the entire breadth of the observed −R, …, +R is the body-fixed projection. As usual,

n.............................................................................................
0 + (2 B + DB)(1 − 2z)
vibrational band. The inferred rotational temper- the values of R satisfy the triangle inequality 1184.86196(3)

2B(1 − z) + DB(2 − z)
ature is about 150 K (34), nearly equal to the cell- R ¼ jJ  ‘j; …; J þ ‘. In this work, we are con- 0.0078300(3)
.............................................................................................
wall temperature of 135 K, which is kept well cerned only with the ground vibrational state with DB –2.876(6) × 10−7
.............................................................................................
above argon’s condensation point of 87 K. n ¼ ‘ ¼ 0 and the excited T1u vibrational state,
The observed fine structure in the infrared populated by the IR photon, with n ¼ ‘ ¼ 1 .
spectrum encodes fundamental details of the Therefore, in the ground vibrational state, R = J;
quantum mechanical structure of C60. To the zeroth similarly, in the excited state where ‘ ¼ 1, R is The excited vibrational state is described to
order, the rotations of C60 can be considered as restricted to J; jJ T 1j. lowest order by a slightly more sophisticated
those of a spherical top with total angular mo- The energies of the states we observe are de- effective Hamiltonian,
mentum operator J (36). The associated rota- termined by effective rotational Hamiltonians
tional quantum states are jJ; k; mi, where J = 0, for each vibrational state. The simplest possible Hex ¼ n0 þ B′J2  2B′zðJ  ‘ Þ ð3Þ
1, 2, … is the total angular momentum quantum effective Hamiltonian for the ground vibrational
number and k, m = −J, …, +J are the projection state is that of a rigid spherical top where n0 is the vibrational band origin, and B′
quantum numbers of the body-fixed compo- is the excited state rotational constant, which
nent (Jz) and lab-fixed component (JZ) of J, Hgr ¼ B″J2 (1) differs slightly from B″ owing to changes of the
respectively. The triply degenerate vibrational moment of inertia upon vibrational excitation.
mode of T1u symmetry that gives rise to the infra- where B″ is the ground state rotational constant, The new rightmost term arises from Coriolis
red band can be modeled as a three-dimensional which is inversely proportional to the moment of forces that couple the total angular momentum
isotropic harmonic oscillator with vibrational inertia. The ground state wavefunctions jR ¼ J; J and the vibrational angular momentum ‘, with
angular momentum operator ‘ . Its quantum kR ; J; ‘ ¼ 0; n ¼ 0; mi are eigenstates of Hgr with ‘ ¼ 1. The z constant encodes the strength of this
states are jn; ‘; k‘ i, where n is the total number energies coupling, which is determined by the geometric
of vibrational quanta; ‘ ¼ n; n  2; n  4; … is details of the vibrational normal mode. The ex-
the vibrational angular momentum quantum Egr ¼ B″J(J + 1) (2) cited state wavefunctions jR; kR ; J; ‘ ¼ 1; n ¼ 1; mi
number; and k‘ ¼ ‘; …; þ‘ is the projection are eigenstates of Hex with energy levels at
quantum number of the body-frame projec-
tion (‘z ) of ‘. This energy is independent of kR and m, leading
The uncoupled rovibrational product wave- to the usual (2R + 1)(2J + 1) = (2J + 1)2 spherical- Eex ¼ n0 þ B′JðJ þ 1Þ  B′z½JðJ þ 1Þþ
functions jJ; k; mijn; ‘; k‘ i are simultaneously top ground-state degeneracy factor. ‘ð‘ þ 1Þ  RðR þ 1Þ ð4Þ

Changala et al., Science 363, 49–54 (2019) 4 January 2019 2 of 5


R ES E A RC H | R E PO R T

Fig. 2. Spectroscopic patterns of the IR active vibrational band of ground vibrational state. norm., normalized to peak absorption.
12
C60 near 8.5 mm. (A) A simulated (sim.) spectrum (black trace) is (B) Rovibrational transitions between the ground vibrational state and
the excited state follow zeroth-order selection rules of D J = 0, ±1 and

Downloaded from http://science.sciencemag.org/ on January 7, 2019


compared to a measured spectrum of cold (blue trace) and hot (red trace)
C60. The measured hot spectrum shows broad, unresolved absorption DR = 0. These lead to independent P (D J = −1), Q (D J = 0), and R (D J = +1)
owing to many thermally occupied vibrational states. The cold spectrum branches that access the upper-state manifolds labeled T1u(+) (for R = J + 1),
exhibits sharp, well-resolved rotational structure from transitions out of the T1u(0) (for R = J), and T1u(−) (for R = J – 1), respectively.

again with a degeneracy of (2R + 1)(2J + 1). As 12, 15, 16, 18, 20 to 22, and 24 to 28, with other scopic constants. The energy expressions in Eqs. 2
R ¼ J; jJ T 1j, the excited state energies sort into values of R < 30 having no allowed states. (For and 5 yield expected transition frequencies of
three distinct manifolds (37) levels with R ≥ 30, the number of allowed states
is equal to 1 plus the number of states for R minus  þ DBÞð1  2zÞ þ
n½RðJÞ ¼ n0 þ ð2B
ðþÞ
Eex ¼ EJ þ 2B′zJ; R¼J þ1 30.) The unusual patterns of allowed angular mo-   zÞ þ DBð2  zÞ þ
J½2Bð1 ð6Þ
ð0Þ
Eex ¼ EJ  2B′z; R¼J mentum quantum numbers are intimately related J 2 DB
ðÞ
Eex ¼ EJ  2B′zðJ þ 1Þ; R ¼ J  1 ð5Þ to the two-, three- and fivefold symmetry axes
of an icosahedron. In the high-R limit, only 1 in where B  ≡ ðB′ þ B″Þ=2 is the mean value of the
where EJ = n0 + B′J(J + 1) is the pure vibrational 60 states exist, owing to the drastic effects of lower- and upper-state rotational constants and
and rigid rotor contribution to the energy. Phys- these 12C nuclear spin statistics. DB ≡ B′  B″ ≪ B  is their difference. Figure 4A
ically, these manifolds correspond to states where Taking the zeroth-order energies, selection shows the measured positions (34) as a function
J and ‘ are mutually antiparallel, perpendicular, rules, and spin statistics all together leaves the of lower state J, which follow the expected nearly
and parallel, respectively. predicted spectrum plotted in black in Fig. 2A. linear dependence. Figure 4B shows the residuals
Rovibrational transitions between the ground It consists of a sharp Q branch surrounded by P from a fit of Eq. 6 to the measured line positions,
and excited T1u vibrational states of spherical tops and R branches containing lines evenly spaced displaying two avoided crossings arising from
such as C60 are governed by the usual strict D J = 0, by approximately (B″ + B′)(1 – z) ≈ 0.0078 cm−1. perturbations in the excited state. The fitted spec-
±1 rule and an additional DR = DkR = 0 rule (36). The qualitative appearance of the measured R troscopic parameters are summarized in Table 1.
These allowed transitions are illustrated in the and Q branch regions is consistent with the The R branch transition frequencies are well re-
level diagram of Fig. 2B. Unlike less symmetric simulation, whereas there is substantial disagree- produced despite the simplicity of the zeroth-
molecules, these selection rules dictate that the ment in the P branch. The portions of the spec- order Hamiltonian, which ignores centrifugal
usual P (D J = −1), Q (D J = 0), and R (D J = +1) trum shown in Fig. 3 provide a closer view of this distortion effects, and the very high range of J.
transitions reach mutually exclusive sets of up- behavior. A complete listing of the ~300 transition frequen-
per state quantum levels. These three manifolds The R branch exhibits a regularly spaced pro- cies used in this fit is given in data S1 (39).
are labeled T1u(+), T1u(0), and T1u(−), according to gression of transitions R(J) that we have assigned The quantum state–resolved spectrum of C60
the energy expressions in Eq. 5. from J ≈ 60 to 360. Transitions outside this range provides structural information of isolated gas-
Inspection of the level diagram in Fig. 2B are below our detection sensitivity. Such high phase molecules through the rotational fine struc-
shows that states with certain values of R are values of the total angular momentum quantum ture. Although the transitions included in our
missing. This is, in fact, an exceptional example of number have been rarely observed, if ever, by initial analysis do not yet allow an independent
nuclear spin statistics at work. The carbon nuclei rotationally resolved frequency domain spectros- determination of B″ and z, if we assume a range
in pure 12C60 are each identical spin-0 bosons, so copy. Portions of the measured and simulated R of z = −0.30 to −0.45 based on theoretical cal-
culations (37), we can estimate B″ ¼ hc1 ℏ2I ≈ 0.0027
2
any permutation of nuclei must leave the total branch from J = 160 to 200 are shown in Fig. 3A.
−1
molecular wavefunction unchanged. This im- Despite the noise in the measured absorption, to 0.0030 cm , where I is the effective moment
poses the strict condition that only states with a these transitions clearly show the expected dis- of inertia of the ground vibrational state, ħ is
total rovibronic symmetry of Ag (+ parity) or Au crete intensity variations in the correct integer Planck’s constant h divided by 2p, and c is the
(− parity) in the Ih point group may exist. Group ratios. Such patterns are a basic consequence of speed of light. Given I ¼ 23 mr2 for a spherical
theoretical analysis (38) of the rovibrational the quantum mechanical indistinguishability shell of mass m and radius r, the corresponding
wavefunctions shows that this condition is met and the perfect icosahedral arrangement of the range of radii is 3.4 to 3.6 Å. This is consistent
only with certain linear combinations of kR states carbon nuclei that make up 12C60. with a previous gas-phase electron diffraction
for a given value of R. In fact, only a single such Quantitative analysis of the R branch transi- measurement of 3.557(5) Å, which includes ther-
linear combination is possible for R = 0, 6, 10, tion frequencies permits extraction of spectro- mal averaging effects that lengthen the measured

Changala et al., Science 363, 49–54 (2019) 4 January 2019 3 of 5


R ES E A RC H | R E PO R T

Fig. 3. Detailed views of portions of the


measured IR band. (A) The R branch shows
agreement between the expected intensity
patterns from the simulation (black trace) and
the measured spectrum (blue trace). The tie
line above the spectrum indicates the lower
state J value of each observed R(J) transition.
(B) The Q branch region of the spectrum
contains several features. The highest wave-
number feature is assigned as the Q branch of
the 12C60 isotopologue. In the inset, the dashed
line represents a fit to a simple quartic centrif-
ugal distortion contour. The additional features
at lower frequencies are likely due to the singly
substituted 13C12C59 isotopologue. (C) These
two portions of the P branch (blue trace) are
representative of the disagreement with the
zeroth-order simulation determined from param-
eters fitted to the R branch (black trace). The
structure not captured by the simulation is evi-
dence of nonscalar centrifugal distortion effects.

Downloaded from http://science.sciencemag.org/ on January 7, 2019


arb., arbitrary units.

radius relative to that of the vibrational ground Fig. 4. Fit results for the R branch. (A) The
state (8). Further analysis of the rotational fine R(J) line positions plotted versus lower-state
structure of 12C60 (and ultimately 12C5913C) will be J display a very linear trend over J = 60 to 360.
necessary to constrain B″ and z independently The individual line positions are listed in (39).
and completely determine the gas-phase struc- (B) The residuals from the fit of Eq. 6 to these
tural parameters. Our measured value of DB im- line positions, summarized in Table 1, exhibit
plies that the effective C60 radius increases by apparent avoided crossings near J = 215 and 275,
only 0.005% upon excitation of the observed which are possible signatures of local dark-state
vibrational mode, which is primarily of a surface- perturbers in the upper state. The error bars
tangent C–C bond stretching character. The are 1s line-center uncertainties determined from
narrow IR transition linewidths (about 20 MHz) lineshape fit residuals (34).
to the excited vibrational state provide a lower
bound for its IVR lifetime of at least 8 ns, despite
being embedded in a dense manifold of dark
vibrational states. This is consistent with our
expectation that the high degree of icosahedral
symmetry substantially restricts rovibrational
coupling.
The Q branch region is shown in Fig. 3B. There
are several unresolved features here, though
each is still quite narrow on an absolute scale of metry of C60, splitting the threefold degeneracy body-fixed projections of R. Whereas most of
0.01 to 0.03 cm−1. The highest frequency fea- of the vibrational level and nullifying the nu- these substates are eliminated by the 12C nuclear
ture is assigned as the Q branch of the 12C60 clear spin statistics. Many more rotational spin statistics, the degeneracy of the remaining
isotopologue in its ground vibrational state. Cen- levels and transitions are expected, which will substates can be broken by nonscalar centrifu-
trifugal distortion effects create a band head be further split by the nonspherical moments gal distortion terms. These so-called “icosahedral
observed near J = 250 (inset of Fig. 3B). The of inertia (40). splitting” terms (41) lead to subsequent splittings
remaining features in the Q branch region are Finally, two representative portions of the P of the observed transitions. In the ground state,
not definitively assigned. Although they are pos- branch are shown in Fig. 3C. Here, the zeroth-order the lowest-order nonscalar centrifugal distortion
sibly hot-band transitions of the 12C60 isotopo- simulation fails to capture either the position or term scales as J 6, whereas such terms can appear
logue, we believe they most likely derive from number of observed transitions. This complicated in the excited state that scale only as J 4. Owing to
the singly substituted 12C5913C isotopologue. fine structure is likely due to high-order centrif- the large J values observed here, it is not surpris-
Despite a 13C natural abundance of only 1.1%, ugal distortion terms not included in the simulated ing that such effects become important. However,
the 60 equivalent substitution sites lead to a spectrum (41). The zeroth-order Hamiltonians, to date, there have been no theoretical predictions
notably high (12C5913C):12C60 ratio of about 2:3. Eqs. 1 and 3, contain only scalar terms that pre- of the magnitude of these icosahedral splitting
The substitution breaks the icosahedral sym- serve the spherical degeneracy of the (2R + 1) terms. A full analysis of this portion of the spectrum

Changala et al., Science 363, 49–54 (2019) 4 January 2019 4 of 5


R ES E A RC H | R E PO R T

is most effectively treated within the irreducible 11. L. Pintschovius, Rep. Prog. Phys. 59, 473–510 (1996). 35. J. T. Stewart, B. E. Brumfield, B. M. Gibson, B. J. McCall, ISRN
spherical tensor formalism (42). 12. D. S. Bethune, G. Meijer, W. C. Tang, H. J. Rosen, Chem. Phys. Lett. Phys. Chem. 2013, 675138 (2013).
174, 219–222 (1990). 36. C. di Lauro, in Rotational Structure in Molecular Infrared
The present experiments point toward an ex- 13. D. S. Bethune et al., Chem. Phys. Lett. 179, 181–186 (1991). Spectra (Elsevier, 2013), chap. 10, pp. 225–245.
citing future direction of fullerene research. The 14. K. Prassides et al., Chem. Phys. Lett. 187, 455–458 37. D. E. Weeks, W. G. Harter, Chem. Phys. Lett. 176, 209–216
general applicability of buffer-gas cooling estab- (1991). (1991).
lishes the possibility of similar studies, using vi- 15. R. L. Cappelletti et al., Phys. Rev. Lett. 66, 3261–3264 38. P. R. Bunker, P. Jensen, Mol. Phys. 97, 255–264 (1999).
(1991). 39. P. B. Changala, M. L. Weichman, K. F. Lee, M. E. Fermann,
brational, electronic, or other spectroscopies, 16. N. Sogoshi et al., J. Phys. Chem. A 104, 3733–3742 (2000). J. Ye, External data for “Rovibrational quantum state resolution
on larger fullerenes such as C70; endofullerenes, 17. S. Iglesias-Groth, F. Cataldo, A. Manchado, Mon. Not. R. of the C60 fullerene,” Version 1, Harvard Dataverse (2018);
wherein an atom or small molecule is encap- Astron. Soc. 413, 213–222 (2011). https://doi.org/10.7910/DVN/RVVAN6.
sulated in a closed fullerene cage; or even pure 18. A. C. Brieva, R. Gredel, C. Jäger, F. Huisken, T. Henning, 40. T. C. Reimer, W. G. Harter, J. Chem. Phys. 106, 1326–1335
13 Astrophys. J. 826, 122 (2016). (1997).
C60, which represents a pristine example of a 19. X.-B. Wang, C.-F. Ding, L.-S. Wang, J. Chem. Phys. 110, 41. W. G. Harter, D. E. Weeks, J. Chem. Phys. 90, 4727–4743
spin-½ network on a spherical lattice. Ultimately, 8217–8220 (1999). (1989).
precision spectroscopy of such targets is the first 20. D.-L. Huang, P. D. Dau, H.-T. Liu, L.-S. Wang, J. Chem. Phys. 42. V. Boudon et al., J. Mol. Spectrosc. 228, 620–634 (2004).
step toward single quantum state preparation 140, 224315 (2014).
21. J. Cami, J. Bernard-Salas, E. Peeters, S. E. Malek, Science 329, AC KNOWLED GME NTS
and control of large molecular systems. 1180–1182 (2010). The authors thank H. Green for technical advice during the design of
22. E. K. Campbell, M. Holz, D. Gerlich, J. P. Maier, Nature 523, the oven source and J. Doyle for insightful discussions. Funding: This
322–323 (2015). work was supported by AFOSR grant no. FA9550-15-1-0111, the
RE FE RENCES AND N OT ES
23. D. J. Nesbitt, R. W. Field, J. Phys. Chem. 100, 12735–12756 Gordon and Betty Moore Foundation, the DARPA SCOUT Program,
1. H. W. Kroto, J. R. Heath, S. C. O’Brien, R. F. Curl, R. E. Smalley, (1996). NIST, and NSF PHYS-1734006. M.L.W. is supported through an NRC
Nature 318, 162–163 (1985). 24. D. Patterson, E. Tsikata, J. M. Doyle, Phys. Chem. Chem. Phys. Postdoctoral Fellowship. Author contributions: P.B.C., M.L.W., and
2. H. Ajie et al., J. Phys. Chem. 94, 8630–8633 (1990). 12, 9736–9741 (2010). J.Y. performed the experiment. K.F.L. and M.E.F. built the DFG-based
3. R. Taylor, J. P. Hare, A. K. Abdulsada, H. W. Kroto, J. Chem. 25. J. Piskorski, D. Patterson, S. Eibenberger, J. M. Doyle, comb. All authors contributed to the writing of the paper. Competing
Soc. Chem. Commun. 1990, 1423–1424 (1990).

Downloaded from http://science.sciencemag.org/ on January 7, 2019


ChemPhysChem 15, 3800–3804 (2014). interests: K.F.L. and M.E.F. have submitted a patent (WO2017209989A1)
4. W. Krätschmer, K. Fostiropoulos, D. R. Huffman, Chem. Phys. Lett. 26. P. B. Changala, B. Spaun, D. Patterson, J. M. Doyle, J. Ye, on portions of the DFG frequency comb instrument. Data and
170, 167–170 (1990). Appl. Phys. B 122, 292 (2016). materials availability: All data are available in the main text, in the
5. W. Krätschmer, L. D. Lamb, K. Fostiropoulos, D. R. Huffman, 27. B. Spaun et al., Nature 533, 517–520 (2016). supplementary materials, or through Harvard Dataverse (39).
Nature 347, 354–358 (1990). 28. F. Adler, M. J. Thorpe, K. C. Cossel, J. Ye, Annu. Rev.
6. C. S. Yannoni, P. P. Bernier, D. S. Bethune, G. Meijer, Anal. Chem. (Palo Alto, Calif.) 3, 175–205 (2010).
J. R. Salem, J. Am. Chem. Soc. 113, 3190–3192 (1991). 29. M. J. Thorpe, J. Ye, Appl. Phys. B 91, 397–414 (2008). SUPPLEMENTARY MATERIALS
7. C. S. Yannoni, R. D. Johnson, G. Meijer, D. S. Bethune, 30. K. Iwakuni et al., Appl. Phys. B 124, 128 (2018).
www.sciencemag.org/content/363/6422/49/suppl/DC1
J. R. Salem, J. Phys. Chem. 95, 9–10 (1991). 31. K. F. Lee, C. J. Hensley, P. G. Schunemann, M. E. Fermann,
Materials and Methods
8. K. Hedberg et al., Science 254, 410–412 (1991). Opt. Express 25, 17411–17416 (2017).
Fig. S1
9. S. Liu, Y.-J. Lu, M. M. Kappes, J. A. Ibers, Science 254, 32. J. Mandon, G. Guelachvili, N. Picqué, Nat. Photonics 3, 99–102
References (43–45)
408–410 (1991). (2009).
10. S. F. Parker et al., Phys. Chem. Chem. Phys. 13, 7789–7804 33. F. Adler et al., Opt. Express 18, 21861–21872 (2010). 29 August 2018; accepted 8 November 2018
(2011). 34. See supplementary materials. 10.1126/science.aav2616

Changala et al., Science 363, 49–54 (2019) 4 January 2019 5 of 5


R ES E A RC H

MESOSCOPIC PHYSICS

Counter-propagating charge
transport in the quantum Hall
effect regime
Fabien Lafont1,2*†, Amir Rosenblatt1*, Moty Heiblum1, Vladimir Umansky1

The quantum Hall effect, observed in a two-dimensional (2D) electron gas subjected to a
perpendicular magnetic field, imposes a 1D-like chiral, downstream, transport of charge
carriers along the sample edges. Although this picture remains valid for electrons and
Laughlin’s fractional quasiparticles, it no longer holds for quasiparticles in the so-called
hole-conjugate states. These states are expected, when disorder and interactions are
weak, to harbor upstream charge modes. However, so far, charge currents were observed
to flow exclusively downstream in the quantum Hall regime. Studying the canonical
spin-polarized and spin-unpolarized v = 2/3 hole-like states in GaAs-AlGaAs
heterostructures, we observed a significant upstream charge current at short propagation

Downloaded from http://science.sciencemag.org/ on January 7, 2019


distances in the spin unpolarized state.

E
lementary charge excitations in the quan- (0, ↑) and (0, ↓) (Fig. 1B) (28), and a polarized
tum Hall effect (QHE) flow downstream state, emerging at high magnetic fields, with two
along the edge of a two-dimensional elec- quantum levels having the same spin but dif-
tron gas (2DEG), with the downstream ferent orbitals (0, ↑) and (1, ↑) (29). The majority
chirality imposed by the magnetic field (1). of previous experiments in the unpolarized state
In the fractional regime (2), this statement re- focused on characterizing the spin domains
mains valid only for particle-like (Laughlin’s) states structure in the bulk (23, 24, 30) or the nuclear
(3–5); by contrast, hole-like states (filling factors spin polarization occurring at high currents
v so that 1/2 + n < v < 1 + n with n = 0, 1, 2...) are (18, 19, 21, 22, 30–35). Still, the configuration of
expected to harbor counter-propagating (down- edge channels for this state remains elusive: On
stream and upstream) charge excitations (6). In the one hand, no upstream channel is expected
a noninteracting and scattering-free model, a in the CF picture; on the other, because the ef-
downstream v = 1 charge mode was predicted to fective K-Matrix in the CF basis is the same for Fig. 1. Longitudinal and transverse magnetore-
be accompanied by an upstream v = 1/3 mode, both v = 2/3 states, an upstream mode should sistances measured in a 40-mm-wide Hall bar
leading to a two-terminal conductance of 4e2/3h, occur also in the unpolarized case (36). We studied sample. (A) Longitudinal four-terminal magneto-
where e and h are the electron charge and the the two flavors of the v = 2/3 state along a short resistance versus backgate voltage measured by
Planck constant, respectively. However, experi- distance (a few micrometers) and found a sub- using I = 1 nA at T = 40 mK. A clear nondissipated
mentally, only downstream charge modes (7, 8) stantial upstream charge current only in the spin- state, Rxx ≈ 0, is visible for the v = 2/3 polarized and
with a two-terminal conductance of 2e2/3h ac- unpolarized state. Consequently, the two-terminal unpolarized states. (B) Sketch of the evolution of the
companied by upstream neutral modes (9–15) resistance deviates from the quantized one at v = relevant energy scales. At low field, a gap exists
have been found. A recent experiment (16) mea- 2/3. The GaAs-AlGaAs heterostructure used to between the (0, ↑) and (0, ↓) states,corresponding
sured conductance of an unequilibrated down- study the two v = 2/3 states had to be carefully to the spin unpolarized state, whereas at higher
stream channels at narrow regions (4 mm wide) designed (with the 2DEG confined in a narrow, fields, thanks to the different B dependency of the
of the polarized v = 2/3 state; the results were 12-nm-wide quantum-well) because we aimed to pffiffiffiffi
Coulomb (ºl1 B e B,where lB is the magnetic length)
consistent with the model from (6), but no di- have the transition between the two states at a
and Zeeman (ºB) energies, the gap exists between
rect measurement of the upstream current was sufficiently high carrier density (and magnetic
the (0, ↑) and the (1, ↑) l levels corresponding to the
made. Although the majority of the studies were field), corresponding to having high mobility
polarized state. (C) Four-terminal transverse mag-
concentrated on the spin-polarized v = 2/3 throughout the transition region in the phase
netoresistance as function of the backgate voltage.
state, there has been recent interest in its spin- space between the two states. A conductive
The v = 2/3 polarized and unpolarized quantum
unpolarized counterpart (17–24) as a potential n + GaAs layer was grown ~1 mm below the 2DEG
Hall plateaus exhibit a resistance Rxy ≈ (2e2/3h)–1 ≈
host for para-fermions when coupled to super- and served as a backgate, capable of tuning the
38.7 kilohms (dashed line on the color bar).
conducting contacts (25–27). In the composite density from 1 × 1011 to 2.5 × 1011 cm–2, with a
fermion (CF) picture, one can construct two kinds corresponding low-temperature dark mobility
of states in the v = 2/3: an unpolarized state, of 1.5 × 106 to 3.5 × 106 cm2 V–1 s–1. Lock-in two-spin varieties of the v = 2/3 states is visible
emerging at lower magnetic fields, with two measurements were performed at ~80 Hz with in Rxx (around Vbg = –0.5 V and B = 10 T) (Fig.
quantum levels that have the same orbital quan- an input current I = 1 nA and an electron tem- 1A). The finite Rxx region corresponds to the
tum number but opposite spin configurations: perature of ~35 mK [additional fabrication in- point at which the system undergoes a first-
formation is provided in (37), section 1]. order quantum phase transition between the spin-
1
Braun Center for Submicron Research, Department of The evolution of the four-terminal longitudinal unpolarized and the spin-polarized v = 2/3 state.
Condensed Matter Physics, Weizmann Institute of Science, (Rxx) and transverse resistance (Rxy), measured The transverse resistance Rxy ≃ ð2e 2 =3hÞ1 ≃
Rehovot 76100, Israel. 2College de France, 11 place Marcelin
Berthelot, 75231 Paris Cedex 05, France.
in a 40-mm-wide Hall-bar geometry, is plotted 38:7 kilohms, however, remains constant on both
*These authors contributed equally to this work. on Fig. 1, A and C. As reported previously sides of the transition. As predicted in (6), the
†Corresponding author. Email: lafont.fabien@gmail.com (17, 21, 22, 30, 31), a clear transition between the presence of an upstream current leads to the

Lafont et al., Science 363, 54–57 (2019) 4 January 2019 1 of 4


R ES E A RC H | R E PO R T

Downloaded from http://science.sciencemag.org/ on January 7, 2019


Fig. 2. Deviation from the quantized Hall
resistance value owing to the upstream cur-
rent. (A) Two-terminal magnetoresistance ver-
sus backgate voltage for a L = 4-mm-long and
60-mm-wide sample measured at T ~ 35 mK
and I = 1 nA. A clear difference appears between Fig. 3. Different sample geometries validating the presence of a counter-propagating charge
the spin-polarized state, which remains quan- flow. (A) Sketch of the three-terminal measurement. Four contacts are aligned on a single edge of
tized, and the spin-unpolarized state, which the sample, 4 mm apart. Current I = 1 nA was sourced at contact 1, and voltage was measured
deviates substantially from the quantized value. between the contact 2 placed upstream and the ground; contact 4 was grounded, and contact 3 was
(B) Evolution of the two-terminal resistance floating. (B) Sketch of the four-terminal Rxx measurement on a narrow, 3-mm-wide and 25-mm-long
averaged over an area of (B, Vbg) corresponding Hall bar. The red lines represent the biased-edge channels, whereas the blue ones represent the
to the polarized and unpolarized v = 2/3 states, as grounded-edge channels. (C) Three-terminal magnetoresistance versus the backgate voltage for the
a function of the length L [(38), section 2]. The measurement scheme presented in (A). A clear finite resistance appears in the unpolarized region.
dashed black line is the quantized value (2e2/3h)–1, (D) Four-terminal Rxx versus backgate voltage for the measurement scheme presented in (B).
and the dashed blue line is an exponential fit The Rxx values are low in both polarized and unpolarized regions, in contrast to (C). (E) Evolution of
the resistance measured in the unpolarized regime at B = 7 T and Vbg = –1.24 V as function of
RðxÞ ¼ ½Rð0Þ  Rð∞Þex=l0 þ Rð∞Þ, where R(0) =
temperature. (Inset) Resistance in the unpolarized regime as function of the backgate voltage for
20 ± 13 kilohms, R(∞) = 38.2 ± 0.3 kilohms, and
different temperatures (36, 56, 86, 122, 160, and 198 mK). (F) Evolution of the log of the longitudinal
l0 = 2.1 ± 0.8 mm.
resistance versus the inverse of the temperature in the Hall bar geometry. (Inset) Evolution of
the resistance versus the backgate voltage in the unpolarized regime for several temperatures
(62, 85, 142, and 196 mK). The extracted activation gap is Eg = 1.07 K.
deviation of the two-terminal resistance from
the canonical value R2t ≃ 38:7 kilohms. We
therefore have conducted two-terminal resistance
measurements of several samples, consisting Measuring the evolution of R↑↑ ↑↓
2t and R2t with the resistance R(0) is in agreement with the
↑↑
of two 60-mm-wide ohmic contacts separated by length, we found R2t independent of contact two-terminal resistance predicted for unequi-
a distance L ranging from 4 to 15 mm. The large separation (Fig. 2B, orange circles), whereas R↑↓2t librated channels proposed in (6), R2t = (4e2/
aspect ratio (of width to length) minimizes back- increases with L, approaching the quantized 3h)–1 ≈ 19.4 kilohms. These observations might
scattering between the propagating edge modes value for L = 15 mm (Fig. 2B, blue circles). Ex- have been possible at short distance because
on opposite sides of the mesa. As visible on ponential fit of the two-terminal resistance is of the reduction of scattering events and the
Fig. 2A for L = 4 mm, in the (B, Vbg) phase presented in Fig. 2B (dashed blue line), [R(0) – screening of the Coulomb interraction by the
space corresponding to the polarized state, we R(∞)]e−x/l0 + R(∞), where R(0) = 20 ± 13 kilohms back gate placed 1 mm away from the 2DEG.
found a two-terminal resistance R↑↑ 2t ðL ¼ 4Þ ≃ is the resistance at zero distance, R(∞) = 38.2 ± Bearing in mind that a finite Rxx caused by
38:6 T 0:1 kilohms. However, for the unpolarized 0.3 kilohms is the resistance at infinite distance, dissipation processes at short contact separation
state, the resistance plateau was found to deviate and l0 = 2.1 ± 0.8 mm is the characteristic can lead to similar observations, a few additional
from the quantized value, showing R↑↓ 2t ðL ¼ 4Þ ≃ equilibration length [additional details on Fig. configurations were tested. One of them was a
35:5 kilohms. 2B are provided in (37), section 2]. Moreover, configuration that uses a complementary Hall

Lafont et al., Science 363, 54–57 (2019) 4 January 2019 2 of 4


R ES E A RC H | R E PO R T

channel, finally arriving at D3. A maximum cur-


rent at D3 was measured when tl = tr = 0.5 [a toy
model for this effect is presented in (37), section 6].
The present set of experiments revealed counter-
propagation of charged particles in the fractional
quantum Hall effect regime. This present exper-
iment may induce future theoretical works of the
less understood unpolarized v = 2/3 state.

REFERENCES AND NOTES


1. K. V. Klitzing, G. Dorda, M. Pepper, Phys. Rev. Lett. 45,
494–497 (1980).
2. D. C. Tsui, H. L. Stormer, A. C. Gossard, Phys. Rev. Lett. 48,
1559–1562 (1982).
3. R. B. Laughlin, Phys. Rev. Lett. 50, 1395–1398 (1983).
4. C. W. J. Beenakker, Phys. Rev. Lett. 64, 216–219 (1990).
5. X. Wen, Mod. Phys. Lett. B 05, 39–46 (1991).
6. A. H. MacDonald, Phys. Rev. Lett. 64, 220–223 (1990).
7. R. C. Ashoori, H. L. Stormer, L. N. Pfeiffer, K. W. Baldwin,
K. West, Phys. Rev. B Condens. Matter 45, 3894–3897
(1992).
8. R. Sabo et al., Nat. Phys. 10.1038/nphys4010 (2017).
Fig. 4. Generation of upstream charge current by a quantum point contact. Evolution of the 9. C. L. Kane, M. P. A. Fisher, J. Polchinski, Phys. Rev. Lett. 72,
current measured in D3 as function of tl and tr for different points in the (Vbg, B) phase space 4129–4132 (1994).

Downloaded from http://science.sciencemag.org/ on January 7, 2019


(points shown in the large image). A significant current is measurable in the unpolarized region 10. Y. Meir, Phys. Rev. Lett. 72, 2624–2627 (1994).
(red, green, purple, orange, and brown points), whereas no signal was measurable in the polarized 11. J. Wang, Y. Meir, Y. Gefen, Phys. Rev. Lett. 111, 246803
(2013).
region (white, black, blue, yellow, and gray points). (Inset) Two successive quantum point contacts 12. A. Bid et al., Nature 466, 585–590 (2010).
setup. Current is sourced at S (red), flowing downstream to the left QPC; there, it is split to 13. I. Gurman, R. Sabo, M. Heiblum, V. Umansky, D. Mahalu,
downstream (red/blue) and upstream (green) charge currents. The unequilibrated upstream current Nat. Commun. 3, 1289 (2012).
reaches the second QPC and turns back to downstream (green/blue), where we measured its 14. H. Inoue et al., Nat. Commun. 5, 4067 (2014).
15. A. Rosenblatt et al., Nat. Commun. 8, 2251 (2017).
voltage at D3. The sketch is not to scale; the distance between the two QPC is 700 nm, and the 16. A. Grivnin et al., Phys. Rev. Lett. 113, 266803 (2014).
distance between the QPC and the nearest ohmic contact is 30 mm. 17. J. P. Eisenstein, H. L. Stormer, L. N. Pfeiffer, K. W. West,
Phys. Rev. B Condens. Matter 41, 7910–7913 (1990).
18. S. Kronmüller et al., Phys. Rev. Lett. 81, 2526–2529
bar structure, with a narrow Hall channel width Buttiker formalism (40, 41) [(38), section 4], (1998).
19. S. Kronmüller et al., Phys. Rev. Lett. 82, 4070–4073 (1999).
of 3 mm (Fig. 3B); this was necessary in order to leads to Gd ≈ 0.687 e 2/h and Gup ≈ 0.026 e 2/h or 20. T. Chakraborty, Adv. Phys. 49, 959–1014 (2000).
ensure the lack of backscattering along distances equivalent to a two-terminal resistance (Gup + 21. J. H. Smet, R. A. Deutschmann, W. Wegscheider,
under consideration. The measured Rxx (Fig. 3D) Gd)–1 ≈ 1.40 h/e2 ≈ 36.2 kilohms, which is in G. Abstreiter, K. von Klitzing, Phys. Rev. Lett. 86, 2412–2415
for the two v = 2/3 states by using this geometry agreement with the two-terminal configuration (2001).
22. S. Kraus et al., Phys. Rev. Lett. 89, 266801 (2002).
was negligibly small, ensuring that edge states at 4 mm presented above (Fig. 2). The mobility of 23. J. Hayakawa, K. Muraki, G. Yusa, Nat. Nanotechnol. 8, 31–35
located on opposite sides of the Hall bar (Fig. 3B, the 2DEG in proximity to an alloyed ohmic contact (2013).
red and blue lines) do not exchange particles. This is degraded, and its density is increased, which 24. J. N. Moore, J. Hayakawa, T. Mano, T. Noda, G. Yusa,
observation is in agreement with the relatively limited us on the minimal distance between ohmic Phys. Rev. Lett. 118, 076802 (2017).
25. R. S. K. Mong et al., Phys. Rev. X 4, 011036 (2014).
large gap (~1 K for the unpolarized state) ex- contacts to 4 mm. 26. D. J. Clarke, J. Alicea, K. Shtengel, Nat. Phys. 10, 877–882 (2014).
tracted from the temperature evolution of R4p xx In order to probe the edge modes at shorter 27. T. Wu et al., Phys. Rev. B 97, 245304 (2018).
presented on Fig. 3F and is in agreement with distances, we used a configuration consisting of 28. J. K. Jain, Phys. Rev. Lett. 63, 199–202 (1989).
previous measurements (38, 39). Furthermore, two, gate-defined quantum point contacts (QPCs) 29. I. V. Kukushkin, K. V. Klitzing, K. Eberl, Phys. Rev. Lett. 82,
3665–3668 (1999).
testing a Corbino geometry sample ensured a separated by 700 nm (Fig. 4, inset), with all ohmic 30. B. Verdene et al., Nat. Phys. 3, 392–396 (2007).
negligible bulk conductance of both v = 2/3 contacts placed far away (above 30 mm). A current 31. J. Huels, J. Weis, J. Smet, K. Klitzing, Z. Wasilewski,
states [(37), section 3]. Last, a three-terminal I = 1 nA was sourced via contact S; currents were Phys. Rev. B 69, 085319 (2004).
configuration, with contacts aligned on a single monitored at the drains while scanning the 32. S. Hennel et al., Phys. Rev. Lett. 116, 136804 (2016).
33. H. Cho et al., Phys. Rev. Lett. 81, 2522–2525 (1998).
edge of the mesa (each separated by 4 mm), al- transmissions of the left and right QPCs tl and t r. 34. Y. Q. Li, V. Umansky, K. von Klitzing, J. H. Smet, Phys. Rev. B
lowed separation of the upstream current from This was done at different points in the (Vbg, B) 86, 115421 (2012).
the downstream one (Fig. 3A), providing a direct phase space for both spin polarization of the v = 35. J. H. Smet et al., Nature 415, 281–286 (2002).
measurement for the upstream conductance. Cur- 2/3 states, indicated by the colored circles in Fig. 36. Y.-H. Wu, G. J. Sreejith, J. K. Jain, Phys. Rev. B 86, 115127
(2012).
rent I was sourced via contact 1 and drained via 4. In the polarized state, all of the current flowed 37. Supplementary text is available as supplementary
contact 4 to the ground. A finite voltage Vup was to drains D1 and D2 independent of tr, which is materials.
measured at contact 2 for the unpolarized state consistent with downstream channels, and zero 38. L. W. Engel, S. W. Hwang, T. Sajoto, D. C. Tsui, M. Shayegan,
only as visible on Fig. 3C. The resistance, defined current was measured at D3 (Fig. 4, white, black, Phys. Rev. B Condens. Matter 45, 3418–3425 (1992).
39. G. S. Boebinger, A. M. Chang, H. L. Stormer, D. C. Tsui,
as Rup = Vup/I, continuously dropped with in- blue, yellow, and gray points). However, in the Phys. Rev. Lett. 55, 1606–1609 (1985).
creasing temperature up to 200 mK (Fig. 3E). unpolarized state (Fig. 4, red, green, purple, 40. M. Büttiker, Phys. Rev. Lett. 57, 1761–1764 (1986).
This dependence has an opposite trend to that orange, and brown points), substantial signal 41. S. Datta, Electronic Transport in Mesoscopic Systems
(Cambridge Univ. Press, 1995), vol. 3.
of usual dissipative processes such as variable was found in D3, simultaneously decreasing the 42. A. Rosenblatt, F. Lafont, Replication Data for: Counter-
range hopping or activation mechanisms, ruling current measured in D1 and D2 result in over- propagating charge transport in the quantum Hall effect
them out as alternative explanations. A com- all current conservation [(37), section 5]. This regime. Harvard Dataverse (2018);
plementary measurement of the downstream “upstream effect” can be explained by the ap-
AC KNOWLED GME NTS
resistance, Rd = Vd/I, was done by sourcing cur- pearance of an upstream current between the two
We thank A. Stern and Y. Meir for fruitful discussions. We thank
rent via contact 2 and measuring the voltage at QPCs (Fig. 4, inset, green arrow), which emerges D. Mahalu for her precious help in the ebeam lithography process.
contact 1. The upstream and downstream con- from the left QPC, flows a short distance to the Funding: We acknowledge the European Research Council
ductances, calculated by using the Landauer- right QPC, and scatters back to the downstream under the European Community’s Seventh Framework Program,

Lafont et al., Science 363, 54–57 (2019) 4 January 2019 3 of 4


R ES E A RC H | R E PO R T

grant agreement 339070; the partial support of the Minerva experimental work and contributed in data interpretation and SUPPLEMENTARY MATERIALS
Foundation, grant 711752; and, together with V.U., the German- writing of the paper. V.U. contributed in molecular beam epitaxy www.sciencemag.org/content/363/6422/54/suppl/DC1
Israeli Foundation (GIF), grant I-1241-303.10/2014, and the Israeli growth. Competing interests: The authors declare that they Supplementary Text
Science Foundation (ISF). Author contributions: F.L. and A.R. have no competing financial interests. Data and materials Figs. S1 to S5
contributed equally to this work in sample design, device availability: All data needed to evaluate the conclusions in the
fabrication, measurement set-up, data acquisition, data analysis paper are present in the paper or the supplementary materials 1 November 2017; accepted 8 November 2018
and interpretation, and writing of the paper. M.H. guided the and deposited at (42). 10.1126/science.aar3766

Downloaded from http://science.sciencemag.org/ on January 7, 2019

Lafont et al., Science 363, 54–57 (2019) 4 January 2019 4 of 4


R ES E A RC H

NANOMATERIALS and HBC—were chosen as target compounds


(Fig. 2, A and B). DBPP, which can be considered
an ultrashort armchair GNR (6-AGNR), repre-
Fluorine-programmed nanozipping sents the model for the on-surface synthesis of
GNRs, and HBC is one of the smallest and best-

to tailored nanographenes on rutile characterized NGs (29–33). Both NGs possess


easy-to-recognize geometries in scanning tunnel-
ing microscopy (STM) images. The required
TiO2 surfaces specially “programmed” fluorinated oligophenyl-
enes P1 and P2 were obtained by multistep
M. Kolmer1,2*, R. Zuzak1, A. K. Steiner3, L. Zajac1, M. Engelund4, S. Godlewski1,
organic synthesis (for details, see the supple-
mentary materials). The key feature of the
M. Szymonski1, K. Amsharov3*
cyclodehydrofluorination is the “switchable”
activity of the C–F bond. Only C–F bonds with
The rational synthesis of nanographenes and carbon nanoribbons directly on nonmetallic
close proximity to a C–H bond displayed ac-
surfaces has been an elusive goal for a long time. We report that activation of the carbon
tivity, whereas peripheral C–F remained com-
(C)–fluorine (F) bond is a reliable and versatile tool enabling intramolecular aryl-aryl coupling
pletely intact. This reactivity enabled tandem
directly on metal oxide surfaces. A challenging multistep transformation enabled by C–F
cyclization via HF elimination in a truly dom-
bond activation led to a dominolike coupling that yielded tailored nanographenes directly on
inolike fashion, because each subsequent cy-
the rutile titania surface. Because of efficient regioselective zipping, we obtained the target
clization step led to the “activation” of one new
nanographenes from flexible precursors. Fluorine positions in the precursor structure
C–F bond (26). The active H–F pairs for the HF-
unambiguously dictated the running of the “zipping program,” resulting in the rolling up of

Downloaded from http://science.sciencemag.org/ on January 7, 2019


zipping concept are shown schematically in
oligophenylene chains.The high efficiency of the hydrogen fluoride zipping makes our approach
Fig. 2, A and B.
attractive for the rational synthesis of nanographenes and nanoribbons directly on insulating
All on-surface experiments, including low-
and semiconducting surfaces.
temperature STM, x-ray photoemission spec-

C
troscopy (XPS), and mass spectrometry (MS)
arbon-based nanostructures synthesized nanostructures directly on technologically rele- studies, were performed in situ under UHV condi-
through rational surface-assisted C–C cou- vant nonmetallic substrates, such as metal oxide tions. We deposited precursor molecules by using
pling on single-crystal metal surfaces (1, 2) surfaces (20–22). However, all reported attempts standard Knudsen cells on the (2×1) reconstructed
include individual isomers of fullerenes to perform the cyclization on metal oxides have (011) face of the rutile TiO2 (for details, see the
(3, 4) and fullerene fragments (5, 6), the been unsuccessful because of the lack of catalytic supplementary materials). To thermally induce
chirality-pure carbon nanotubes (7), atomically activity in the cyclodehydrogenation process the transformation of P1, we started with sub-
precise nanographenes (NGs) (8–10), and graphene (20) (Fig. 1C). The cyclization of PAH precursors monolayer deposition of precursor molecules on
nanoribbons (GNRs) with a well-defined pe- on such surfaces requires high temperatures, the substrate kept at room temperature (RT) and
riphery (6, 11–15). The consecutive, thermally which leads to a loss of selectivity. Thus, the then heated the substrate to ~570 K (bulk activa-
triggered cyclodehydrogenation of the polycyclic rational synthesis of tailored carbon-based nano- tion temperature) for 10 min. Under these mild
aromatic hydrocarbon (PAH) precursor bearing architectures on metal oxide surfaces requires conditions, most P1 molecules desorbed from the
required C–C connectivity to the target nano- the development of an alternative cyclization surface, leaving almost bare surface terraces with
structure represents the key transformation in technique. Previously, we have found that in- no clear evidence of successful HF elimination
the on-surface synthesis strategy. The synthesis tramolecular aryl-aryl coupling can be effectively (see the supplementary materials). At a higher
of hexabenzo[bc,ef,hi,kl,no,qr]coronene (HBC) realized through C–F bond activation on g-Al2O3 annealing temperature of ~670 K, particularly
by Weiss et al. showed that this step can be under relatively mild conditions (23–27). Fur- flat molecules with the specific rhomboid shape
realized efficiently under ultrahigh vacuum ther exploration revealed that metal oxides of expected for DBPP were observed in our STM
(UHV) conditions on atomically clean metal III and IV groups also displayed activity in experiment. However, because of the appreciable
surfaces (16) (Fig. 1A). The catalytic activity of cyclodehydrofluorination at elevated temper- thermal desorption of P1, DBPP molecules were
the metals substantially reduced the activation atures (28). Among them, bulk powders of ti- adsorbed only on chemically active sites (step
barrier of the cyclization (8). In 2010, Cai et al. tanium dioxide activated C–F bonds at 570 K, edges or domain boundaries), which compli-
applied a similar strategy to form atomically which made it an attractive candidate for on- cated the accurate interpretation of their non-
precise GNRs on the Au(111) surface (11) (Fig. 1B). surface investigations performed under UHV uniform STM contrast (see the supplementary
This discovery paved the way toward the fabrica- conditions. materials).
tion of complex molecular nanoarchitectures We present the rational on-surface synthesis of With the larger precursor P2, after deposi-
on selected noble metal surfaces (17). However, NGs on a semiconducting rutile TiO2(011) surface tion onto an RT substrate, P2 molecules were
for most practical applications, a carbon-based through dominolike HF zipping of programmed found mostly in globular form on reconstructed
nanostructure must be transferred onto insulat- fluoroarene precursors (Fig. 1D). The high poten- terraces of rutile (011) with STM. However,
ing or semiconducting surfaces (18, 19). tial of the approach was demonstrated by a chal- after annealing at ~570 K, the molecules re-
An attractive yet challenging way to tackle this lenging transformation consisting of the formal mained on the surface (Fig. 2C). Moreover, we
problem is the controlled synthesis of carbon rolling up of the linear oligophenylene chain observed a general change in P2 appearance
around a phenyl moiety, yielding NG HBC (Fig. and observed elongated geometries with lengths
1
Centre for Nanometer-Scale Science and Advanced Materials, 1D). In contrast to the commonly used rigid up to ~2.5 nm. These geometries correspond
NANOSAM, Faculty of Physics, Astronomy and Applied design of precursors, our approach allows the to different possible configurations of P2 on the
Computer Science, Jagiellonian University, Łojasiewicza 11,
30-348 Kraków, Poland. 2Center for Nanophase Materials
regioselectivity of the cyclization to be unam- surface (see detailed analysis in the supplemen-
Sciences, Oak Ridge National Laboratory, Oak Ridge, TN biguously programmed by F atom positions, tary materials), consistent with the expected
37831, USA. 3Department of Organic Chemistry, Friedrich providing sufficient flexibility in the design of flexibility of the precursors. This observation
Alexander University Erlangen-Nuremberg, 91058 Erlangen, precursor molecules. points out that the globular geometry, the fa-
Germany. 4Espeem S.A.R.L., L-4365 Esch-sur-Alzette,
Luxembourg.
To investigate the HF-zipping process on a vorable gas-phase configuration of P2 preserved
*Corresponding author. Email: konstantin.amsharov@fau.de rutile surface, two model NGs—namely, DBPP after deposition, was only metastable on the
(K.A.); kolmerma@ornl.gov (M.K.) (dibenzo[ij,rst]phenanthro[9,10,1,2-defg]pentaphene) surface.

Kolmer et al., Science 363, 57–60 (2019) 4 January 2019 1 of 4


R ES E A RC H | R E PO R T

To induce the transformation of P2, we heated


the rutile (011) substrate to ~670 K for 10 min.
Although most of the molecules were found on
step edges, some molecules appeared directly
on newly formed ad-islands that allowed their
high-quality STM visualization (Fig. 2D). The
round shape and the size (~1.6-nm full width at
half maximum, as shown by STM image cross
sections in Fig. 3, A and B) of the molecules are
in agreement with the expected HBC model
(Fig. 3C), our unoccupied-states STM image
simulations (see the supplementary materials),
and previous reports (29, 30, 32). The presence of
HBC molecules demonstrated the feasibility of
the HF-zipping strategy on the rutile surface.
The programmed P2 precursor was transformed
via five consecutive cyclodehydrofluorination
steps followed by the final cyclodehydrogenation
into the target NG molecule.
Among molecules found on ad-islands, some
possessed an additional protrusion located

Downloaded from http://science.sciencemag.org/ on January 7, 2019


beside the center of the molecule, as marked
by arrows in Fig. 3A. We attributed these
images to molecules of helicenelike H2-HBC,
presented in Fig. 3D, in which the final cyclo-
Fig. 1. Selected examples of on-surface syntheses of NGs and nanoribbons by a bottom-up dehydrogenation step was not accomplished.
approach. (A) First on-surface synthesis of NG HBC (16); (B) rational synthesis of GNRs on Au(111) The presence of two H atoms in the fjord region
(11); (C) attempts to perform cyclodehydrogenation on a metal oxide surface (20); (D) first caused deviation from planar geometry, with
rational on-surface synthesis of NGs on a nonmetallic surface (this work). two corresponding benzene rings oriented out
of plane. The high-resolution STM image of an
HBC and H2-HBC pair in Fig. 3E confirms the
expected position of the protrusion on the
molecules. The uncopied-states STM contrast
of H2-HBC is also reproduced in our STM image
simulation (see the supplementary materials),
which is in good agreement with the exper-
imental image. The formation of the H2-HBC
intermediate after only the first five cyclization
reactions activated via F was rather unexpected,
because the last cyclization step should occur
spontaneously given the high strain in the fjord
region. However, the observation of the H2-
HBC intermediate indicates that, on the TiO2
surface, the cyclodehydrofluorination process
had a markedly lower activation barrier than
cyclodehydrogenation. A similar strategy was
in fact completely inefficient on metal surfaces.
As we found for the Au(111) surface, catalytic
activation of the competitive cyclodehydrogena-
tion processes resulted in undefined molecular
structures formed from P2 after their anneal-
ing (see results and discussion in the supple-
mentary materials). Thus, metal oxide surface
assistance in the cyclodehydrofluorination is
the key aspect of the successful HF zipping (28).
Although the cyclization mechanism is not fully
understood, the most probable scenario includes
the C–F bond polarization by the active Ti center,
allowing synchronous Friedel-Crafts–like aryla-
tion (34, 35).
Fig. 2. HF elimination–based zipping of precursors. Schemes of (A) DBPP and (B) HBC The STM data show that the HF-zipping strat-
formation concepts. (C) Three-dimensional (3D) visualization of an STM image (+2 V; 10 pA) egy was efficient, as many single-target molecules
of P2 deposited on rutile (011)-(2×1) at RT and annealed at 570 K for 10 min. Note different were found locally on the surface. Other than H2-
configurations of molecules. (D) 3D STM image (+2.5 V; 50 pA) obtained after sample HBC and HBC, no other molecular species were
annealing at 670 K. Single HBC molecules are adsorbed on newly formed ad-islands with observed on the ad-islands where high-quality
different surface reconstruction (yellow-green). (Inset) STM image (+2 V, 10 pA, 2.5 nm by STM imaging was possible. To shed more light
2.5 nm) of a single HBC molecule. Scale bars in (C) and (D) are 2 nm. on the global outcome of the thermally induced

Kolmer et al., Science 363, 57–60 (2019) 4 January 2019 2 of 4


R ES E A RC H | R E PO R T

HF elimination reaction, we combined the STM of two peaks separated by ~2 eV in binding peak observed at EB = 686.8 eV is related to an
data with the XPS chemical analysis. The C1s energy (EB), which correspond to C–C (red line, organofluorine component (13, 36, 37). The ab-
core-level photoemission spectrum of P2 mole- EB = 284.4 eV) and C–F (green line, EB = 286.3 eV) sence of a peak at ~684.5 eV suggests the lack of
cules deposited on the rutile (011) surface at RT contributions (36, 37). Figure 4B presents the F1s a F–Ti component (38). Thus, the XPS analysis
(Fig. 4A) showed an asymmetric signal composed core-level region. For RT deposition, the single confirmed that the C–F bonds in the precursor
molecules were intact after deposition on the
surface at RT.
After annealing at 670 K for 10 min, the
XPS signal from the C1s region consisted of
only a single peak at EB = 284.5 eV, corre-
sponding to a C–C component (Fig. 4A), con-
firming global scission of C–F bonds in P2
molecules caused by efficient HF elimination.
The corresponding STM images (Fig. 3, A and
E) show that the flat-lying HBC molecules
were found on the newly formed reconstructed
areas of the surface, forming ad-islands attached
to TiO2(011)-(2×1) step edges or domain bound-
aries. These structures were not observed in a
control experiment, where we directly deposited
HBC molecules on the rutile (011) and annealed

Downloaded from http://science.sciencemag.org/ on January 7, 2019


the sample to 670 K (see the supplementary ma-
terials). Moreover, other halogenoarenes with
bromine (20–22) or iodine (21) substituents an-
nealed under similar conditions at rutile titania
surfaces did not produce the observed ad-islands.
An obvious hypothesis is that F atoms are
building blocks in these new structures. How-
ever, Fig. 4B shows that after annealing, the
XPS signal from the F1s region was strongly
reduced, consisted of only organic fluorine
(<10% of the initial intensity), and provided
no indication of a F–Ti component at ~684.5 eV
(arrow). Lack of F at the surface region mo-
tivated us to look for fluorine-containing mol-
ecules desorbing from the rutile (011) surface
after the HF-zipping reaction by monitoring cor-
Fig. 3. HF versus H2 elimination. (A) STM image (+2 V, 50 pA) presenting molecules of responding MS signals during controlled sample
HBC and H2-HBC (arrows) formed from P2 after annealing at 670 K. (B) Cross sections along heating from RT up to 770 K. We observed sig-
purple and green lines in (A). (C and D) Optimized geometries of (C) HBC and (D) H2-HBC nals only for molecules of TiOF2 (Fig. 4C) and
molecules. Gray and white circles correspond to carbon and hydrogen atoms, respectively. TiOF (see the supplementary materials). Despite
(E) High-resolution STM image (+2.7 V, 200 pA) of HBC and H2-HBC on newly formed the sharp peak located at ~500 K, the main
reconstruction of rutile (011). Scale bars in (C) to (E) are 1 nm. fraction of TiOF2 desorbed when the temperature

Fig. 4. Chemical analysis. (A) XPS


C1s core-level spectra measured for P2
deposited on rutile (011) at RT (top)
and after annealing to 670 K (bottom).
arb., arbitrary. (B) XPS F1s core-level
spectra measured for P2 deposited
on rutile (011) at RT and after annealing
to 670 K. The arrow marks the energy
of the eventual F–Ti component. (C) Mass
spectrometer signals of a TiOF2 molecule
(m/z = 101.8) registered during controlled
heating of bare and P2-covered rutile TiO2(011)
from RT to around 770 K. The main fraction
of thermally desorbed TiOF2 molecules from the
P2-covered surface is registered for temper-
atures exceeding 670 K. (D) High-resolution STM
image (+2.7 V, 200 pA) presenting new recon-
struction of the ad-island with apparent
c(2×1) symmetry. (E) Calculated structure of
the hydroxylated rutile TiO2(011)-(1×1) surface
forming (2×1) reconstruction. Gray, red, and white circles correspond to titanium, oxygen, and hydrogen atoms, respectively. (F) Unoccupied-states
STM image simulation of the structure presented in (E). Scale bars in (D) to (F) are 0.5 nm. Purple rectangles mark corresponding unit cells.

Kolmer et al., Science 363, 57–60 (2019) 4 January 2019 3 of 4


R ES E A RC H | R E PO R T

exceeded 670 K, consistent with our previous nologically relevant semiconducting or insulat- 31. W. H. Soe et al., ACS Nano 6, 3230–3235 (2012).
experimental observations. ing surfaces. 32. L. Gross et al., Science 337, 1326–1329 (2012).
33. T. Ardhuin, O. Guillermet, A. Gourdon, S. Gauthier,
Desorption of TiOF2 points to strong Ti–F J. Phys. Chem. C 122, 11905–11910 (2018).
covalent bonding of F to the surface during the RE FERENCES AND NOTES 34. J. Ichikawa, M. Yokota, T. Kudo, S. Umezaki, Angew. Chem. Int.
HF zipping, which may indirectly explain the 1. J. Méndez, M. F. López, J. A. Martín-Gago, Chem. Soc. Rev. 40, Ed. Engl. 47, 4870–4873 (2008).
observed surface reconstruction under newly 4578–4590 (2011). 35. D. Sharapa, A.-K. Steiner, K. Amsharov, Phys. Status Solidi B
2. P. A. Held, H. Fuchs, A. Studer, Chemistry 23, 5874–5892 10.1002/pssb.201800189 (2018).
formed HBC molecules. Adsorbates strongly in- (2017). 36. F. Blobner et al., J. Phys. Chem. C 119, 15455–15468
teracting with the surface are known to induce 3. G. Otero et al., Nature 454, 865–868 (2008). (2015).
changes in rutile titania reconstructions, as pre- 4. K. Amsharov et al., Angew. Chem. Int. Ed. Engl. 49, 9392–9396 37. R. Han et al., Chem. Commun. 52, 9805–9808 (2016).
viously reported for (110) (39) and (011) (40, 41) (2010). 38. J.-Y. Ruzicka et al., RSC Adv. 4, 20649–20658 (2014).
5. K. T. Rim et al., Angew. Chem. Int. Ed. Engl. 46, 7891–7895 39. D. Silber et al., Nat. Commun. 7, 12888 (2016).
faces. Recent work by Balajka et al. (41) reported (2007). 40. Q. Cuan, J. Tao, X. Q. Gong, M. Batzill, Phys. Rev. Lett. 108,
a water-induced reconstruction of a rutile (011) 6. N. Abdurakhmanova et al., Carbon 84, 444–447 (2015). 106105 (2012).
surface to form a bulk-terminated (1×1) face 7. J. R. Sanchez-Valencia et al., Nature 512, 61–64 (2014). 41. J. Balajka et al., J. Phys. Chem. C 121, 26424–26431
covered with a hydroxyl group overlayer form- 8. M. Treier et al., Nat. Chem. 3, 61–67 (2011). (2017).
9. C. Rogers et al., Angew. Chem. Int. Ed. Engl. 54, 15143–15146
ing (2×1) reconstruction. In the case of a HF (2015). AC KNOWLED GME NTS
elimination reaction, the desorption of TiOF2 10. R. Zuzak et al., Chem. Commun. 54, 10256–10259 (2018).
Funding: The research was supported by the Polish Ministry
species also formally leads to the formation of 11. J. Cai et al., Nature 466, 470–473 (2010).
of Science and Higher Education, contract no. 0341/IP3/2016/74.
water molecules, TiO2 + 2HF → TiOF2 + H2O, 12. P. Ruffieux et al., Nature 531, 489–492 (2016).
R.Z. acknowledges support received from the National
13. H. Hayashi et al., ACS Nano 11, 6204–6210 (2017).
which then could dissociate and locally create Science Center, Poland (2017/24/T/ST5/00262). A.K.S. and
14. C. Ma et al., Nat. Commun. 8, 14815 (2017).
the hydroxyl-rich reconstruction. Close inspec- K.A. thank the Deutsche Forschungsgemeinschaft (DFG-SFB
15. D. J. Rizzo et al., Nature 560, 204–208 (2018).
953 “Synthetic Carbon Allotropes” project A6, and AM407) for
tion of the ad-island structure performed by 16. K. Weiss et al., Angew. Chem. Int. Ed. Engl. 38, 3748–3752
financial support. Work was partially conducted at the Center

Downloaded from http://science.sciencemag.org/ on January 7, 2019


high-resolution STM characterization (Fig. 4D) (1999).
for Nanophase Materials Sciences (CNMS), which is a DOE
17. L. Talirz, P. Ruffieux, R. Fasel, Adv. Mater. 28, 6222–6231
shows bright protrusions forming rows along the Office of Science User Facility. The research was partially
(2016).
[01-1] direction, with neighboring ones shifted supported from basic and statutory funds of the Jagiellonian
18. P. B. Bennett et al., Appl. Phys. Lett. 103, 253114 (2013).
University in Krakow provided by the Polish Ministry of Science
by half of the lattice, giving apparent pseudo- 19. J. P. Llinas et al., Nat. Commun. 8, 633 (2017).
and Higher Education. Author contributions: K.A. and M.K.
hexagonal c(2×1) symmetry. Results of our den- 20. M. Kolmer et al., Angew. Chem. Int. Ed. Engl. 52, 10300–10303
conceived the project. K.A. and A.K.S. carried out the precursor
(2013).
sity functional theory calculations shown in Fig. synthesis and analysis. M.K. and R.Z. conducted the on-surface
21. M. Kolmer et al., Chem. Commun. 51, 11276–11279 (2015).
4E present the exact structure of the ad-islands synthesis and low-temperature STM, XPS, and MS analyses
22. G. Vasseur et al., J. Am. Chem. Soc. 138, 5685–5692
with support from L.Z., S.G., and M.S. M.E. conducted the
with four hydroxyl groups (two dissociated water (2016).
computations. M.K. and K.A. prepared the manuscript with
molecules) per (2×1) unit cell. Corresponding 23. K. Y. Amsharov, M. A. Kabdulov, M. Jansen, Angew. Chem. Int.
feedback from all other authors. Competing interests: None
Ed. Engl. 51, 4594–4597 (2012).
unoccupied-states STM image simulation (Fig. declared. Data and materials availability: All data needed to
24. N. Suzuki, T. Fujita, K. Y. Amsharov, J. Ichikawa, Chem.
4F) confirmed that for high positive bias volt- evaluate the conclusions in the paper are present in the paper or
Commun. 52, 12948–12951 (2016).
the supplementary materials.
ages, this (2×1) surface reconstruction gave the 25. O. Papaianina, K. Y. Amsharov, Chem. Commun. 52,
apparent c(2×1) symmetry observed in the ex- 1505–1508 (2016). SUPPLEMENTARY MATERIALS
26. A. K. Steiner, K. Y. Amsharov, Angew. Chem. Int. Ed. Engl. 56,
perimental data. These results support the rutile www.sciencemag.org/content/363/6422/57/suppl/DC1
14732–14736 (2017).
titania surface participation in intermediate Materials and Methods
27. O. Papaianina et al., Angew. Chem. Int. Ed. Engl. 56,
Supplementary Text
states of the cyclodehydrofluorination and re- 4834–4838 (2017).
Figs. S1 to S34
flect its crucial role in this process. Our results 28. K. Amsharov, Phys. Status Solidi B 253, 2473–2477
Table S1
(2016).
provide a pathway toward custom-designed References (42–45)
29. P. Samorí, N. Severin, C. D. Simpson, K. Müllen, J. P. Rabe,
sp2 carbon–based nanostructure formation by J. Am. Chem. Soc. 124, 9454–9457 (2002). 21 September 2018; accepted 16 November 2018
direct on-surface synthesis methods on tech- 30. L. Gross et al., Phys. Rev. B 71, 165428 (2005). 10.1126/science.aav4954

Kolmer et al., Science 363, 57–60 (2019) 4 January 2019 4 of 4


R ES E A RC H

ATOMIC PHYSICS Laser cooling works through velocity-dependent


scattering and exchange of momentum between
near-resonant photons and ions, molecules, or
Laser cooling of ions in a atoms. For simple Doppler cooling (4) using a
transition with natural linewidth g (expressed in

neutral plasma hertz), excitation wavelength l, and laser detun-


ing D ~ −g, particles with velocity substantially
outside the capture range (vc = lg) are Doppler-
Thomas K. Langin, Grant M. Gorman, Thomas C. Killian* shifted too far out of resonance for appreciable
light scattering. Thus, cooling is most effective in
Laser cooling of a neutral plasma is a challenging task because of the high temperatures systems with vT ≲ vc for characteristic thermal
typically associated with the plasma state. By using an ultracold neutral plasma created velocity vT = (kBT/m)1/2, where m is the particle
by photoionization of an ultracold atomic gas, we avoid this obstacle and demonstrate mass. For typical optical transitions, vc ≈ 10 m/s,
laser cooling of ions in a neutral plasma. After 135 microseconds of cooling, we observed requiring T ≲ 1 K. This is one reason that laser
a reduction in ion temperature by up to a factor of four, with the temperature reaching cooling has not been successfully applied to ions
as low as 50(4) millikelvin. This pushes laboratory studies of neutral plasmas deeper into in non-ultracold neutral plasmas, which are in-
the strongly coupled regime, beyond the limits of validity of current kinetic theories for variably much hotter than UNPs. UNPs provide
calculating transport properties. The same optical forces also retard the plasma expansion, the required low initial ion temperature, but high
opening avenues for neutral-plasma confinement and manipulation. collision rates (25) and hydrodynamic expansion
of the plasma into surrounding vacuum (14, 15)

T
he application of laser cooling to trapped With the use of standard methods for UNP create an environment that differs markedly from

Downloaded from http://science.sciencemag.org/ on January 7, 2019


ions (1–3) and neutral atoms (4) has driven creation, coupling in these systems is limited to other systems that have been laser cooled.
groundbreaking advances in physics, includ- Gi ≲ 3 by disorder-induced heating (DIH), which To create UNPs, we initially cooled 5 × 108 88Sr
ing quantum computing (5), Wigner crys- occurs immediately after plasma creation from atoms to T = 1 mK and magnetically trapped
tallization (6–8), and quantum degeneracy the disordered atomic or molecular gas. DIH de- them in the metastable 5s5p 3P2 state by using
(9). More recently, laser-cooling techniques have creases the ion Coulomb energy and increases standard laser-cooling techniques (34). Trapping
been applied to molecules (10), solids (11, 12), and the temperature to TDIH ≈ e2/12pe0akB as ions fields and cooling lasers were then extinguished,
mesoscopic quantum objects (13). In this study, develop spatial correlations (14, 15, 26). For typi- and the atom cloud expanded for 6 ms before a
using an ultracold neutral plasma (UNP) created cal UNP densities, TDIH ~ 1 K. Many schemes pulse (10 mJ for 10 ns) of lpulse = 322 nm photons
by photoionizing Sr atoms in an ultracold gas have been proposed to overcome this limit, such from a doubled, pulsed-dye laser ionized 10%
(14, 15), we demonstrate laser cooling of ions in as precorrelating the system before ionization of the atoms. The plasma density distribution
a neutral plasma. by using Rydberg blockade (27, 28), Fermi re- was well approximated by a slightly asymmetric
A major motivation for cooling ions in a neu- pulsion (26), an optical lattice (28), and molecu- Gaussian distribution with root mean square (RMS)
tral plasma is to study transport, thermalization, lar Rydberg plasmas in a supersonic beam (29). radii sx(0) = 2.4(1) mm and sy/z(0) = 3.1(1) mm
and collective modes when the ratio between the Sequential excitation to higher ionization states and peak density ni(0) = 1.3(3) × 108 cm−3. This
Coulomb potential energy and thermal kinetic (30) has been shown to increase G by 40%. Exper- yielded a peak TDIH = 0.41(0.03) K. lpulse was
energy of ions is large [Gi ¼ e2 =4pe0 akB Ti ≳ 1, iments using Rydberg blockade (31) and molec- tuned such that DE = hc/lpulse − EPI, the excess
where Ti is the ion temperature, a = (3/4pni)1/3 ular plasmas (29) have yielded promising results, photon energy above the photoionization thresh-
is the Wigner-Seitz radius for density ni, e is the but no measured values of G have been reported. old energy EPI, set the electron temperature to
elementary charge, e0 is the vacuum permittivity, In this work, we realized laser-cooling proposals Te(0) = 2DE/3kB = 15.5(3) K. (Here, h is Planck’s
and kB is the Boltzmann constant]. Standard (32, 33) and achieved Gi as high as 11(1). constant, and c is the speed of light.) Electrons
kinetic theories (16) fail to describe important
plasma properties under such conditions of strong
Coulomb coupling because they neglect effects of
spatial correlations. Such conditions are found in
white dwarf stars (6, 17), cores of Jovian planets
(6), dusty plasmas (18), trapped nonneutral plas-
mas (3, 7, 8), laser-produced plasmas important
for studies of warm dense matter and inertial
confinement fusion (17, 19), and UNPs. State-
of-the-art predictions of transport and thermal-
ization rates for high-density strongly coupled
plasmas (20) are currently obtained from direct
molecular dynamics simulation (21–23) of the
Yukawa one-component-plasma (OCP) model
(6, 17, 24). UNPs are highly faithful realizations
of the Yukawa OCP model (15). With precise
temperature and density diagnostics (14) and
pump-probe techniques for studying kinetic pro-
cesses (25), UNPs offer many advantages for Fig. 1. Principles of laser cooling of a neutral plasma. (A) Sr+-level diagram indicating the
studying the effects of strong coupling on col- wavelengths and decay rates for transitions relevant to cooling and imaging. (B) Experimental
lisional processes (15, 24, 25) and validating schematic. Cooling (408-nm) and repumping (1092- and 1033-nm) lasers were applied in counter-
numerical methods. propagating configurations with the indicated polarizations. Light at 422 nm for LIF was shaped by a
slit to illuminate a central slice of the plasma. It propagated perpendicular to the imaging axis ð^z Þ and,
unless otherwise specified, along the laser-cooling axis ð^x Þ. Propagation directions for LIF and cooling light
Department of Physics and Astronomy, Rice University, 6100
Main Street, Houston, TX 77005, USA. are indicated. LIF images were recorded on an intensified charge-coupled device camera. A high-pass
*Corresponding author. Email: killian@rice.edu dichroic D reflected the cooling laser and transmitted the LIF light. M, mirror; l/4, quarter-wave plate).

Langin et al., Science 363, 61–64 (2019) 4 January 2019 1 of 4


R ES E A RC H | R E PO R T

were trapped by Coulomb attraction to the ions


and formed a neutralizing background with over-
all nonneutrality on the order of a few percent
(14, 15).
Immediately after plasma formation, counter-
propagating s+ and s− polarized beams near res-
onance with the 5s 2S1/2–5p 2P3/2 transition at
408 nm (g = 22.4 MHz) illuminated the plasma,
forming a one-dimensional optical molasses (4)
for laser cooling along the x direction (Fig. 1).
The single-beam peak intensity was I = 100 mW/
cm2 (1/e2-intensity radius w = 9 mm, and satu-
ration parameter s0 = 2.3). Lasers at 1092 and
1033 nm repumped ions from long-lived 2D3/2
and 2D5/2 states, returning them to the cooling
cycle. Reductions in cooling efficiency caused by
coherent coupling of the 2S1/2 and 2D5/2 states
and resulting electromagnetically induced trans-
parencies (35) were minimized by rapid velocity-
changing collisions in the plasma (25). After laser
cooling, spatially resolved measurements of ion

Downloaded from http://science.sciencemag.org/ on January 7, 2019


temperature and density were performed by using
laser-induced fluorescence (LIF) on the 2S1/2–
2
P1/2 transition at 422 nm (36). The LIF laser il-
luminated a central slice of the plasma (z ≈ 0),
providing transverse spatial resolution of 13 mm Fig. 2. Ion temperature and coupling variation. Shown are the data for laser detuning D = −20 MHz
and resolution along the imaging axis equal to [red (cooling)], D = 20 MHz [blue (heating)], and no 408-nm laser (yellow). (A to C) Temperature at
the tight dimension of the LIF light (wz = 2 mm). three different times after plasma creation (as indicated in each panel). Each measurement corresponds
Unless otherwise specified, temperature was mea- to a region with Dx = 260 mm and Dy = 4.5 mm centered at y = 0. Cooling and heating were ineffective
sured along the laser-cooling axis (Fig. 1). at large displacement from the plasma center because the plasma expansion Doppler-shifted these
Figure 2, A to C, shows temperature measure- ions out of resonance with the lasers. (D) Temperature versus time in the central region (|x| ≤ 0.5 mm).
ments, spatially resolved along the laser-cooling (E) Coulomb coupling parameter Gi versus time in the central region. Solid lines in (D) and (E) were
axis, for three different laser-cooling parameters: calculated by using coupled ion and electron kinetic equations (36). We do not display results from
no cooling light (yellow), detuning from reso- the model for the heating data because the density perturbation was too severe for the model to
nance of D = −20 MHz [cooling (red)], and D = be applicable (Fig. 3A). Error bars indicate SD.
+20 MHz [heating (blue)]. By 5 ms after plasma
qffiffiffiffiffiffiffiffiffiffiffiffi
formation, cooling and heating beams had little for the entire plasma of hv2exp i ¼ sð0Þ=texp on much farther than that for no 408-nm light. Even
effect. Temperature variation across the sample more notable is the increase of Gi to 11(1) after
reflected variation in density and the resulting DIH a time scale of texp. Cooling is effective only in 135 ms (Fig. 2E), which is comparable to condi-
1=3
temperature ðTDIH ºni Þ. By 60 ms, the ion tem- regions for which the expansion velocity along the tions of interest in white dwarf stars (6, 17), for
perature was substantially altered by the lasers. cooling-laser axis remains less than or comparable example. It is also much deeper into the strong
^ → →
In the center of the plasma (x ≈ 0), Ti doubled in to the velocity capture range½jx  v exp ðr ; tÞj ≲ vc  for coupling regime than has previously been re-
the heating configuration and was reduced by an appreciable time. ported with these systems. A value of Gi = 4 was
half for cooling compared with no cooling light. For these experiments, s(0)/texp ≈ 40 m/s ex- obtained (38) in a UNP with relatively high den-
The trend continued for 135 ms of heating or ceeded the velocity capture range, and texp ≈ 75 ms sity and low electron temperature, which in-
cooling, with the lowest temperature observed, was on the order of the minimum time required duces substantial screening of ion-ion interactions
Ti = 50(4) mK, providing clear evidence of laser to scatter enough photons to substantially cool [screening parameter k = a/lD = 1 for Debye
cooling. the ions (4). Thus, cooling was most effective for screening length lD = (kBTee0/nee2)1/2] and re-
Cooling was effective only in the central region jxj ≲ 1 mm, where the expansion velocity stayed duces the effects of strong coupling. For our con-
(jxj ≲ 1 mm), which illustrates the role of plasma relatively small. Analogous statements can be ditions, k ≤ 0.7, and the screening was weaker.
expansion. Immediately after plasma formation, made for the heating configuration. To observe Although laser-cooling was applied only along
the density gradient and electron thermal energy substantial laser cooling, it was essential to one axis, all three degrees of freedom were ef-
created a radially directed force that drives ex- create very large plasmas compared with those fectively cooled because of the high collision rate
pansion (14). Although electron-ion thermaliza- in previous UNP experiments (14, 15), which in- in the plasma. Molecular dynamics simulations
tion has noticeable effects (37) and the plasma creased texp and gave more time for laser cooling. (39) show that local thermal equilibrium is es-
used in this work was slightly asymmetric, an Figure 2D shows the evolution of the ion tablished on the time scale of a few times the
analytic expansion model for a collisionless, temperature for the center of the plasma, where inversep offfiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffi
the ion plasma ffi oscillation frequency,
spherically symmetric, Gaussian plasma is a sat- cooling and heating were most effective. Fits w1
pi ¼ e0 mi =ni e2 ≲ 2 ms. We confirmed cross-
isfactory approximation for developing an intui- from an approximate kinetic model (14, 37) ac- thermalization by measuring the temperature
tive explanation of laser-cooling results. In this counting for DIH, electron-ion heating, adiabatic transverse to the cooling axis (36). Lasers along
model (14, 15), expansion creates a hydrodynamic cooling, and laser cooling describe the data rea- a single axis also produce three-dimensional
→ →
plasma-velocity field v exp ðr; tÞ ¼ ½t=ðt 2 þ t2exp Þr sonably well (36). The natural dynamics, seen in cooling in trapped ions (1, 2), but this is not true
(where r is the displacement from the plasma the data for no laser cooling, was an increase to for neutral atoms (4) and molecules (10), which
center, t is time, and texp = [mis(0)2/kBTe(0)]1/2 is Ti ~ 0.4 K within the first few microseconds, have much lower collision rates. Collisions did
a characteristic time for the expansion). The owing to DIH, followed by cooling caused by not damp the hydrodynamic expansion velocity
velocity increases with time and distance from adiabatic expansion. In the presence of the cool- transverse to the laser-cooling axis because of
the plasma center, saturating at an RMS value ing lasers, however, the ion temperature dropped conservation of momentum during each collision.

Langin et al., Science 363, 61–64 (2019) 4 January 2019 2 of 4


R ES E A RC H | R E PO R T

atoms would allow for larger s0 and texp for a


given density. Laser cooling could then be ap-
plied for a longer time, leading to lower temper-
ature and higher Gi. The lowest temperature
theoretically achievable with Doppler cooling
on this transition is TDoppler = hg/2kB = 0.5 mK
(4), and even with present conditions it is likely
that cooling can continue longer than reported
here and below 50 mK. However, the natural
linewidth of the LIF transition is already large
compared with the Doppler broadening at this
temperature, limiting further application of this
Fig. 3. Influence of laser forces on plasma expansion. (A) Evolution of plasma density temperature diagnostic. Improving the temper-
distribution. Red-detuned optical molasses along ^x retarded expansion, whereas blue-detuned light ature resolution by, for example, using a narrow
accelerated it, eventually leading to bifurcation. The scale bar is 5 mm. The color bar is rescaled for two-photon transition to a metastable D state
each time to nmax = (13, 8.5, 4.2, 2.2, 1.3) × 107 cm−3 for t = (5, 30, 60, 90, 120) ms. (B) RMS radius should enable measurement of lower tempera-
sx(t) from Gaussian fit to experimental data (same symbols as in Fig. 2). Error bars indicate SD. ture. Then it will be possible to study the laser-
cooling and laser-confinement limits imposed
by electron-ion heating and three-body recom-
bination (14, 15, 32).

Downloaded from http://science.sciencemag.org/ on January 7, 2019


REFERENCES AND NOTES
1. D. Wineland, R. Drullinger, F. Walls, Phys. Rev. Lett. 40,
1639–1642 (1978).
2. W. Neuhauser, M. Hohenstatt, P. Toschek, H. Dehmelt,
Phys. Rev. Lett. 41, 233–236 (1978).
3. D. H. E. Dubin, T. M. O’Neil, Rev. Mod. Phys. 71, 87–172 (1999).
4. H. Metcalf, P. van der Straten, Laser Cooling and Trapping
(Springer-Verlag, 1999).
5. H. Haffner, C. F. Roos, R. Blatt, Phys. Rep. 469, 155–203
(2008).
6. S. Ichimaru, Rev. Mod. Phys. 54, 1017–1059 (1982).
7. W. M. Itano et al., Science 279, 686–689 (1998).
8. A. Mortensen, E. Nielsen, T. Matthey, M. Drewsen, Phys. Rev. Lett.
96, 103001 (2006).
9. C. J. Pethick, H. Smith, Bose–Einstein Condensation in Dilute
Gases (Cambridge Univ. Press, ed. 2, 2008).
10. E. S. Shuman, J. F. Barry, D. Demille, Nature 467, 820–823
(2010).
11. D. V. Seletskiy et al., Nat. Photonics 4, 161–164 (2010).
12. R. I. Epstein, M. I. Buchwald, B. C. Edwards, T. R. Gosnell,
C. E. Mungan, Nature 377, 500–503 (1995).
Fig. 4. Effects of detuning. (A) Temperature at x = 0 versus detuning for 135 ms of evolution in 13. M. Aspelmeyer, T. J. Kippenberg, F. Marquardt, Rev. Mod. Phys.
the optical field. The inset shows Ti versus x for D = −10 MHz (red) and D = −30 MHz (blue), 86, 1391–1452 (2014).
14. T. C. Killian, T. Pattard, T. Pohl, J. M. Rost, Phys. Rep. 449,
along with Gaussian fits. (B) Plasma size versus detuning at 135 ms of evolution. Here, size is the 77–130 (2007).
RMS width calculated numerically from the image. Error bars indicate SD. 15. M. Lyon, S. L. Rolston, Rep. Prog. Phys. 80, 017001 (2017).
16. L. G. Stanton, M. S. Murillo, Phys. Rev. E 93, 043203 (2016).
17. M. S. Murillo, Phys. Plasmas 11, 2964–2971 (2004).
The light-scattering force from the cooling ever, as the lasers were further red detuned, more
18. G. E. Morfill, A. V. Ivlev, Rev. Mod. Phys. 81, 1353–1404 (2009).
lasers also notably retarded the expansion of the of the cloud experienced the light-scattering 19. B. A. Remington, R. P. Drake, D. D. Ryutov, Rev. Mod. Phys.
plasma, as shown in Fig. 3 for the same initial forces for a longer time, creating a larger region 78, 755–807 (2006).
plasma conditions as in Fig. 2. The kinetic model of cooled ions at the expense of slightly decreased 20. J. Clérouin, P. Arnault, C. Ticknor, J. D. Kress, L. A. Collins,
Phys. Rev. Lett. 116, 115003 (2016).
discussed above provides a reasonable descrip- cooling efficiency (Fig. 4A, inset). Similarly, the
21. J. Daligault, Phys. Rev. Lett. 108, 225004 (2012).
tion of the evolution of the RMS size along the acceleration of plasma expansion for the heating 22. J. Daligault, K. O. Rasmussen, S. D. Baalrud, Phys. Rev. E 90,
laser axis (Fig. 3B). For larger initial plasma size configuration was most effective for a relatively 033105 (2014).
and detuning of the cooling laser, retardation large blue detuning, D ~ 50 MHz, as shown in the 23. Z. Donkó, P. Hartmann, Phys. Rev. E 69, 016405 (2004).
24. M. S. Murillo, Phys. Rev. Lett. 96, 165001 (2006).
of the expansion was even more effective (36), plot of RMS size along the laser axis (Fig. 4B).
25. T. S. Strickler, T. K. Langin, P. McQuillen, J. Daligault,
raising the intriguing possibility of confining a With Gi = 11, laser-cooled UNPs are already in T. C. Killian, Phys. Rev. X 6, 021021 (2016).
neutral plasma with optical forces, perhaps with an interesting regime for applying established 26. M. S. Murillo, Phys. Rev. Lett. 87, 115003 (2001).
the addition of spatially varying magnetic fields techniques for measuring collision rates, trans- 27. G. Bannasch, T. C. Killian, T. Pohl, Phys. Rev. Lett. 110, 253003
(2013).
in a hybrid magneto-optical trap (4) and mag- port, and dispersion relations (15, 25). Laser forces
28. D. O. Gericke, M. S. Murillo, Contrib. Plasma Phys. 43, 298–301
netic cusp (40) configuration. For blue detun- also open entirely new possibilities. For example, (2003).
ing, the plasma bifurcated because ions were by patterning the lasers spatially, it should be 29. H. Sadeghi et al., Phys. Rev. Lett. 112, 075001 (2014).
accelerated away from the center until the force possible to create reasonably sharp velocity gradi- 30. M. Lyon, S. D. Bergeson, A. Diaw, M. S. Murillo, Phys. Rev. E 91,
033101 (2015).
diminished when the velocity exceeded the cap- ents and measure shear viscosity. Heating and
31. M. Robert-de-Saint-Vincent et al., Phys. Rev. Lett. 110, 045004
ture range. The marked change in expansion dy- cooling separate regions of the plasmas should (2013).
namics for blue detuning highlights the potential initiate heat flow and allow measurement of ther- 32. S. G. Kuzmin, T. M. O’Neil, Phys. Plasmas 9, 3743–3751
of laser forces for manipulating a plasma. mal conductivity. There are also straightforward (2002).
Figure 4 illustrates the variation of laser- opportunities to improve the laser-cooling pro- 33. T. Pohl, T. Pattard, J. M. Rost, Phys. Rev. Lett. 92, 155003
(2004).
cooling and heating effects with detuning D. cess, such as investigating cooling along three 34. S. B. Nagel et al., Phys. Rev. A 67, 011401 (2003).
After 135 ms of laser application, Gi in the central dimensions, which might be effective for plasma 35. M. Fleischhauer, A. Imamoglu, J. P. Marangos, Rev. Mod. Phys.
region was minimized for D ~ −20 MHz. How- confinement. Increasing the number of ionized 77, 633–673 (2005).

Langin et al., Science 363, 61–64 (2019) 4 January 2019 3 of 4


R ES E A RC H | R E PO R T

36. Further experimental and simulation details are available as ACKN OWLED GMEN TS competing interests. Data and materials availability: All data
supplementary materials. We thank I. Plompen for experimental assistance. Funding: This work shown in this work can be found in the Harvard Dataverse (41).
37. P. McQuillen, T. Strickler, T. K. Langin, T. C. Killian, was supported by the Air Force Office of Scientific Research through
Phys. Plasmas 22, 033513 (2015). grant FA9550-17-1-0391 and by the NSF/DOE Partnership in Basic SUPPLEMENTARY MATERIALS
38. M. Lyon, S. D. Bergeson, M. S. Murillo, Phys. Rev. E 87, 033101 (2013). Plasma Science and Engineering through the DOE/SC Office of Fusion
www.sciencemag.org/content/363/6422/61/suppl/DC1
39. S. D. Baalrud, J. Daligault, Contrib. Plasma Phys. 57, 238–251 (2017). Energy Sciences grant DE-SC0014455. Author contributions: T.K.L.
Supplementary Text
40. H. Grad, Containment in Cusped Plasmas Systems (Courant constructed the apparatus, performed experiments, analyzed data,
Figs. S1 to S4
Institute of Mathematical Sciences, New York Univ., 1961). and performed numerical simulations. G.M.G. performed experiments
References (42–49)
41. T. K. Langin, G. M. Gorman, T. C. Killian, Replication data for: and analyzed data. T.C.K. conceived of and designed the experiment.
Laser cooling of ions in a neutral plasma, Version 1, Harvard All authors discussed results and contributed to the preparation of 14 February 2018; accepted 13 November 2018
Dataverse (2018); https://doi.org/10.7910/DVN/8ZOVUB. the manuscript. Competing interests: The authors declare no 10.1126/science.aat3158

Downloaded from http://science.sciencemag.org/ on January 7, 2019

Langin et al., Science 363, 61–64 (2019) 4 January 2019 4 of 4


R ES E A RC H

NEUROSCIENCE The pulvinar receives a massive afferent input


from V1 (1, 9), and its response to visual stimuli
depends on V1 (1, 19). Because silencing of V1
A collicular visual cortex: has a minor effect on POR activity, the pulvinar
might seem a poor candidate for relaying visual

Neocortical space for an ancient activity to POR. However, the pulvinar is also a
key node of the colliculo-cortical pathway be-
cause it receives direct input from SC (10, 20).
midbrain visual structure If there were pulvinar neurons whose visually
evoked activity was driven by SC and unaffected
Riccardo Beltramo1,2,3* and Massimo Scanziani1,2,3*
by V1 silencing, then such neurons could me-
diate responses in POR that are independent
Visual responses in the cerebral cortex are believed to rely on the geniculate input to of V1. We first determined whether there are
the primary visual cortex (V1). Indeed, V1 lesions substantially reduce visual responses neurons in the pulvinar that are visually driven
throughout the cortex. Visual information enters the cortex also through the superior by SC (Fig. 2). Injections in V1 and SC with viral
colliculus (SC), but the function of this input on visual responses in the cortex is less clear.
anterograde tracers revealed that axons origi-
SC lesions affect cortical visual responses less than V1 lesions, and no visual cortical nating from SC preferentially target the caudal
area appears to entirely rely on SC inputs. We show that visual responses in a mouse lateral pulvinar, whereas axons originating from V1
visual cortical area called the postrhinal cortex are independent of V1 and are abolished preferentially target the rostral pulvinar (Fig. 2A).
upon silencing of the SC. This area outperforms V1 in discriminating moving objects. We
To determine whether V1 and SC inputs are also
thus identify a collicular primary visual cortex that is independent of the geniculo-cortical separated functionally, we recorded responses

Downloaded from http://science.sciencemag.org/ on January 7, 2019


pathway and is capable of motion discrimination. from the caudal or rostral pulvinar while opto-
genetically silencing V1 or SC (Fig. 2, B to D).

T
We presented dark moving dots, visual stimuli
he mammalian cerebral cortex receives sen- the respective recording sites overlapped (Fig. 1 known to drive robust activity in the SC (21).
sory information from several modalities. and fig. S1A). Visual areas in mice are anatom- Photoinhibition of SC strongly attenuated its re-
Even within the same modality, sensory ically defined by their retinotopic afferent input sponses to the visual stimuli, particularly in the
information reaches the cortex via anatom- originating from V1 (14, 16). We thus injected the stratum opticum (Fig. 2B) (79.34 ± 4.31% average
ically distinct parallel pathways. The rela- anterograde viral tracer AAV1.CAG.TdTomato decrease ± SEM in visually evoked firing rate; P <
tive roles of these distinct pathways in driving in the posterior portion of V1 and identified POR 0.0001, Wilcoxon signed-rank test, n = 33, 5 mice)
cortical responses to a sensory stimulus and the via transcranial epifluorescence illumination (see also fig. S7). SC silencing similarly attenuated
extent to which their sensory representations are of the labeled V1 axons projecting to the visual the visually evoked responses recorded simulta-
spatially segregated in the cortex are still matters areas surrounding V1 (Fig. 1A and fig. S2). Drift- neously in the caudal pulvinar (Fig. 2B) (80.02 ±
of debate (1). ing gratings displayed on a monitor at the center 5.96% average decrease ± SEM in visually evoked
In the visual system, dorsolateral geniculate of the receptive field triggered responses in 40% firing rate; P < 0.0001, Wilcoxon signed-rank test,
nucleus (dLGN) innervation of the primary visual (81 of 209) of the units isolated from POR [aver- n = 34, 5 mice). Silencing of V1 had little effect
cortex (V1) is considered the primary entry point age firing rate ± SEM of visually evoked responses on visually evoked activity in the caudal pul-
of retinal input to the cortex (2). V1 lesions abol- for regular-spiking (RS), putative excitatory neu- vinar (Fig. 2C) (24.64 ± 5.33% average decrease ±
ish or strongly reduce visually evoked activity in rons: 1.61 ± 0.25 Hz, n = 41; for fast-spiking (FS), SEM in visually evoked firing rate; P = 0.0004,
several higher cortical visual areas (3–6). The putative inhibitory interneurons: 3.14 ± 0.43 Hz, Wilcoxon signed-rank test, n = 63, 7 mice) while
colliculo-cortical pathway provides visual input n = 40; 5 mice]. We silenced V1 by photoactivat- strongly reducing visual responses in the rostral
to the cortex from the superior colliculus (SC) via ing cortical inhibitory interneurons expressing pulvinar (Fig. 2D) (91.43 ± 4.82% average de-
the pulvinar nucleus of the thalamus (7–10). channelrhodopsin-2 (ChR2). This approach abol- crease ± SEM in visually evoked firing rate; P =
Its inactivation has either no or only a slight ished visual responses in RS neurons across the 0.0005, Wilcoxon signed-rank test, n = 16, 3 mice).
and feature-selective effect on cortical visual re- entire cortical depth (fig. S3) and over large areas Could the SC be disynaptically connected to
sponses (9, 11–13). Thus, despite a clear anatom- of V1 (fig. S4) (17). Despite this extensive silencing POR through the pulvinar? We used anterograde
ical link from SC to visual cortex, no cortical area of V1, however, most of the visual response in trans-synaptic tracing in which transfection of
has been identified yet whose visual responses POR persisted (Fig. 1, C and D) [21.65 ± 6.51% virus harboring Cre recombinase in the presynaptic
rely entirely on visual activity originating from average decrease ± SEM in visually evoked firing neuronal population leads to the conditional ex-
the SC. rate of RS cells (P = 0.022, n = 41); 34.5 ± 5.03% pression of a reporter gene in the postsynaptic
Visual responses in the mouse cortical area of FS cells (P < 0.0001, n = 40, 5 mice; Wilcoxon neuronal population (22) (Fig. 3, A and B, and
postrhinal cortex (POR) are well documented signed-rank test)]. Whereas the response latencies fig. S8). We injected this virus in the SC and a
(14–16). Although generally assumed to rely on in V1 and POR were quite similar (fig. S5), the virus containing conditional green fluorescent
V1, their dependence on V1 has not been directly time courses of the peristimulus time histogram protein (GFP) in the caudal pulvinar. Histologi-
assessed. We determined the impact of V1 on (PSTH) in V1 and POR were markedly different cal analyses revealed cell bodies expressing GFP
POR’s visual responses in awake, head-fixed mice. (Fig. 1, C and D, and fig. S6). in the caudal pulvinar and axonal arborizations
We optogenetically silenced V1 while performing Which structure other than V1 could relay vi- densely innervating layers 4 and 1 in POR as well
simultaneous electrophysiological recordings from sual input to POR? The dLGN is also a source as other cortical visual areas, albeit with the ex-
V1 and POR, ensuring that the receptive fields of of afferent input to other visual areas (16). To ception of the laterointermediate area (LI), to a
determine whether POR directly receives input much lesser extent than POR (Fig. 3, A and B, and
1
Center for Neural Circuits and Behavior, Neurobiology Section,
from the dLGN, we injected cholera toxin sub- fig. S8), consistent with recent observations (20).
and Department of Neuroscience, University of California San unit B (CTB) in POR (Fig. 1E). The dLGN was To determine whether visually evoked activity in
Diego, La Jolla, CA, USA. 2Department of Physiology, University almost devoid of retrogradely labeled neurons. POR depends on SC, we performed simultaneous
of California San Francisco, San Francisco, CA, USA. 3Howard The vast majority (>99%) of retrogradely labeled recordings from POR and SC while optogeneti-
Hughes Medical Institute, University of California San
Francisco, San Francisco, CA, USA.
cell bodies in the visual thalamus were found in cally silencing SC (Fig. 3, C to F). We presented
*Corresponding author. Email: ric.beltramo@gmail.com (R.B.); the pulvinar (18) [also called the latero-posterior dark moving dots and ensured that the receptive
massimo@ucsf.edu (M.S.) nucleus in rodents (10)]. fields at the recording sites in POR and in the

Beltramo et al., Science 363, 64–69 (2019) 4 January 2019 1 of 6


R ES E A RC H | R E PO R T

A Identification of higher visual areas B Silencing V1 while recording in POR


anterograde AAV1-CAG-TdTomato anterior V1 POR Rec. Rec. LED
RL Rec. Rec.
A
RL AM AL LED
PM
AL LM

medial
GAD-Cre
lateral

medial

lateral
PM LI AAV9-Flex-ChR2
LI
LM V1 injected in V1
POR
POR V1 POR V1
P 1 mm P

posterior posterior

C V1 Firing rate POR Firing rate D LED


V1 LED
POR
+45° min max min max +45°
0.8 0.8

Normalized firing rate

Normalized firing rate


average average
0.6 0.6

Elevation
Elevation

0° 0° 0.4 0.4

0.2 0.2

-45° -45° 0 0
-45° 0° +45° -45° 0° +45° -1 -0.5 0 +0.5 +1 -1 -0.5 0 +0.5 +1
Azimuth Azimuth Time from stimulus onset (s) Time from stimulus onset (s)
LED LED 8
20

Downloaded from http://science.sciencemag.org/ on January 7, 2019


15 6

POR firing rate LED ON (Hz)


4

V1 firing rate LED ON (Hz)


10

8
2
6
Firing rate (Hz)

16 single unit 16 single unit


4
1
8 8 2

0 0 0 0
-1 -0.5 0 +0.5 +1 -1 -0.5 0 +0.5 +1 0 2 4 6 8 10 15 20 0 1 2 4 6 8
Time from stimulus onset (s) Time from stimulus onset (s) V1 firing rate LED OFF (Hz) POR firing rate LED OFF (Hz)

E anterograde F G Pulvinar
retrograde AAV1-CAG 1.0
TdTomato V1
CTB

Fraction of total CTB+ cells


0.8

in Pulvinar and dLGN


POR
0.6
Pulvinar
0.4
V1 dLGN
POR
0.2
dLGN
1mm 300 µm 100 µm 0.0
? Bregma: -4.5 mm Bregma: -2.6 mm -3.0 -2.6 -2.2 -1.8
visual thalamus Distance from bregma (mm)

Fig. 1. Visual responses in POR are not driven by the geniculate-V1 as described for (C) (33 non-GABAergic RS units in V1 and 41 RS units
pathway. (A) Injection of the anterograde tracer AAV1.TdTomato in in POR from five animals). (Top) Summary average PSTHs. The PSTH
V1 enabled the visualization of higher visual areas. Delineated cortical values for individual units were normalized by their maximum value and
areas are as shown in fig. S2. The weaker fluorescence of POR is consistent then averaged together. (Bottom) Scatter plots reporting the responses
with its weaker V1 input (31). (B) Drifting gratings (diameter, 20°) were of all units measured during the stimulus presentation period (0.9 s).
presented to awake mice conditionally expressing ChR2 in V1 inhibitory Green data points, example units in (C). (E) Injection of the retrograde
neurons. Recordings were simultaneously performed in POR and in tracer CTB in POR. (F) (Left) TdTomato injection site in V1 with
V1. A light-emitting diode (LED)–coupled optic fiber was used to anterograde projection to POR (white) and CTB injection in POR (red).
silence V1. (C) Example experiment. (Left) V1 recordings; (right) POR (Middle) CTB+ neurons in dLGN and pulvinar nuclei. (Right) Higher-
recordings. (Top) Heatmaps of the receptive fields of multiunit activity. magnification image of the region delineated by the square in the middle
Dotted circle shows position of the visual stimulus. (Bottom) Raster plots image. (G) Distribution of retrogradely labeled dLGN and pulvinar neurons
and PSTH of RS units under control conditions (black) and during V1 along the thalamic rostro-caudal axis (ratio of CTB+ cells in pulvinar or
silencing (blue). Black horizontal bar, duration of stimulus presentation; in dLGN to the total CTB+ cells counted in the two nuclei; 45 coronal
blue horizontal bar, period of V1 silencing. (D) Summary of all experiments sections, three mice).

superficial layers of SC overlapped (see materials 0.0001, Wilcoxon signed-rank test, n = 96, 5 mice), receptive field silenced in SC. That was evident
and methods and figs. S1B and S9). SC silencing across cortical depths in a homogeneous manner for dot trajectories covering a large fraction
almost completely abolished the response of POR (fig. S10). The reduction of POR responses to dots of visual space, where SC silencing created a
to the dots (Fig. 3D) (93.77 ± 1.95% average de- was particularly pronounced for the portion of “scotoma” in the response of POR neurons
crease ± SEM in visually evoked firing rate; P < the POR receptive field that overlapped with the (fig. S9). To directly compare the effect of SC

Beltramo et al., Science 363, 64–69 (2019) 4 January 2019 2 of 6


R ES E A RC H | R E PO R T

silencing with that of V1 silencing, we also pre- highlighting the much stronger impact of SC than Because SC sends sparse inhibitory GABAergic
sented drifting gratings (Fig. 3, E and F) iden- V1 on visually evoked activity in POR (79.83 ± projections to the dLGN (21), our optogenetic
tical to those used to measure V1 silencing (Fig. 1, 4.46% average decrease ± SEM in visually evoked activation of GABAergic projection neurons in
C and D). Optogenetic silencing of SC suppressed firing rate; P < 0.0001, Wilcoxon signed-rank test, SC might suppress dLGN neurons. The dLGN
the response of POR to drifting gratings (Fig. 3F), n = 44, 2 mice). projects to other visual areas in addition to V1 (16)

Fig. 2. Anatomical and


A SC:a AAV1-CAG-GFP
V1: AAV1-CAG-TdTomato
Caudal Rostral
functional segregation
Bregma: -3.9mm Bregma: -3.12mm Bregma: -2.52mm Bregma: -2.04mm
of cortical and collicular
Pulv
inputs in the pulvinar. SC
Injection sites

V1
dLGN Pulv
Pulv dLGN
(A) (Top) Coronal
sections showing the
injection sites of AAV1.
CAG.TdTomato in V1
500 µm 500 µm 500 µm 500 µm
and AAV1.CAG.GFP in
SC
Normalized Fluorescence Density

1
SC (left) and of V1 and SC to pulvinar
V1 to pulvinar
SC projections to 0.8 V1
dLGN and pulvinar
(Pulv) for three repre- 0.6
SC
sentative sections

Downloaded from http://science.sciencemag.org/ on January 7, 2019


0.4
along the rostro-caudal
Pulv
axis. (Bottom left)
0.2
Normalized fluorescent Caudal Rostral

density (average ± SEM) 0


-3.2 -2.8 -2.4 -2.0
along rostro-caudal axis Caudal Distance from bregma (mm) Rostral
of the pulvinar (green,
Laser Rec. LED LED
SC input; magenta, B C D
V1 input; 54 coronal V1 V1
sections, three mice). Silencing SC Silencing V1 Silencing V1
Fluorescence density SC Rec.

values were normalized


to those for the coronal Rec. Pulv Rec. Pulv Pulv
section displaying Caudal Rostral Caudal Rostral Caudal Rostral
maximal tdTomato or
GFP expression. (Bottom SC Caudal Pulv Caudal Pulv Rostral Pulv
(stratum opticum) (-3.2mm bregma -2.4mm) (-3.2mm bregma -2.4mm) (-2.3mm bregma -1.8mm)
right) Schematic
illustration of the results. 15 single unit 15 single unit single unit single unit
(B) (Top row) The
Firing rate (Hz)

Firing rate (Hz)

Firing rate (Hz)

Firing rate (Hz)


stimulus was a dark dot 10 10
moving along a straight
trajectory. Recordings 5 5
were performed simulta-
neously from stratum 0 0
opticum of SC (with an
0.6 0.6
Normalized firing rate

Normalized firing rate

Normalized firing rate

Normalized firing rate

optrode for silencing) and average average average average


0.5 0.5
caudal pulvinar. (Second
0.4 0.4
row) (Left) PSTH of
an SC unit. Black, control; 0.3 0.3

blue, SC silencing; black 0.2 0.2

horizontal bar, period 0.1 0.1

of stimulus presentation; 0
0 +1 +2 +3
0
0 +1 +2 +3 0 +1 +2 +3 0 +1 +2 +3
blue horizontal bar, period Time from stimulus onset (s) Time from stimulus onset (s) Time from stimulus onset (s) Time from stimulus onset (s)
C.Pulv.firing rate-laser SC ON (Hz)

C.Pulv.firing rate-LED V1 ON (Hz)

R.Pulv.firing rate-LED V1 ON (Hz)


SC firing rate-laser SC ON (Hz)

of SC silencing. (Right)
15 20
PSTH of a simultaneously 20 30
recorded unit in the 15 15
10 20
caudal pulvinar. (Third
10 10
row) Average PSTH
5 10
for 33 (left) and 34 (right) 5 5
isolated units in SC and
0 0 0 0
in caudal pulvinar (five
0 5 10 15 0 5 10 15 20 0 10 20 30 0 5 10 15 20
animals). (Bottom row) SC firing rate-laser SC OFF (Hz) C.Pulv..firing rate-laser SC OFF (Hz) C.Pulv..firing rate-LED V1 OFF (Hz) R.Pulv..firing rate-LED V1 OFF (Hz)
Scatter plots of firing
rates averaged over a 450-ms interval (i.e., the response window; see caudal pulvinar. (Second row) PSTH of a unit in caudal pulvinar. Black,
materials and methods for details on the moving dot analysis) during the control; blue, V1 silencing. (Third row) Average PSTH for 63 isolated units
period of visual stimulation. Green data points, example units shown in the (seven animals). (Bottom row) Scatter plot as in (B). (D) Similar experiment
second row. (C) (Top row) V1 silencing and simultaneous recordings in as shown in (C) but recording from rostral pulvinar (16 units; three animals).

Beltramo et al., Science 363, 64–69 (2019) 4 January 2019 3 of 6


R ES E A RC H | R E PO R T

(although not POR) (Fig. 1E). If visual responses mediated visual responses in POR. We therefore the receptive field of the recording site in POR.
in POR depended on a geniculate input relayed blocked neuronal activity in SC with tetrodotoxin TTX application abolished visually evoked re-
via other visual areas, rather than on a collicular (TTX) injected in the stratum opticum of SC (Fig. 3, sponses in POR to both moving dots (Fig. 3H)
input, optogenetic activation of GABAergic SC G and H, and fig. S11). Again, we ensured that the (94.46 ± 3.18% average decrease ± SEM in
neurons could reduce putative geniculate- receptive field of the TTX injection site matched visually evoked firing rate; P < 0.0001, n = 44,

Fig. 3. POR is driven by A B POR


Normalized
Fluorescence Density
1
Bregma: -4.45mm 0.2 0.6 1
the colliculo-cortical AAV1-hSyn-Cre AAV1-CAG TdTomato
Bregma: -4.45mm
Anterograde V1 L1
pathway. (A) Anterograde

Normalized Fluorescence Density


transynaptic A
0.8
Aud RL AM L2/3
trans-synaptic tracing. TEa
AL
AAV1.hSyn.Cre was TEp LI LM
PM
0.6

POR
injected in SC and AAV8. Bregma: -3.07mm
L4
POR V1
P
CAG.Flex.GFP was injected AAV8-CAG
0.4
Flex-GFP
in caudal pulvinar. AAV1. SC L5
CAG.TdTomato injected in Pulv 0.2
(caudal) L6
V1 was used to identify Pulv
Caudal Rostral
higher visual areas. 1mm 150 µm 300 µm
Caudal pulvinar 0
Td-Tomato / GFP / DAPI GFP axons (GFP) POR LI TEa TEp A/RL LM AL AM P PM
Delineated cortical areas
are as shown in fig. S8.
(B) (Left) Double labeling C Moving dot D POR single unit 0.6
POR average

POR firing rate-laser SC ON (Hz)

Downloaded from http://science.sciencemag.org/ on January 7, 2019


of axons targeting POR. 0.5
6

Red, V1 afferents (for POR

Normalized firing rate


0.4 4
localization); green,
12
caudal pulvinar afferents. Laser Rec. 0.3
2
Firing rate (Hz)

(Inset) GFP expression 8


0.2
POR
in the caudal pulvinar. 4 0
0.1
(Middle) Magnification of
SC 0
the region marked by -2 -1 0 +1 +2 +3
0
-2 -1 0 +1 +2
-2
-2 0 2 4 6 25 75
the rectangle in the left Time from stimulus onset (s) Time from the center of POR firing rate-laser SC OFF (Hz)
“SC response interval” (s)
panel (GFP channel) and
summary distribution
E Drifting grating F POR single unit 0.8

POR firing rate-laser SC ON (Hz)


of GFP fluorescence POR average 6

(caudal pulvinar afferents)


Normalized firing rate

0.6
4
along POR cortical depth
(five animals). (Right) Laser Rec. 10 0.4
2
Firing rate (Hz)

Fluorescence density 8
POR 6
distribution of trans- 4
0.2 0
synaptically labeled caudal 2
SC 0
pulvinar axons across -1 -0.5 0 +0.5 +1
0
-1 -0.5 0 +0.5 +1
-2
-2 0 2 4 6 10 30
cortical areas. Green bars, Time from stimulus onset (s) Time from stimulus onset (s) POR firing rate-laser SC OFF (Hz)

normalized averages
and SEM (five animals) G Moving dot H POR single unit 0.8
POR average
-20
Time from TTX inj.(min)

8
POR firing rate after TTX injection (Hz)

across 10 distinct cortical -10


areas. For each animal, the 0
0.6 6
Normalized firing rate

fluorescence density of +10


each area was normalized +20 4
to that for POR. Each TTX Rec. +30 0.4
+40
symbol corresponds to a POR
2
Firing rate (Hz)

different animal. Black 8 0.2


6 0
triangle, experiment on 4
SC
the left. (C) SC silencing 2
0 0 -2
and POR recording. -1 -0.5 0 +0.5 +1 -1 -0.5 0 +0.5 +1 -2 0 2 4 6 10 30
Time from stimulus onset (s) Time from stimulus onset (s) POR control firing rate (Hz)
The visual stimulus was
a dark dot moving at a
speed of 30° per second along the two cardinal and two oblique axes for similar to those shown in (C) and (D) but with a circular drifting grating patch
0.67 or 3 s (i.e., the time required to cover, at 30° per second, trajectories of as the stimulus (diameter: 20°; 44 isolated units; two animals). The average
20° or 90° of visual space, respectively). (D) (Left) Raster plot and PSTH PSTH was aligned to the visual stimulus onset. Scatter plot, neuronal responses
of a POR unit under control conditions (black) and during SC silencing (blue). measured during stimulation period (0.9 s), as in Fig. 1D. (G) SC silencing
(Middle) Aligned average PSTH for 96 isolated units (five animals). The and POR recording. The visual stimulus was a dark dot moving at 30° per
average PSTH was generated by aligning the response of each isolated second along a straight trajectory of 20° of visual space (stimulus duration,
POR unit to the center of the “SC response interval” for the same stimulus 0.67s). The superficial layers of SC were silenced via local application of TTX.
(time 0 s) (see materials and methods for a description of the moving dot (H) (Left) Raster plot and PSTH of an isolated POR unit under control
analysis; see also fig. S9). (Right) Scatter plot of firing rates of POR units, conditions (black) and ~20 min after the beginning of TTX infusion in SC
averaged over a 450-ms window (i.e., the response window; see materials and (red). The gray portion of the raster plot indicates the initial ~20 min of TTX
methods description of the moving dot analysis) within the SC response infusion. (Middle) Average PSTH, aligned to the visual stimulus onset, for
interval. Green data point, example on the left. (E and F) Results of experiments 44 isolated units (three animals). (Right) Scatter plot as in (D).

Beltramo et al., Science 363, 64–69 (2019) 4 January 2019 4 of 6


R ES E A RC H | R E PO R T

3 mice) and drifting gratings (fig. S11) (92.46 ± respond to small objects moving in the field of that occur as the dot moves along its trajectory.
3.79% average decrease in visually evoked firing view is a characteristic property of the SC (21). If so, the exact sequence of the changes in lumi-
rate; P < 0.0001, Wilcoxon signed-rank test, n = 39, We compared the response of V1 and POR to nance along the trajectory may not be relevant
3 mice). Baseline activity in POR was unaffected, small moving objects. The response of a neuron for eliciting a response. In the other case, the
indicating that the suppression of visual responses to a dot moving on a monitor may report differ- neuron may selectively respond to the motion
was not due to a direct action of TTX on POR. ent aspects of the stimulus. In one case, the neu- of the dot, i.e., to changes in luminance occurring
Compared with V1, does POR capture distinct ronal response may simply report local changes sequentially at adjacent spatial positions. We
properties of the visual world? The ability to in luminance within the neuron’s receptive field therefore presented two different stimuli: a

Fig. 4. POR neurons V1 POR


discriminate moving A Moving Dot Random Dot Rec. Rec.
dots from random
dots. (A) (Left) 1 6
The stimulus was 2 21
3 3
a dark dot moving for ...
11
1 s at a speed of 60 ...
30° per second along
a straight trajectory.
(Middle) Random dot: B V1 Moving Dot Random Dot 20
The stimulus was 10

V1 firing rate - Random Dot (Hz)

Downloaded from http://science.sciencemag.org/ on January 7, 2019


made of the same
5
frames as the
moving dot but 4
was presented in
random order. Each 3
8 8
Firing rate (Hz)
Firing rate (Hz)

iteration showed
2
a different random
sequence. (Right) 4 4 1
Recordings were
performed in V1 or 0
0 0
POR. (B) Raster plot -1 0 +1 -1 0 +1 0 1 2 3 4 5 10 20
and PSTH of a V1 unit Time from stimulus onset (s) Time from stimulus onset (s) V1 firing rate - Moving Dot (Hz)
in response to a
moving dot (left) or a C POR Moving Dot Random Dot 20

POR firing rate - Random Dot (Hz)


random dot (middle), 10
and the scatter plot 5
(right) of average
firing rates of V1 units 4
during the period of
3
stimulus presentation
8 8
(1 s) for moving
Firing rate (Hz)
Firing rate (Hz)

2
versus random dots
(67 units, five animals). 4 4 1
Green data point,
0
example unit shown 0 0
on the left. (C) As -1 0 +1 -1 0 +1 0 1 2 3 4 5 10 20
Time from stimulus onset (s) Time from stimulus onset (s) POR firing rate - Moving Dot (Hz)
in (B) but for POR
(56 units, five animals).
Note that the shown D V1 POR
p<0.001
1 1
POR unit did not 1 p>0.001
POR p(Moving Dot > cut-off)
V1 p(Moving Dot > cut-off)

respond to random 0.8 0.8 0.9


dots. (D) (Left) ROC
0.8
Area under ROC

0.8
Fraction of trials
Fraction of trials

curve for the V1 0.6 0.6 Moving 0.8


Moving
isolated unit shown
0.4 0 0.7
in (B). (Inset) 0.4 0
Distribution of spikes Random Random 0.6
for moving dots 0.2 0.2
0.8 0.8
(black bars) and 0 4 8 12 0 4 8 12 0.5
0 Spikes 0 Spikes
random dots (red 0.4
bars). (Middle) ROC 0 0.2 0.4 0.6 0.8 1 0 0.2 0.4 0.6 0.8 1
V1 p(Random Dot > cut-off) POR p(Random Dot > cut-off) V1 POR
curve for the POR
isolated unit shown
in (C). (Right) Comparison of area under ROC curve (average ± SEM) for all responsive POR and V1 units. Black filled data points denote
P < 0.001 for difference in spike distributions between responses to moving and random dots (Wilcoxon rank sum test). Gray bars
show areas under ROC: for V1, 0.55 ± 0.007, 67 units, five mice; for POR: 0.69 ± 0.015, 56 units, five mice (P < 0.0001, Wilcoxon
rank sum test). Green data points, example units shown in (B) and (C).

Beltramo et al., Science 363, 64–69 (2019) 4 January 2019 5 of 6


R ES E A RC H | R E PO R T

“moving dot” and a “random dot” (Fig. 4A). The areas (23, 24). However, though this selectivity to 6. S. Molotchnikoff, F. Hubert, Brain Res. 510, 223–228
moving dot stimulus consisted of a small dot moving objects was believed to result from the (1990).
7. R. A. Berman, R. H. Wurtz, J. Neurosci. 30, 6342–6354
shifting position incrementally along a linear hierarchical cortical processing of geniculate (2010).
trajectory through the receptive field of the inputs entering V1 (23, 24), our data indicate 8. D. C. Lyon, J. J. Nassi, E. M. Callaway, Neuron 65, 270–279
neuron (the same type of stimulus as used in that this property of POR depends on collicular (2010).
experiments described above). For the random input and could be directly inherited from SC. 9. M. Tohmi, R. Meguro, H. Tsukano, R. Hishida, K. Shibuki,
Curr. Biol. 24, 587–597 (2014).
dot stimulus, the dot positions along the same Similarly, the expanded representation of the 10. N. A. Zhou, P. S. Maire, S. P. Masterson, M. E. Bickford,
trajectory were randomized (Fig. 4A). Except for upper visual hemifield reported in POR (24, 25) Vis. Neurosci. 34, E011 (2017).
the temporal order of the dot positions, the two could also be directly inherited from the equally 11. H. R. Rodman, C. G. Gross, T. D. Albright, J. Neurosci. 10,
stimuli were identical. V1 neurons responded biased representation in SC (26). Because the 1154–1164 (1990).
12. T. Ogino, K. Ohtsuka, Invest. Ophthalmol. Vis. Sci. 41, 955–960
almost equally well to moving and to random colliculo-cortical pathway is believed to be phylo- (2000).
dots (Fig. 4B) [25.19% (67 of 266) of the units genetically older than the geniculate-V1 pathway 13. A. Zénon, R. J. Krauzlis, Nature 489, 434–437 (2012).
isolated from V1 responded to moving and/or (27), it is tempting to regard POR as an ancestral 14. Q. Wang, A. Burkhalter, J. Comp. Neurol. 502, 339–357
random dots; average firing rate ± SEM for mov- primary visual area. (2007).
15. C. R. Burgess et al., Neuron 91, 1154–1169 (2016).
ing dot: 1.62 ± 0.19 Hz; for random dot: 1.13 ± Previous reports of SC lesions in cats (12) and 16. L. L. Glickfeld, S. R. Olsen, Annu. Rev. Vision Sci. 3, 251–273
0.16 Hz; n = 67; 5 mice]. For all responsive V1 rodents (9) described only a slight reduction, if (2017).
neurons, the moving dot produced only a 1.4-fold- any, of visually evoked activity in various visual 17. A. D. Lien, M. Scanziani, Nat. Neurosci. 16, 1315–1323
higher average firing response than the random cortical areas. Furthermore, in rodents, this re- (2013).
18. N. Zhou, S. P. Masterson, J. K. Damron, W. Guido,
dot. The response of POR neurons to the same duction depends on the features of the stimulus M. E. Bickford, J. Neurosci. 38, 347–362 (2018).
stimuli, however, showed a marked preference (9). However, none of these recordings was per- 19. D. B. Bender, Brain Res. 279, 258–261 (1983).
for the moving dot over the random dot (Fig. 4C). formed in POR. In primates, SC silencing and 20. C. Bennett, S. D. Gale, M. E. Garrett, M. L. Newton, E. M. Callaway,

Downloaded from http://science.sciencemag.org/ on January 7, 2019


For all responsive POR neurons, the moving dot lesions also have little or no impact on visual G. J. Murphy, S. R. Olsen, bioRxiv 395244 [Preprint].
7 November 2018. https://doi.org/10.1101/395244.
produced a 9.2-fold-higher average firing re- response of several visual cortical areas unless 21. S. D. Gale, G. J. Murphy, J. Neurosci. 34, 13458–13471
sponse than the random dot [33.73% (56 of 166) V1 has been ablated first (11). Although primate (2014).
of the units isolated from POR responded to vision may rely less on SC than in other mam- 22. B. Zingg et al., Neuron 93, 33–47 (2017).
either stimulus; average firing rate ± SEM for mals, again, these recordings were not performed 23. B. Vermaercke et al., J. Neurophysiol. 112, 1963–1983 (2014).
24. N. Nishio et al., Sci. Rep. 8, 11136 (2018).
moving dot: 2.77 ± 0.5 Hz; for random dot: 0.3 ± in the parahippocampal cortical areas TF and 25. M. E. Garrett, I. Nauhaus, J. H. Marshel, E. M. Callaway,
0.05 Hz; P < 0.0001, Wilcoxon signed-rank TH, the primate areas most similar to POR (28). J. Neurosci. 34, 12587–12600 (2014).
test, n = 56; 5 mice]. This was not because POR On the other hand, the driving rather than modu- 26. U. C. Dräger, D. H. Hubel, J. Neurophysiol. 39, 91–101 (1976).
neurons responded much more to moving dots latory impact of SC on the thalamus reported 27. I. T. Diamond, W. C. Hall, Science 164, 251–262 (1969).
28. S. C. Furtak, O. J. Ahmed, R. D. Burwell, Neuron 76, 976–988
than did V1 neurons, but mainly because POR here is not without precedent. In primates, the (2012).
neurons responded much less to random dots SC drives the mediodorsal nucleus of the thala- 29. R. H. Wurtz, M. A. Sommer, J. Cavanaugh, Prog. Brain Res. 149,
than did V1 neurons. Receiver operator char- mus (29) to relay corollary oculomotor activity 207–225 (2005).
acteristics (ROC) analysis showed that an inde- to the frontal eye fields. Primates can also par- 30. D. A. Leopold, Annu. Rev. Neurosci. 35, 91–109 (2012).
pendent observer is better at discriminating tially recover from the inability to detect visual AC KNOWLED GME NTS
moving from random dots based on the response stimuli caused by V1 lesions, a phenomenon called We thank all the members of the Scanziani lab for discussions
of POR than the response of V1 neurons (Fig. blindsight and that involves SC (30). Whether about the project and comments on the manuscript; H. Karten for
4D). Finally, we used moving dots to compare some aspect of blindsight depends on the impact advice during the course of the study; L. Frank, R. Nicoll, and
the sizes of receptive fields of POR and V1 neu- of SC on visual cortex remains to be established. E. Feinberg for critical reading of the manuscript; and M. Mukundan,
J. Evora, N. Kim, and Y. Li for technical support. Funding: This
rons (fig. S12). Neurons in POR had significantly These results show a spatial and functional project was supported by the European Molecular Biology
larger receptive fields than those in V1 (medians ± segregation of the sensory representation of the Organization Long Term Fellowship, the Human Frontier Science
interquartile ranges of receptive field area; POR: two main visual pathways to visual cortex, the Program Long Term Fellowship, and the Howard Hughes
735.5 ± 631 square degrees, n = 62, 5 mice; V1: geniculate-V1 and colliculo-cortical pathways, Medical Institute. Author contributions: R.B. and M.S. designed
the study. R.B. conducted all experiments and analyses. R.B.
157 ± 71.25 square degrees, n = 31, 8 mice; P < and define a specialized cortical area whose and M.S. wrote the paper. Competing interests: The authors
0.0001, Wilcoxon rank sum test). responses to visual stimuli are driven by the declare no competing interests. Data and materials availability:
These results show that a cortical area, POR, colliculo-cortical pathway. All data and analyses necessary to understand and assess the
is driven by visual information conveyed via the conclusions of the manuscript are presented in the main text and
RE FERENCES AND NOTES in the supplementary materials.
colliculo-cortical pathway rather than by the
1. S. M. Sherman, R. W. Guillery, Exploring the Thalamus and Its
geniculate-V1 pathway. The weak impact of V1 Role in Cortical Function. (MIT Press, 2001). SUPPLEMENTARY MATERIALS
silencing on POR is consistent with the weak 2. D. J. Felleman, D. C. Van Essen, Cereb. Cortex 1, 1–47
www.sciencemag.org/content/363/6422/64/suppl/DC1
projection of the former onto the latter area (14). (1991).
Materials and Methods
The superior ability of POR to discriminate 3. P. H. Schiller, J. G. Malpeli, Brain Res. 126, 366–369
Figs. S1 to S12
(1977).
moving objects compared with that of V1 is in References (31–41)
4. H. Sherk, J. Neurophysiol. 41, 204–215 (1978).
agreement with previous descriptions of en- 5. P. Girard, P. A. Salin, J. Bullier, J. Neurophysiol. 66, 1493–1503 3 August 2018; accepted 21 November 2018
hanced motion selectivity in lateral cortical visual (1991). 10.1126/science.aau7052

Beltramo et al., Science 363, 64–69 (2019) 4 January 2019 6 of 6


R ES E A RC H

CLIMATE CHANGE ever, suggest variations by as much as ±25% for


components of the Atlantic circulation (14, 15).
If we instead modify circulation rates to covary
The Little Ice Age and 20th-century with surface temperature anomalies such that
advective and diffusive fluxes are changed by ±25%

deep Pacific cooling in the Little Ice Age relative to the 1990s, the mag-
nitude of our results is altered (fig. S3), but not the
qualitative pattern. In a general circulation model
G. Gebbie1* and P. Huybers2 not subject to such simplified assumptions, the
centennial-scale subsurface temperature response
Proxy records show that before the onset of modern anthropogenic warming, globally is also well approximated by the transport of an
coherent cooling occurred from the Medieval Warm Period to the Little Ice Age. The unchanging circulation (16). Of course, it cannot
long memory of the ocean suggests that these historical surface anomalies are be excluded that changes in deep circulation—for
associated with ongoing deep-ocean temperature adjustments. Combining an ocean example, in response to altered deep water forma-
model with modern and paleoceanographic data leads to a prediction that the deep tion rates or winds (17)—counteract the basic pattern
Pacific is still adjusting to the cooling going into the Little Ice Age, whereas temperature of temperature response expected from modern
trends in the surface ocean and deep Atlantic reflect modern warming. This prediction circulation. The results of EQ-0015 are thus con-
is corroborated by temperature changes identified between the HMS Challenger expedition sidered a prediction that requires further testing.
of the 1870s and modern hydrography. The implied heat loss in the deep ocean since Differences in the simulated timing and mag-
1750 CE offsets one-fourth of the global heat gain in the upper ocean. nitude of temperature trends between the Atlantic

D
and Pacific offer a fingerprint of historical changes

Downloaded from http://science.sciencemag.org/ on January 7, 2019


owncore temperature profiles found in rials). The resulting estimate, referred to as EQ- in surface temperature. To compare this fingerprint
boreholes from the Greenland (1) and West 0015, indicates that disparate modern-day tem- against observations, we turn to the deep-ocean tem-
Antarctic ice sheets (2) enable the recovery perature trends are expected at depth (Fig. 1). At perature measurements from the HMS Challenger
of past surface temperatures. These bore- depths below 2000 m, the Atlantic warms at expedition that were obtained near the beginning
hole inversions indicate a globally coher- an average rate of 0.1°C over the past century, of the instrumental era, 1872–1876 CE. There were
ent pattern of cooling from the Medieval Warm whereas the deep Pacific cools by 0.02°C over the 5010 temperature observations along the cruise
Period to the Little Ice Age that is also documented past century. track, including 4081 observations below the
in recent land (3) and ocean (4) proxy compila- The pattern of temperature trends can be un- mixed layer and 760 observations from deeper
tions. The ocean adjusts to surface temperature derstood as a basic consequence of an advective- than 2000 m (Fig. 2). Previous analysis (18) showed
anomalies over time scales greater than 1000 years diffusive adjustment to surface conditions. Deep a 0.4°C warming between the 1870s and 2000s
in the deep Pacific (5, 6), which suggests that it too Atlantic waters are directly replenished by their for- in the upper 500 m of the ocean, tapering off to
hosts signals related to Common Era changes in mation in the North Atlantic, but deep Pacific waters values indistinguishable from zero at 1800 m
surface climate (7). But whether these signals are must propagate from the Atlantic and Southern depth. Challenger temperature trends were not
predictable or detectable in the face of three- oceans. Radiocarbon observations (11) indicate that assessed at deeper levels, however, over concerns
dimensional ocean circulation and mixing processes, most waters in the deep Atlantic were last at the regarding depth-dependent biases.
let alone invertible for surface characteristics, has surface 1 to 4 centuries ago, whereas most deep Our focus is to test the model prediction of
been unclear. Pacific waters have longer memory due to isola- deep-Pacific cooling. Therefore, we guard against
To explore how Common Era changes in sur- tion from the atmosphere for 8 to 14 centuries observational biases that would predispose re-
face temperature could influence the interior (6). As a result of differing response times, At- sults toward such a trend. In particular, we adjust
ocean, we first inverted modern-day tracer obser- lantic temperature trends reflect warming over Challenger temperatures to be 0.04°C cooler per
vations for ocean circulation using a previously recent centuries, including that associated with kilometer of depth in keeping with a previously
described methodology (8). In this inversion, the anthropogenic influences, whereas the Pacific is used correction for the effects of compression
net effects of sub–grid-scale processes on advec- still cooling as a consequence of ongoing replace- (18, 19). Another concern is that the rope used for
tive and diffusive transport are empirically con- ment of Medieval Warm Period waters by Little measurements may not have paid out entirely in
strained at a 2° resolution in the horizontal and Ice Age waters. the vertical, causing depths to be overestimated.
33 levels in the vertical. When integrated with The simulated magnitude of temperature But comparing Challenger reports of ocean depth
prescribed surface values, the estimated cir- changes also reflects an advective-diffusive re- against modern bathymetry (20) indicates that,
culation gives accurate predictions of interior sponse to surface conditions. EQ-0015 indicates if anything, depths are underestimated, possibly
d13C (9) and radiocarbon values (6). The relative deep-Pacific cooling of 0.1°C following the tem- because the hemp rope used aboard the Challenger
influences of Antarctic Bottom Water and North perature maximum associated with the Medieval stretched (fig. S4). We apply no further depth cor-
Atlantic Deep Water are also captured (8) and Warm Period, whereas the faster-responding deep rections because underestimates would only bias
agree with estimates made using related ap- Atlantic cools by as much as 0.3°C. Ocean circu- our analysis toward showing greater warming. The
proaches (10). lation can be likened to a filter through which exception is in the Southern Ocean, where strong
It is also possible to represent the transient interior water properties inherit a temporally currents are expected to cause greater horizontal
oceanic response to changing surface conditions. smoothed version of surface signals. Signals in deflection of the line (18); data south of 45°S are
A 2000-year simulation is performed by initial- the deep Pacific are more heavily smoothed and therefore excluded. Finally, the max-min thermo-
izing our empirical circulation model at equilib- have a more attenuated signal than their Atlantic meter used on the Challenger would have been
rium in 15 CE and prescribing globally coherent counterparts because they are subject to mixing over biased in regions with vertical temperature inver-
surface temperature anomalies (4) that propagate a longer journey (12). The incomplete response of sions. To mitigate the influence of such reversals,
into the ocean interior (see supplementary mate- the subsurface to rapid surface changes also leads we also exclude the 164 data points that are lo-
to delays seen in EQ-0015 being shorter than those cated in temperature inversions in modern clima-
indicated by radiocarbon-age analysis (13). tology (21), leaving a total of 3212 observations.
1
Department of Physical Oceanography, Woods Hole Implicit in the EQ-0015 simulation is that tem- The most recent top-to-bottom global assess-
Oceanographic Institution, Woods Hole, MA 02543, USA.
2
Department of Earth and Planetary Sciences, Harvard
perature anomalies are transported according to ment of ocean temperatures comes from the
University, Cambridge, MA 02139, USA. a statistically steady ocean circulation. Estimates World Ocean Circulation Experiment (WOCE)
*Corresponding author. Email: ggebbie@whoi.edu of circulation strength over the Common Era, how- campaign of the 1990s. Interpolating WOCE

Gebbie and Huybers, Science 363, 70–74 (2019) 4 January 2019 1 of 5


R ES E A RC H | R E PO R T

observations (21) to the Challenger data locations


permits for comparison of temperatures across
more than a century. The squared cross-correlation
between WOCE and Challenger temperatures is
0.97 and remains high at 0.92 after removing a
global-mean vertical profile from each individual
profile. Comparison of other 20th-century hydro-
graphic data also indicated only minor density
perturbations on the basic oceanic structure (22).
Similarity of the oceanic temperature and den-
sity structure over time supports the interpreta-
tion of changes in circulation since the Little Ice
Age as involving only minor perturbations.
Despite overall consistency, there are system-
atic differences between WOCE and Challenger
temperatures. The upper 1000 m of the ocean
hosts pervasive warming (Fig. 3), as found earlier
(18). Basin-wide warming is also found to 2800 m
depth in the Atlantic and is significant at the
95% confidence level. Significance levels are
computed accounting for the effects of high-

Downloaded from http://science.sciencemag.org/ on January 7, 2019


frequency motions incurred by internal waves,
mesoscale eddies, and wind variability (see sup-
plementary materials). In the deep Pacific, we
find basin-wide cooling ranging from 0.02° to
0.08°C at depths between 1600 and 2800 m
(Fig. 3) that is also statistically significant. The
basic pattern of Atlantic warming and deep-
Pacific cooling diagnosed from the observations
is consistent with our model results, although
the observations indicate stronger cooling trends
in the Pacific. Note that the difference between
Atlantic and Pacific trends is particularly diag-
nostic because it is insensitive to choices regard-
ing depth-dependent bias corrections.
The bulk of the Challenger observations that
indicate 20th-century cooling are found in the
Pacific between 2000 and 4000 m depth. We
estimate the integrated rate of heat loss in this
Pacific layer to be 1 TW. Although a warming
trend was identified in repeat hydrographic ob-
servations available over recent decades for the
abyssal ocean below 4000 m (23), trend estimates
specifically for the deep Pacific between 2000
and 4000 m depth were found to be insignificant
at 6 ± 7 TW (5 to 95% confidence interval) over
the period 1991–2010 (24). Reanalysis products
augment the hydrographic data with other ob-
servational and numerical model information,
but no consensus on the sign of deep-Pacific
temperature trends has emerged amongst these
estimates (25). Some reanalyses do, however,
show a pattern of Atlantic warming and deep-
Pacific cooling that is congruent with our find-
ings (26, 27) (see supplementary materials).
Whereas it was suggested that this deep-Pacific
cooling in reanalyses originates from model
initialization artifacts and weak data constraints
(25), our results indicate that such temperature Fig. 1. Simulated interior ocean response to Common Era surface temperature anomalies.
drifts should be expected on physical grounds. (A) Global average (black line) and regionally averaged (colored lines) surface temperature time series
We also emphasize that there is a major caveat qb, for a simulation initialized from equilibrium in 15 CE (EQ-0015). Regional variations are plotted for
in all these comparisons, in that rate estimates the Antarctic (ANT), North Atlantic (NATL), sub-Antarctic (SUBANT), and North Pacific (NPAC). Prior
may be sensitive to decadal variability and the to globally available instrumental surface temperatures beginning in 1870 CE, global changes are
time periods over which trends are computed (7). prescribed according to estimates from paleoclimate data. (B) Time evolution of the Pacific-average
The EQ-0015 simulation is independent of the potential temperature profile from EQ-0015. (C) Similar to (B) but for the Atlantic-average profile.
Challenger observations, and these two indica- Atlantic and Pacific averages are taken north of 35°S and 45°S, respectively, and color shading has
tions of deep-ocean temperature trends can be a 2.5-cK interval from –35 to 35 cK. Note the expanded time axis after 1750 CE.

Gebbie and Huybers, Science 363, 70–74 (2019) 4 January 2019 2 of 5


R ES E A RC H | R E PO R T

combined to give a more detailed estimate. We


first average Challenger-to-WOCE temperature
trends over the Atlantic and Pacific basins as
a function of depth. These basin-wide average
trends are used to relax the assumption of glob-
ally uniform changes in surface conditions and
to constrain regional temperature histories for
14 distinct regions over the Common Era by a
control theory method (see supplementary ma-
terials). The result, referred to as OPT-0015, fits
the observed vertical structure of Pacific cooling
and Atlantic warming (Fig. 3). Global surface
changes still explain the basic Atlantic-Pacific
difference in OPT-0015, but greater Southern
Ocean cooling between 600 and 1600 CE leads
to greater rates of cooling in the deep Pacific
over recent centuries. Regionally inferred varia-
tions in North Atlantic and sub-Antarctic surface
temperatures also reproduce an Atlantic warm-
ing minimum at 800 m. Because OPT-0015 is
constrained using only basin-wide averages, re-

Downloaded from http://science.sciencemag.org/ on January 7, 2019


gional temperature patterns can be indepen- Fig. 2. Observed and simulated deep-ocean temperature changes. Observed ocean temperature
dently compared against observations. Notable changes are diagnosed by differencing WOCE and Challenger temperature measurements. WOCE
in this regard is that OPT-0015 produces greater temperatures are linearly interpolated to the location of Challenger temperatures, and differences
rates of cooling in the deep North Pacific and are plotted after averaging between 1800 and 2600 m depth (colored markers). Simulated
greater warming in the vicinity of the Atlantic temperature changes for the same depth interval are diagnosed from OPT-0015. Color scaling
deep western boundary current. Similar patterns is equivalent for observed and simulated temperature changes.
are evident in the Challenger observations (fig.
S7) as well as the average across multiple ocean
reanalyses (25).
Regional surface temperatures in OPT-0015
can also be compared against ice-core borehole
inversions. OPT-0015 places the coldest Antarctic
conditions in the 1500s and the coldest North
Atlantic in the 1800s, both of which are amplified
relative to the global average (Fig. 4). This inter-
hemispheric sequence of peak cooling aligns with
the minimum surface temperatures estimated
from boreholes in Antarctica (2) and Greenland
(1). A second, weaker cool interval inferred from
Greenland boreholes between 1400 and 1600 CE
(1) is, however, not found for the North Atlantic in
OPT-0015. The inference of amplified temperature
anomalies in the Antarctic and North Atlantic oceans
is also consistent with stronger positive feedbacks
at high latitudes. Amplification of high-latitude
signals could also stem from greater winter than
summer cooling during the Little Ice Age (28) and
from the greater sensitivity of deep-water forma-
tion to winter conditions (29). The combination of
greater volatility in winter surface conditions and
greater sensitivity of interior waters to these con-
ditions may explain observations of amplified mid-
depth temperature variability relative to the surface
over the Holocene (30, 31).
The OPT-0015 results provide an estimate of
full-ocean changes in heat content over the
Common Era. With regard to changes in heat
content in the upper 700 m of the ocean (Fig. 4), Fig. 3. Vertical profiles of temperature change. Difference between WOCE and Challenger
there is excellent consistency between OPT-0015 temperatures is shown as a function of depth with 95% confidence intervals averaged over the
and results from observational analyses (32) and Pacific (blue) and Atlantic (red). Features of the WOCE-Challenger temperature difference are
model simulations (33), each indicating ~170 ZJ reproduced in a simulation initialized from equilibrium at 15 CE (EQ-0015, dashed curves) and an
(1 ZJ = 1021 J) of heat uptake between 1970 and inversion constrained by the observations (OPT-0015, solid curves). WOCE-Challenger temperature
2010 (Fig. 4). Over a longer period, 1875–2005, differences are calculated using a weighted average that accounts for the covariance of ocean
OPT-0015 gives 330 ZJ of global upper-ocean temperatures and their uncertainties based on the expected effects of high-frequency oceanic
heat uptake, equal to the central estimate from variability (markers and error bars with darker colors). For comparison, a simple average for each
an earlier analysis of upper-ocean heating using basin and depth level is also shown with uncertainties that are empirically estimated (lighter colors).

Gebbie and Huybers, Science 363, 70–74 (2019) 4 January 2019 3 of 5


R ES E A RC H | R E PO R T

Challenger observations (18). More generally,


OPT-0015 indicates that the upper 2000 m of
the ocean has been gaining heat since the 1700s,
but that one-fourth of this heat uptake was
mined from the deeper ocean. This upper-lower
distinction is most pronounced in the Pacific
since 1750, where cooling below 2000 m offsets
more than one-third of the heat gain above
2000 m.
The implications of the deep Pacific being in
disequilibrium become more apparent when
compared to a counterfactual scenario where the
ocean is fully equilibrated with surface conditions
in 1750 CE. That the deep Pacific gains heat in this
scenario, referred to as EQ-1750, confirms that heat
loss in OPT-0015 results from the cooling associated
with entry into the Little Ice Age. Moreover, the
EQ-1750 scenario leads to 85% greater global ocean
heat uptake since 1750 because of excess warming
below 700 m. It follows that historical model simu-
lations are biased toward overestimating ocean

Downloaded from http://science.sciencemag.org/ on January 7, 2019


heat uptake when initialized at equilibrium during
the Little Ice Age, although additional biases are
also likely to be present (34). Finally, we note that
OPT-0015 indicates that ocean heat content was
larger during the Medieval Warm Period than at
present, not because surface temperature was greater,
but because the deep ocean had a longer time to
adjust to surface anomalies. Over multicentennial
time scales, changes in upper and deep ocean
heat content have similar ranges, underscoring
how the deep ocean ultimately plays a leading
role in the planetary heat budget.

REFERENCES AND NOTES


1. D. Dahl-Jensen et al., Science 282, 268–271 (1998).
2. A. J. Orsi, B. D. Cornuelle, J. P. Severinghaus,
Geophys. Res. Lett. 39, L09710 (2012).
3. PAGES 2k Consortium, Nat. Geosci. 6, 339–346 (2013).
4. H. V. McGregor et al., Nat. Geosci. 8, 671–677 (2015).
5. F. Primeau, J. Phys. Oceanogr. 35, 545–564 (2005).
6. G. Gebbie, P. Huybers, J. Phys. Oceanogr. 42, 291–305
(2012).
7. C. Wunsch, P. Heimbach, J. Phys. Oceanogr. 44,
2013–2030 (2014).
8. G. Gebbie, P. Huybers, J. Phys. Oceanogr. 40, 1710–1728
(2010).
9. G. Gebbie, P. Huybers, Geophys. Res. Lett. 38, L06604
(2011).
10. T. DeVries, F. Primeau, J. Phys. Oceanogr. 41, 2381–2401
(2011).
11. R. M. Key et al., Global Biogeochem. Cycles 18, GB4031
(2004).
12. M. Holzer, F. Primeau, J. Geophys. Res. 115, C12021
(2010).
13. É. Delhez, É. Deleersnijder, Cont. Shelf Res. 28, 1057–1067
(2008).
14. D. C. Lund, J. Lynch-Stieglitz, W. B. Curry, Nature 444,
601–604 (2006).
15. S. Rahmstorf et al., Nat. Clim. Chang. 5, 475–480
(2015).
16. J. Marshall et al., Clim. Dyn. 44, 2287–2299 (2015).
17. M. Kawase, J. Phys. Oceanogr. 17, 2294–2317 (1987).
18. D. Roemmich, W. J. Gould, J. Gilson, Nat. Clim. Chang. 2,
425–428 (2012).
Fig. 4. Regional surface temperature variations and changes in ocean heat content over the 19. P. Tait, On the Pressure-Errors of the “Challenger”
Thermometers, Narrative of the Challenger Expedition, Vol. II,
Common Era. (A) Surface temperature time series after adjustment to fit the HMS Challenger
Appendix A (HM Stationery Office, 1882).
observations (OPT-0015), including four major surface regions (colored lines) and the global area-weighted 20. British Oceanographic Data Centre, GEBCO Digital Atlas
average (black line). (B) Time series of global oceanic heat content anomalies relative to 1750 CE (2003); www.bodc.ac.uk/projects/data_management/
from OPT-0015 as decomposed into upper (cyan, 0 to 700 m), mid-depth (blue, 700 to 2000 m), and international/gebco/gebco_digital_atlas.
21. V. Gouretski, K. Koltermann, WOCE Global Hydrographic
deep (black, 2000 m to the bottom) layers. Heat content anomalies calculated from an equilibrium
Climatology (Tech. Rep. 35, Berichte des Bundesamtes für
simulation initialized at 1750 (EQ-1750, dashed lines) diverge from the OPT-0015 solution in deeper layers. Seeschifffahrt und Hydrographie, 2004).
(C) Similar to (B) but for the Pacific. Heat content anomaly is in units of zettajoules (1 ZJ = 1021 J). 22. D. Roemmich, C. Wunsch, Nature 307, 447–450 (1984).

Gebbie and Huybers, Science 363, 70–74 (2019) 4 January 2019 4 of 5


R ES E A RC H | R E PO R T

23. S. G. Purkey, G. C. Johnson, J. Clim. 23, 6336–6351 33. P. J. Durack, P. J. Gleckler, F. W. Landerer, K. E. Taylor, Competing interests: The authors declare that they
(2010). Nat. Clim. Chang. 4, 999–1005 (2014). have no competing financial interests. Data and materials
24. D. G. Desbruyères, S. G. Purkey, E. L. McDonagh, 34. J. M. Gregory et al., Geophys. Res. Lett. 40, 1600–1604 availability: Data to reproduce the findings are available
G. C. Johnson, B. A. King, Geophys. Res. Lett. 43, (2013). at the National Centers for Environmental Information,
10356–10365 (2016). accession number 0178641.
25. M. Palmer et al., Clim. Dyn. 49, 909–930 (2017). ACKN OWLED GMEN TS
26. I. Fukumori, Mon. Weather Rev. 130, 1370–1383 (2002). We thank C. Wunsch for highlighting the potential influence SUPPLEMENTARY MATERIALS
27. A. Köhl, Q. J. R. Meteorol. Soc. 141, 166–181 (2015). of past climate events in the modern ocean; D. Halpern for www.sciencemag.org/content/363/6422/70/suppl/DC1
28. A. Atwood, E. Wu, D. Frierson, D. Battisti, J. Sachs, J. Clim. 29, pointing us to the HMS Challenger data; U. Ninnemann, Materials and Methods
1161–1178 (2016). K. Nisancioglu, T. Eldevik, T. Furevik, Y. Rosenthal, Supplementary Text
29. H. Stommel, Proc. Natl. Acad. Sci. U.S.A. 76, 3051–3055 D. Roemmich, L. H. Smedsrud, and T. Stocker for discussions; Table S1
(1979). and three anonymous reviewers for suggestions. Funding: Figs. S1 to S9
30. Y. Rosenthal, B. K. Linsley, D. W. Oppo, Science 342, 617–621 Supported by the James E. and Barbara V. Moltz Fellowship Movie S1
(2013). and NSF grant OCE-1357121 (G.G.) and by NSF grant References (35–46)
31. Y. Rosenthal, J. Kalansky, A. Morley, B. Linsley, Quat. Sci. Rev. OCE-1558939 (P.H.). Author contributions: G.G. and P.H.
155, 1–12 (2017). performed the research and the writing. G.G. contributed 15 September 2018; accepted 12 November 2018
32. S. Levitus et al., Geophys. Res. Lett. 39, L10603 (2012). as lead author; P.H. contributed as the co-author. 10.1126/science.aar8413

Downloaded from http://science.sciencemag.org/ on January 7, 2019

Gebbie and Huybers, Science 363, 70–74 (2019) 4 January 2019 5 of 5


R ES E A RC H

VIROLOGY in Brazil (7, 8). However, highly variable pathogens


such as LASV present a substantial challenge
for this type of amplicon-based approach. Owing
Metagenomic sequencing at the to an interstrain nucleic acid sequence variation
of up to 32 and 25% for the L (large segment en-

epicenter of the Nigeria 2018 Lassa coding the RNA polymerase and the zinc-binding
protein) and S (small segment encoding the
glycoprotein and the nucleoprotein) segments,
fever outbreak respectively (9), even PCR-based laboratory
diagnosis poses a serious challenge. Designing
L. E. Kafetzopoulou1,2,3, S. T. Pullan1,2, P. Lemey4, M. A. Suchard5, D. U. Ehichioya3,6,
targeted whole-genome sequencing approaches,
such as those using PCR amplicons or bait-and-
M. Pahlmann3,6, A. Thielebein3,6, J. Hinzmann3,6, L. Oestereich3,6, D. M. Wozniak3,6,
capture probes, without prior knowledge of the
K. Efthymiadis7, D. Schachten3, F. Koenig3, J. Matjeschk3, S. Lorenzen3, S. Lumley1,
targeted LASV lineage is therefore cumbersome.
Y. Ighodalo8, D. I. Adomeh8, T. Olokor8, E. Omomoh8, R. Omiunu8, J. Agbukor8,
Random reverse-transcription (RT) and am-
B. Ebo8, J. Aiyepada8, P. Ebhodaghe8, B. Osiemi8, S. Ehikhametalor8, P. Akhilomen8, plification by sequence-independent single primer
M. Airende8, R. Esumeh8, E. Muoebonam8, R. Giwa8, A. Ekanem8, G. Igenegbale8, amplification (SISPA) for metagenomic sequenc-
G. Odigie8, G. Okonofua8, R. Enigbe8, J. Oyakhilome8, E. O. Yerumoh8, I. Odia8, ing to identify RNA viruses has been demon-
C. Aire8, M. Okonofua8, R. Atafo8, E. Tobin8, D. Asogun8,9, N. Akpede8, strated to work on the MinION (10), and our
P. O. Okokhere8,9, M. O. Rafiu8, K. O. Iraoyah8, C. O. Iruolagbe8, P. Akhideno8, previous work highlighted the feasibility of re-
C. Erameh8, G. Akpede8,9, E. Isibor8, D. Naidoo10, R. Hewson1,2,11,12, J. A. Hiscox2,13,14, trieving complete viral genomes directly from

Downloaded from http://science.sciencemag.org/ on January 7, 2019


R. Vipond1,2, M. W. Carroll1,2, C. Ihekweazu15, P. Formenty10, S. Okogbenin8,9, patient samples at clinically relevant viral
E. Ogbaini-Emovon8*, S. Günther3,6*†, S. Duraffour3,6* titers using this approach for dengue and
chikungunya viruses (11). We describe here the
The 2018 Nigerian Lassa fever season saw the largest ever recorded upsurge of cases, raising application of field metagenomic sequencing of
concerns over the emergence of a strain with increased transmission rate. To understand the LASV at the Irrua Specialist Teaching Hospital
molecular epidemiology of this upsurge, we performed, for the first time at the epicenter of an (ISTH), Edo State, during the 2018 Lassa fever
unfolding outbreak, metagenomic nanopore sequencing directly from patient samples, an season.
approach dictated by the highly variable genome of the target pathogen. Genomic data and A total of 120 LASV-positive samples were se-
phylogenetic reconstructions were communicated immediately to Nigerian authorities and the quenced during a 7-week mission; these were
World Health Organization to inform the public health response. Real-time analysis of 36 selected on the basis of cycle threshold value
genomes and subsequent confirmation using all 120 samples sequenced in the country of origin and location of the 341 cases reported by ISTH
revealed extensive diversity and phylogenetic intermingling with strains from previous years, between 1 January and 18 March 2018 (figs. S1
suggesting independent zoonotic transmission events and thus allaying concerns of an and S2). The majority of samples originated from
emergent strain or extensive human-to-human transmission. Edo State followed by Ondo and Ebonyi (fig. S2).

L
Selected samples covered the wide range of
assa fever is an acute viral hemorrhagic trol (NCDC) and the World Health Organization clinical viral loads observed, including several
illness, first described in 1969 in the town of (WHO) urgently requested sequencing informa- samples testing negative in one of the two real-
Lassa, Nigeria (1). It is contracted primarily tion and preliminary results from our pilot-scale time RT-PCR assays used (fig. S3 and data S1).
through exposure to urine or feces of in- study, in which we used a metagenomic ap- Up to six samples were run in multiplex per
fected Mastomys spp. rodents or, less fre- proach with the Oxford Nanopore MinION de- MinION flow cell, along with a negative con-
quently, through the bodily fluids of infected vice (Oxford Nanopore Technologies) to conduct trol. To produce high-confidence consensus se-
humans. Lassa virus (LASV) is endemic in parts in-country, mid-outbreak viral genome sequencing. quences for phylogenetic inference, we chose
of West Africa, including Nigeria, Benin, Côte This instigated a major uptick in sequencing efforts, to map both basecalled reads and raw signal
d’Ivoire, Mali, Sierra Leone, Guinea, and Liberia leading to the sequencing of 120 samples. data to a reference sequence and call variants
(2). The upsurge of Lassa fever cases during the Nanopore sequencing is an emerging technol- using Nanopolish software, as developed for
2018 endemic season in Nigeria—referred to ogy with great potential. The MinION is a small, the West African Ebola virus disease outbreak
here as the 2018 Lassa fever outbreak—has been robust sequencing device suited for the genetic (5); basecalled reads were then remapped to
the largest on record, reaching 1495 suspected analysis of pathogens in remote or resource- the consensus and a further round of correc-
cases and 376 confirmed cases and affecting limited settings (4). Nanopore sequencing of tion was applied (fig. S4). Owing to the di-
more than 18 states by 18 March (fig. S1). This polymerase chain reaction (PCR) amplicons of versity of LASV, selection of an individual
notably exceeds the 102 confirmed cases reported Ebola virus genomes provided important data reference genome for read alignment was re-
during the same period in 2017 (fig. S1) (3). The from the field in real time during the 2014–2016 quired for each sample. To select the closest
unprecedented scale of the outbreak raised fears Ebola virus disease outbreak in West Africa (5), existing LASV reference genome, nonhuman
of the emergence of a strain with a higher rate and a more sophisticated multiplex amplicon se- reads from each sample were assembled de
of transmission. Because of these concerns, on quencing methodology (6) has been used effective- novo using Canu (12). A notable proportion of
28 February the Nigeria Centre for Disease Con- ly during recent Zika and yellow fever outbreaks reads generated per sample were LASV at an

1
Public Health England, National Infection Service, Porton Down, UK. 2National Institute of Health Research (NIHR), Health Protection Research Unit in Emerging and Zoonotic Infections, University of
Liverpool, Liverpool, UK. 3Bernhard Nocht Institute for Tropical Medicine, Hamburg, Germany. 4Department of Microbiology and Immunology, Rega Institute, KU Leuven – University of Leuven, Leuven,
Belgium. 5Departments of Biomathematics, Biostatistics, and Human Genetics, University of California, Los Angeles, CA, USA. 6German Center for Infection Research (DZIF), partner site Hamburg,
Germany. 7Artificial Intelligence Laboratory, Vrije Universiteit Brussel, Brussels, Belgium. 8Irrua Specialist Teaching Hospital, Irrua, Nigeria. 9Faculty of Clinical Sciences, College of Medicine, Ambrose Alli
University, Ekpoma, Nigeria. 10World Health Organization, Geneva, Switzerland. 11Faculty of Infectious and Tropical Diseases, Department of Pathogen Molecular Biology, London School of Hygiene and
Tropical Medicine, London, UK. 12Faculty of Clinical Sciences and International Public Health, Liverpool School of Tropical Medicine, Liverpool, UK. 13Singapore Immunology Network, Agency for Science,
Technology and Research (A*STAR), Singapore. 14Institute of Infection and Global Health, University of Liverpool, Liverpool, UK. 15Nigeria Centre for Disease Control, Abuja, Nigeria.
*These authors contributed equally to this work.
†Corresponding author. Email: guenther@bni.uni-hamburg.de

Kafetzopoulou et al., Science 363, 74–77 (2019) 4 January 2019 1 of 4


R ES E A RC H | R E PO R T

V
III
IV

I
VI

0.1 subst./site

Downloaded from http://science.sciencemag.org/ on January 7, 2019


II

100
91
99
93

100
88
100

0.02

Fig. 1. Phylogenetic reconstruction of the S segment data. The circular highlights the human LASV sequences obtained from previous years
tree includes 96 sequences from 2012 to 2017, 88 sequences from 2018, (light gray); sequences obtained from rodent samples (dark gray); and, for
and sequences available from GenBank. The rectangular tree focuses on 2018, the first seven sequences generated in Nigeria (light pink), the
the genotype II clade (in blue in the circular tree), which includes most of remaining 28 sequences analyzed on-site (medium pink), and the
the 2018 sequences. The six genotypes are indicated with different colors remaining sequences finalized in Europe (dark pink). The same color code
and roman numerals. Bootstrap support >90% is indicated with a small is used in the genotype II rectangular tree. Bootstrap values >80% are
gray circle at the middle of their respective branches. The color strip shown for the major genotype II lineages.

average frequency of 4.26% with a maximum of at 20-fold depth. LASV accounted for 0.83% of as a frame of reference to document how the
42.9%, allowing for sufficient genomic sequence reads in the same sample, providing 96% genome genomic data generated in real time (made pub-
(>70%) for phylogenetic comparison of at least coverage. These findings demonstrate the po- licly available at virological.org) provided valu-
one segment in 91 of the samples tested (figs. tential of this simple approach to identify mul- able epidemiological insights into the unfolding
S3 to S6). tiple RNA viruses, including those present as outbreak dynamics.
Additionally, sequences were validated by co-infections. In all other samples tested, LASV Maximum likelihood phylogenetic reconstruc-
Illumina resequencing of 14 SISPA prepara- was the sole pathogen identified despite a small tion of the S segment sequences indicates that all
tions, which matched with their Oxford Nano- number of reads classified as other viruses (fig. 2018 viruses fall within the Nigerian LASV
pore counterparts with little to no divergence, S7 and data S1). diversity, specifically within genotypes II and
confirming the accuracy of the Oxford Nano- To dissect the molecular epidemiology of the III, and they are phylogenetically interspersed
pore approach (table S1). 2018 Lassa fever outbreak in Nigeria, we per- with Nigerian LASV sequences from previous
Metagenomic classification using the Centri- formed phylogenetic analysis of all newly gen- years (Fig. 1). This phylogenetic pattern is
fuge software system (13) identified 0.10% of erated LASV sequences together with unpublished mimicked by the L segment reconstruction
reads from sample 110 as originating from hepa- sequences from previous years (data S2) and (fig. S8). Only seven viruses in the entire genome
titis A virus, providing 74% genome coverage sequences available in GenBank. We used this dataset (n = 348) were identified as clustering

Kafetzopoulou et al., Science 363, 74–77 (2019) 4 January 2019 2 of 4


R ES E A RC H | R E PO R T

significantly differently in the L and S segments substitutions per site per year) (Fig. 2 and coding region of human-to-human LASV trans-
(supplementary methods), which is in line with figs. S9 and S10), in agreement with previous mission (14). Four clusters of sequences showing
the small number of potential LASV reassort- estimates (9). We used these rate estimates ≤4 and ≤12 nucleotide differences in the S and L
ments identified previously (9). The phylogenetic together with an estimate of the time be- segments, respectively, were identified (035-045,
pattern implicates independent spillover from tween successive cases in a transmission chain 035-058, 137-138, and 053-089-106; for some of
rodent hosts as the major driver of Lassa to assess how many substitutions can be ex- them, only the S or L segment sequence was
fever incidence during the outbreak (Fig. 1 and pected between directly linked infections. We available). Retrospective tracing revealed that
fig. S8). compared conservative to more liberal expec- the sequences for pairs 137-138 and 035-058
However, a number of sequences from the tations, the latter accommodating an indepen- were derived from the same patients. Epide-
2018 outbreak clustered as pairs in the phyloge- dent upper estimate of potential sequencing miological investigation of the remaining clus-
netic reconstructions, raising concerns over errors (Fig. 2 and fig. S9). In the S segment, for ters did not provide evidence for transmission
human-to-human transmission. We illustrate example, more than two substitutions between chains, though direct linkage cannot be ex-
such cluster pairs in a Bayesian time-measured sequences from directly linked infections is cluded. Even when applying liberal assumptions
tree estimated from genotype II S (Fig. 2) and L highly unlikely (P < 0.01 and P = 0.03, respectively, for the number of mutations during human-to-
segment sequences (fig. S9). These analyses for the conservative and liberal probability es- human transmission, the vast majority of cases
resulted in highly similar evolutionary rate timates). This expectation is consistent with during the 2018 outbreak resulted from spillover
estimates for both segments (mean, ~1.2 × 10−3 the low number of substitutions observed in the from the natural reservoir.

1850

Downloaded from http://science.sciencemag.org/ on January 7, 2019


1.0
0.0015
rate (substitutions/site/year)

0.8
0.0014
probability

1900
0.6

0.0013
0.4

0.0012
0.2

0.0011
0.0

0.0010
0 1 2 3 4
substitutions
1950

2000

5 0 6 5 2 59 6 19 0 39 46 31 19 156 6 18 15 91
88 175 137/138 4
035-045 096-115 053-089/106 089-106

Fig. 2. Assessing the potential for direct linkage between pairs of 2018 on the mean evolutionary rate estimate and a mean estimate for the
sequences in the S segment. The maximum clade credibility tree generation time, whereas the light blue distribution is based on upper
summarizes a Bayesian evolutionary inference for the genotype II sequences estimates and also incorporates an upper estimate for the MinION
in the S segment. A time scale and a marginal posterior distribution for the sequencing error (supplementary methods). At the bottom of the tree,
time to the most recent common ancestor are shown to the left. The size of clusters of sequences for which human-to-human transmission cannot be
the internal node circles reflects posterior probability support values. 2018 excluded according to the upper estimates of generation time are indicated.
sequences clustering as pairs are indicated in dark pink; the number of A pair of identical sequences (137-138) that was retrospectively found
substitutions between them is indicated at their respective tips. A posterior to be derived from the same patient is marked with a gray box. One pair
estimate of the evolutionary rate and probability distributions for observing (096-115) was disregarded as a potential transmission chain because
a given number of substitutions during a human-to-human transmission of 21 differences in the L segment (fig. S9). The temporal signal before BEAST
event are shown as insets. The distribution represented by gray bars is based inference was explored in fig. S10.

Kafetzopoulou et al., Science 363, 74–77 (2019) 4 January 2019 3 of 4


R ES E A RC H | R E PO R T

A request for information on circulating 4. M. Jain, H. E. Olsen, B. Paten, M. Akeson, Genome Biol. 17, 239 and ZMV I 1-2517WHO010) and through the Global Health
strains was made on 28 February at the height (2016). Protection Program (agreement ZMVI1-2517-GHP-704), the
5. J. Quick et al., Nature 530, 228–232 (2016). German Federal Ministry for Economic Cooperation and
of the outbreak; within 10 days, our pilot study Development through the Rapid Deployment Expert Group to
6. J. Quick et al., Nat. Protoc. 12, 1261–1276 (2017).
was expedited and the initial analysis com- Combat Threats (SEEG), the European Union’s Horizon
7. N. R. Faria et al., Nature 546, 406–410 (2017).
pleted. The fact that the 2018 outbreak was 2020 research and innovation program to S.G. (grant 653316-
8. N. R. Faria et al., Science 361, 894–899 (2018).
fueled by the circulating LASV diversity and EVAg), and the German Research Foundation (DFG) to S.G.
9. K. G. Andersen et al., Cell 162, 738–750 (2015).
and D.U.E. (GU 883/4-1). D.U.E. acknowledges fellowships from
not by transmission of a new or divergent lin- 10. A. L. Greninger et al., Genome Med. 7, 99 (2015). Alexander von Humboldt Foundation and Kirmser Foundation.
eage was already evident from the first seven 11. L. E. Kafetzopoulou et al., Euro Surveill. 23, 1800228 (2018). The funders had no role in the design and interpretation
genomes generated by 10 March (fig. S1). This 12. S. Koren et al., Genome Res. 27, 722–736 (2017). of the data and preparation of the manuscript. Author
information was promptly communicated 13. D. Kim, L. Song, F. P. Breitwieser, S. L. Salzberg, Genome Res. contributions: L.E.K., S.G., S.D., S.T.P., and P.L. conceptualized
26, 1721–1729 (2016). the study; L.E.K., S.T.P., and P.L. set up the methodology;
to the NCDC, forming the basis of its report L.E.K., J.H., A.T., S.D., and D.U.E. performed sequencing and
14. S. L. M. Whitmer et al., Emerg. Infect. Dis. 24, 599–602
released on 12 March 2018 (15). Whereas this (2018). data validation; L.E.K., P.L., M.A.S., S.T.P., D.S., F.K., J.M.,
small sample was restricted to genotype II, 15. Nigeria Centre for Disease Control, “Early Results of Lassa and S.Lo. performed the formal sequencing data analysis; L.E.K.,
the final collection of 36 LASV genome se- Virus Sequencing & Implications for Current Outbreak S.D., J.H., A.T., M.P., and L.O. performed sample selection,
Response in Nigeria” (2018); https://ncdc.gov.ng/news/121/ data collection, and organization of sequencing datasets; D.M.
quences generated on-site also included a W., K.E., D.S., F.K., and J.M. set up and assisted with the
early-results-of-lassa-virus-sequencing-%26-implications-for-
representative of genotype III (Fig. 1 and fig. current-outbreak-response-in-nigeria. bioinformatics pipeline; M.A.S., D.U.O., M.P., L.O., Y.I., D.I.A.,
S9), further supporting the spillover of long- 16. P. Lemey, ISTH-BNITM-PHE/LASVsequencing: T.O., E.O., R.O., J.Ag., B.E., J.Ai., P.E., B.O., S.E., P.A., M.A.,
standing LASV diversity in the outbreak. The LASVrelease, Zenodo (2018); http://doi.org/10.5281/ R.Es., E.M., R.G., A.E., G.I., G.Od., G.Ok., R.En., J.O., E.O.Y., I.O.,
zenodo.1481015. C.A., M.O., R.A., E.T., D.A., N.A., P.O.O., M.O.R., K.O.I.,
conclusions drawn from the first set of ge- C.O.I., P.A., C.E., G.A., and E.I. performed diagnostic analysis;
nome sequences immediately eased fears of L.E.K., S.T.P., P.L., and S.D. visualized data presentation;
extensive human-to-human transmission and L.E.K., S.T.P., P.L., and S.D. wrote the manuscript; all authors

Downloaded from http://science.sciencemag.org/ on January 7, 2019


allowed public health resources to be allo- ACKN OWLED GMEN TS reviewed and edited the manuscript; S.G., M.W.C., J.A.H., R.H.,
We thank the health authorities of Nigeria for their cooperation and R.V. supervised the study; M.P., R.V., A.T., C.I., P.F., D.N.,
cated appropriately. The response was focused S.O., E.O.E., S.G., S.D., and S.Lu. performed project
during the outbreak response. Funding: L.E.K., S.T.P., R.H.,
on intensified community engagement on ro- R.V., M.W.C., and J.A.H. acknowledge funding by the National administration and implementation; S.G., P.L., M.W.C., R.V.,
dent control, environmental sanitation, and Institute for Health Research Health Protection Research R.H., J.A.H., L.E.K., and D.U.E. were involved in funding
safe food storage. Further research is needed Unit (NIHR HPRU) in Emerging and Zoonotic Infections at the acquisition. Competing interests: C.I. is a member of the WHO
University of Liverpool in partnership with Public Health Strategic Technical Advisory Group on Infectious Diseases;
to evaluate whether improved diagnostics and D.A. serves as an expert for the WHO R&D Blueprint for action
England (PHE), in collaboration with Liverpool School of Tropical
disease awareness and/or ecological and cli- Medicine. The views expressed are those of the author(s) to prevent epidemics (the Blueprint); S.G. is a member of the
mate factors promoting transmission are the and not necessarily those of the NHS, the NIHR, the Department Scientific Advisory Group (SAG) to advise WHO on the
drivers behind the changing epidemiology of of Health, or Public Health England. L.E.K. has received implementation of the Blueprint, including a plan for
travel expenses and accommodation from Oxford Nanopore to international coordination of the R&D effort in the
Lassa fever in Nigeria. event of a highly infectious pathogen epidemic; S.O. serves as
speak at conferences regarding this work. L.E.K. has received
Portable metagenomic sequencing of genet- some reagents free of charge from Oxford Nanopore in an expert for the Blueprint. All other authors declare no
ically diverse RNA viruses on the MinION, di- support of her Ph.D. project. M.W.C. has received reagents competing interests. Data and materials availability: LASV
rect from patient samples without the need to free of charge from Oxford Nanopore in support of previous sequences from 2018 are deposited in GenBank under
projects not related to the work presented in this manuscript. BioProject PRJNA482058 (data S1); sequences from 2012 to
export material outside of the country of origin 2017 are deposited under BioProjects PRJNA482054 and
L.E.K. and M.W.C. have not received other financial
and with no pathogen-specific enrichment, is compensation nor hold shares. P.L. and M.A.S. acknowledge PRJNA482058 (data S2). Alignments, trees, and BEAST xml files
shown to be a feasible methodology enabling funding from the European Research Council under the are available at https://github.com/ISTH-BNITM-PHE/
a real-time characterization of potential out- European Union’s Horizon 2020 research and innovation LASVsequencing and in (16).
breaks in the field. program (grant 725422-ReservoirDOCS) and from the Wellcome
Trust Collaborative Award, 206298/Z/17/Z. P.L. acknowledges SUPPLEMENTARY MATERIALS
support by the Special Research Fund, KU Leuven (“Bijzonder www.sciencemag.org/content/363/6422/74/suppl/DC1
Onderzoeksfonds,” KU Leuven, OT/14/115), and the Materials and Methods
Research Foundation–Flanders (“Fonds voor Wetenschappelijk
RE FE RENCES AND N OT ES Figs. S1 to S10
Onderzoek – Vlaanderen,” G066215N, G0D5117N, and
1. J. D. Frame, J. M. Baldwin Jr., D. J. Gocke, J. M. Troup, Am. J. Table S1
G0B9317N). M.A.S. acknowledges support under National
Trop. Med. Hyg. 19, 670–676 (1970). Science Foundation grant DMS 1264153. This study was References (17–30)
2. D. A. Asogun et al., PLOS Negl. Trop. Dis. 6, e1839 supported by the German Federal Ministry of Health through Data S1 and S2
(2012). support of the WHO Collaborating Centre for Arboviruses
3. WHO, “Lassa Fever – Nigeria” (2018); www.who.int/csr/don/ and Hemorrhagic Fever Viruses at the Bernhard Nocht Institute 3 August 2018; accepted 12 November 2018
23-march-2018-lassa-fever-nigeria/en/. for Tropical Medicine (agreements ZMV I 1-2517WHO005 10.1126/science.aau9343

Kafetzopoulou et al., Science 363, 74–77 (2019) 4 January 2019 4 of 4


R ES E A RC H

PALEONTOLOGY Lisowicia bojani, are the first substantial finds


from Europe (10, 11).
Many previous authors have analyzed the
An elephant-sized Late Triassic structure of the pelvic girdle of Triassic dicyn-
odonts, resulting in the unanimous opinion that

synapsid with erect limbs the posture of the hindlimbs was erect (12). By
contrast, most authors agree that Triassic dicyn-
odonts had sprawling forelimbs with the hori-
Tomasz Sulej1 and Grzegorz Niedźwiedzki2* zontal position of the humerus (13). Lisowicia has
a relatively conventional dicynodont hindlimb
Here, we describe the dicynodont Lisowicia bojani, from the Late Triassic of Poland, a construction but departs from the standard
gigantic synapsid with seemingly upright subcursorial limbs that reached an estimated forelimb posture (Fig. 1). In many respects, its
length of more than 4.5 meters, height of 2.6 meters, and body mass of 9 tons. Lisowicia is forelimb position resembles that of large quad-
the youngest undisputed dicynodont and the largest nondinosaurian terrestrial tetrapod rupedal dinosaurs, but forelimb elements of
from the Triassic. The lack of lines of arrested growth and the highly remodeled cortex Lisowicia are morphologically similar to other
of its limb bones suggest permanently rapid growth and recalls that of dinosaurs and dicynodonts (Fig. 2). The result is a subcursorial
mammals. The discovery of Lisowicia overturns the established picture of the Triassic tetrapod with upright limb posture, unlike any
megaherbivore radiation as a phenomenon restricted to dinosaurs and shows that other known stem-group mammal but compa-
stem-group mammals were capable of reaching body sizes that were not attained again rable with that of large crown-group mammals
in mammalian evolution until the latest Eocene. such as rhinoceroses and hippopotami, as well as

T
quadrupedal dinosaurs such as sauropodomorphs

Downloaded from http://science.sciencemag.org/ on January 7, 2019


he time interval from the end of the (2, 7), which is very similar to the largest middle and ceratopsians.
Permian to the beginning of the Jurassic Permian dinocephalians, such as Tapinocephalus Histological data from limb bones of Lisowicia
(252 to 201 million years ago) coincided or Moschops (2). provide life history data that complement its dis-
with a trophic and taxonomic restructur- Fossils of Triassic dicynodonts are extremely tinctness. Like other large dicynodonts, Lisowicia
ing of terrestrial ecosystems (1). During the abundant in African, Asian, and North and South shows a large area of bone resorption in the inner
middle Permian, the predominant large herbivores American deposits but are comparatively poorly cortex. However, unlike in other genera, there is
were dinocephalians—stem-group mammals (in the known from other regions (5, 6). Dicynodonts no clear sign of growth-slowing later in life. The
clade Synapsida, “mammal-like reptiles”) such as were seemingly rare in the European Late Triassic, presence of potential lines of arrested growth in
Tapinocephalus, which was up to 3 m in length being known only from a single mandible (8) the studied tibia might be indicative of slower,
and weighed an estimated 2 tons (2). These ani- and questionable isolated bones (9). The Late more episodic growth. However, the lack of char-
mals were associated with faunas of nonsynapsid Triassic dicynodont fossils described here, of acteristic slow-growing tissue on the periphery
pareiasaurian parareptiles and a rich variety of
other synapsids. In the late Permian, the large-
size synapsid herbivores (rhachiocephalid di-
cynodonts) and the last pareiasaurians played
the role of largest terrestrial herbivores (2). By
the Early Jurassic, no stem-group mammals
were larger than a half meter in length, and
most were much smaller (3, 4), whereas herbiv-
orous dinosaurs exceeded 15 m in length and
10 tons in weight; virtually all mid-sized to large
tetrapods were archosaurs. Until now, this pat-
tern has appeared clear-cut, with Triassic syn-
apsids approaching the largest Permian forms
in size but with no forms reaching sizes of the
first large sauropodomorphs.
Dicynodonts were among the most abundant
and diverse synapsids from the middle Permian
to the early Late Triassic (5, 6). There were two
episodes of body size increase in their evolu-
tion: the first in the late Permian, exemplified by
Rhachiocephalus, and the second in the Middle to
Late Triassic, when dicynodonts such as Placerias
were the dominant herbivores in some ecosystems
(6). There have been comparatively few rigorous
estimates of dicynodont or dinocephalian body
masses presented in the literature. The largest of
these dicynodonts (such as kannemeyeriiforms)
are estimated previously to have reached lengths Fig. 1. The skeleton restoration of Lisowicia bojani. (A) Left humerus (ZPAL V.33/96) in ventral
of 3 to 3.5 m and weights of up to 1 to 2 tons view. (B) Left radius (ZPAL V.33/665) in lateral view. (C) Cervical vertebrae (ZPAL V.33/720) in
posterior view. (D) Dorsal vertebrae (ZPAL V.33/720) in lateral view. (E) Left pelvis (ZPAL V.33/720;
ilium, pubis, and ischium) in lateral view. (F) Left femur (ZPAL V.33/75) in anterior view. (G) Left
1
Institute of Paleobiology, Polish Academy of Sciences (PAS), tibia (ZPAL V.33/75) in lateral view. (H) Left fibula (ZPAL V.33/75) in medial view. (I) Left ulna (ZPAL
Twarda 51/55, 00-818 Warsaw, Poland. 2Department of
V.33/470) in lateral view. (J) Left scapulocoracoid (ZPAL V.33/468) in lateral view. (K) Fused
Organismal Biology, Uppsala University, Norbyvägen 18A, 752
36 Uppsala, Sweden. quadrate and quadratojugal (ZPAL V.33/735) in posterior view. Scale bars, 10 cm (A) to (K); 1 m for
*Corresponding author. Email: grzegorz.niedzwiedzki@ebc.uu.se the skeleton. (L) Light gray bones represent missing elements. il, ilium; pu, pubis; is, ischium.

Sulej et al., Science 363, 78–80 (2019) 4 January 2019 1 of 3


R ES E A RC H | R E PO R T

of the largest bones of Lisowicia suggests that Triassic land nondinosaur tetrapod. Gigantism faunas suggest evolutionary decline, the con-
the studied material represents either a fast- in herbivorous dinosaurs first emerged in the cept of the Late Triassic kannemeyeriiforms as
growing taxon or juvenile/subadult individuals Late Triassic, with the evolution of the first highly geographically restricted relicts is no longer
of extremely large body size. However, the sec- large sauropodomorphs (16, 17) and then the valid (22). The recognition of dicynodonts in
ond explanation is rather unlikely because of its earliest true sauropods (18). Until now, gigan- the late Norian–earliest Rhaetian of Europe (10)
size and that these two bones are well ossified. tism in the Triassic appeared to be entirely a and Karoo Basin (21) conflicts with some ideas
Lisowicia demonstrates that Late Triassic di- dinosaur adaptation (19), and previously known on early Late Triassic dicynodont extinction and
cynodonts became specialized herbivores. It dis- Triassic dicynodonts were substantially smaller. survival, namely their supposed absence during
plays several features in the limb skeleton that The discovery of Lisowicia suggests that general the radiation of early sauropodomorphs (Fig. 3B).
suggest that this group evolved new postural ecological factors may have been driving the Upright posture has been associated with de-
adaptations. The massive scapula of Lisowicia process, rather than clade-specific attributes of creased joint stress and energetic cost of loco-
lacks a distinct acromion process for articulation dinosaurs (20). motion (23). Selection pressures on some aspects
with the clavicle, the scapula articulates with the The find of Lisowicia shows that at least of lifestyle or ecology were likely drivers of the
humerus on its posteroventrally (instead of pos- one dicynodont lineage also participated in the evolution of the distinct posture of Lisowicia
terolaterally) located glenoid, and distal articu- “push for gigantism” at the same time as the among dicynodonts. Increase in the body size of
lation surfaces of the humerus are in the same sauropodomorphs (20) but also suggests that dicynodonts across the Late Triassic may have
plane instead of being rotated (formal taxonomic their evolutionary history in the Late Triassic is been driven by selection pressure to reach a size
description is provided in the supplementary poorly documented (Fig. 3A). In addition, rec- refuge from large predators (24). It is possible
materials). ognition of Lisowicia as a placeriine dicynodont also that the gigantism of the latest dicynodonts
On the basis of published scaling relationships together with the resurrection and recent de- was a metabolic adaptation that allowed these
(14), we estimate an adult body mass of 9000 kg, scription of Pentasaurus from South Africa (21) animals to maximize food retention time and

Downloaded from http://science.sciencemag.org/ on January 7, 2019


which approaches that of an African elephant alters our understanding of the Late Triassic consequently the energy gain (25). It took Late
[the largest recorded individual stood 4 m at fossil record of dicynodonts. Although their rel- Triassic dicynodonts some 20 million years to
the shoulders and weighed 10,000 kg (15)]. This atively lower abundance and richness compared produce giant forms (Fig. 3, B and C), and it was
confirms that Lisowicia was certainly the largest with those of Middle and early Late Triassic a rather gradual size increase and a similar pace

Fig. 2. Comparison of the reconstructed pectoral girdle of Lisowicia of articulation areas. (B) Reconstruction of large dicynodont Stahleckeria
bojani with another dicynodont, dinosaur, and recent mammal. (GPIT/RE/8001) in anterior and lateral views. (C and D) Hypothetical
(A) Position of bones of L. bojani in anterior and lateral views. Some flexibility of the humerus in protraction-retraction. (E) Reconstruction
proportions of the bones were estimated by means of comparison of rhinoceros Diceros in anterior and lateral views based on MPUWr 502223.
with articulated skeletons of Parakannemeyeria (IVPP V. 979) and (F) Reconstruction of Triceratops in anterior and lateral views based on
Sinokannemeyeria (IVPP V.974), but most were inferred from the size (27). Scale bars, 10 cm.

Sulej et al., Science 363, 78–80 (2019) 4 January 2019 2 of 3


R ES E A RC H | R E PO R T

Fig. 3. Phylogeny of
kannemeyeriiform
dicynodonts and its
relationship with the
changes in femur
length of dicynodonts
and sauropodomorphs.
(A) Time-calibrated
phylogeny of the Triassic
dicynodonts simplified
after (22) (numerical ages
for the base and top of
Norian are based on the
Chronostratigraphic Chart
of the ICS v. 2018/8)
with position of L. bojani.
(B) Femur length
(body size proxy) of
sauropodomorph (black
squares) and dicynodont
(gray circles) taxa from the

Downloaded from http://science.sciencemag.org/ on January 7, 2019


Middle to Late Triassic
plotted at the stratigraphic
range midpoints for each
taxon. (C) Comparison
of dicynodont femur bones
(1, 2, ZPAL V.33/763,
Lisowicia; 3, UCMP 32394,
Placerias; 4, MCZ 378
58M, Ischigualastia;
5, MCN PV 3600,
Dinodontosaurus; 6, GPIT/
RE/8002, Stahleckeria).

to that observed in the evolution of herbivorous 11. T. Sulej, R. Bronowicz, M. Tałanda, G. Niedzwiedzki, Proc. R. PAS) for help with preparation of dicynodont shoulder girdle
dinosaurs in the Mesozoic and mammalian line- Soc. Edinb. 101, 261–269 (2011). virtual model, P. E. Ahlberg (Uppsala University) for discussion,
12. J. Fröbisch, Can. J. Earth Sci. 43, 1297–1308 (2006). D. Snitting (Uppsala University) for help with phylogenetic
ages in the mid-late Paleogene (26). All suggest 13. L. R. Walter, in The Beginning of the Age of Dinosaurs and computed tomography data, N. Campione (University
that in the Late Triassic, there was a substantial (Cambridge Univ. Press, 1986), pp. 89–97. of New England) for his help with body mass estimate, and
temporal overlap in the occurrence of very large 14. N. E. Campione, D. C. Evans, BMC Biol. 10, 60 (2012). K. Zaremba-Niedźwiedzka (Uppsala University) for help during
herbivores: the previously dominant dicynodonts 15. D. Macdonald, The New Encyclopedia of Mammals (Oxford preparation of the manuscript. We are very thankful to
Univ. Press, 2001). anonymous reviewers whose comments radically improved
and their emerging ecological analogs among 16. A. M. Yates, Palaeontology 46, 317–337 (2003). the final version of the paper. Funding: The study was supported
archosaurs, the sauropodomorph dinosaurs. 17. P. M. Sander et al., Biol. Rev. Camb. Philos. Soc. 86, 117–155 by Polish grant (2012/07/B/NZ8/02707) and Swedish
(2011). Vetenskapsrådet grant (2017-05248). Author contributions:
RE FE RENCES AND N OT ES 18. A. M. Yates, J. W. Kitching, Proc. Biol. Sci. 270, 1753–1758 T.S. designed the study. T.S. and G.N. performed the
1. H.-D. Sues, N. C. Fraser, Triassic Life on Land: The Great (2003). comparative and analytical work, participated in morphological
Transition (Columbia Univ. Press, 2010). 19. P. C. Sereno, Science 284, 2137–2147 (1999). studies, and wrote the paper. Competing interests: The authors
2. G. M. King, Anomodontia, Encyclopedia of Paleoherpetology 20. R. B. Sookias, R. J. Butler, R. B. J. Benson, Proc. Biol. Sci. 279, declare no competing interests. Data and materials
(Part 17C) (Gutsav Fischer Verlag, 1988). 2180–2187 (2012). availability: All described specimens are accessioned at the
3. Z. Kielan-Jaworowska, R. L. Cifelli, Z.-X. Luo, Mammals from 21. Ch. F. Kammerer, Palaeontologia Africana 52, 102–128 (2018). Institute of Paleobiology, PAS (Poland).
the Age of Dinosaurs: Origins, Evolution, and Structure 22. C. F. Kammerer, J. Fröbisch, K. D. Angielczyk, PLOS ONE 8,
(Columbia Univ. Press, 2004). e64203 (2013).
SUPPLEMENTARY MATERIALS
4. T. S. Kemp, The Origin and Evolution of Mammals (Oxford Univ. 23. A. A. Biewener, Science 245, 45–48 (1989).
24. G. Niedźwiedzki, P. Gorzelak, T. Sulej, Lethaia 44, 87–92 www.sciencemag.org/content/363/6422/78/suppl/DC1
Press, 2005).
(2011). Materials and Methods
5. J. Fröbisch, Earth Sci. Rev. 95, 119–157 (2009).
25. P. Bajdek, K. Owocki, G. Niedźwiedzki, Palaeogeogr. Supplementary Text
6. J. Fröbisch, PLOS ONE 3, e3733 (2008).
Palaeoclimatol. Palaeoecol. 411, 1–17 (2014). Figs. S1 to S16
7. A. R. Fiorillo, K. Padian, C. Musikasinthorn, Palaios 15, 373–386
26. D. Prothero, Rhinoceros Giants: The Palaeobiology of Tables S1 to S7
(2000).
Indricotheres (Indiana Univ. Press, 2013). References (28–74)
8. R. R. Schoch, Neues Jahrb. Geol. Palaontol. Abh. 263, 119–123
27. S. Fujiwara, J. Vertebr. Paleontol. 29, 1136–1147 (2009). Movies S1 to S4
(2012).
9. M. W. Maisch, C. S. Vega, R. R. Schoch, Palaeodiversity 2, 28 November 2016; resubmitted 4 August 2018
271–278 (2009). ACKN OWLED GMEN TS Accepted 19 October 2018
10. J. Dzik, T. Sulej, G. Niedźwiedzki, Acta Palaeontol. Pol. 53, We thank J. Dzik (Institute of Paleobiology, PAS) for proposing Published online 22 November 2018
733–738 (2008). this research and support, M. Dec (Institute of Paleobiology, 10.1126/science.aal4853

Sulej et al., Science 363, 78–80 (2019) 4 January 2019 3 of 3


R ES E A RC H

EVOLUTION electrophoretic transitions (Fig. 1B), suggesting


that natural Pel mutations remove sequences
forming alternative DNA structures.
DNA fragility in the parallel evolution To test the effect of Pel sequences on chromo-
some stability in vivo, we measured the rate of

of pelvic reduction in stickleback fish DNA double-strand breaks in yeast artificial chro-
mosomes (Fig. 2A). Constructs without added
test regions broke at background rates of 3.37
Kathleen T. Xie1,2,3, Guliang Wang 4, Abbey C. Thompson1,5, Julia I. Wucherpfennig1, breaks per 106 divisions (Fig. 2B), consistent with
Thomas E. Reimchen6, Andrew D. C. MacColl7, Dolph Schluter8, Michael A. Bell9*, previous reports (14). Chromosomes containing
Karen M. Vasquez4, David M. Kingsley1,2† marine Pel broke ~25 to 50 times more fre-
quently (Fig. 2B), a rate even higher than that
Evolution generates a remarkable breadth of living forms, but many traits evolve repeatedly, by of previously analyzed human fragile sites (14).
mechanisms that are still poorly understood. A classic example of repeated evolution is the loss Pel from freshwater pelvic-reduced populations
of pelvic hindfins in stickleback fish (Gasterosteus aculeatus). Repeated pelvic loss maps to [but not freshwater pelvic-complete populations
recurrent deletions of a pelvic enhancer of the Pitx1 gene. Here, we identify molecular features (fig. S1)] broke at rates similar to that of the con-
contributing to these recurrent deletions. Pitx1 enhancer sequences form alternative DNA trol (Fig. 2B), suggesting that natural Pel muta-
structures in vitro and increase double-strand breaks and deletions in vivo. Enhancer mutability tions remove breakage-prone regions.
depends on DNA replication direction and is caused by TG-dinucleotide repeats. Modeling Reverse complements of marine Pel broke
shows that elevated mutation rates can influence evolution under demographic conditions ~10 to 20 times less frequently than identical
relevant for sticklebacks and humans. DNA fragility may thus help explain why the same loci sequences in the forward orientation (Fig. 2B).

Downloaded from http://science.sciencemag.org/ on January 7, 2019


are often used repeatedly during parallel adaptive evolution. RNA transcription can influence fragile site break-
age (15), but reversing transcription orientation
of the nearby URA3 marker did not significantly

M
any phenotypic traits evolve repeatedly tributions of plasmid topoisomers (11) (Fig. 1A). affect Pel fragility (Fig. 2C). In contrast, adding a
in organisms adapting to similar envi- A control stickleback genomic region showed replication origin on the opposite side of Pel did
ronments, and studying these cases can smooth curves characteristic of B-DNA (Fig. 1B). switch fragility, making the forward sequence
reveal ecological and genetic factors shap- In contrast, Pel sequences from marine popula- stable and the reverse complement fragile (Fig.
ing parallel evolution (1, 2). For example, tions showed mobility shifts characteristic of 2C). Thus, Pel fragility is markedly dependent
loss of pelvic appendages has evolved repeatedly alternative DNA structure formation (Fig. 1B). on DNA replication direction.
in mammals, amphibians, reptiles, and fishes. Structural transitions started at a negative super- Pel contains abundant runs of alternating
Marine stickleback fish (Gasterosteus aculeatus) helical density of –s = 0.043 and changed ap- pyrimidine-purine repeats (Fig. 3A and data S1),
develop a robust pelvic apparatus, whereas many parent linking numbers by 10 to 16 helical turns, which can adopt alternative structures, such as
freshwater populations have lost pelvic struc- similar to shifts produced by Z-DNA (left-handed Z-DNA, previously associated with deletions in
tures (3). Pelvic reduction is associated with par- DNA, starting –s = 0.046) of ~105 to 170 base bacteria, mice, and humans (16, 17). Three stretches
ticular ecological conditions, is likely adaptive, pairs (bp) (12, 13). Pel sequences from pelvic- of ~15, ~20, and ~50 TG-dinucleotide repeats in
and maps to recurrent and independent dele- reduced populations did not show unusual marine Pel total ~170 bp (consistent with linking
tions of a pelvic enhancer (Pel) upstream of the
homeodomain transcription factor gene (Pitx1)
that show repeatable molecular signatures of pos- A Fig. 1. Marine but not
itive selection (4–7). This unusual spectrum of freshwater Pel alleles
regulatory deletions contrasts with the accu- form alternative
mulation of single-nucleotide changes in other structures in vitro.
studies (6, 8, 9), hinting that special DNA fea- (A) 2D electrophoresis of
tures may shape adaptive variation at the Pitx1 circular DNA topoisomers.
locus (6). A distribution of plasmid
Pel enhancer sequences show high predicted Canonical Structure changes Structure topoisomers is separated
helical twist flexibility (6), a DNA feature asso- topoisomer distribution apparent supercoiling shifts distribution on an agarose gel; each
ciated with delayed replication and fragile site B topological class forms
instability (10). To examine whether Pel forms one spot. Canonical B-DNA
alternative DNA structures in vitro, we used two- forms a smooth distribution.
dimensional (2D) electrophoresis to analyze dis- Alternative structures
cause mobility shifts.
Distribution shifts at the
1
Department of Developmental Biology, Stanford University linking number that induces
School of Medicine, Stanford, CA, USA. 2Howard Hughes alternative structure. Dagger
Medical Institute, Stanford University School of Medicine, Rabbit Slough Little Campbell River Bodega Bay
Stanford, CA, USA. 3Department of Biochemistry, Stanford
symbol, mobility shift.
Marine
University School of Medicine, Stanford, CA, USA. 4Division of (B) Pel from marine and
Pharmacology and Toxicology, University of Texas at Austin, freshwater pelvic-reduced
Austin, TX, USA. 5Department of Genetics, Stanford University populations. Control, Atp1a1.
School of Medicine, Stanford, CA, USA. 6Department of Biology,
University of Victoria, Victoria, BC, Canada. 7School of Life
Sciences, University of Nottingham, Nottingham, UK.
8
Department of Zoology, University of British Columbia,
Vancouver, BC, Canada. 9Department of Ecology and Evolution,
Stony Brook University, Stony Brook, NY, USA.
*Present address: University of California Museum of
Toad Lake Paxton Lake Control
Paleontology, Berkeley, CA, USA.
†Corresponding author. Email: kingsley@stanford.edu Freshwater pelvic-reduced

Xie et al., Science 363, 81–84 (2019) 4 January 2019 1 of 4


R ES E A RC H | R E PO R T

A B C ori
URA3
URA3
LEU2 seed Test region
Marine Pel region Reverse URA3 ori
Centromere Breakage Telomere
Freshwater transcription direction URA3
Pel region
pelvic-reduced ori ori
LEU2 seed Test region
URA3
Pel region Reverse DNA
Marine RC
URA3
replication direction
New telomere formation
* * * * * * *
LEU2 seed
-4 -4
10 10

Fig. 2. Marine but not freshwater Pel alleles

Breaks per division

Breaks per division


break at high rates in yeast, in an orientation-
dependent fashion. (A) Test DNA is inserted -5
10 10
-5

in a yeast artificial chromosome between two


selectable markers (LEU2 and URA3) and
downstream of a telomere seed site. Breakage
results in loss of URA3. (B) Box-and-whisker plot -6 -6
10 10
of Pel breakage rates. Whisker ends indicate
maximum and minimum of six fluctuation assays

Control
(10 cultures each). RC, reverse complement. *P <

RABS RC

RABS RC

RABS RC
BDGB

BDGB
TOAD
RABS

RABS
PAXB
LITC

LITC

Control

Control

Control
RABS

RABS

RABS
0.01 (table S5). See table S6 for population names.

Downloaded from http://science.sciencemag.org/ on January 7, 2019


(C) Reversing replication direction through the Marine Fresh Marine RC
test region, but not URA3 transcription direction, Reverse Reverse
Control = artificial chromosome without test region URA3 DNA
reverses orientation of fragility. *P < 0.01 (table S5). transcription replication
ori, DNA replication origin.

A Pel region deletions in natural stickleback populations D E Mammalian mutation frequencies


(TG)n or (CA)n
(TG)20 (TG)15 (TG)50 (TG)5 * * * *

Mutation frequency (x 10 )
60

-4
Pel 50

CTG PAXB CTG 40

GC KFSY GC 30
HUMP
20
TG CMCB TG
CA BEPA CA 10

BOOT 0

Control

(TG)30

(TG)41

(CA)30

(CA)41
B C YAC breakage rates F Recovered deletions in mammalian mutation assay
(TG)n (TG)41

supF
(CA)n
* * *
-4
10
GACTTCG GACTTCG
Breaks per division

-5
10
GGT GGT
GT GT

-6
(TG)30 10
(TG) 14
(TG) 43
(TG) 79
(CA) 16
(CA) 50
Control

TGAGCTCGA TGAGCTCGA

Fig. 3. TG-dinucleotide repeats recapitulate structure formation, high Dagger symbol, mobility shift. (C) Yeast artificial chromosome (YAC) breakage
breakage rate, orientation dependence, and deletion spectrum. (A) To- rates for TG- or CA-repeats of varying lengths. *P < 0.01 (table S5). (D) Reporter
scale maps of Pel in different freshwater pelvic-reduced populations (table S6). shuttle plasmid schematic. (E) Mammalian mutation frequencies. Error
Green, Pel sequence driving pelvis expression (6). Tan, TG-repeats. White bars indicate SEM of four or five independent experiments. *P < 0.05
boxes, DNA deletions in indicated populations. Blue, DNA remaining. Letters (Student’s t test). Dagger symbol, deletions dominate mutation spectrum
indicate microhomologies at deletion junctions. (B) 2D gel for (TG)30. (fig. S2A). (F) To-scale map of (TG)41-induced deletions in mammalian cells.

Xie et al., Science 363, 81–84 (2019) 4 January 2019 2 of 4


R ES E A RC H | R E PO R T

Downloaded from http://science.sciencemag.org/ on January 7, 2019


Fig. 4. Pel is located in the breakage-prone orientation in stickle- locus in 10,000 generations and eventually becoming fixed, as a function
backs, generating a fragile site likely to contribute to parallel evolu- of typical stickleback population sizes (N) and mutation rates
tion in natural populations. (A) Workflow for profiling genome-wide (m, gray bars) for single-nucleotide polymorphisms (SNPs), copy number
replication timing. FACS, fluorescence-activated cell sorting. (B) Stickle- variants (CNVs), and fragile sites. De novo point mutations are unlikely
back chromosome VII replication timing. Red line indicates the to occur and become fixed in small vertebrate populations, even
Pel locus, which is subtelomeric. Hash marks indicate reference genome when conferring a selective advantage (s = 0.01, modeled here). In contrast,
assembly gap. (C) Diagram of stable and fragile replication orientations. mutations occurring at fragile sites are likely to arise and contribute
Purple, newly synthesized leading strand; pink, newly synthesized lagging to repeated evolution when conferring a selective advantage. For additional
strand. (D) Probability of at least one de novo mutation arising at a particular parameters, including neutrality (s = 0), see figs. S6 and S7.

number changes seen in the topoisomer assays microhomology-mediated end-joining repair and and macroscopic loss of pelvic structures in ge-
above). TG-repeats alone induced mobility shifts similar to junctions seen in stickleback pelvic- netic crosses (fig. S5).
in topoisomer assays (Fig. 3B) (18) and elevated reduction alleles (6) (Fig. 3A). Ligation-mediated Could elevated mutation rates contribute to
chromosome breakage in yeast, with longer re- polymerase chain reaction suggested that breaks reuse of Pel deletions in parallel evolution? Pop-
peats stimulating more breaks (Fig. 3C). In con- initiated near the dinucleotide repeats (fig. S2C). ulation genetic modeling indicates that new
trast, both long and short versions of the reverse Taken together, our results indicate that TG- mutations occurring at the low rates of typical
complement sequence (CA-repeats) were stable repeats form alternative DNA structures in vitro single-nucleotide changes (~10−9 mutations per
(Fig. 3C), recapitulating the orientation depen- and can recapitulate the high mutation rates, site per generation) would rarely arise at a parti-
dence of Pel fragility. orientation dependence, and propensity to stim- cular locus in postglacial stickleback populations,
We also tested the effect of TG- and CA-repeats ulate breaks and deletions of the full Pel region. whereas mutations occurring at elevated rates
in mammalian COS-7 cells (Fig. 3D) (19). Dinu- To determine the orientation of Pel sequences (~10−5 mutations per site per generation, for fragile
cleotide repeats elevated mutation frequencies, relative to DNA replication in sticklebacks (Fig. sites) would arise often. When new mutations do
with TG-repeats being more mutagenic than CA- 4A and fig. S3), we sequenced S- and G-phase occur, their subsequent fate is controlled by drift
repeats of comparable length, and longer repeats cells from developing embryos and calculated and selection (21). Neutral or small-effect point
being more mutagenic than shorter repeats (Fig. S/G read-depth ratios to determine replication mutations will usually be lost or rise to fixation
3E), in accordance with results from yeast assays. timing (20). Pel is located in a timing transition slowly, whereas deletions may cause larger pheno-
Mutations stimulated by the most mutagenic se- region (Fig. 4B and fig. S4), consistent with uni- typic effects and can sweep if environmental
quence, (TG)41, were predominantly >100-bp dele- directional replication. The replication direction conditions favor pelvic reduction (Fig. 4D and
tions that removed part or all of the repeat and through Pel matches the fragile orientation (Fig. figs. S6 and S7). The combined effects on both
adjacent reporter gene (Fig. 3F and fig. S2A). 4C), suggesting that Pel would form a TG-repeat– the “arrival of the fittest” and the “survival of the
Approximately 70% of deletion junctions con- associated fragile site in vivo. Experimental CRISPR fittest” may explain why recurrent Pel deletions
tained microhomologies and insertions (Fig. 3F targeting confirmed that initiation of breaks in are the predominant mechanism for evolving
and fig. S2, A and B), consistent with error-prone Pel was sufficient to trigger local DNA deletions stickleback pelvic reduction. For other traits,

Xie et al., Science 363, 81–84 (2019) 4 January 2019 3 of 4


R ES E A RC H | R E PO R T

ancient standing variants provide an alternative DNA breakage sites in humans (fig. S10). As 23. R. D. Barrett, D. Schluter, Trends Ecol. Evol. 23, 38–44 (2008).
way to overcome the demographic constraints causative changes are identified for a greater 24. 1000 Genomes Project Consortium, Nature 526, 68–74 (2015).
25. R. Moxon, C. Bayliss, D. Hood, Annu. Rev. Genet. 40, 307–333 (2006).
of waiting for de novo mutations in small popu- number of phenotypic traits, it will be interesting 26. A. Stoltzfus, L. Y. Yampolsky, J. Hered. 100, 637–647 (2009).
lations and can also lead to reuse of similar alleles to see the extent to which DNA fragility has in- 27. X. Du et al., Nucleic Acids Res. 42, 12367–12379 (2014).
in different populations (22, 23). fluenced the genes and mutations that underlie 28. S. C. Galen et al., Proc. Natl. Acad. Sci. U.S.A. 112,
13958–13963 (2015).
The demographic parameters typical of stickle- evolutionary change in nature. 29. A. Bacolla, J. A. Tainer, K. M. Vasquez, D. N. Cooper, Nucleic
backs apply to many vertebrates evolving with Acids Res. 44, 5673–5688 (2016).
small population sizes or facing rapid environ- RE FERENCES AND NOTES 30. A. D. Hargreaves et al., Proc. Natl. Acad. Sci. U.S.A. 114,
mental changes. For example, migration of mod- 1. D. Schluter, E. A. Clifford, M. Nemethy, J. S. McKinnon, Am. 7677–7682 (2017).
Nat. 163, 809–822 (2004). 31. C. B. Lowe et al., Genome Res. 28, 256–265 (2018).
ern humans out of Africa occurred with relatively
2. D. L. Stern, V. Orgogozo, Science 323, 746–751 (2009).
small populations adapting to new environments 3. M. A. Bell, Biol. J. Linn. Soc. Lond. 31, 347–382 (1987). AC KNOWLED GME NTS
in 3000 generations or fewer (24). Notably, nearly 4. T. E. Reimchen, Can. J. Zool. 58, 1232–1244 (1980). We thank V. Tien, J. Le, M. Yau, M. Thakur, A. Muralidharan,
half of currently known mutations underlying 5. M. A. Bell, G. Ortí, J. A. Walker, J. P. Koenings, Evolution 47, M. Whitlock, B. Belotserkovskii, R. Driscoll, K. Cimprich, J. Wang,
adaptive traits in modern humans also appear 906–914 (1993). S. Quake, and A. Casper for experimental assistance or advice;
6. Y. F. Chan et al., Science 327, 302–305 (2010). R. Daugherty, J. Rollins, B. Lohman, R. Mollenhauer, M. Reyes, and
to be produced by mechanisms with elevated 7. M. Karhunen, J. Merilä, T. Leinonen, J. M. Cano, O. Ovaskainen, F. von Hippel for help with fieldwork; C. Freudenreich for yeast
mutation rates (table S1). Mol. Ecol. Resour. 13, 746–754 (2013). strains; and Z. Weng and B. Carter for help with high-throughput
High mutation rates have been described at 8. B. Prud’homme et al., Nature 440, 1050–1053 (2006). sequencing and cell sorting. Funding: NIH grants 5P50HG2568
contingency loci in bacteria and other systems 9. D. L. Stern, N. Frankel, Philos. Trans. R. Soc. London Ser. B (D.M.K.), CA093729 (K.M.V.), and 2T32GM007790 (J.I.W.); NSF
368, 20130028 (2013). grant DEB0919184 (M.A.B.); NSF and Stanford CEHG Graduate
(25–30). Our study reveals an example of DNA 10. R. G. Thys, C. E. Lehman, L. C. T. Pierce, Y.-H. Wang, Fellowships (K.T.X.); NIH Predoctoral Fellowship (A.C.T.); HHMI
fragility contributing to repeated morphological Curr. Genomics 16, 60–70 (2015). investigator (D.M.K.). Author contributions: K.T.X. and D.M.K.
evolution in vertebrates. Our data also highlight 11. R. Bowater, F. Aboul-Ela, D. M. Lilley, Methods Enzymol. 212, designed the study. K.T.X., G.W., A.C.T., and J.I.W. performed

Downloaded from http://science.sciencemag.org/ on January 7, 2019


several mechanisms that could alter local muta- 105–120 (1992). experiments. K.T.X., G.W., A.C.T., D.S., K.M.V., and D.M.K. analyzed
12. A. Nordheim, A. Rich, Proc. Natl. Acad. Sci. U.S.A. 80, data. T.E.R., A.D.C.M., D.S., and M.A.B. provided key populations
tion rates, including expansion and contraction 1821–1825 (1983). and comments. K.T.X. and D.M.K. wrote the paper with input from
of TG-repeats, changes in sequence orientation, 13. A. Rich, A. Nordheim, A. H. Wang, Annu. Rev. Biochem. 53, all authors. Competing interests: None declared. Data and
or changes in DNA replication. Natural variation 791–846 (1984). materials availability: Raw sequencing data and processed
in such parameters may affect the evolvability 14. H. Zhang, C. H. Freudenreich, Mol. Cell 27, 367–379 (2007). S/G read-depth ratio data have been deposited at GEO accession
15. A. Helmrich, M. Ballarino, L. Tora, Mol. Cell 44, 966–977 (2011). GSE121537.
of different loci and the particular genetic paths 16. G. Wang, L. A. Christensen, K. M. Vasquez, Proc. Natl. Acad.
likely to be taken when ecological conditions Sci. U.S.A. 103, 2677–2682 (2006). SUPPLEMENTARY MATERIALS
favor a given phenotype. The sequence features 17. G. Wang, S. Carbajal, J. Vijg, J. DiGiovanni, K. M. Vasquez, www.sciencemag.org/content/363/6422/81/suppl/DC1
associated with DNA fragility in the Pel region J. Natl. Cancer Inst. 100, 1815–1817 (2008). Materials and Methods
18. H. Hamada, M. G. Petrino, T. Kakunaga, M. Seidman, Figs. S1 to S11
are also found in thousands of other positions B. D. Stollar, Mol. Cell. Biol. 4, 2610–2621 (1984). Tables S1 to S6
in stickleback and human genomes (fig. S8). 19. G. Wang, K. M. Vasquez, Proc. Natl. Acad. Sci. U.S.A. 101, References (32–61)
Notably, TG-repeats are enriched in other loci 13448–13453 (2004). Data S1
20. N. Rhind, D. M. Gilbert, Cold Spring Harb. Perspect. Biol. 5,
that have undergone recurrent ecotypic deletions 10 March 2017; resubmitted 18 April 2018
a010132 (2013).
during marine-to-freshwater stickleback evolution 21. M. Kimura, Genetics 47, 713–719 (1962). Accepted 28 November 2018
(31) (table S2 and fig. S9) and are enriched near 22. P. F. Colosimo et al., Science 307, 1928–1933 (2005). 10.1126/science.aan1425

Xie et al., Science 363, 81–84 (2019) 4 January 2019 4 of 4


R ES E A RC H

PROTEIN TRANSLOCATION (9–11, 16), were not sufficiently resolved for


model building, likely because of their flexible
motions (Fig. 1A). The structure reveals that
Structure of the posttranslational Sec Sec63 together with Sec71-Sec72 forms a large
soluble domain, which sits on the cytosolic side

protein-translocation channel of the Sec61 channel (Fig. 1). Sec63 consists of


an N-terminal domain containing three TMs and
a J domain between the second and third TMs
complex from yeast and a C-terminal cytosolic domain (Fig. 2, A and
B). The cytosolic domain contains two a helical
Samuel Itskanov 1 and Eunyong Park2*
domains (HD1 and HD2) and an immunoglobulin-
like [fibronectin type-III (FN3)] domain, which
The Sec61 protein-conducting channel mediates transport of many proteins, such as secretory are arranged similarly to the homologous region
proteins, across the endoplasmic reticulum (ER) membrane during or after translation. of the Brr2 RNA helicase (17) (fig. S3). Sec71-Sec72,
Posttranslational transport is enabled by two additional membrane proteins associated with the structure of which is similar to a recent crys-
the channel, Sec63 and Sec62, but its mechanism is poorly understood. We determined a
tal structure of Chaetomium thermophilum Sec71-
structure of the Sec complex (Sec61-Sec63-Sec71-Sec72) from Saccharomyces cerevisiae by Sec72 (18), clamps Sec63’s cytosolic domain like
cryo–electron microscopy (cryo-EM). The structure shows that Sec63 tightly associates with tongs (fig. S4).
Sec61 through interactions in cytosolic, transmembrane, and ER-luminal domains, prying open Sec63 makes extensive contacts with the chan-
Sec61’s lateral gate and translocation pore and thus activating the channel for substrate
nel through its transmembrane, cytosolic, and
engagement. Furthermore, Sec63 optimally positions binding sites for cytosolic and luminal luminal domains, indicative of a major role in

Downloaded from http://science.sciencemag.org/ on January 7, 2019


chaperones in the complex to enable efficient polypeptide translocation. Our study provides regulating the channel’s function (Fig. 2, C to
mechanistic insights into eukaryotic posttranslational protein translocation.
E). In the membrane region, the TMs of Sec63
are located at the back (opposite from the later-

T
al gate) of the Sec61 channel, interacting with
he eukaryotic Sec61 or prokaryotic SecY Saccharomyces cerevisiae Sec complex at 3.7-Å the TMs of Sec61b and Sec61g as well as TM1
complex forms a universally conserved resolution by cryo–electron microscopy (cryo-EM) and TM5 of Sec61a (Fig. 2C). Considering the
protein-conducting channel that is essen- (Fig. 1 and figs. S1 and S2). Many side chains extensive interactions between these elements,
tial for biogenesis of many proteins (1–3). are clearly visible in the density map, enabl- the TMs of Sec63 likely make a main contribu-
The channel mediates transport of soluble ing modeling of an accurate atomic structure tion to the association between Sec61 and the
(e.g., secretory) proteins across the eukaryotic (Fig. 1B and fig. S2C). The map also allowed rest of the Sec complex. In the cytosolic region,
endoplasmic reticulum (ER) membrane or the us to improve the model for the eukaryotic the FN3 domain of Sec63 interacts with the loop
prokaryotic plasma membrane through its water- Sec61 channel, which was previously built into between TM6 and TM7 (L6/7) of Sec61a through
filled pore and integration of membrane pro- maps at ~4- to 5-Å local resolutions (14, 15). antigen-antibody–like binding. Like other FN3 do-
teins into the lipid phase through its lateral However, Sec62 and the ER-luminal J domain mains, FN3 of Sec63 has a canonical b-sandwich
gate. The Sec61/SecY channel consists of an of Sec63, which transiently interacts with BiP fold composed of seven b strands (referred to as
hourglass-shaped a subunit, which contains 10
transmembrane segments (TMs 1 to 10), and
two small b and g subunits, which are single- Fig. 1. Structure of
pass membrane proteins in eukaryotes (4). Often, the yeast Sec
translocation is coupled with translation (i.e., complex. (A) Cryo-EM
cotranslational translocation) by direct docking density map and
of a translating ribosome onto the channel. The (B) atomic model
channel also translocates many proteins in a of the yeast post-
posttranslational manner, the mechanisms of translational protein
which differ between eukaryotes and prokary- translocation complex.
otes. In eukaryotes, posttranslational transloca- The front view is a view
tion requires two essential membrane proteins, into the lateral gate.
Sec63 and Sec62, which associate with the chan-
nel (5–8), and the ER-resident Hsp70 chaperone
BiP, which grasps the substrate polypeptide in
the ER lumen and prevents it from backsliding
to the cytosol (9–12). In fungal species, the com-
plex (hereafter referred to as the Sec complex) is
further associated with the nonessential Sec71
and Sec72 subunits (10, 11, 13). The molecular
architecture of the Sec complex and the func-
tions of its subunits are poorly defined.
To gain insight into Sec-mediated protein
translocation, we determined a structure of the

1
Biophysics Graduate Program, University of California,
Berkeley, Berkeley, CA 94720, USA. 2Department of
Molecular and Cell Biology and California Institute for
Quantitative Biosciences, University of California, Berkeley,
Berkeley, CA 94720, USA.
*Corresponding author. Email: eunyong_park@berkeley.edu

Itskanov et al., Science 363, 84–87 (2019) 4 January 2019 1 of 4


R ES E A RC H | R E PO R T

Downloaded from http://science.sciencemag.org/ on January 7, 2019


Fig. 2. Structure of Sec63 and its interactions with the channel. plane. TMs 2, 9, and 10 of Sec61a are located above the cross-sectional
(A) Schematic of Sec63 domains. Regions interacting with other parts plane. (D) Interactions between Sec63 and Sec61 in the luminal side.
of the complex are indicated by blue lines. Unmodeled regions are shown On the left is a b sheet formed between Sec61a (TM5 indicated by a
with dashed lines. (B) Structure of Sec63 (front view). The position of dashed line) and the segment between Sec63 TM3 and the J domain.
Sec61 is shaded in gray. (C) Interactions between TMs of Sec63 and On the right is a magnified view with side chains shown as sticks.
Sec61. On the left is a view from the back; on the right is a cutaway view (E) Interactions between the FN3 domain and the cytosolic loop L6/7 of
from the ER lumen. The black arrowed line represents the cross-sectional Sec61a (also see Fig. 1B). L, Leu; I, Ile; V, Val; Y, Tyr; E, Glu; R, Arg; F, Phe.

Fig. 3. A fully opened


Sec61 channel in the Sec
complex. (A and B) Struc-
ture of the Sec61 channel.
The N- and C-terminal
halves of Sec61a
are in blue and salmon,
respectively. The gray den-
sity feature is presumed
detergent molecules. Pore-
lining residues are shown
as green balls and sticks.
The density feature for the
plug is in purple. Numbers
“2” and “7” indicate TM2
and TM7, respectively. (C to
F) Comparison of Sec61 of
the Sec complex (colored)
with Sec61 of the cotrans-
lational ribosome-Sec61
complex [gray; (C) and (D)]
or SecY of a bacterial post-
translational SecA-SecY
channel complex [gray; (E)
and (F)]. The structures are
aligned with respect to the
C-terminal half of Sec61a [(C) to (F)]. Shown are the front [(A), (C), and (E)] and cytosolic [(B), (D), and (F)] views. Numbers indicate corresponding TMs. Dashed
lines represent the lateral gate. Asterisks indicate the translocation pore. For simplicity, L6/7 and L8/9 of Sec61a are not shown. In (D) and (F),TMs of Sec63 are also
shown (green). In (F), TMs of SecG are indicated by “G.” Also see fig. S6 for comparisons to archaeal SecY and substrate-engaged channels. ATPase, adenosine
triphosphatase; PDB, Protein Data Bank.

Itskanov et al., Science 363, 84–87 (2019) 4 January 2019 2 of 4


R ES E A RC H | R E PO R T

Fig. 4. Model of an active translocation complex. (A) The Sec

Downloaded from http://science.sciencemag.org/ on January 7, 2019


complex structure superimposed with an Ssa1p C-terminal peptide (red
orange; PDB ID: 5L0Y) and DnaK Hsp70 as a model for BiP (yellow and
brown; PDB ID: 5RNO). (B) Schematics for a closed Sec61 channel in
isolation (left), an open channel in association with Sec63 (middle), and
an active Sec complex engaged with a substrate [right; corresponding
to the model in (A)]. For the full translocation cycle, see fig. S8.

A to G) but contains unusually long A-B, B-C, and Compared with previous Sec61/SecY structures static potential around the pore may disfavor
D-E interstrand loops (fig. S3, B and C). With (4, 14, 21–24), the channel in the Sec complex permeation of positively charged species (fig. S7C).
both A-B and B-C loops, FN3 creates a binding displays a substantially wider opening at its later- Yeast Sec61 has a relatively less hydrophobic
surface for L6/7, which uses a combination of sur- al gate, through which a signal sequence can pore constriction compared with nonfungal Sec61
face complementarity and electrostatic and hy- readily pass as an a helix (Fig. 3 and fig. S6). This and prokaryotic SecY (fig. S7D). In prokaryotes,
drophobic interactions (Fig. 2E and fig. S3D). contrasts with structures of channels associated reduction of hydrophobicity in the pore con-
Although sequence conservation is not obvious, with the ribosome or the bacterial posttransla- striction has been shown to lead to membrane
metazoan Sec63s have similar extensions in the tional translocation motor SecA (14, 21–24), in potential dissipation (26), and similarly, in higher
A-B and B-C loops. We expect analogous interac- which the channel shows an only partially open eukaryotes it might cause calcium leakage from
tions between Sec63 and Sec61 in other eukary- lateral gate (Fig. 3, C to F), which was proposed the ER. However, yeast may tolerate ion leakage
otes. The interaction between FN3 and L6/7 is to be further opened by interaction with the because calcium is stored primarily in the vacuole.
noteworthy because L6/7, together with L8/9, hydrophobic signal sequence during the initial In resting or primed channels, the pore is closed
forms a docking site for the ribosome (14, 19, 20) substrate insertion. The opening is achieved by or narrow (<2 Å in radius) and further blocked
(fig. S5A). Accordingly, superimposition of the a largely rigid-body movement between the two by a small a-helical plug in the luminal funnel
Sec complex with a ribosome-bound Sec61 struc- halves (TMs 1 to 5 and 6 to 10) of Sec61a and (4, 14, 21). By contrast, in our structure, the plug
ture shows massive steric clashes between the additional motions of the lateral gate helices. seems flexible and displaced from the pore (Fig.
ribosome and the cytosolic domains of Sec63 The fully open conformation appears to be a 3, A and B).
and Sec62 (fig. S5B), explaining why Sec61 in the result of the extensive interactions with Sec63. The spatial arrangement of Sec63 and Sec71-
Sec complex cannot bind to the ribosome (7, 11). For example, binding between FN3 and L6/7 Sec72 with respect to the Sec61 channel suggests
In the ER luminal side, a segment preceding TM3 perhaps pulls the C-terminal half of Sec61a to how these components play roles in accepting a
of Sec63 is directed into the luminal funnel of the open the lateral gate. However, further investi- polypeptide substrate from a cytosolic chaperone
Sec61 channel through the crevice present be- gation will be necessary to understand the pre- and handing it over to the channel and subse-
tween TM5 of Sec61a and the TM of Sec61g (Fig. cise mechanism and the dynamics of channel quently to BiP. Studies of C. thermophilum Sec72
2D). This segment makes an antiparallel b sheet gating in the native membrane environment. At have suggested that Sec72 provides a docking site
together with a b hairpin looping out in the the open lateral gate slit, there is a weak density for the cytosolic Hsp70 chaperone Ssa1p (18),
middle of Sec61a’s TM5. This b-augmentation feature, which likely represents bound detergent which prevents substrates from premature fold-
is further buttressed by hydrophobic interactions molecules (Fig. 3, A and B). In the native mem- ing or aggregation before translocation (6). Super-
with the N-terminal segment of Sec63. These brane, lipid molecules may occupy this site and imposition of the cocrystal structure of Sec72 and
features are highly conserved throughout eukary- facilitate initial binding of signal sequences. an Ssa1p C-terminal tail shows that the Ssa1p-
otes and thus likely play an important role in Our channel structure likely also represents a binding site is ~60 Å above the channel’s pore
optimal positioning of the J domain. fully open state of the translocation pore (Fig. 3B (Fig. 4A). While the cytosolic domain of Sec63-71-
One pronounced feature of the Sec complex and fig. S7). The radius of the pore constriction is 72 sits on top of Sec61, its position is tilted such
structure is a fully open channel (Fig. 3, A and ~3 Å, large enough to pass an extended polypep- that the polypeptide can insert straight down to
B). The Sec61/SecY channel has a characteristic tide chain. The opening would also permit pass- the pore. Similarly, Sec62 is also positioned off
clamshell-like topology, in which its central pore age of small hydrated ions and polar molecules the translocation path (Fig. 1A). Thus, upon re-
can open toward the lipid phase through the in the absence of a translocating polypeptide lease from Ssa1p, a substrate would efficiently
lateral gate formed between TM2 and TM7. (25, 26), although the relatively positive electro- engage with the pore without obstruction. The

Itskanov et al., Science 363, 84–87 (2019) 4 January 2019 3 of 4


R ES E A RC H | R E PO R T

structure also allows us to propose how BiP Hsp70 RE FERENCES AND NOTES 23. R. M. Voorhees, R. S. Hegde, Science 351, 88–91 (2016).
may catch the substrate in the ER lumen. Despite 1. E. Park, T. A. Rapoport, Annu. Rev. Biophys. 41, 21–40 (2012). 24. L. Li et al., Nature 531, 395–399 (2016).
2. R. M. Voorhees, R. S. Hegde, Curr. Opin. Cell Biol. 41, 91–99 (2016). 25. D. Heritage, W. F. Wonderlin, J. Biol. Chem. 276, 22655–22662
the low resolution of the J domain (Fig. 1A), we (2001).
could dock a homology model into the EM den- 3. E. C. Mandon, S. F. Trueman, R. Gilmore, Cold Spring Harb.
Perspect. Biol. 5, a013342 (2013). 26. E. Park, T. A. Rapoport, Nature 473, 239–242 (2011).
sity map based on the shape of the feature and 27. R. Kityk, J. Kopp, M. P. Mayer, Mol. Cell 69, 227–237.e4 (2018).
4. B. Van den Berg et al., Nature 427, 36–44 (2004).
the orientations of the flanking segments (Fig. 28. D. T. Ng, J. D. Brown, P. Walter, J. Cell Biol. 134, 269–278 (1996).
5. J. A. Rothblatt, R. J. Deshaies, S. L. Sanders, G. Daum,
29. M. A. Smith, W. M. Clemons Jr., C. J. DeMars, A. M. Flower,
4A). We then superimposed a recent crystal struc- R. Schekman, J. Cell Biol. 109, 2641–2652 (1989).
J. Bacteriol. 187, 6454–6465 (2005).
ture of a bacterial J domain–Hsp70 complex (27) 6. R. J. Deshaies, S. L. Sanders, D. A. Feldheim, R. Schekman,
30. S. F. Trueman, E. C. Mandon, R. Gilmore, J. Cell Biol. 199,
Nature 349, 806–808 (1991).
to our EM structure (Fig. 4A). This modeling ex- 907–918 (2012).
7. H. A. Meyer et al., J. Biol. Chem. 275, 14550–14557 (2000).
ercise showed that a peptide-binding cleft of the 8. J. Tyedmers et al., Proc. Natl. Acad. Sci. U.S.A. 97, 7214–7219 AC KNOWLED GME NTS
Hsp70 [called substrate-binding domain b (SBDb)] (2000).
We thank D. Toso for help with electron microscope
would be placed directly below the translocation 9. D. Feldheim, J. Rothblatt, R. Schekman, Mol. Cell. Biol. 12,
operation and J. Hurley, S. Brohawn, and K. Tucker for
pore. Thus, the J domain seems optimally posi- 3288–3296 (1992).
critical reading of the manuscript. Funding: This work was
10. J. L. Brodsky, R. Schekman, J. Cell Biol. 123, 1355–1363 (1993).
tioned to allow BiP to grasp the substrate poly- funded by UC Berkeley (E.P.) and an NIH training grant
11. S. Panzner, L. Dreier, E. Hartmann, S. Kostka, T. A. Rapoport, (T32GM008295; S.I.). Author contributions: S.I. and E.P.
peptide as it emerges from the channel. Cell 81, 561–570 (1995). performed experiments, interpreted results, and wrote the
Our structure offers a model for how Sec63 12. K. E. Matlack, B. Misselwitz, K. Plath, T. A. Rapoport, Cell 97, manuscript; E.P. conceived and supervised the project.
enables posttranslational translocation (Fig. 4B 553–564 (1999). Competing interests: None declared. Data and materials
and fig. S8) and provides a more complete pic- 13. N. Green, H. Fang, P. Walter, J. Cell Biol. 116, 597–604 (1992). availability: The cryo-EM density maps and atomic model have
14. R. M. Voorhees, I. S. Fernández, S. H. Scheres, R. S. Hegde, been deposited in EM Data Bank (accession code: EMD-0336) and
ture of how the Sec61/SecY channel works Cell 157, 1632–1643 (2014). Protein Data Bank (accession code: 6N3Q), respectively.
together with different binding partners (i.e., 15. K. Braunger et al., Science 360, 215–219 (2018).
ribosomes, Sec63, or SecA) to enable transport of 16. K. E. Matlack, K. Plath, B. Misselwitz, T. A. Rapoport, Science

Downloaded from http://science.sciencemag.org/ on January 7, 2019


277, 938–941 (1997). SUPPLEMENTARY MATERIALS
a range of substrates. Association of Sec63 seems
17. T. H. Nguyen et al., Structure 21, 910–919 (2013). www.sciencemag.org/content/363/6422/84/suppl/DC1
to induce full opening of the channel, a confor- 18. A. Tripathi, E. C. Mandon, R. Gilmore, T. A. Rapoport, Materials and Methods
mation in which the channel can readily accept a J. Biol. Chem. 292, 8007–8018 (2017). Figs. S1 to S8
substrate polypeptide. Such a conformation, com- 19. Z. Cheng, Y. Jiang, E. C. Mandon, R. Gilmore, J. Cell Biol. 168, Table S1
pared with a partially open channel seen with 67–77 (2005). References (31–40)
20. T. Becker et al., Science 326, 1369–1373 (2009).
the other modes, is likely advantageous for many 21. J. Zimmer, Y. Nam, T. A. Rapoport, Nature 455, 936–943 (2008). 9 October 2018; accepted 21 November 2018
posttranslational-specific substrates, which tend to 22. P. F. Egea, R. M. Stroud, Proc. Natl. Acad. Sci. U.S.A. 107, Published online 13 December 2018
have a less hydrophobic signal sequence (28–30). 17182–17187 (2010). 10.1126/science.aav6740

Itskanov et al., Science 363, 84–87 (2019) 4 January 2019 4 of 4


R ES E A RC H

PROKARYOTIC IMMUNITY purified Cas12g1 was incapable of processing


its pre-crRNA in vitro with or without tracrRNA,
suggesting that additional endogenous factors
Functionally diverse type V are required for in vivo crRNA biogenesis (figs.
S4 and S5 and table S3).

CRISPR-Cas systems By investigating the mechanism of in vivo in-


terference by subtype V-G systems, we found that
ternary complexes consisting of Cas12g1, tracrRNA,
Winston X. Yan1*, Pratyusha Hunnewell1*, Lauren E. Alfonse1, Jason M. Carte1, and in vivo screen–validated crRNAs showed no
Elise Keston-Smith1, Shanmugapriya Sothiselvam1, Anthony J. Garrity1, Shaorong Chong1, cleavage of cognate ssDNA or dsDNA substrates
Kira S. Makarova2, Eugene V. Koonin2, David R. Cheng1, David A. Scott1† at 37°C (fig. S6, A and B, and tables S4 to S8).
The Cas12g1 locus originates from a hot spring
Type V CRISPR-Cas systems are distinguished by a single RNA-guided RuvC metagenome but, although the ternary complex
domain-containing effector, Cas12. Although effectors of subtypes V-A (Cas12a) is thermostable [complex melting temperature
and V-B (Cas12b) have been studied in detail, the distinct domain architectures and (Tm) = 74°C] (fig. S7), we observed no ssDNA or
diverged RuvC sequences of uncharacterized Cas12 proteins suggest unexplored dsDNA cleavage at 42°C, 50°C, or 60°C (fig. S6,
functional diversity. Here, we identify and characterize Cas12c, -g, -h, and -i. Cas12c, C to H). Given the transcriptional association
-h, and -i demonstrate RNA-guided double-stranded DNA (dsDNA) interference activity. of Cas12g1 in vivo interference indicated by the
Cas12i exhibits markedly different efficiencies of CRISPR RNA spacer complementary preferential targeting of sense-strand DNA (Fig.
and noncomplementary strand cleavage resulting in predominant dsDNA nicking. Cas12g 2A), we assessed cleavage of sense ssDNA (con-
is an RNA-guided ribonuclease (RNase) with collateral RNase and single-strand DNase taining crRNA spacer-complementary target)

Downloaded from http://science.sciencemag.org/ on January 7, 2019


activities. Our study reveals the functional diversity emerging along different routes or antisense ssDNA substrates in the presence of
of type V CRISPR-Cas evolution and expands the CRISPR toolbox. sense or antisense RNA transcripts. The Cas12g1
ternary complex efficiently cleaved the sense

C
ssDNA in the presence of sense RNA (hereafter,
ompetition between prokaryotes and vi- signment of separate subtypes, V-G, V-H, and V-I target RNA), and this activity increased in ef-
ruses has led to the evolution of diverse (Fig. 1A, fig. S1, and table S1). Whereas Cas12h ficiency from 37° to 50°C (Fig. 2E and fig. S8A).
defense strategies, with more being iden- and -i cluster with Cas12b, albeit at a large evo- No ssDNA cleavage was observed for any other
tified through the mining of growing lutionary distance, Cas12g clusters with the pre- DNA-RNA substrate combination (fig. S8, B to D).
genomic and metagenomic sequence data- dicted subtype V-U effectors and TnpBs (Fig. 1A). In the presence of target RNA, Cas12g1 ternary
bases (1–3). Class 2 CRISPR-Cas systems are of The subtype V-U effectors, including the recently complex also cleaved unrelated collateral ssDNA
particular interest, because their programmable identified Cas14a, -b, and -c (subtype V-F), are (Fig. 2E and fig. S9), demonstrating that target
single-effector nucleases have enabled genome much smaller than the typical CRISPR effec- RNA activates nonspecific collateral ssDNA
engineering and nucleic acid detection tools (4–8). tors and show greater similarity to TnpB (11, 20). cleavage in trans by Cas12g1.
Class 2 systems include types II, V, and VI, which Cas14a and Cas12g appear to have evolved from The weak ssDNA cleavage observed at 37°C is
are based on Cas9, Cas 12, and Cas13 effectors, re- distinct TnpB ancestors (Fig. 1A). Thus, exper- likely not responsible for the robust Cas12g1 in-
spectively (9–11). Cas9 contains an HNH nuclease imental characterization of subtype V-G is of terference activity observed in vivo. Thus, we
domain inserted into a RuvC nuclease domain particular interest to elucidate the routes of evo- investigated the intrinsic ribonuclease (RNase)
(12–14), and the two domains together cleave lution of TnpB proteins into functional CRISPR activity of Cas12g1 and observed strong target
double-stranded DNA (dsDNA). Cas12 contains a effectors. RNA cleavage with the ternary complex at 37°C
single RuvC nuclease domain that cleaves dsDNA To functionally characterize the type V-G, -H, (Fig. 2F), and this was further enhanced at 50°C
adjacent to protospacer adjacent motif (PAM) and -I systems, we used an Escherichia coli nega- (fig. S10 and tables S4 to S8). At 50°C, detectable
sequences (15) and single-stranded DNA (ssDNA) tive selection screen, in which RNA-guided inter- target RNA cleavage was observed at ternary
nonspecifically (16). Cas13 contains two HEPN ference activity of reconstituted CRISPR-Cas complex concentrations as low as 125 pM (fig.
domains that cleave RNA exclusively (10, 17, 18). systems reduces bacterial viability at 37°C (19). S11A), with no background cleavage of nontarget
We aggregated more than 10 terabytes of se- Each screen included: (i) an effector plasmid car- RNA at the highest complex concentration tested
quence data and generated a database of 293,985 rying predicted Cas genes; (ii) a CRISPR array (250 nM) (figs. S10B and S11B). Cas12g1 ternary
putative CRISPR-Cas systems (19). From this data- library targeting pACYC184 and E. coli essential complex also cleaved dye-labeled collateral RNA
base we identified type V systems with predicted genes; and (iii) a noncoding plasmid containing accompanying unlabeled target RNA at target
effectors ranging in size from 720 to 1093 amino concatenated cas gene-flanking noncoding sequenc- concentrations as low as 100 pM, demonstrating
acids, each of which contained a C-terminal RuvC es for the unbiased detection of trans-activating that the stand-alone RNA detection sensitivity of
domain (fig. S1). The classification tree of type V crRNA (tracrRNA) elements (Fig. 1, B and C). Cas12g1 is comparable to that of the highest per-
effectors splits into three major branches: (i) In vivo screening of the compact subtype V-G forming Cas13 variants (Fig. 2F and fig. S11, C
Cas12a, -c, -d, and -e; (ii) Cas12b and its distant effector, Cas12g1 (767 amino acids), revealed in- and D) (21). Both RNA and ssDNA cleavage by
homologs; and (iii) subtype V-U variants closely terference activity that specifically targeted the Cas12g1 are metal ion dependent and require an
related to transposon-encoded TnpB. Predicted sense DNA strand of actively transcribed sub- intact RuvC domain that was previously known
type V effectors in this study showed weak se- strate regions (Fig. 2A, fig. S2A, and table S2). to cleave only DNA (Fig. 2, G and H, and figs. S4
quence similarity (E > 10−3) with previously char- Analysis of target-flanking sequences revealed and S12). The thermostability and nucleic acid
acterized ones. Combined with differences in no PAM requirements for interference (fig. S2, B detection sensitivity of Cas12g1 has the potential
locus organization and subsequently uncovered to D). Mutation of the RuvC-I motif of Cas12g1 to enhance the performance and durability
functional differences, our work supports the as- [Asp513→Ala (D513A)] or omission of the non- of nucleic acid diagnostic methods, such as
coding plasmid substantially decreased inter- SHERLOCK and DETECTR (16, 18, 22). Addi-
1
Arbor Biotechnologies, Cambridge, MA 02139, USA. ference activity (Fig. 2B and fig. S2, E to G). tionally, the small size of Cas12g1 is likely to
2
National Center for Biotechnology Information, National RNA sequencing of screen samples revealed a facilitate delivery for diverse in vivo transcrip-
Library of Medicine, National Institutes of Health, Bethesda,
MD 20894, USA.
tracrRNA expressed from the noncoding plasmid tome engineering applications (23, 24).
*These authors contributed equally to this work. and a mature crRNA from the CRISPR array li- We next investigated subtype V-H and V-I sys-
†Corresponding author. Email: dscott@arbor.bio brary (Fig. 2, C and D, and fig. S3). However, tems containing effectors Cas12h (870 to 933

Yan et al., Science 363, 88–91 (2019) 4 January 2019 1 of 4


R ES E A RC H | R E PO R T

A TnpB
B [Accessory] Effector CRISPR array Fig. 1. Discovery and screening of type V
Natural
Locus
CRISPR-Cas diversity. (A) Classification tree
V-F
Cas14b T7 lac of type V effectors (Cas12 proteins) with the
Effector [Accessory]
V-F Effector
corresponding CRISPR-Cas loci organization
Cas14a
plasmid LacO RBS + mH6 shown for each branch. Cas12 proteins analyzed
V-U3 in pET-28a(+)
C2c10 in this work are highlighted in red. (B) Design
T7 lac
V-U4 of in vivo screen effector and noncoding
C2c9 Noncoding
(NC) plasmid Concatenated NC sequences
plasmids. CRISPR array libraries were
V-U2 LacO
C2c8
in pACYC184 designed with spacers uniquely and uniformly
J23119 J23119 sampled from both strands of pACYC184 or
V-F
Cas14c CRISPR Array
Library
DR DR + DR DR E. coli essential genes, then flanked by two
V-U1 UMI reverse array direction DRs and transcribed by a J23119 promoter.
C2c4 (spacers targeting pACYC184 and E. coli essential genes)
(C) Workflow schematic of the in vivo
V-G
Cas12g E. coli screen.
V-C
C CRISPR array library

Cas12c (C2c3)

Assembly
V-D
Cas12d (CasY) + Noncoding
Effector plasmid
plasmid
V-A
Cas12a (Cpf1) or pACYC
transformation components
V-E
Cas12e (CasX) antibiotic
Reaction

selection
V-U5

Downloaded from http://science.sciencemag.org/ on January 7, 2019


C2c5

V-B
Cas12b (C2c1)
E. coli with depletion of E. coli with
V-I CRISPR systems active CRISPR systems
Cas12i
output and
V-H input plasmid
Readout

Cas12h PCR & NGS


2 surviving depleted arrays
E. coli
Interference Cas effector RuvC-I, II, III Nuc
small
Adaptation Cas4 Cas1 Cas2 RNAseq
Noncoding CRISPR array tracrRNA
mature crRNA
& tracrRNAs

A B C

Reads Mapped (×103)


CRISPR array expression 80
30
# top strand spacers

top strand bottom strand min. CRISPR array


24
40
18
pACYC

S
Spacer target
DNA strand

12 0 nt
AS 0 102
6 mature crRNA
0
E. coli EG

S
ORI TetR CamR
D
# bottom strand spacers

Cas12g1 CRISPR array


Reads Mapped (×103)

0 AS Native
6 locus
T A D T A D
12 W 13 13 W 13 13
D5 A5 D5 A5 12 Noncoding
18 plasmid
Cas12g1 6
24
3 (log) 10 1 (log) 14000
30 Screen Hits nt
fold depletion RNA expression (count) 0
<5 (log) 400 0 1230
tracrRNA

E 37°C 50°C
F G 37°C 50°C
H
Collateral ssDNA Collateral ssRNA Collateral ssDNA 37°C 50°C
Target ssRNA Target ssRNA Target ssRNA Target ssRNA
Nontarget ssRNA Nontarget ssRNA tracrRNA tracrRNA
tracrRNA tracrRNA Mature-crRNA Mature-crRNA
Mature-crRNA Mature-crRNA Cas12g1-WT Cas12g1-WT
Cas12g1-WT Cas12g1-WT Cas12g1-D513A Cas12g1-D513A
150 150 150 150 150
15% TBE-Urea

80 75 80
15% TBE-Urea
15% TBE-Urea

75 80
50 50 50
50
cleaved cleaved 50 cleaved cleaved
TBE-Urea

ssDNA ssRNA ssDNA ssRNA


15%

IR800 5’ labeled IR800 5’ labeled


SYBR-labeled collateral ssDNA SYBR-labeled collateral ssDNA IR800 5’ labeled target ssRNA
target/nontarget ssRNA collateral ssRNA

Fig. 2. Cas12g displays RNA-activated target cleavage of RNA and were subtracted from this and similar analyses. (C and D) Mature crRNA
collateral trans-cleavage of RNA and ssDNA. (A) Strongly depleted (C) and tracrRNA (D) identified from small RNA sequencing of in vivo
CRISPR arrays from in vivo screening of Cas12g1 and its noncoding screen samples containing Cas12g1 and noncoding plasmid. The
plasmid mapped to pACYC184. (B) Heatmap showing strongly depleted schematic above tracrRNA shows construction of noncoding plasmid
CRISPR arrays (screen hits) to evaluate RuvC and substrate strand from native locus sequences. (E and F) Target ssRNA activated collateral
dependencies of Cas12g1 (S, sense; AS, antisense; EG, essential genes). ssDNA cleavage at 37°C and 50°C (E) and target and collateral ssRNA
A513D was cloned from the D513A construct to rescue its activity. Strongly cleavage at 37°C (F). (G and H) Cleavage assays targeting collateral
depleted CRISPR arrays in negative control screens without the effector ssDNA (G) and ssRNA (H) with purified RuvC mutant dCas12g1 D513A.

Yan et al., Science 363, 88–91 (2019) 4 January 2019 2 of 4


R ES E A RC H | R E PO R T

Fig. 3. In vivo and in vitro activity of Cas12i. A CRISPR array expression B Cas12i1 depleted motifs
(A) Evaluation of a minimal active system for top strand bottom strand 3nt (6): No 3nt motifs detected
Cas12i, with heatmaps showing strongly depleted 2nt (3,5):

pACYC
S

Spacer target
1nt (1,2,4):
CRISPR arrays from in vivo screening in

DNA strand
Cas12i1
AS 5 6
different Cas12i system compositions (S, sense;

E. coli EG
AS, antisense; EG, essential genes). (B) (Top) S 4
5 1nt 2nt 3nt
Distribution of bit scores for all permutations of

Bit score
3 # nt in motif permutation
AS 3
1- to 3-nucleotide (nt) motifs within the target
2 4
and 15-nt flanking sequences corresponding to 2 1

pACYC
S

Spacer target
strongly depleted in vivo arrays, calculated as

DNA strand
Cas12i2
AS 1
described in (19). The box above describes

E. coli EG
motif analysis for Cas12i1 as an example. (Bottom) S 0
Web logos from target-flanking sequences. Cas12i1 Cas12i2
2 2

Bit score
AS
(C to E) Titration of a Cas12i1 binary complex 1 1
200

Screen Hits
on target and nontarget ssDNA (C), collateral Cas12i (WT) 0 0
dCas12i (log) -6 -1 -6 -1
ssDNA with target and nontarget ssDNA Distance before 5’ target start
Noncoding
(D), and target and nontarget dsDNA (E). (F) S1 <5

nuclease treatment to resolve dsDNA nicks C D Collateral ssDNA


Target ssDNA Target ssDNA
(induced by Cas12i1) into dsDNA breaks. Nontarg. ssDNA Nontarg. ssDNA
pre-crRNA pre-crRNA
Cas12i1 [4-125nM] Cas12i1 [31nM-1µM]
150 150

15% TBE-Urea

15% TBE-Urea

Downloaded from http://science.sciencemag.org/ on January 7, 2019


100 100
75 75
cleaved cleaved
ssDNA 50 ssDNA 50

IR800 5’ labeled target/non-target ssDNA IR800 5’ labeled collateral ssDNA


E F
Target dsDNA Target dsDNA
Nontarg. dsDNA S1 Nuclease [0.1U]
pre-crRNA pre-crRNA
Cas12i1 [31nM-1µM] Cas12i1 [31nM-1µM]

nicked dsDNA

15% TBE-Urea
150 150

4-20% TBE
100 dsDNA substrate 100
cleaved 75 cleaved dsDNA 50
dsDNA 50

IR800 5’ labeled target/non-target dsDNA SYBR-labeled target dsDNA


(target: non-spacer-complementary strand labeled)

amino acids) and Cas12i (1033 to 1093 amino collateral ssDNA in the presence of unlabeled nomic data (10). With our expanded database, we
acids), respectively. These effectors show distant target ssDNA, consistent with collateral ssDNA detected and synthesized in vivo screen plasmids
similarity to Cas12b, with substantial truncation cleavage activity (Fig. 3D). for complete subtype V-C systems containing the
of N-terminal regions responsible for PAM recog- We observed Cas12i1-mediated cleavage of effectors OspCas12c (from Oleiphilus sp. HI0009),
nition and DNA unwinding (25, 26). In vivo dsDNA under denaturing conditions, which was Cas12c1, and Cas12c2. All these systems showed
screening of Cas12h1 (870 amino acids), Cas12i1 suggestive of dsDNA nicking. While reactions broad and symmetrical targeting of both DNA
(1093 amino acids), and Cas12i2 (1054 amino containing dsDNA with a labeled non-spacer- strands, consistent with autonomous dsDNA
acids) demonstrated robust and broadly distrib- complementary strand showed robust DNA interference (Fig. 4A and fig. S18). RNA sequenc-
uted targeting of both strands of dsDNA sub- cleavage over a wide range of binary complex ing of screening samples for the minimal subtype
strates that was dependent on an intact RuvCI concentrations, those containing dsDNA with V-C systems demonstrated pre-crRNA process-
domain (Fig. 3A and figs. S13A and S14, A to F). the spacer-complementary strand labeled showed ing and highly expressed tracrRNAs (fig. S19).
The noncoding plasmid was not required, in- only small amounts of cleavage at the highest A 5′ TG PAM was required for Cas12c1 and
dicating that, unlike subtype V-B systems, the concentrations tested (Fig. 3E and fig. S17, A OspCas12c, and a minimal 5′ TN PAM was re-
minimal V-H and V-I interference modules in- and B). Under nondenaturing conditions, Cas12i1 quired for Cas12c2 (Fig. 4B). The single-nucleotide
clude only the effector and crRNA (Fig. 3A and cleavage reactions yielded products with lower TN PAM for Cas12c2 dsDNA targeting comple-
fig. S14, G and H). Analysis of target-flanking electrophoretic mobility than the input dsDNA, ments recently engineered Cas9 effectors with
sequences corresponding to strongly depleted and these products were then converted to minimal PAMs (28), potentially expanding the
arrays from in vivo screens showed that dsDNA double-strand breaks by S1 nuclease treatment, target space for genome editing.
interference by Cas12h1 depends on a 5′ RTR PAM consistent with nicking of dsDNA substrates We have presented here a framework for sys-
(fig. S13B), whereas Cas12i1 and Cas12i2 prefer a (Fig. 3F). These results suggested that Cas12i1 tematic discovery, screening, and characteri-
5′ TTN PAM (Fig. 3B). preferentially nicks the non-spacer-complementary zation of class 2 CRISPR-Cas systems, and we
Small RNA sequencing of Cas12i1 in vivo screen strand, and it cleaves the spacer-complementary demonstrated a range of activities for four type
samples demonstrated biogenesis of a mature strand with a lower efficiency to yield a dsDNA V CRISPR-Cas subtypes, including target and
crRNA (fig. S15), which was confirmed in vitro break. Together, the small size, autonomous pro- collateral cleavage of ssRNA and ssDNA as well
using purified Cas12i1 and a minimal pre-crRNA cessing of multiplexed crRNAs, and nicking ac- as dsDNA nicking and cleavage (Fig. 4C). These
(DR-spacer-DR-spacer-DR) (fig. S16 and table tivity of Cas12i could enhance double-nicking findings reveal the transition in the properties
S3). Binary complexes containing Cas12i1 and applications for high-fidelity genome editing (27). of Cas12 proteins along the proposed evolution-
pre-crRNAs efficiently cleaved target contain- Subtype V-C loci have been previously observed ary path from TnpB to large type V effectors.
ing ssDNA substrates (Fig. 3C) as well as labeled but never characterized due to incomplete ge- Additionally, future applications could include

Yan et al., Science 363, 88–91 (2019) 4 January 2019 3 of 4


R ES E A RC H | R E PO R T

B Fig. 4. In vivo dsDNA interference by Cas12c.


A CRISPR array expression 4
top strand bottom strand 1nt 2nt 3nt (A) Evaluation of a minimal active system for Cas12c,
800 3

Bit score
Cas12c1
# nt in motif permutation with heatmaps showing strongly depleted CRISPR
2
(log) arrays from in vivo screening in different Cas12c
Cas12c2
<5
1 system compositions. Gray boxes indicate data not
OspCas12c Screen available. (B) (Top) Distribution of bit scores for
0
Hits
Cas12c (WT)
Cas12c1 Cas12c2 OspCas12c all permutations of 1- to 3-nt motifs within the

Bit score
2 2 2
dCas12c 1 target and 15-nt flanking sequences corresponding
Cas1 0 to strongly depleted arrays. (Bottom) Web logos
-6
Noncoding Distance to 5’ target end from target-flanking sequences. (C) Overview
of minimal components and interference
C Subtype V-C Subtype V-H, I Subtype V-G mechanisms of Cas12g, -h, -i, and -c. Asterisks
Cas12c ternary complex Cas12h,i binary complex Cas12g ternary complex
denote putative mechanisms subject to
components

crRNA additional validation.


System

5’ 3’
5’
crRNA 3’ 5’
crRNA 3’ 3’
5’ 5’
3’
tracrRNA
tracrRNA
Cas12c: 1209 - 1330aa Cas12h: 870 - 924aa; Cas12g: 720 - 830aa
Cas12i: 1033 - 1093aa
ssDNA or ssRNA

?
* ? ?
ssRNA
cleavage

ssDNA 3’ 5’
3’ 5’ 3’ 5’

Downloaded from http://science.sciencemag.org/ on January 7, 2019


ssDNA ssDNA

ssRNA

*
cleavage

5’ 3’ 5’ 3’
dsDNA

3’ 5’ 3’ 5’ Substrate: DNA RNA


Cleavage: Cis Trans

expanded genomic targeting via the minimal 10. S. Shmakov et al., Mol. Cell 60, 385–397 (2015). D.R.C., L.E.A., J.M.C., E.K.S., S.S., S.C., and A.J.G., conceived
Cas12c2 PAM, high-fidelity genome editing using 11. S. Shmakov et al., Nat. Rev. Microbiol. 15, 169–182 (2017). and designed the study. D.R.C. and D.A.S. designed and
12. G. Gasiunas, R. Barrangou, P. Horvath, V. Siksnys, implemented the computational searches, with additional input
Cas12i nicking (27), or sensitive and durable from K.S.M. and E.V.K., including phylogenetic analysis and
Proc. Natl. Acad. Sci. U.S.A. 109, E2579–E2586 (2012).
nucleic acid detection via collateral cleavage by 13. M. Jinek et al., Science 337, 816–821 (2012). classification. W.X.Y., D.A.S., P.H., L.E.A., J.C., E.K.S., S.S., S.C.,
the thermostable Cas12g1 (18, 22). We antici- 14. E. V. Koonin, K. S. Makarova, F. Zhang, Curr. Opin. Microbiol. and A.J.G. performed all of the experimental work and analyzed
pate that our discovery framework will yield 37, 67–78 (2017). the data. W.X.Y. and D.A.S. wrote the manuscript with input
15. B. Zetsche et al., Cell 163, 759–771 (2015). from E.V.K. and help from all authors. Competing interests:
new CRISPR-Cas variants as genomic and meta- W.X.Y., P.H., L.E.A., J.M.C., E.K.S., S.S., S.C., A.J.G., D.R.C.,
16. J. S. Chen et al., Science 360, 436–439 (2018).
genomic sequence databases grow, expanding the and D.A.S. are employees and shareholders of Arbor
17. O. O. Abudayyeh et al., Science 353, aaf5573 (2016).
understanding of CRISPR biology and the nucleic 18. A. East-Seletsky et al., Nature 538, 270–273 (2016). Biotechnologies, Inc. W.X.Y., D.R.C., and D.A.S. are current or
acid manipulation toolbox. 19. W. X. Yan et al., Mol. Cell 70, 327–339.e5 (2018). former officers and D.R.C. is a director of Arbor Biotechnologies.
20. L. B. Harrington et al., Science 362, 839–842 (2018). Arbor Biotechnologies has filed patents related to this work.
21. J. S. Gootenberg et al., Science 360, 439–444 (2018). Data and materials availability: All data are available in the
RE FE RENCES AND N OT ES manuscript or the supplementary material. All reagents are
22. J. S. Gootenberg et al., Science 356, 438–442 (2017).
1. D. Burstein et al., Nature 542, 237–241 (2017). 23. D. B. T. Cox et al., Science 358, 1019–1027 (2017). available to the academic community through Addgene.
2. S. Doron et al., Science 359, eaar4120 (2018). 24. S. Konermann et al., Cell 173, 665–676.e14 (2018). Sequencing data are available on the NCBI Sequence Read
3. E. V. Koonin, K. S. Makarova, Y. I. Wolf, Annu. Rev. Microbiol. 71, 25. D. Dong et al., Nature 532, 522–526 (2016). Archive under Bioproject ID PRJNA496291.
233–261 (2017). 26. T. Yamano et al., Cell 165, 949–962 (2016).
4. R. Barrangou, P. Horvath, Nat. Microbiol. 2, 17092 (2017). 27. F. A. Ran et al., Cell 154, 1380–1389 (2013). SUPPLEMENTARY MATERIALS
5. R. Barrangou et al., Science 315, 1709–1712 (2007). 28. J. H. Hu et al., Nature 556, 57–63 (2018). www.sciencemag.org/content/363/6422/88/suppl/DC1
6. D. B. T. Cox, R. J. Platt, F. Zhang, Nat. Med. 21, 121–131 Materials and Methods
(2015). ACKN OWLED GMEN TS Figs. S1 to S19
7. S. E. Klompe, S. H. Sternberg, Harnessing “A Billion Years We thank the entire Arbor Biotechnologies team for support and Tables S1 to S10
of Experimentation”: The Ongoing Exploration and comments on this work. Funding: Arbor Biotechnologies is a References (29–33)
Exploitation of CRISPR–Cas Immune Systems. CRISPR J. 1, privately funded company. K.S.M. and E.V.K. are supported by
141–158 (2018). the intramural program of the U.S. Department of Health 14 October 2018; accepted 20 November 2018
8. G. J. Knott, J. A. Doudna, Science 361, 866–869 (2018). and Human Services (to the National Library of Medicine). Published online 6 December 2018
9. K. S. Makarova et al., Nat. Rev. Microbiol. 13, 722–736 (2015). Author contributions: W.X.Y. and D.A.S., with input from P.H., 10.1126/science.aav7271

Yan et al., Science 363, 88–91 (2019) 4 January 2019 4 of 4


Apply for our exciting research Prize!

$25, 000 Grand Prize!


Get published in Science!
Te Science-PINS Prize is a highly competitive international prize that honors sci-
entists for their excellent contributions to neuromodulation research. For purposes
of the Prize, neuromodulation is any form of alteration of nerve activity through the
delivery of physical (electrical, magnetic, or optical) stimulation or chemical agents
to targeted sites of the nervous system.

For full details, judging criteria and eligibility requirements, visit:

www.sciencemag.org/prizes/pins
Submission Deadline: March 15, 2019
F O R C E F O R S C I E N C E . O R G

Members and friends of


AAAS are invited to join
AAAS Travels on fascinating
trips to all 7 contintents!
STA ND TOG E THE R
Be a Force for Science

Alaska
Au
urora Borealis
March 28 - April 3, 2019!
Come discover the great beauty
of Alaska in winter, and
see the greatest light show on
earth! See Alaskan wildlife in
winter and take the train to
Fairbanks, passing 20,310 foot
Denali en route! See the
Aurora Borealis dance across
the night sky!
$2,995 pp twin + air

Tahiti Total
Solar Eclipse
June 25-July 4, 2019

GET THE FACTS


With optional
Bora Bora Extension Understand the science behind the issues that matter.
to July 7, 2019
Photo by Dr. David Morrison
Discover the magic of Tahiti and FOLLOW AAAS ADVOCACY
Moorea, and see the July 2, 2019 Champion public discussion and evidence-based policy.
Eclipse from our chartered
aircraft near the remote
Gambier Islands hosted by the
villagers in Mangareva! TAKE ACTION
Discover a wonderland of coral Learn ways you can become an advocate and stand up for science.
reefs and exquisite mountain
peaks in Bora Bora.
$5,995 pp twin + air + ext
For a detailed brochure,
please call (800) 252-4910
All prices are per person twin share + air

BETCHART EXPEDITIONS Inc.


17050 Montebello Rd
Cupertino, California 95014
Email: AAASInfo@betchartexpeditions.com
www.betchartexpeditions.com
ARTIFICIAL INTELLIGENCE AUTONOMOUS VEHICLES BIOMATERIALS IN ROBOTICS HUMANOIDS LAND & UNDERSEA ROBOTS MEDICAL & SURGICAL ROBOTS
MICRO/NANO ROBOTS ROBOT ENGINEERING ROBOTS IN EDUCATION SPACE ROBOTS THEORETICAL ADVANCES WITH POSSIBLE APPLICATIONS

Transforming the Future


of Robotics

As a multidisciplinary online-only journal, Science Robotics publishes original, peer-reviewed,


research articles that advance the feld of robotics. The journal provides a central forum for
communication of new ideas, general principles, and original developments in research and
applications of robotics for all environments.
Learn more at: ScienceRobotics.org
Make Your Research
Hit the Target

Science Translational Medicine publishes peer-reviewed, cutting-edge biomedical


research in the felds of cardiology, cancer, immunotherapy, infectious diseases
and vaccines, bioengineering and devices, neurology and neurodegenerative
diseases, obesity, diabetes and metabolic disorders, drug discovery, genomic
medicine, imaging, stem cell therapy and regenerative medicine.

Submit your research today


Learn more at: ScienceTranslationalMedicine.org
want new
technologies?
watch
our
webinars
antibodies Learn about the
apoptosis latest break-
biomarkers throughs, new
cancer technologies, and
cytometry ground-breaking
data research in a variety
diseases of felds. Our
DNA expert speakers
epigenetics explain their quality
genomics research to you and
immunotherapies answer questions
medicine submitted by live
microbiomics viewers.
microfluidics
microscopy
neuroscience
VIEW NOW!
proteomics webinar.
sequencing sciencemag.
toxicology
transcriptomics
org

Brought to you by the Science/AAAS


Custom Publishing Ofce

@SciMagWebinars
March 29-April 3 | Georgia World Congress Center | Atlanta, GA

Join us in Atlanta for the latest innovative and


inspiring cancer research from around the world
Register Today!
Become a Member! Join the AACR and receive a discount on registration

The AACR Annual Meeting highlights the work of the greatest


minds in cancer science and medicine from institutions all over
the world. This meeting presents the many scientific discoveries
across the breadth of cancer research—from prevention, early
detection, and interception; to cancer biology, translational,
and clinical studies; to survivorship, population science, and
advocacy. This year’s program, with the theme of “Integrative
Cancer Science • Global Impact • Individualized Patient Care,”
#AACR19
will be a comprehensive, cutting-edge scientific event that you
will not want to miss! AACR.org/AnnualMeeting
online @sciencecareers.org

myIDP: A career plan


SCIENCE CAREERS customized for you, by you.
ADVERTISING

For full advertising details, go


to ScienceCareers.org and click
For Employers, or call one of our
representatives.

For your career in science, thereÕs only one


AMERICAS
+1 (202) 326 6577
+1 (202) 326 6578
advertise@sciencecareers.org
Recommended by
EUROPE, INDIA, AUSTRALIA, leading professional
NEW ZEALAND, REST OF societies and the NIH
WORLD
+44 (0) 1223 326527
Features in myIDP include:
advertise@sciencecareers.org
§ Exercises to help you examine your skills, interests,
CHINA, KOREA, SINGAPORE, and values.
TAIWAN, THAILAND
§ A list of 20 scientific career paths with a prediction of
+86 (131) 4114 0012
advertise@sciencecareers.org
which ones best fit your skills and interests.
§ A tool for setting strategic goals for the coming year, with
JAPAN optional reminders to keep you on track.
+81 (3) 6459 4174
advertise@sciencecareers.org
§ Articles and resources to guide you through the process.
§ Options to save materials online and print them for further
JOB BOARD SUPPORT review and discussion.
support@sciencecareers.org § Ability to select which portion of your IDP you wish to
share with advisors, mentors, or others.
§ A certificate of completion for users that finish myIDP.

Visit the website and start planning today!


ScienceCareers.org myIDP.sciencecareers.org

All ads submitted for publication must comply with In partnership with:
applicable U.S. and non-U.S. laws. Science reserves
the right to refuse any advertisement at its sole
discretion for any reason, including without limitation
for ofensive language or inappropriate content,
and all advertising is subject to publisher approval.
Science encourages our readers to alert us to any ads
that they feel may be discriminatory or ofensive.
ways that Science Careers
can help advance your career

1. Register for a free online account on


ScienceCareers.org.

2. Search thousands of job postings and find


your perfect job.

3. Sign up to receive e-mail alerts about job


postings that match your criteria.

4. Upload your resume into our database and


connect with employers.

5. Watch one of our many webinars on


different career topics such as job
searching, networking, and more.

6. Download our career booklets, including


Career Basics, Careers Beyond the Bench,
and Developing Your Skills.

7. Complete an interactive, personalized


career plan at “my IDP.”

8. Visit our Career Forum and get advice from


career experts and your peers.

9. Research graduate program information


and find a program right for you.

10. Read relevant career advice articles from


our library of thousands.

Visit ScienceCareers.org
today — all resources are free

SCIENCECAREERS.ORG
online @sciencecareers.org

Advance your
career with expert
advice from
Science Careers.

Download Free Career Advice Booklets!


ScienceCareers.org/booklets

Featured Topics:
§ Networking
§ Industry or Academia
§ Job Searching
§ Non-Bench Careers
§ And More
online @sciencecareers.org
Career Development Center

Career Development Center


Meet career challenges head-on with online courses
designed for scientists

 Public engagement  Proposal writing


 R&D funding analysis  Career development
 Efective communication  Science policy and advocacy

REGISTER TODAY
CareerDevelopment.aaas.org
WORKING LIFE
By Barbara A. Wanchisen

Lessons from the ‘real world’

W
hen I left my tenured professorship for a nonacademic job, I thought I had already done
the hard part: making the decision to leave the professional world that had been my home
for many years. I had little inkling of the culture shock that awaited me in my new sphere
of science policy and how disorienting it would be. In the 17 years since, I’ve seen that I’m
far from the only one who struggles with this transition. Regardless of career stage, leaving
academia requires some adjusting. For those who, like me, make the move later in their
careers, after decades as established academics, it can be even harder. Knowing what to expect before-
hand can take some of the shock out of the transition to the world outside academia.

Downloaded from http://science.sciencemag.org/ on January 7, 2019


YOU AREN’T THE CENTER OF THE SUMMER IS NOT SPECIAL. After
SU
WORLD, AND YOU WILL HAVE AN a long academic year, summer
ACTUAL BOSS. If you’re a senior feels different and, in some
fe
academic, teaching, advising, ways, special. It can be a time
w
and managing a research group to regroup and refresh—write,
can turn your world into a develop ideas, even spend a few
de
solipsistic universe where what months away from the distrac-
m
you say goes. Most students tions of campus. Outside of aca-
ti
are attentive and agreeable, no demia, summer is generally three
matter what they really think. more months in the workplace. It
The dean and department chair might be punctuated by vacation,
are loosely construed as your but by and large, work goes on as
supervisors, but they generally usual for 12 months a year.
want you to focus on your own
ideas so that you can bring in THERE IS NO TENURE. This is a
grant money and prestige. tough one! Many in the profes-
Outside of academia, on the soriate value this near-guarantee
other hand, collaboration in of steady employment for a life-
service of a common goal is far time. But leaving tenure can
more important than any one “I had little inkling of the culture actually be liberating for a go-
person’s ideas. That is true even getter with a good work ethic.
if you are in a very senior lead-
shock that awaited me.” Employers want to keep strong,
ership role. There are goals to creative employees around, and
achieve and relationships to manage; you can’t pursue just they realize that individuals are not necessarily there for
your own interests. Having a more formal boss might feel life. That means that organizations can be very loyal to
odd, but be open to it. Bosses can offer support in ways their long-term, high-performing employees and treat them
that university structures can’t. well. And if you don’t enjoy the work or feel badly treated,
there’s no reason to stay.
YOU WON’T HAVE NEARLY ENOUGH TIME TO DO THE BACK- If you decide to take the plunge into the outside world,
GROUND WORK YOU’D LIKE. Completeness and thorough ex- take some time to acclimate to the new environment. You’ll
amination are hallmarks of a serious scholar. In academia, probably experience some initial surprises, but give your-
you can usually take all the time you need to do plenty self a chance to see whether things get better. And if this
ILLUSTRATION: ROBERT NEUBECKER

of background research, talk to colleagues, and cogitate article convinces you that academia is the right place for
before producing a decision or a publication. But in the you and that you should stay and flourish there, then that
outside world, you may have 30 minutes to come up with is a win, too. j
an answer. This was a particularly hard lesson for me to
learn. Sage advice from someone more junior than I but Barbara A. Wanchisen is the director of the Board on
with more “real world” work experience helped immensely. Behavioral, Cognitive, and Sensory Sciences at the National
They said that sometimes I just had to go with my gut and Academies of Sciences, Engineering, and Medicine in Wash-
call it a day. ington, D.C. Send your story to SciCareerEditor@aaas.org.

98 4 JANUARY 2019 • VOL 363 ISSUE 6422 sciencemag.org SCIENCE

Published by AAAS

You might also like