Professional Documents
Culture Documents
Abhilash. M.
ABSTRACT
World wide spread of H1NI Influenza A Virus has raised concerns. Modelling of Matrix protein m1
of Influenza A virus protein was done using Modeller 9V2. Modelled structure was submitted to protein
model database and can be downloaded using accession number . Further modelled protein structure was
subjected to Insilco analysis using various Bioinformatics tools. Two anti-influenza drugs currently being
used to treat infected patients are oseltamivir (Tamiflu) and zanamivir (Relenza), both of which target the
neuraminidase enzyme of the virus. Reports of the emergence of drug resistance make the development of
new anti-influenza molecules a priority. Hence, modelled structure of H1NI Matrix m1 will be very useful
for insilico analysis of potential Matrix protein m1 inhibitors.
1
www.ijpbs.net Bioinformatics
International Journal of Pharma and Bio Sciences V1(1)2009
2
www.ijpbs.net Bioinformatics
International Journal of Pharma and Bio Sciences V1(1)2009
3
www.ijpbs.net Bioinformatics
International Journal of Pharma and Bio Sciences V1(1)2009
6
www.ijpbs.net Bioinformatics
International Journal of Pharma and Bio Sciences
V1(1)2009
10 20 30 40 50 60 70
| | | | | | |
MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRPILSPLTKGILGFVFTLTVPS
cccccccceeeeeecccccchhhhhhhhhhhhhccccchhhhhhhhhccccccccccccceeeeeeeccc
ERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTT
ccchhhhhhhhhhccccccccchhhhhhhhhhhhhhhhhcccceeeeeeccchhhheeeeeeecccceee
EAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVANQTR
ccccccccccccccccccchhhhhhhhcccchhhhhchhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
QMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQRFK
hhhhhhhhhccccccccchhhhhhhhhhhhhhhhhhheeeec
Sequence length : 252
GOR4 :
Alpha helix (Hh) : 127 is 50.40%
310 helix (Gg) : 0 is 0.00%
Pi helix (Ii) : 0 is 0.00%
Beta bridge (Bb) : 0 is 0.00%
Extended strand (Ee) : 33 is 13.10%
Beta turn (Tt) : 0 is 0.00%
Bend region (Ss) : 0 is 0.00%
Random coil (Cc) : 92 is 36.51%
7
www.ijpbs.net
Bioinformatics
International Journal of Pharma and Bio Sciences V1(1)2009
Figure 2:
GOR IV secondary structure prediction of Matrix protein m1 of H1N1 Influenza virus.
Figure 3: Amino acid frequency plot of Matrix protein m1 of H1N1 Influenza virus.
Beta Staircase Model about an assumed alpha helix. The view is always
The beta staircase graphically displays along the central axis of the helix from N to C-
(Figure 5) the disposition of amino acid side chains terminus. The helical wheel is an effective method
8
www.ijpbs.net Bioinformatics
International Journal of Pharma and Bio Sciences V1(1)2009
Figure 5:
Beta staircase model of Matrix protein m1 of H1N1 Influenza virus.
Anolea environment is taken from a distance-dependent
Anolea (Atomic non-local environment knowledge-based mean force potential that has
assessment) is a server that performs energy been derived from a database of 1476 non-
calculations on a protein chain, evaluating the redundant protein chains with sequence identity
“Non-Local Environment (NLE)” of each heavy below 25 % and solved by X-Ray crystallography
atom in the molecule (Figure 2). The energy of with a resolution lower than 3A0.
each pairwise interaction in this non-local
9
www.ijpbs.net Bioinformatics
International Journal of Pharma and Bio Sciences V1(1)2009
Table 1:
Molecular properties calculation of Matrix protein m1 of H1N1 Influenza virus.
Molecular weight (Daltons) 27894.279
10
www.ijpbs.net Bioinformatics
International Journal of Pharma and Bio Sciences V1(1)2009
CONCLUSION
Novel H1N1 (Referred to as “Swine flu” REFERENCES
early on) is a new influenza virus causing illness in
people. This new virus was first detected in people 1. "Swine influenza". The Merck Veterinary
in the united states in April 2009. A June 10, 2009 Manual. 2008.
update by the U.N.'s World Health Organization http://www.merckvetmanual.com/mvm/index.jsp
(WHO) states that 74 countries have officially ?cfile=htm/bc/121407.htm. Retrieved on April
reported 27,737 cases of influenza A (H1N1) 30, 2009.
infection, including 141 deaths. Two anti-influenza 2. V Trifonov, H Khiabanian, B Greenbaum, R
drugs currently being used to treat infected patients Rabadan (30 April 2009). "The origin of the
are oseltamivir (Tamiflu) and zanamivir (Relenza), recent swine influenza A(H1N1) virus infecting
both of which target the Neraminidase enzyme of humans". Eurosurveillance 4 (17).
the virus. Reports of the emergence of drug 3. Maria Zampaglione (April 29, 2009). "Press
resistance make the development of new anti- Release: A/H1N1 influenza like human illness in
influenza molecules a priority. This project aimed at Mexico and the USA: OIE statement". World
designing structure of Matrix m1 of H1N1 which Organisation for Animal Health.
will be useful for designing novel Matrix m1 http://www.oie.int/eng/press/en_090427.htm.
protein inhibitors which will help to combat H1N1 Retrieved on April 29, 2009.
Pandemic. 4. Shin JY, Song MS, Lee EH, Lee YM, Kim SY,
Kim HK, Choi JK, Kim CJ, Webby RJ, Choi YK
ACKNOWLEDGEMENT (2006). "Isolation and characterization of novel
We are very much thankful to Shri.S.Narasa H3N1 swine influenza viruses from pigs with
Raju, Chairman of Children’s education trust,Shri respiratory diseases in Korea". Journal of
Narasimha raju, Executive director of Children’s Clinical Microbiology 44 (11): 3923–7.
education trust ,Dr.T.Krishnan Principal, Dr.Kusum 5. Ma W, Vincent AL, Gramer MR, Brockwell CB,
Paul of The oxford college of Engineering, Lager KM, Janke BH, Gauger PC, Patnayak DP,
Bangalore for their support and encouragement. Webby RJ, Richt JA (26 December 2007).
"Identification of H2N3 influenza A viruses
11
www.ijpbs.net Bioinformatics
International Journal of Pharma and Bio Sciences V1(1)2009
12
www.ijpbs.net Bioinformatics