CORPORATE PHILANTHROPY RESOURCE GUIDE

Fall 2010

Profiles from leading organizations in the following categories:

Consultants Membership Organizations Philanthropy IT and General Resources Intergovernmental Organizations Academic Institutions Venture Philanthropy Philanthropy News Sources

About the Resource Guide

The Committee Encouraging Corporate Philanthropy (CECP) engages the public, private, and independent sectors to help advance the case for corporate philanthropy. In keeping with its mission, CECP in 2007 first embarked on an assessment of select organizations that play important roles within the landscape of corporate philanthropy. Now, three years later, CECP is pleased to present an updated edition of this free online publication. This CECP Resource Guide is not intended to be exhaustive – it is a starting point to serve as a tool for more strategic and effective corporate giving as well as to facilitate effective partnerships across the three sectors. Information included in this guide was provided directly by the represented organizations. Inclusion in this guide should not be considered as an endorsement by CECP. Requests for consideration or referrals for inclusion in this guide, as well as questions and updates, can be emailed to: info@CorporatePhilanthropy.org with the subject line ―CECP Resource Guide.‖ This document is available for free download online at: http://www.corporatephilanthropy.org/research/best-practices/resource-guide.html

About the Committee Encouraging Corporate Philanthropy

The Committee Encouraging Corporate Philanthropy (CECP) is the only international forum of business leaders focused on corporate philanthropy. Membership includes more than 180 global CEOs and chairpersons of companies that collectively account for more than 40% of reported corporate giving in the United States. Engaging with the public, private, and independent sectors, CECP members seek and create opportunities to serve as corporate giving advocates, practitioners, educators, and spokespersons to advance the case for philanthropy and to inspire other business leaders to make a lasting commitment to community giving.

Courtney King, Communications Manager, CECP 212.825.1000, info@corporatephilanthropy.org

PAGE 1 : Corporate Philanthropy Resource Guide

CORPORATE PHILANTHROPY RESOURCE GUIDE Table of Contents

CONSULTANTS

AccountAbility APCO Worldwide Bridgespan The Catchpole Corporation Cause Consulting The Center for Effective Philanthropy (CEP) Ceres Changing Our World, Inc. CAFAmerica Comunitas Cone E-Philanthropy Solutions Inc. Entrepreneurs Foundation Fleishman-Hillard The Foundation Center FSG Social Impact Advisors Global Business Network (GBN) Global Philanthropic LBG Associates Louder Than Words, Inc. Mission Measurement, LLC National Philanthropic Trust Oxford Analytica Rockefeller Philanthropy Advisors Strategic Philanthropy Advisors, LLC Taproot Foundation TCC Group The Consulting Network The Philanthropic Initiative (TPI) True Impact LLC Walker Information Wellspring Consulting MEMBERSHIP ORGANIZATIONS ADMICAL Association of Corporate Contributions Professionals (ACCP) The Aspen Institute Association of Fundraising Professionals Business Civic Leadership Center Business in the Community (BITC) BSR (Business for Social Responsibility) Business Roundtable Canadian Business for Social Responsibility Cause Marketing Forum Committee Encouraging Corporate Philanthropy

5 8 12 14 16 18 20 22 24 27 28 30 32 34 37 39 41 43 44 47 49 51 52 54 56 57 58 59 61 63 65 67

68 70 72 74 76 78 82 84 85 87 88

PAGE 2 : Corporate Philanthropy Resource Guide

The Conference Board Corporate Responsibility Officer (CR Magazine) CSR Europe European Foundation Centre Forum of Regional Associations of Grantmakers Independent Sector Giving Institute: Leading Consultants to Non-Profits Global Philanthropy Forum Global Reporting Initiative (GRI) Grantmakers for Effective Organizations International Business Leaders Forum (IBLF) International Society of Business, Economics, and Ethics (ISBEE) LBG Research Institute Net Impact Worldwide Initiatives for Grantmaker Support PHILANTHROPY INFORMATION TECHNOLOGY AND RESOURCES Action Without Borders / Idealist.org American Institute of Philanthropy AngelPoints Charity Navigator CMO Council GlobalGiving Foundation GreenNonprofits.org GuideStar The JK Group, Inc. National Committee for Responsive Philanthropy NPower NY People to People Fundraising Points of Light Public/Private Ventures (P/PV) TechSoup Global VolunteerMatch

91 95 97 99 102 103 105 106 107 110 112 114 115 117 119

120 121 122 124 127 129 131 132 133 135 136 138 140 141 144 148

INTERGOVERNMENTAL ORGANIZATIONS International Finance Corporation UN Global Compact 150 153

ACADEMIC INSTITUTIONS Boston College Center for Corporate Citizenship Center for Responsible Business The Center on Philanthropy at Indiana University Center for Social Innovation, Stanford Graduate School of Business Centre for Charitable Giving and Philanthropy Yale School of Management Program on Social Enterprise 155 156 158 159 159 162 163

PAGE 3 : Corporate Philanthropy Resource Guide

VENTURE PHILANTHROPY Acumen Fund Echoing Green Endeavor European Venture Philanthropy Association (EVPA) Venture Philanthropy Partners (VPP) 164 166 168 172 173

PHILANTHROPY NEWS SOURCES 3BL Media, LLC Corporate Philanthropy Report The Chronicle of Philanthropy Philanthropy Journal Philanthropy News Digest Stanford Social Innovation Review 175 176 177 178 179 180

PAGE 4 : Corporate Philanthropy Resource Guide

AccountAbility
www.accountability.org

OVERVIEW Mission

AccountAbility is a leading international organisation providing innovative solutions to the most pressing challenges in corporate responsibility and sustainable development. Since 1995, we‘ve been helping businesses, non-profits and governments embed ethical, environmental and social accountability into their DNA. Our unique value proposition brings together leading-edge research, widely-recognised standards and strategic consulting services. Non-profit consultancy 1995 New York and London International leadership and members (in +20 countries) Sunil A. Misser – Chief Executive Officer 35-40 employees Businesses, NGOs, assurance service providers, civil society organizations and research bodies Five offices: London, New York, Washington DC, Sao Paulo, Beijing

Type of organization Year of origin Headquarters location International scope Senior leadership Number of employees Target audience Size of membership / network

SERVICES Services and programs

Research: The AccountAbility Institute, AccountAbility‘s research arm, conducts in-depth examinations of the most pressing global sustainability issues, enabling the creation of innovative strategies and impactful sustainability initiatives. Focus areas of our research include: Collaborative governance, strategic community investment, responsible competitiveness, supply chains, climate change, low-carbon innovation, water management. Financial services, pharmaceuticals, energy and extractives, information and communications technology, apparel and footwear. North America, European Union, Mid-East, G20, emerging markets and developing world. Standards: AccountAbility's AA1000 series are principles-based standards to help organizations become more accountable, responsible and sustainable. They are used by a broad spectrum of organisations:

PAGE 5 : Corporate Philanthropy Resource Guide

multinational businesses, small and medium enterprises, governments and civil societies. AccountAbility offers services related to the implementation of the AA1000 series, as well as a five-day training program to support their application. The AccountAbility Principles Standard (AA1000APS) provides a framework for an organization to identify, prioritise and respond to its sustainability challenges. The AccountAbility Assurance Standard (AP1000AS) provides a methodology for assurance practitioners to evaluate the nature and extent to which an organisation adheres to the AccountAbility Principles. The AccountAbility Stakeholder Engagement Standard (AA1000SES) provides a framework to help organisations ensure stakeholder engagement processes are robust and deliver results. Advisory Services: AccountAbility consults with businesses, civil institutions, government bodies, partnerships and multilateral organizations to help them strengthen their approach to corporate responsibility, sustainable development and governance. Through the implementation of practical market-driven solutions, we help clients increase revenue, manage risk, and enhance brand and reputation. Main areas of service include: Strategy and Governance: Our approach links and leverages organisation-wide strategy and objectives, core competencies, stakeholder expectations, peer benchmarking and emerging risks and opportunities. Strategic CR Initiatives and Programs: We apply our expertise at the program level to plan, execute and manage initiatives to accelerate progress toward the achievement of CR goals. Reporting and Assurance: Our approach ensures accurate mapping of stakeholders and their material issues to deliver a powerful, audience-specific articulation of CR priorities and detailed performance disclosure. Stakeholder Engagement: We design and convene stakeholder dialogues to better understand the interests and needs of all parties, and apply this understanding in all key decisions.
Other services

Partnership Governance & Accountability Framework – Framework intended to help partnership brokers, managers, funders and impacted stakeholders design, implement and assess the quality of partnership governance and accountability. Responsible Competitiveness Index -- Country-specific research on the links between responsible business practices and the competitiveness of over 80 countries. Certified Sustainability Assurance Practitioner Program –

PAGE 6 : Corporate Philanthropy Resource Guide

Developed jointly by AccountAbility and IRCA, CSAP is the first internationally-recognised professional qualification in the field of sustainability assurance.
Research areas

Collaborative governance Strategic community investment Responsible competitiveness Supply chain management Climate change and low-carbon innovation Water management In-house research team. Also collaborates with leading edge CR organisations, consultancies, academic institutions and others on research projects. AccountAbility is the only organisation in the CR and sustainable development field to offer research, standards, and services – all ―under one roof.‖ Global leadership in CR research and innovation, wide global network of corporate citizenship experts and sole patent holder of corporate accountability standards. New CEO as of May 2010 New Regional Heads appointed for Latin America, and MidEast Africa New York office opened in April 2010 Climate Competitiveness Index 2010 – research report on how countries are making progress towards a low-carbon, resourceefficient Green Economy.

Differentiating features of organization Competitive advantages

Recent news / developments

CONTACT Point of contact

London: Elizabeth Upton -- Elizabeth@accountability.org, +44 (0) 20 7549 0400 New York:: Lori Parks – Lori@accountability.org +1 646-495-1624

PAGE 7 : Corporate Philanthropy Resource Guide

APCO Worldwide
www.apcoworldwide.com

OVERVIEW Mission

APCO‘s mission is to be the corporate affairs and communication partner of choice for our clients and the employer of choice in our industry. We are committed to using our strengths in research, analysis, strategy and communication to increase understanding of complex issues that affect our societies. We do this by living up to our values in everything we do. As a company, and as professionals, we value integrity, honesty, transparency, mutual respect, accountability, cultural differences, employee growth and continuous learning. Our values transcend geographical boundaries and are embraced in every APCO office. We hold ourselves accountable to our employees, clients, shareholders and the societies in which we do business, and we aim to measure ourselves against best practice standards of responsible business that go beyond legal compliance. In addition, we strive to raise the bar of best practice where we work and in everything we do. Global Communication Consultancy 1984 Washington, D.C. Offices in major media and financial capitals throughout the Americas, Europe, the Middle East, Africa and Asia Margery Kraus, Founder & CEO 550 employees 29 locations throughout the Americas, Europe, the Middle East, Africa and Asia APCO leverages international expertise to provide customized solutions to meet the needs of multinational clients and addresses clients‘ issues from an integrated communication and public affairs perspective. Clients include corporations, governments, industry associations and nonprofit organizations. Our clients include seven of the top 10 companies on Fortune‘s Global 500.

Type of organization Year of origin Headquarters location International scope Senior leadership Number of employees

Target audience

SERVICES Services and programs

At APCO Worldwide we organize our talents and tools to meet client needs, not the other way around. Clients come to us because we offer truly integrated services. We work to develop a custom approach to any challenge or opportunity our clients may face in the realms of business, public opinion and government. APCO‘s services include:

PAGE 8 : Corporate Philanthropy Resource Guide

Business, Industry & Finance: Branding & Positioning Corporate Advisory & Market Entry Executive & Board Communication Financial Communication Internal Communication Marketing Communication SM Product Launch Navigator – APCO Pathfinder Media & Public Opinion: Community Relations SM Corporate Responsibility – CR3G ® Creative Services – StudioAPCO SM Crisis Management – Crisis360 Issues Management Litigation Communication Media Relations & Spokesperson Training ® Online Communication – APCO Online ® Opinion Research – APCO Insight ® Social Media – APCO Online Stakeholder Mapping & Engagement Strategic Philanthropy Government & Public Policy: Ally Development & Coalition Building Antitrust & Competition Business Diplomacy Government Relations Policy Research & Analysis Trade & Investment Policy http://www.apcoworldwide.com/content/services/index.aspx SM Global Political Strategies (GPS), an executive service of APCO Worldwide, brings together an international team of experienced diplomats, policy advisors and business people to provide some of the world‘s most dynamic organizations with the strategic insight and forward-looking counsel they need to properly understand what‘s next in their world. In short, it is a personal foreign affairs department with experience drawn from developed and emerging markets around the world. GPS specializes in: political intelligence, risk assessment and problem solving market entry and establishment government systems for defense and security, communication and public-service reform government relations and coalition building regulatory and treaty development trade and investment policy competition and antitrust issues global positioning and reputation management policy-making processes in key capitals and international organizations GPS works with clients‘ C-suite executives – those who are

Other services

PAGE 9 : Corporate Philanthropy Resource Guide

Research areas

Differentiating features of organization

thinking through, shaping and setting the strategic goals of the organization – to help navigate the future. Business Diplomacy A study conducted by APCO Worldwide (APCO) highlights the American public‘s lofty expectations for businesses abroad. The Global Business Diplomacy Study reveals a consensus that business success brings with it an increased responsibility to address global challenges. The study findings demonstrate the American public‘s belief that global expansion necessitates a greater emphasis on corporate responsibility, a renewed focus on environmental and human rights and an expectation that companies strive to be valued corporate citizens in the markets hosting their operations. In fact, on a wide range of these challenging topics, the American public expects more from business than from the U.S. government. http://www.apcoworldwide.com/content/pdfs/Business_Diplomacy _Study2006.pdf Corporate Responsibility A survey conducted by APCO Worldwide shows the people most likely to be listening are receptive and responsive to proactive corporate social responsibility (CSR) communication and this communication directly impacts behavior. The Global CSR Survey sheds new light on the perceived value of CSR communication, the role key stakeholders play in influencing and working with companies on CSR and how CS communication impacts consumer and investment behavior. http://www.apcoworldwide.com/content/PDFs/Global_CSR_Study.p df Return on Reputation Indicator: State of the Retail Industry. APCO Worldwide created a groundbreaking research-based management tool called Return on Reputation Indicator that takes a broader, more holistic, 360-degree view of reputation. The State of the Retail Industry study provides deep insight into the key issues and expectations that define the retail industry's reputation, the key strengths and opportunities for enhancing reputation, and how reputation can shape the operating environment and drive business outcomes. Client service not only drives us, it defines us. At APCO Worldwide, we address clients‘ interests and objectives through communication and public affairs consulting that combines a global perspective with local expertise to understand the issues, events and trends that impact businesses and organizations around the world. Clients value our ability to help them navigate the complex and often converging worlds of business, industry and finance; media, public opinion and society; and government and public policy. APCO helps clients anticipate what‘s next and smartly manage reputational, communication and business opportunities and challenges that affect their organizations, products, services or brands. Our diverse and hands-on global team of over 550 experts comes from the environments clients need to reach – we are former elected leaders, journalists, ambassadors, business and nonprofit executives, government officials, market researchers, and communication and Internet experts. APCO creates and implements strategic and tailored

PAGE 10 : Corporate Philanthropy Resource Guide

solutions to advance clients‘ objectives. International Advisory Council APCO Worldwide's International Advisory Council (IAC) comprises more than 40 recognized global leaders, including former elected politicians, leaders of business and industry, academics at leading universities, world-class journalists and editors, NGO and nonprofit pioneers, diplomats and policy experts. All are top consultants with invaluable real-world knowledge, individuals who understand the complex issues clients face because they have encountered them – and successfully conquered them – in their own careers. APCO Launches Reputation-Management Tool to Measure Impact of Reputation on Key Business Outcomes (July 7, 2010) http://www.apcoworldwide.com/content/news/press_releases2010 /ror_indicator0707.aspx APCO Launches Corporate Responsibility Blog Shared Purpose (April 30, 2010) http://sharedpurpose.virtualvantagepoints.com/ APCO Strengthens Support for Clinton Global Initiative at 2009 Meeting (September 25, 2009) http://www.apcoworldwide.com/content/news/press_releases2009 /apco_cgi0909.aspx
CONTACT Point of contact

Recent news / developments

Ellen Mignoni Senior Vice President Washington, D.C. 202-778-1000 (Office) 202-466-6002 (Office Fax) emignoni@apcoworldwide.com Tara Greco Vice President Washington, D.C. 202-778-1000 (Office) 202-466-6002 (Office Fax) tgreco@apcoworldwide.com Visit our blog www.shared-purpose.com. Shared Purpose is a forum to think about, discuss, and predict what‘s next for business and society.

PAGE 11 : Corporate Philanthropy Resource Guide

Bridgespan
www.bridgespangroup.org

OVERVIEW Mission

Bridgespan works to build a better world by strengthening the ability of nonprofit organizations to achieve breakthrough results in addressing society‘s most important challenges and opportunities. Nonprofit 501(c)(3) organization, Consultant 2000 Boston, Massachusetts Offices in New York and San Francisco. Thomas J. Tierney, Chairman and Co-founder Jeffrey L. Bradach, Managing Partner and Co-founder Board of Trustees and Advisory Board Note: Bridgespan was founded under auspices of Bain & Company, Inc. 175 Nonprofits and foundations; philanthropists, in-sector professionals, and business executives interested in moving to mission-centric roles.

Type of organization Year of origin Headquarters location Senior leadership

Number of employees Target audience

SERVICES Services and programs

Other services

Research areas

Consulting Work centers around framing key questions, bringing data and analysis to bear on those questions, facilitating values-based discussion about important strategic and organizational choices, and laying out an implementation plan that encompasses the economic and organizational implications of the plan. Focus on working with organizations addressing issues of disadvantaged populations, environmental degradation, and civic engagement; also, foundations. Knowledge initiatives Learning and sharing what works, prompting new thinking about and tools for strategy and management, distributing insights via media, website, publications, working sessions, speaking engagements, symposia, and collaborations. Bridgestar Seeks to help nonprofits attract, connect, and develop strong leadership teams to strengthen overall performance of the sector. Services include job board; talent-matching advisory and search; ability to learn about board service and create or connect to openings; robust knowledge base, including Leadership Matters newsletter; role/function-based portals; opportunities to share ideas and insights with peers; learning events. Case studies, articles and papers in leading publications, and newsletters relating to issues of nonprofit strategy, capital, and

PAGE 12 : Corporate Philanthropy Resource Guide

Differentiating features of organization

Recent news / developments
CONTACT

talent. Access to leading-edge management thinking and tools from Bain & Company; ―bridger‖ (moving from private to public sector) focus of Bridgestar offers hiring organizations access to new pools of talent from which to recruit leaders. New York office opened June 2007.

Point of contact

Jeffrey L. Bradach, Managing Partner and Co-founder 617 572-2833 Jeff.bradach@bridgespan.org

PAGE 13 : Corporate Philanthropy Resource Guide

The Catchpole Corporation
www.catchpole.com

OVERVIEW Mission

Type of organization Year of origin Headquarters location International scope

The Catchpole Corporation is the global leader in executive and corporate visibility strategies for companies in all markets. We provide counsel regarding organizations and forums with which companies can engage regionally, nationally, and/or worldwide. Public relations consultant 1987 Wellesley, Massachusetts Catchpole regularly manages client executive visibility programs on a global scale and researches organizations/events in all geographic regions worldwide Terry Catchpole, Chairman and CEO Amy Scarlino, President and COO Companies of all sizes and in all markets

Senior leadership Target audience

SERVICES Services and programs

Other services

Executive Visibility Program: Designed for companies eager to enhance the stature of their company and its executives through strategic organizational affiliations and speaking engagements. Objective is to elevate company and leadership brands, as well as to enhance a firm‘s thought leadership as regards sustainable business practices and its global corporate social responsibility (CSR) role. Corporate Visibility Program: Designed for companies eager to mount an aggressive speaker program as an extension of their overall marketing communications initiative. Objective is to implement an allinclusive, custom-crafted program that includes event research and targeting; agenda development tracking; topic abstract content development; speaker proposal submission; securing quality engagements; and engagement logistic tracking. Speakware Executive Online Research Service Designed for corporate communications professionals to use in managing executive visibility speaking programs for their c-level executives, as well as in identifying nongovernment organization partners for sustainability/CSR initiatives. The service includes in-depth profiles of more than 400 organizations and forums, from regional entities such as the Detroit Economic Club to global leadership programs such as those hosted by the World Economic Forum.

PAGE 14 : Corporate Philanthropy Resource Guide

Speakware Event Research Service Designed for companies that want a comprehensive event research resource as a key component of their corporate speaker program. The service includes access to top-line information on approximately 2500 global events in more than 100 market categories. Speakware Custom Event Research Service Designed for companies that want thorough, detailed information on the most important events that draw their target audiences. The service includes a custom event collection that maps directly to a subscriber companies‘ business objectives, prepared on an exclusive basis by Catchpole event experts. Speakware Events News Alert Designed for companies that need continual updates on events in their key markets. The service includes updates of critical event deadline information, as well as call for papers URLs.
Differentiating features of organization

Competitive advantages

Catchpole is the only global agency that focuses exclusively on executive and corporate visibility speaking programs, counseling client companies on the most effective strategies as regards organizational affiliation and speaking forum participation. Catchpole understands the dynamics that drive a successful speaker program and has an outstanding track record of producing results that advance client companies‘ business objectives. Catchpole has developed superb working relationships with conference managers, based upon our understanding of the unique makeup of each conference and what is needed to add value to the agenda development process in terms of quality speakers and topics. Through its grasp of the essentials in a successful corporate speaker program and a successful conference agenda, Catchpole is able to leverage clients‘ thought leadership resources and deliver quality speakers and compelling topics to conference mangers, adding value to their agenda and establishing a mutually beneficial partnership with positive outcomes for all parties.

CONTACT Point of contact

Terry Catchpole terry@catchpole.com 781.489.6114

PAGE 15 : Corporate Philanthropy Resource Guide

Cause Consulting
www.causeconsulting.com

OVERVIEW Mission

Type of organization Year of origin Headquarters location International scope Senior leadership Number of employees

Cause Consulting integrates corporate citizenship, philanthropy, marketing, and business disciplines to help companies meet a range of business and social objectives. We work with Fortune 500 companies to help them simultaneously strengthen business and impact society. Business and Corporate Citizenship Strategy Firm 2005 Boston We design and execute programs for our US-based international clients in Europe, Asia and Latin America.. Mark Feldman, Principal and Managing Director Nikki Korn, Principal Five senior full-time employees supported by a network of specialists

SERVICES Services and programs

Corporate Citizenship/Strategic Philanthropy Strategy We guide clients on their citizenship journeys and provide counsel on a range of issues including philanthropy, environmental sustainability, employee practices, supply chain, and governance. Signature Program Development and Enhancement We create citizenship, strategic philanthropy, community relations, employee volunteerism, cause-related marketing, and sponsorship programs. We develop proprietary, branded initiatives and identify ownable issues and partnerships. Positioning, Branding, and Marketing/Communications We brand, package, and communicate citizenship programs in compelling ways. We develop and implement integrated marketing and communications plans for internal and external audiences. Stakeholder Engagement We use the power of citizenship programs to strengthen relationships with key stakeholders. We map and prioritize audiences, facilitate communications, forge alliances, create volunteer initiatives, and track results.

Differentiating features of organization

Cause Consulting is a team of seasoned, senior professionals. We are driven by our values: curious, courageous and caring. We bring social innovation to program development and execution enabling clients to scale for real and lasting impact. We partner with our clients to create and grow acclaimed

PAGE 16 : Corporate Philanthropy Resource Guide

programs such as: o Adobe Youth Voices o AMD Changing the Game o ARAMARK Building Community o Fidelity Future Stage o Samuel Adams Brewing the American Dream
Recent news / developments

Cause Consulting ranks #3 among corporate responsibility firms by Corporate Responsibility magazine http://www.thecro.com/files/CRTOP10.pdf. Our client, the Boston Beer Company, won the 2010 CECP Excellence Award in Corporate Philanthropy for its Samuel Adams Brewing the American Dream program.

CONTACT Point of contact

Mark Feldman 268 Newbury Street Boston, MA 02116 mfeldman@causeconsulting.com Tel.: 617.266.0700

PAGE 17 : Corporate Philanthropy Resource Guide

The Center for Effective Philanthropy (CEP)
www.effectivephilanthropy.org

OVERVIEW Mission

Type of organization Year of origin Headquarters location Senior leadership Number of employees Target audience Size of membership / network

The mission of the Center for Effective Philanthropy (CEP) is to provide data and create insight so philanthropic funders can better define, assess, and improve their effectiveness and impact Nonprofit research and educational organization 2001 Cambridge, Massachusetts Phil Buchanan, President Stephen Heintz, Chair of Board 30 on staff Foundation CEOs, trustees, senior executives, and program staff CEP focuses on the largest private, community, and corporate foundations in the US and abroad. To date, more than 200 foundations have used CEP‘s assessment tools. None; CEP is funded through mix of foundation grant funding and earned revenue from assessment tools and programming.

Membership fee, if applicable

SERVICES Services and programs

CEP offers research, assessment tools, and programming to improve foundation effectiveness. CEP‘s research and programming focuses on funder-grantee relationships, developing strategy, assessing performance, optimizing governance, and managing operations. Assessment tools include: ® 1. The Grantee Perception Report (GPR)
Provides comparative data on grantee perceptions of foundation performance on a variety of dimensions

2. The Applicant Perception Report
Companion to the GPR, which provides comparative data from surveys of declined applicants

3. The Comparative Board Report (CBR)
The only board self-assessment tool that includes comparative data gathered through large-scale research on foundation boards

4. The Staff Perception Report (SPR)
Explores foundation staff members‘ perceptions of foundation effectiveness and hob satisfaction on a comparative basis

5. The Donor Perception Report (DPR)
Explores, on a comparative basis, donors‘ perceptions of the community foundations to which they contribute

6. The Stakeholder Perception Report (STAR)
Generates insights about foundation performance based on the perceptions of stakeholders a foundation may seek to influence as part of its strategy—including peer foundations, elected officials, and the media

PAGE 18 : Corporate Philanthropy Resource Guide

7. Beneficiary Perception Report (BPR)
Provides feedback and insights from a funder‘s ultimate beneficiaries—the people whose lives it seeks to affect

8. The Operational Benchmarking Report (OBR)
Provides comparative data, relative to a selected group of foundations, on aspects of foundation operations

9. The Multidimensional Assessment Process
Provides foundations with an integrated assessment of performance based on comparative data from a variety of sources, including grantees, declined applicants, foundation staff, and foundation board members Other services

Research areas

Case studies and research issue papers; Bi-annual national conferences and regional seminars, webinars; Online Strategy SelfAssessment Initiatives related to foundation effectiveness, including fundergrantee relationships, developing strategy, assessing performance, optimizing governance, and managing operations. CEP is the only organization developing comparative data to enable higher-performing foundations. CEP‘s large-scale, comparative data sets on various aspects of foundation performance inform research and assessment tools that help foundations to increase their effectiveness.

Differentiating features of organization Competitive advantages

CONTACT Point of contact

Alyse d‘Amico; alysed@effectivephilanthropy.org Vice President, Programming, Communications and Development 617-492-0800, ext. 206

PAGE 19 : Corporate Philanthropy Resource Guide

Ceres
www.ceres.org

OVERVIEW Mission Type of organization

Year of origin Headquarters location International scope

Integrating sustainability into capital markets for the health of the planet and its people. 501 (c) (3) Non-Profit organization focused on tackling large scale sustainability challenges with a disposition towards environmentally focused issues 1989 Boston, Massachusetts Collaboration with the European based Institutional Investors Group on Climate Change (IIGCC) to organize the bi-annual Investor Summit on Climate Risk President: Mindy S. Lubber JD, MBA Director of Electric Power Programs: Dan Bakal Senior Director of Corporate Programs: Andrea Moffat Co-Director of Policy Program: Chris Fox Director of Investor Programs: Christopher P. Davis Co-Director of Policy Program: Anne Kelly Director of Oil & Insurance Programs: Andrew Logan Board Member: Jack Ehnes, CEO CalSTRS Board Member: Anne Stausboll, CEO CalPERS 50 Environmentalists, investors, policy makers, corporate leaders, shareholders, employees, consumers and sustainability advocates Ceres is Compromised of 3 Core Networks: The Investor Network on Climate Risk (INCR) which is comprised of asset managers and investors whose assets combine to nearly $10 trillion dollars The Ceres Coalition which includes 70 NGOs and 80 institutional investors The Ceres Company Network which is comprised of 80 corporations, 30 of whom are in the Fortune 500

Senior leadership

Number of employees Target audience Size of membership / network

SERVICES Services and programs

The Ceres Coalition promotes sustainability by influencing companies and the capital markets to incorporate environmental and social challenges into their decision-making by bridging the voice of stakeholders to corporate leaders Ceres companies are able to achieve competitive advantages by integrating environmental and social performance into their business strategies. They understand that environmental and social issues pose potential risks for their businesses and are committed to addressing them. The Ceres Industry sector brings investors and environmental experts together to work with companies and industries on solutions to a range of environmental problems. Ceres is

PAGE 20 : Corporate Philanthropy Resource Guide

coordinating dialogues on climate change in the electric power sector, working with oil companies to protect biodiversity and address climate change, supporting regional efforts to address climate change in the Northeast U.S. and Canada, and working with the insurance sector to adequately assess environmental risks.
Other services Research areas

Business for Innovative Climate & Energy Policy (BICEP) Investor Network on Climate Risk (INCR) Energy use Water scarcity Natural resource use Global Climate change Corporate and market risk exposure The Ceres coalition of investors, environmentalists, and other public interest groups is the largest of its kind in North America. The coalition promotes sustainability by influencing companies and capital markets to incorporate environmental and social challenges into their decision-making. By leveraging the collective power of investors and other key stakeholders, Ceres has achieved dramatic results Recipient of numerous awards including the 2006 Skoll Award for Social Entrepreneurship and the Fast Company/Monitor Group Social Capitalist award, and was named one of the 100 most influential players in the corporate governance movement by Directorship Magazine. Launched the Global Reporting Initiative (GRI), now the de-facto international standard used by over 1,300 companies for corporate reporting on environmental, social and economic performance Co-host of the bi-annual Investor Summit on Climate Risk that brings together hundreds of investors and corporate leaders from around the world with over $22 trillion in combined assets. Participants discuss with leading policymakers, investors, and business leaders on how to manage the risks and seize the economic opportunities presented by climate change Publication of the 21 Century Electric Utility report which st identifies key elements of a 21 century electric utility business model and makes specific recommendations to utilities as they transition to a low-carbon future st Publication of the 21 Century Corporation report that serves as a vision and practical guide for integrating sustainability into the DNA of business. The report analyzes the drivers, risks and opportunities involved in making the shift to sustainability, and details strategies and results from companies who are taking on these challenges Publication of the Oil Sands Report which examines the environmental and social risks associated with development of the Canadian Oil Sands
st

Differentiating features of organization

Recent news / developments

CONTACT Point of contact

Jessica Halverson, Senior Manager, Development halverson@ceres.org

PAGE 21 : Corporate Philanthropy Resource Guide

Changing Our World, Inc.
www.changingourworld.com

OVERVIEW Mission

Type of organization Year of origin Headquarters location

Changing Our World is a trusted philanthropy and fundraising consulting firm that provides expertise and individualized solutions, helping nonprofits create strong relationships with donors and enabling grantmakers and corporations to invest their resources wisely. Consultancy 1999 New York, NY Regional offices: Atlanta, Boston, Dallas, Los Angeles, Sarasota and D.C. Office in London, UK Mike Hoffman, Chairman & CEO Chris Watson, President 100+ Corporations, nonprofits, foundations, and philanthropists

International scope Senior leadership Number of employees Target audience

SERVICES Services and programs

We are comprised of three areas of practice: Corporate Social Engagement Help corporate clients plan and implement focused and strategic community involvement programs designed to create sustainable impacts no matter what the social cause area – we are experts in translating business strategy into social change. Fundraising Offer full-service fundraising consulting to nonprofit organizations, specializing in capital campaigns, feasibility studies, strategic planning and other major gift efforts. Interactive Services Create and execute successful online strategies that raise money and build communities by integrating social media, digital storytelling, email marketing, and website development for nonprofit organizations.

Other services

Research areas

Corporate Social Engagement services include strategic planning, program design & implementation, employee engagement & volunteerism, cause-related marketing, nonprofit partnership development, measurement and grants management. Benchmarking and best practices; data analysis for all economic and social sectors and philanthropy types; in-depth economic, social, and philanthropic trend forecasting and analysis generated in renowned research department led by Dr. Susan Raymond

PAGE 22 : Corporate Philanthropy Resource Guide

Differentiating features of organization

Competitive advantages

In providing consulting services both to nonprofits and to philanthropies, Changing Our World brings an unparalleled perspective of the sector to each of our client engagements – a perspective that enables the firm to offer organizations of all sizes the strategy and expertise they need to succeed. Changing Our World consultants keenly understand both planning and implementation. Members of the Corporate Social Engagement group are skilled at creating practical plans, crafting tactics for implementation, and serving as partners in that implementation. Additionally, as a member of Omnicom Group [NYSE: OMC], the world's largest and most diversified communications company, Changing Our World can access communications, public relations, and branding expertise to assist its clients in taking their fundraising and philanthropic initiatives successfully into broader public realms.

CONTACT Point of contact

Cori Cunningham, Senior Managing Director 646.264.2666, ccunningham@changingourworld.com 220 East 42 Street, 5 Floor New York, NY 10017
nd th

PAGE 23 : Corporate Philanthropy Resource Guide

CAFAmerica
www.cafamerica.org

OVERVIEW Mission

Charities Aid Foundation America (CAFAmerica) works to change the culture of giving by making it safe, easy and effective for everyone to give globally. Our mission is to help US donors make strategic and focused philanthropic decisions which have a lasting impact on the needs of the global communities they support. CAFAmerica‘s solutions eliminate barriers to global giving and facilitate tax effective, cross-border gifts. Through safe and secure international grant making and expert advice and analysis about foreign nonprofits and societal issues, we are your first choice for international giving. Facilitate and support US donations to international charities; CAFAmerica is a US 501(c)3 nonprofit 1992 Alexandria, VA Foreign nonprofit organizations representing any issue located anywhere in the world that CAFAmerica is legally able to make grants. Since 2001, CAFAmerica has granted over $150 million in over 75 countries. CAFAmerica is a member of the CAF International Network, which spans six continents, with partner offices in the United Kingdom, Australia, Bulgaria, India, Russia, South Africa, and Brazil. Susan Saxon-Harrold, CEO Janet C. Boyd, Board President 10 at CAFAmerica; over 500 in CAF International Network US-based donors (corporations, foundations, individuals and families) interested in making tax efficient donations to foreign nonprofits – including due diligence and grantmaking.

Type of organization Year of origin Headquarters location International scope

Senior leadership Number of employees Target audience

SERVICES Services and programs

We enable Americans to give safely, knowledgeably and securely overseas through a variety of solutions, and offer international grant making and advisory services: Donor Advised Fund (DAF) -- A convenient and simple way to tax effectively support and manage global philanthropic initiatives and programs. The DAF is designed to support ongoing, high volume philanthropic programs which require fund management services. Matching Donor Advised Fund (MDAF) -- Designed to support corporate international programs. The MDAF provides the flexibility to manage an international matched giving program of any type or size. It simultaneously ensures that employees are empowered to

PAGE 24 : Corporate Philanthropy Resource Guide

invest in the philanthropic causes closest to them with the confidence of full support from their employer, and strengthens a company‘s image. By establishing a MDAF at CAFAmerica, corporations can tax effectively support the international philanthropic goals of their employees, matching employee contributions and/or volunteer time. Single Donor Advised Gift (DAG) -- Single gifts allow donors to make a smaller number of grants, on a schedule or as desired, and are a great resource for companies to support a variety of causes. Donors can make tax effective single contributions to CAFAmerica and recommend that grants be made to foreign nonprofits. CAFAmerica can also recommend a nonprofit that fits a donor‘s interests and philanthropic goals. Research and Advisory Services -- CAFAmerica provides expert advice and analysis about foreign nonprofits, societal/regional issues, and global giving strategies. From examining the feasibility of a giving strategy in a particular region to identifying potential nonprofit recipients, from coordinating global cross-border giving to managing programs on the ground, research and advisory services are the first step to an effective and comprehensive global philanthropic program. ‘Friends of’ Charity Fund -- With this Fund, foreign nonprofits can launch and maintain a US fundraising appeal and accept tax deductible donations of any size from any US donors. Establishing a ‗Friends of‘ Charity Fund on behalf of a foreign nonprofit is a great way to put them on the right path to a sustainable, long-term US fundraising program. Global philanthropic issues, legal and tax infrastructure related to international philanthropy CAFAmerica‘s global giving solutions complement a corporation‘s domestic charitable giving by providing the international component to its grantmaking: Solutions for global growth -- CAFAmerica‘s solutions are particularly suited to US corporations with growing overseas presence that require an international giving or employee matching strategy. Relieves administrative burden -- Our staff carries out the foreign nonprofit due diligence, processing, reconciliation and distribution of donations, as well as provides monthly status reports. Secure grant making -- CAFAmerica‘s due diligence and general review process ensures the highest level of safety and ―risk-based‖ grant making. Flexible grant making -- Contributions can be made to any charitable organization working on any issue in the world where it is legally feasible under US laws and regulations. The CAFAmerica DAF & MDAF allow for contributions of any size at any time, making contributing convenient for corporations and their employees. Convenient and seamless service -- We help corporations achieve their vision with a suite of global giving solutions

Research areas Differentiating features of organization

PAGE 25 : Corporate Philanthropy Resource Guide

designed to meet their needs at competitive prices. Responsible, knowledgeable and responsive staff -- Our staff responds quickly and draws on many years of collective experience to fulfill grant making needs. International presence -- Donors receive access to trusted expertise via the regional CAF offices and a group of international consultants.
Recent news / developments

Website: www.cafamerica.org CAFAmerica issue briefs now available on our website under ―Resources-Publications‖ (ex: HIV/AIDS, Empowering Women)

CONTACT Point of contact

Denise Simpson, Director of Donor Advised Giving denise@cafamerica.org p. 703-549-8931

PAGE 26 : Corporate Philanthropy Resource Guide

Comunitas
www.comunitas.org.br www.bisc.org.br

OVERVIEW Mission

Type of organization Year of origin Headquarters location International scope Senior leadership Number of employees Size of membership / network Membership fee, if applicable

Comunitas is a civil society organization which works for the advancement and strengthening of democracy and civil society in contemporary Brazil. Developing new dynamics of social participation, encouraging innovative projects and putting them in practice with the help of various social agents – such are the scopes of Comunitas, which also provides advice for companies and civil institutions. Not for Profit 1995 São Paulo – Brazil Partner of CECP Renata de Camargo Nascimento 4 21 of the largest Brazilian enterprises

SERVICES Services and programs

The BISC (Corporate Social Investment Benchmark) is the main project developed by the organization, which is released annually. Comunitas also promotes an annual meeting with the partner CEOs. Strengthen the Social Responsibility dialogue among the most relevant leaders in Brazil, thought the establishment of Best Practices and Advocacy Committees. Corporate Social Responsibility The intersectoral approach

Other services

Research areas Differentiating features of organization Competitive advantages Recent news / developments Other information

CONTACT Point of contact

Helena Hypólito (helena@comunitas.org.br)

PAGE 27 : Corporate Philanthropy Resource Guide

Cone
www.coneinc.com

OVERVIEW Mission

Cone is an award-winning strategy and communications agency.
Our goal is to develop innovative programs that respond to the needs and passions of consumers. We help build and communicate authentic, credible and relevant brands to engage stakeholders, build awareness, enhance reputation and drive customer loyalty and trust. Strategy and communications agency 1980 Boston, Massachusetts Jens Bang, Chief Executive Officer Bill Fleishman, President 95 employees Fortune 500 corporations and national nonprofits Member of the Omnicom Group

Type of organization Year of origin Headquarters location Senior leadership Number of employees Target audience Size of membership / network

SERVICES Services and programs

Other services

Research areas

Cause Branding Strategic philanthropy, cause branding and promotions, employee volunteerism, public-private partnerships Corporate Responsibility CR strategy, stakeholder engagement, CR communications, CR reporting Nonprofit Marketing Brand strategy and positioning, partnership assessment, fundraising and awareness campaigns, organizational development Brand Marketing New product launches, product revitalizations, special events, influencer outreach, new media Crisis Prevention & Management Risk assessment, risk management, issue research, monitoring and analysis, crisis preparedness plans, drills and trainings Media Services Messaging, media trainings and strategic media relations New Media New media strategies and programs Creative Brand identity, collateral, web design, packaging, logos, video Tracking industry trends and ongoing research on consumer,

PAGE 28 : Corporate Philanthropy Resource Guide

Differentiating features of organization Competitive advantages

employee and corporate attitudes towards companies' and nonprofits‘ involvement with social and environmental issues; nonprofit branding; new media trends Unique combination of five core competencies that help organizations create stakeholder loyalty and long-term relationships Cone is a mid-sized agency with a blue-chip roster. Clients receive the intimacy of a mid-sized agency, which means ongoing, frequent access to senior staff, while enjoying the bench strength of the largest agencies, which means access to seasoned practitioners with decades of experience in varied industries on both the agency and client side. Cone released its 2010 Shared Responsibility Study and POV which highlights the intersection of Cause Branding and Corporate Responsibility as the future of responsible business. Cone formally launched its Nonprofit Marketing discipline with services designed to help nonprofits strengthen their brands and drive awareness and funds.

Recent news / developments

CONTACT Point of contact

Jens Bang CEO 617-939-8324 jbang@coneinc.com

PAGE 29 : Corporate Philanthropy Resource Guide

E-Philanthropy Solutions Inc.
www.ephilanthropy-solutions.com

EPS

OVERVIEW Mission

Type of organization Year of origin Headquarters location International scope Senior leadership Number of employees Target audience

E-Philanthropy Solutions Inc. conducts design and implementation of strategic technology and business processes, enabling grantmakers to maximize time available for their core mission: strategic philanthropy Consulting Firm 2001 Ossining, NY Yes Kieran Murray President 3 Large Corporations and Private Foundations

SERVICES Services and programs

Other services

Strategic Technology: Project Management Technology Assessments Requirements Development Business Case Development Data Modeling Data Conversion Database Design System Design Systems Integration Implementation Assistance Web Design Business Process: Business Process Design Process Re-Engineering Needs Assessments Requirements Development Organizational Design Communication Strategies Audit and Tax Compliance Outsourcing Training Program Strategy Development

PAGE 30 : Corporate Philanthropy Resource Guide

Research areas Differentiating features of organization Recent news / developments

Web 2.0, Grants Management Process Engineering 21 years of extensive technology and business process design and development experience, and 13 years of Foundation and Corporate Philanthropy management experience. E-Philanthropy Solutions is the only technology consulting firm in the philanthropic space to have implemented and\or evaluated all of the major grants, volunteerism and scholarship management software\solutions providers offerings in the past 2 years for actual clients. E-Philanthropy Solutions is and has always been committed to providing fair and non bias counsel to its clients.

CONTACT Point of contact

Kieran Murray – President (914) 945-0200 kmurray@ephilanthropy-solutions.com

PAGE 31 : Corporate Philanthropy Resource Guide

Entrepreneurs Foundation
www.efnational.org

OVERVIEW Mission

Type of organization Year of origin Headquarters location International scope Senior leadership Number of employees Target audience Size of membership / network Membership fee, if applicable

To engage companies in corporate citizenship and philanthropic efforts so that new and leveraged resources are generated for community benefit. Non profit consultancy 1998 Silicon Valley US, Israel, Canada Diane Solinger, Executive Director 15+ Companies of all sizes, Corporate citizenship professionals 550 companies, 350 venture capitalists Fee for service or equity based

SERVICES Services and programs

Entrepreneurs Foundation (EF) is a nonprofit consulting firm providing strategic advisory services, tactical support and outsourced staffing for the creation, implementation or enhancement of corporate citizenship programs. Over 880 companies have engaged with EF in the creation and development of their citizenship programs. EF is available for a variety of services including: Develop, create and enhance corporate strategy and mission for philanthropy, citizenship and community involvement programs. Develop corporate infrastructure, policies, framework and procedures to support overall programs. Provide benchmarking and trends along with studies and best practices on citizenship and CSR Create guidelines and focus areas for corporate and employee giving programs Offer expertise, secure and coordinate employee volunteer programs, skilled volunteering programs, including non-profit board matching programs Offer and implement framework for in-kind and product donation program development

PAGE 32 : Corporate Philanthropy Resource Guide

Other services

Research areas Differentiating features of organization

Develop marketing programs for internal and external audiences that tie back to corporate strategy and greater marketing Companies can utilize EF to fully outsource all corporate philanthropic and community involvement programs from project based work to staffing for companies of any size. Corporate Citizenship Trends
EF works with companies of all sizes to provide strategic and tactical support as they develop, enhance and/or create their citizenship efforts. Being engaged with EF provides companies access to a network of corporate citizenship professionals, numerous learning opportunities while also helping companies to navigate the overall citizenship landscape As EF has worked with companies at all stages of development we are able to create a customized offering that fits the culture of each company. Furthermore, we have the resources available to help companies implement these programs on both a tactical and strategic level.

Competitive advantages

CONTACT Point of contact

Dipti Pratt, Marketing Director 650-575-2202 dpratt@efbayarea.org

PAGE 33 : Corporate Philanthropy Resource Guide

Fleishman-Hillard
www.fleishman.com

OVERVIEW Mission

Fleishman-Hillard delivers successful communications campaigns that deliver on performance impact and results. Public Relations, Public Affairs and Marketing Communications company 1946 St. Louis, Missouri 80 owned offices globally John D. Graham, Chairman David T. Senay, President and CEO
Note: Fleishman-Hillard is a wholly owned subsidiary of Omnicom Group, Inc.

Type of organization Year of origin Headquarters location International scope Senior leadership

SERVICES Services and programs

PR, Public Affairs and Marketing Communications services in broad range of 24 Practice Groups and 14 Specialty Areas. Services include: Media relations Messaging Reputation management Executive positioning Thought leadership Digital and social media Media training Program development in areas including: o Corporate philanthropy and foundation support o Cause marketing o Community engagement o Sustainability Signature Philanthropy Program Development Build reputation by creating a program that connects philanthropy, cause and/or community-based efforts into a comprehensive approach Program components include: o Developing focus for giving activities o Integrating internal and external outreach initiatives o Leveraging philanthropy to build positive corporate reputation o Reaching and leveraging stakeholders o Highlighting thought leadership Board Mapping Assessment tool identifies existing and potential strategic

Other services

PAGE 34 : Corporate Philanthropy Resource Guide

relationships with key influencers via not-for-profit and community boards Evaluation includes: o Analysis of current position o Evaluation of opportunity areas o Assessment of employees‘ understanding of bottom line and willingness to participate in initiatives o Identification of key issues and top interests o Aligning involvement with strategic targets Community Engagement Model Leverage community outreach activities to help build positive brand reputation Step-by-step process includes: o Aligning all corporate citizenship activities with business priorities o Showcasing community leadership o Prioritizing civic involvement o Strengthening ties with key influencers o Increasing executive visibility o Conducting proactive media outreach Charity Mapping A research-based, integrated approach to identifying and maximizing a strategic charity partnership Process includes: o Articulating the mission o Identifying objectives o Outlining screening criteria o Determining categories o Conducting research Innovation Sessions Ideation tool brought to you by FH Innovation, a practice group made up of more than 100 professionals worldwide Sessions are based on your needs and can help you:  Identify your brand‘s foundation and develop messaging and proof points  Develop a unique selling proposition  Create hundreds of relevant and actionable ideas  Learn to identify and manage ―unsolvable‖ business challenges  Mapping programs against internal and external stakeholders
Differentiating Features

Competitive Advantages

Commitment to client service Measuring impact on business goals Delivering results Global reach and coordination Ability to leverage and integrate new technologies Practice Group Approach Communications teams are selected from more than 30 different practice groups across all geographic regions Matches each professional‘s strengths against your needs

PAGE 35 : Corporate Philanthropy Resource Guide

Gives you access to the counsel of the most experienced practitioners in various industries, disciplines, and target audiences Sampling of practice groups includes: o Reputation management o Social impact marketing o Sustainability o Digital o Global aid o Internal communications o Innovation Global Reach and Coordination Network of more than 80 offices worldwide, Conducts business in more than 20 languages in 28 countries Member of Omnicom‘s family of more than 200 companies, which allows us to collaborate with advertising and specialty companies to solve client issues FH International Advisory Board Brings together an array of distinguished thought leaders from the private and public sectors Advisers offer strategic counsel internally and externally, and can be asked to: o Author op-ed pieces o Serve as guest speakers at events o Participate in planning meetings — in person, via video, or through calls to decision makers
Research areas

Competitive analysis and scoring Comprehensive evaluation and measurement Online access to articles, podcasts, case studies, blogs

CONTACT Point of contact

Lisa Claybon 312-751-3516 lisa.claybon@fleishman.com Marjorie Benzkofer 312-751-3513 Marjorie.benzkofer@fleishman.com

PAGE 36 : Corporate Philanthropy Resource Guide

The Foundation Center
www.foundationcenter.org

OVERVIEW Mission Type of Organization Year of origin Headquarters location Senior leadership Number of employees Target audience

The mission of the Foundation Center is to strengthen the nonprofit sector by advancing knowledge about U.S. philanthropy. Nonprofit philanthropy services consultancy 1956 New York, NY Field offices in Atlanta, Cleveland, Washington DC, San Francisco Brad Smith, President M. Christine DeVita, Chairman of the Board 131 Foundations, Nonprofit grantseekers Also serves researchers, policymakers, media, and the general public Approximately 550 foundations and corporations provide support.

Size of membership / network

SERVICES Services and programs

Foundation Directory Online Electronic database with information on nearly 100,000 currently active grantmakers and over 2 million grants Publisher Annually publishes dozens of directories, guides, research reports, and books on nonprofit management Library/Learning Centers Free access to print and electronic publications in 5 professionally-staffed Center locations rand in 450 funding information centers known as Cooperating Collections across the U.S. and internationally; Knowledgeable staff Training & Education Full curriculum of free and affordable classes—classroom and online—cover the funding research process, proposal writing, grantmakers and their giving, and related topics. Research Original research on foundations and their giving. FC Stats has thousands of data tables covering foundations and their giving Philanthropy News Digest Online daily news service, with RFPs, jobs, book reviews, and interviews with leaders in the field. Philanthropy In/Sight: Google Maps-based application combines Center data with an array of socio-economic indicators helps grantmakers plan the future direction of their programs

PAGE 37 : Corporate Philanthropy Resource Guide

Research areas

PubHub Searchable online collection of thousands of reports published by foundations and nonprofit organizations Glasspockets.org Web portal highlighting foundation transparency practices Funding trends reports provide the latest data available on every aspect of U.S. foundation philanthropy; special topic reports around specific areas of foundation funding and practice Over 50 years of service ―Most comprehensive database of U.S. grantmakers and their grants‖ Current President joined the Center in 2008 Priorities • Assume a leadership position on issues of transparency and accountability in the use of private wealth for public good. (glasspockets.org) • Produce knowledge about the ―what‖ of philanthropy in terms of its impact on the most critical issues facing society (foundationcenter.org/gainknowledge/research/ specialtrends.html) • Provide a more global view of philanthropy. (philanthropyinsight.org) • Provide affinity groups, regional associations of grantmakers, and donor collaboratives with the data infrastructure and services they need to be more strategic and increase their impact. (foundationcenter.org/educationexcellence/) • ―Level the playing field‖ by ensuring that under-resourced nonprofits are getting the training and information they need to access foundation grants. (foundationcenter.org/collections/) • Marshal the Foundation Center‘s diverse resources to help nonprofits and foundations respond to the global economic crisis. (foundationcenter.org/focus/economy/)

Differentiating features of organization Recent news / developments

CONTACT Point of contact

Cheryl Loe, Communications Project Manager (212) 620-4230 communications@foundationcenter.org

PAGE 38 : Corporate Philanthropy Resource Guide

FSG Social Impact Advisors
www.fsg-impact.org

OVERVIEW Mission

Type of organization Year of origin Headquarters location

FSG is a nonprofit consulting firm specializing in research, strategy and evaluation. We help corporation, foundations and nonprofits-individually and collectively--achieve greater social impact by working with them to develop more effective solutions to major social and environmental challenges. 501(c)(3) nonprofit organization 1999 Boston Offices in Geneva (Switzerland), San Francisco, Seattle, Washington DC FSG works globally with clients across the Americas, Europe and Asia Mark Kramer, Founder & Managing Director Michael Porter, Founder & Senior Advisor 70 Corporations, Foundations, Nonprofits, Governmental Organizations FSG has completed nearly 400 consulting engagements since inception and attracts over 40,000 unique website visitors annually.

International scope Senior leadership Number of employees Target audience Size of membership / network

SERVICES Services and programs

Discovering better ways to solve social problems by providing consulting services in Strategy, Evaluation, and Organizational change. FSG's Services include: -Strategy Consulting -Implementation -Research -Evaluation -Organizational Change -Coalition-Building FSG's areas of expertise include: -Corporations and Society/CSR -Community Philanthropy -Education & Youth -Environment -Evaluation -Global Development

Research areas

PAGE 39 : Corporate Philanthropy Resource Guide

Differentiating features of organization

Competitive advantages

Recent news / developments

-Global Health -Social Investing Dedication to creating shared value for corporations and society built on the work of co-founders Mark Kramer and Michael Porter of Harvard Business School. Seminal publications in Harvard Business Review, Stanford Social Innovation Review, and frequent cites in mainstream, academic and online media. Representative clients include the Bill & Melinda Gates Foundation, GE, Merck, Nestle, Pfizer, Shell, Target and UBS. FSG's team of consultants combines world class expertise in corporate strategy development with deep knowledge and on-theground experience in social issues. Opened office in Washington DC. Cosponsoring conferences with Stanford University on cross-sector collaboration and with Harvard University on agricultural development. Publications on Catalytic Philanthropy and Collective Impact. www.fsg-impact.org

CONTACT Point of contact

Eastern US: John Kania 617-357-4000 x111, john.kania@fsg-impact.org 20 Park Plaza Suite 320, Boston, MA 02116 Western US: Fay Hanleybrown 206-624-6745, fay.hanleybrown@fsg-impact.org 216 First Avenue South, Suite 460 Seattle, WA 98104 Europe: Marc Pfitzer +41-22-718-0300, Marc.Pfitzer@fsg-impact.org Rue de Chantepoulet 25 CH-1201 Geneva

PAGE 40 : Corporate Philanthropy Resource Guide

Global Business Network (GBN)
A member of the Monitor Group
www.gbn.com

OVERVIEW Mission

Type of organization Year of origin Headquarters location Senior leadership Number of employees Target audience

As the world's foremost scenario consultancy, Global Business Network (GBN), a member of Monitor, has collaborated with hundreds of the world's leading corporate, nonprofit, and governmental organizations to explore emerging uncertainties, understand rising risks and opportunities, innovate and develop robust, adaptive strategies for the future. Scenario and strategy consultancy 1987 San Francisco, CA Andrew Blau and Nick Turner, co-presidents
Note: GBN became a member of the Monitor Group in 2000

25 Organizations striving to master and manage uncertainty and shape the future: Global corporations across sectors; local, state, national, international government entities; non-profit and membership organizations; foundations and philanthropic organizations Network of more than 200 scenarists and thought leaders

Size of membership / network

SERVICES Services and programs

Other services

Consulting, research, and training services that uniquely apply the concepts of scenario thinking—long-view, outside-in, multiperspective—to critical business challenges in: Strategy Innovation Risk Visioning and alignment Organizational and leadership development Events
Periodic events, informal gatherings, and collaborative learning experiences that bring together strategists from the corporate, government and nonprofit sectors with provocative thinkers from a variety of disciplines to think about emerging issues, trends, risks, and opportunities

Access to GBN Network members
Clients have access to a diverse group of visionary and provocative thinkers ( "remarkable people") from science and technology, the arts, business, academia Research areas

Global uncertainties across disciplines; energy, climate change and green technologies; science and technology; media and

PAGE 41 : Corporate Philanthropy Resource Guide

Differentiating features of organization

Recent news / developments

communications; demographics; organizational development and leadership; innovation World-class reputation and expertise in scenario thinking and planning; complementary tools and methodologies for grappling with uncertainty; design of powerful, co-creative learning experiences, network of provocative thought leaders; access to full scope of Monitor Group‘s advisory, capacity-building, and capital services; thought leaders include noted authors/founders Peter Schwartz and Stewart Brand, and former CEO Eamonn Kelly. Rockefeller Foundation/GBN Scenarios on the Future of Technology and Economic Development: Scenarios on the tremendous opportunities (and challenges) that lie ahead, especially in emerging countries, as government, philanthropy, and business use technology to eradicate poverty and increase future options, prosperity and well being for billions. http://www.gbn.com/consulting/article_details.php?id=101&breadcrumb =ideas The GBN Bulletin—ideas, opinions, and insights on the future. Free subscription: http://www.gbn.com/ideas/bulletin.php GBNtweets—follow the remarkable future-oriented ideas and projects of GBN‘s staff and network at http://twitter.com/gbntweets GBN Podcasts—visionary thinkers address a wide array of social, technological, economic, environmental, and political trends and their implications for business and society at http://www.gbn.com/mp3s/

CONTACT Point of contact

Nancy Murphy (nmurphy@gbn.com) GBN Global Business Network a member of the Monitor Group 101 Market Street, Suite 1000 San Francisco, CA 94105 415-932-5400 (phone) http://www.gbn.com For general inquiries: info@gbn.com

PAGE 42 : Corporate Philanthropy Resource Guide

Global Philanthropic
www.globalphilanthropic.com

OVERVIEW Mission

Global Philanthropic is a worldwide group of strategic management professionals providing a diverse range of specialist services to the philanthropic sector. Consultancy 2002 London Has conducted the largest international study of global philanthropy in relation to the Millennium Development Goals. Has senior consultants and associates in Asia-Pacific, Europe and North America and also serving clients in Africa. Lead offices are in London, Hong Kong, Sydney and Brisbane. President and Group CEO: Ben Morton Wright. 30 (1) Ambitious organisations looking to increase, internationalize or initiate transformational fundraising.

Type of organization Year of origin Headquarters location International scope

Senior leadership Number of employees Target audience

SERVICES Services and programs

Through our advisory services, we help non-profit organisations obtain the resources they need to meet their most ambitious development goals. Our Giving and Wealth Strategies Services assist a range of high net worth individuals to develop focused strategies for giving.

Research areas

Differentiating features of organization Recent news / developments

Global Philanthropic Research (formerly Saints Information) is one of the top three leading prospect research agencies with full global reach. Global reach, culturally attuned research, advice built on the largest global research data sets. Visit our website: www.globalphilanthropic.com

CONTACT Point of contact

clientsupport@globalphilanthropic.com

PAGE 43 : Corporate Philanthropy Resource Guide

LBG Associates
www.lbg-associates.com

OVERVIEW Mission

LBG Associates‘ mission is to help companies develop strategic corporate citizenship and community involvement programs that generate positive, measurable benefits for the community, as well as the corporate bottom-line. Philanthropic consultancy 1993 245 Long Close Rd., Stamford, CT 06902 N/A Linda Gornitsky, Ph.D., President and Founder Laura M. Beaudry, Vice President, Research 2 Corporations, Foundations, Family foundations

Type of organization Year of origin Headquarters location International scope Senior leadership Number of employees Target client / customer / consumer

SERVICES Services and programs

LBG Associates is a woman-owned consulting firm focused on designing, implementing, and managing strategic corporate citizenship and community outreach programs and initiatives. We also conduct landmark benchmarking studies on key topics of interest relating to corporate citizenship and provide training in this area for all levels of management. We provide advice on corporate contributions and foundation giving, corporate volunteerism and employee giving programs, strategic communications development, grants management, and grants/program evaluation. As part of the strategy development process, we conduct all types of research, including benchmarking studies, senior management interviews, employee surveys and focus groups, and community attitude assessments. We also conduct major benchmarking studies on a variety of topics including volunteerism, domestic community involvement, global community involvement, disaster relief, and diversity. Dr. Gornitsky also provides training on corporate citizenship for senior executives, foundation board members, contributions committee members, and community relations staff, both at headquarters and in the field. Corporate citizenship research topics include: national and global community involvement and contributions, environmentalism, volunteerism, employee/workplace giving, disaster relief, signature programs, diversity, and sponsorships. Specific issue-oriented research areas include (but are not limited

Other services

Research areas

PAGE 44 : Corporate Philanthropy Resource Guide

Key Competitors Differentiating features of organization

to): environmental giving and volunteerism, after-school programs, corporate governance, donor-advised funds, financial education and economic literacy, mental health and learning disorders, and nonprofit capacity building. None LBG Associates is unique in that it provides not only consulting services, but also extensive research capabilities, training workshops, and meeting facilitation. We provide highly personalized, customized service to clients, driving social change through: Advice to help companies develop strategic, innovative corporate citizenship programs that help communities become better places to live and work; Implementation of socially responsible strategies, programs, policies and procedures, especially for companies with limited time and/or expertise; Research on cutting-edge corporate social responsibility issues, groundbreaking citizenship trends, ―best practices‖ and pressing social needs and concerns; and Training that equips community relations practitioners with the knowledge and skills to become ―strategic thinkers‖ and to grow and advance in the field of corporate community involvement.

Competitive advantages

LBG Associates offers unparalleled competencies in the following: Strategic Program Development: We develop community investment strategies for companies that are aligned with business objectives and meet community needs. We work with clients on all aspects of their community outreach program, including improving the grants management process; training senior management and contributions committees on strategy and the grant review process; liaising with stakeholders; developing and managing strategic nonprofit partnerships and signature programs; designing and facilitating workshops and retreats; and preparing internal and external communications strategies Grants Management: We design grant applications, review grant applications, work with grantees to improve their applications, develop databases, prepare correspondence, and design RFPs. Signature Programs: We develop signature programs (high impact, high visibility programs) for clients to help differentiate them from the competition in today‘s cluttered marketplace. Measurement and Evaluation: We conduct all types of research for clients, including the measurement and evaluation of their overall community outreach and volunteer programs, as well as specific national programs. We also teach courses and workshops on measurement. Research: LBG Associates has published eight nationally renown studies on trends and best practices related to philanthropy, volunteerism, environmental community involvement, diversity, and disaster relief. We have also undertaken myriad custom-tailored research projects for clients, involving evaluation and assessments of various community needs and social issues. Volunteerism: We are considered to be the top consulting firm in the country on corporate volunteerism. We have published two

PAGE 45 : Corporate Philanthropy Resource Guide

Recent news / developments

research reports, devised the first and only standards of excellence and self- diagnostic tool, taught classes in volunteerism, designed an advanced course on volunteerism, and developed countless volunteer programs for companies. Relationship Building/Liaison: We source nonprofit partners for clients, including identifying potential partners, working with them to develop programs and following up to ensure a successful program. Governance: With all the attention being paid to governance issues and the need for transparency, we have developed an expertise in governance issues, especially for corporate foundations. Staff/Board Trainings: We train senior management and contributions staff on how to evaluate grant proposals, as well as on strategic philanthropy, volunteerism and measurement. Motivating Volunteers during Tough Times (10/09) http://www.lbg-associates.com/publications/ How Green Is Your Company? New Green Performance Index Unveiled by LBG Associates (January 2009): http://world-wire.com/news/0901070001.html Research Study Reveals "The 76 Trends Driving Community Involvement" (February 2008): http://www.csrwire.com/News/14220.html

CONTACT Point of contact

Linda Gornitsky, Ph.D., 203-325-3154; LBGAssoc@gmail.com Laura Beaudry, 203-750-0500; laura@lbg-associates.com 245 Long Close Rd., Stamford, CT 06902

PAGE 46 : Corporate Philanthropy Resource Guide

Louder Than Words, Inc.
www.louderthanwords.com

OVERVIEW Mission Type of organization Year of origin Headquarters location Senior leadership Number of employees Target audience

The mission of Louder Than Words, Inc. is to communicate the inspirational stories of organizations and individuals to the world. Boutique PR agency 2003 Waltham, Massachusetts Rich Polt, President 5 Foundations, nonprofits, and businesses that are philanthropically minded, community-driven, and socially responsible

SERVICES Services and programs

Other services

Single Day Sessions: Media relations Messaging development Consulting & Program Development: Media relations Media training Strategic messaging Capacity building PR for select grantees Writing and material development Press For Action is a program that provides resource strapped nonprofits with free, short term PR campaigns. The goal of the program is to help Boston area organizations generate meaningful press coverage and awareness, while simultaneously enriching the community with inspirational and thought provoking news content. There are a variety of communications consultancies that work within the philanthropic sector, but few are able to provide highlevel consulting and execute these programs on the back end. Louder Than Words achieves both, successfully developing and implementing strategic campaigns. Louder Than Words brings together experienced practitioners with corporate and nonprofit backgrounds to provide comprehensive communications services. Good Business: The Happy Marriage Between Public Relations & Philanthropy Private Foundations Should Consider PR Businessweek.com http://tinyurl.com/2559g5 Mainstream Media Discovers Philanthropy:

Differentiating features of organization

Competitive advantages

Recent news / developments

PAGE 47 : Corporate Philanthropy Resource Guide

How you can Take Advantage of the Spotlight Onphilanthropy.com http://tinyurl.com/2a4e4g

CONTACT Point of contact

Crystal Noble 781-487-0002 ext. 13 crystal@louderthanwords.com

PAGE 48 : Corporate Philanthropy Resource Guide

Mission Measurement, LLC
www.missionmeasurement.com

OVERVIEW Mission

Type of organization Year of origin Headquarters location International scope Senior leadership Number of employees Target audience

Mission Measurement helps corporations, foundations, and nonprofit organizations measure the impact of social strategies and improve performance. Mission Measurement is a consulting firm specializing in the developing, measuring and evaluating social strategy. 2005 Chicago, IL Mission Measurement serves clients worldwide Jason Saul, CEO 10 Mission Measurement provides Strategy Consulting and Measurement & Evaluation services for corporate philanthropy and social responsibility programs, nonprofits, foundations, public agencies and education organizations.

SERVICES Services and programs

Our Strategy Consulting services help clients develop high impact social change strategies. Our experience has taught us that outcomes must drive strategy, not the other way around. Our strategy work always starts with the end in mind: defining success first, and then determining the best, most effective strategies for driving those results. And because we measure strategies across hundreds of organizations, we know what works and the research behind it. Our Measurement & Evaluation (M&E) services help clients to measure outcomes and analyze results across programs, grants or affiliates. For us, measurement is not for the sake of measurement. Organizations can use measurement to improve strategy, to allocate resources more efficiently, to demonstrate value to stakeholders and to manage better. Our M&E services are designed to help our clients learn, and improve. Our services include:with clients to map data flows, identify reporting needs, and implement sustainable, recurring data collection and reporting processes. Mission Measurement presents expert analysis of an organization‘s benchmarks, best practices, and overall impact in a dynamic reporting format. Business Case For Measurement; Social Impact Measurement and Benchmarking; Strategic Corporate Philanthropy; Corporate Social Responsibility; Stakeholder Trust; Social Enterprise; College Access; Early Childhood Education; Youth Development; Student Achievement; School Reform/Transformation; Community Building; Health Care Access & Delivery; Applied Measurement.

Research areas

PAGE 49 : Corporate Philanthropy Resource Guide

Differentiating features of organization

Competitive advantages

Mission Measurement is a pioneer, and recognized thought leader in the field of social impact performance measurement. Jason Saul, the firm‘s CEO, wrote the book on Benchmarking for Nonprofits: How to Manage, Measure and Improve Performance (Fieldstone Press 2006); Social Innovation, Inc.: Five Strategies to Drive Business Value through Social Change (forthcoming from Jossey-Bass in October 2010); and The End of Fundraising: How to Sell Your Impact in an Era of Outcomes (forthcoming from Jossey-Bass in February 2011). Mission Measurement developed the standards for measuring the impact of corporate philanthropy and is the forefront of developing next generation social innovation strategy for its clients and for the entire CSR field. Mission Measurement provides clients with access to the leading authorities in social impact performance measurement. The firm‘s expertise, experience, and success in this space has enabled Mission Measurement to secure strategic relationships with leading corporate, foundation, and nonprofit clients.

CONTACT Point of contact

Wendy Lazar wlazar@missionmeasurement.com 312-899-1800

PAGE 50 : Corporate Philanthropy Resource Guide

National Philanthropic Trust
www.nptrust.org

OVERVIEW Mission

Type of organization Year of origin Headquarters location International scope Senior leadership Number of employees Target audience Membership fee, if applicable SERVICES Services and programs

NPT‘s mission is to increase philanthropy in our society. To accomplish this, it provides products and services, such as donoradvised funds, that help both individual donors and financial advisors to manage charitable giving. NPT is an independent public charity designated as 501(c)(3) and 509(a)(1) by the IRS 1996 Jenkintown, PA As a provider of donor-advised funds, we make national and international grants on behalf of our donors Eileen R. Heisman, President and CEO 20 Individuals, families and organizations that can use NPT‘s services to facilitate their charitable giving through donor-advised funds. None

NPT offers donor-advised funds and supporting organizations. Since its founding, NPT has raised over $2 billion in charitable contributions and made over 44,000 grants to charities in the U.S. and 26 other countries. NPT currently has approximately $700 million in assets under management. NPT offers private label donor-advised funds to such institutions as Harris Bank, iShares, JP Morgan Chase, JP Morgan Securities, Pitcairn Financial Group, and UBS. NPT offers flexible and customized donor-advised funds. NPT accepts the widest range of gifts, including securities, privately-held and restricted stock, real estate, and many other assets. NPT provides expertise in complex grantmaking and offers a wide range of investment options, including exchange-traded funds, separately managed accounts, and private investments. See ―Differentiating Features‖ NPT recently announced its new partnerships with Hollencrest Capital Management to offer the Independent Charitable Gift Fund, which enables charitable giving, and with Harris Charitable Fund Program, enabling charitable giving through donor-advised funds.

Other services

Differentiating features of organization

Competitive advantages Recent news / developments

CONTACT Point of contact

Patricia Renzulli, VP Marketing prenzulli@nptrust.org 215.277.3118

PAGE 51 : Corporate Philanthropy Resource Guide

Oxford Analytica
www.oxan.com

OVERVIEW Mission

Type of organization Year of origin Headquarters location International scope Senior leadership Number of employees

Oxford Analytica‘s mission is to draw on the knowledge of Oxford University and other major centres of learning around the world to provide business and government leaders with timely, impartial and authoritative analysis of world economic, political and social developments. International consultancy firm specialising in the global political economy 1975 Oxford, England Offices in New York, Washington DC, Paris and Quebec Dr. David Young – Executive Chairman 60 full-time staff, and a global network of over 1,500 scholar experts based in major universities and research institutions around the world. Decisionmakers, policymakers, c-suite executives and analysts at major corporations, governments and international institutions.

Target audience

SERVICES Services and programs

The Oxford Analytica Daily Brief: Our flagship intelligence service provides government, corporate and financial clients with timely, authoritative, forward-looking analysis of geopolitical and macroeconomic events and issues every business day. The Global Stress Point Matrix: A unique early warning system monitoring some 20 potential high impact/low probability events that pose major risks to global stability.

Other services

Consultancy Practice: Our Consultancy Practice draws upon the firm‘s in-house expertise and expert contributor network to provide clients with actionable strategic intelligence and advisory services. The Practice has developed core competencies in the following: Political Risk Sustainability Thought Leadership Country/Region Analysis Scenario Planning Transnational Issues Market Entry Sector/trend/issue analysis

Research areas Differentiating features of organization Competitive advantages

Geopolitics, international political economy We provide analysis and advisory services. Both are subject to a rigorous peer review process to ensure the highest possible standards of accuracy, authority and impartiality. We deliver global analysis of every major development in the world

PAGE 52 : Corporate Philanthropy Resource Guide

every business day of the year. We provide analysis, not commentary or opinion. Our 1,500 strong expert network means we are well positioned to address almost any issue on behalf of a client with an unrivalled degree of depth, sophistication and knowledge. We do not engage in advocacy.

CONTACT Point of contact

Mark Elsner Vice President, Business Development Tel. 202 729 6964 melsner@oxford-analytica.com

PAGE 53 : Corporate Philanthropy Resource Guide

Rockefeller Philanthropy Advisors
www.rockpa.org

OVERVIEW Mission Type of organization Year of origin

Rockefeller Philanthropy Advisors (RPA) helps donors create thoughtful, effective philanthropy throughout the world. Nonprofit 501(c) 3 organization, philanthropic advisory service Originally founded over 100 years ago as a part of the Rockefeller family office, RPA became an independent nonprofit organization eight years ago. New York City Regional offices in Chicago, Los Angeles and San Francisco RPA works with 160 families and entities around the world, facilitating over $200 million in annual grantmaking in 70 countries. Since its inception, RPA has overseen over $3 billion in grantmaking across the world. Melissa Berman, President and CEO Kevin P.A. Broderick, Board Chair 40 Donors of all types – individuals and families, family foundations, charitable trusts, donor-advised fund holders, independent foundations, corporations and corporate foundations, family offices and public institutions and agencies 160 donors around the world N/A

Headquarters location International scope

Senior leadership Number of employees Target audience

Size of membership / network Membership fee, if applicable

SERVICES Services and programs

RPA‘s broad range of services includes: Establishing a foundation, Charitable Giving Fund or other giving vehicle Guiding the creation of a mission or program focus for giving Developing strategic and operating plans Structuring key governance and investment policies Providing in-depth research and advice on issues, approaches and best practices Supporting fiscal sponsorship and re-granting programs Implementing and evaluating competitive grant programs Assessing the quality, results and impact of grantmaking Organizing and leading customized retreats, intergenerational dialogue, board meetings and training programs

Other services

RPA also operates a Charitable Giving Fund, through which clients can make gifts outside the United States, participate in funding

PAGE 54 : Corporate Philanthropy Resource Guide

Research areas

Differentiating features of organization Competitive advantages

consortia and operate nonprofit initiatives. RPA conducts research and publishes in areas of relevance to the donor community such as impact investing and diversity in philanthropy. RPA also creates guides to help donors embark on a philanthropic path and RPA profiles great givers whose philanthropic stories are inspirations to us all. RPA employs a team-oriented approach that stresses confidentiality, effectiveness and customization. Each client works with a team of advisors whose expertise directly matches their interests and needs. RPA‘s senior staff members offer an average of 20 years each in grantmaking experience with major foundations, both domestic and international, including the Ford Foundation, the Levi-Strauss Foundation, the New York Community Trust, and the John A. Hartford Foundation For more than 120 years, RPA has served America‘s most philanthropic family. Through this service, RPA has acquired unparalleled insights and wisdom; unique experience with a diversity of styles, goals and programs; and the ability to work seamlessly with and across several generations at once. In July 2010, Rockefeller Philanthropy Advisors was awarded a $3.7 million, three-year grant from the Bill and Melinda Gates Foundation to provide potential and current donors and their advisors with resources to help maximize their efforts and increase effective, sustainable giving worldwide.

Recent news / developments

CONTACT Point of contact

Lauren Russell Geskos, Senior Manager, (212) 812-4201, LGeskos@rockpa.org

PAGE 55 : Corporate Philanthropy Resource Guide

Strategic Philanthropy Advisors, LLC
www.spadvisors.com

OVERVIEW Mission

Strategic Philanthropy Advisors, LLC provides consulting services to enhance organizational effectiveness and maximize the external impact of domestic and international grantmakers, social investors, schools, and nonprofit organizations. Limited Liability Company, Consultant 2006 San Francisco, CA with an East Coast office in New York, NY Eddy Bayerdelle, PhD, Michael Feller, MBA, EdD, Gregory L. King, Robert A. Rosenbloom, PhD, Margaret Southerland, Denise Nix Thompson, MBA, MA. 7 Our clients include corporate contributors, private foundations, individual donors, hedge funds, municipalities, and nonprofit organizations. None

Type of organization Year of origin Headquarters location Senior leadership

Number of employees Target audience

Membership fee, if applicable

SERVICES Services and programs

Other services Differentiating features of organization Competitive advantages

We assist foundations and corporate giving programs in designing, implementing and measuring innovative grant programs through short term consulting projects and longer engagements that supplement the grant review work of in-house staff. We help nonprofits build their capacity by conducting financial feasibility studies, creating strategic and revenue development plans, streamlining processes, providing cost reduction programs, managing joint venture partnerships, developing evidence-based programs and writing fundable private and federal government proposals. We serve as course instructors, presenters and panelists at philanthropic and nonprofit forums. We have extensive experience serving as nonprofit interim CEOs and program directors. The firm works in the areas of community development, arts and culture, education, healthcare, and social services. We are practitioners with combined experience of 100 years as grantmakers, management consultants, educators, and nonprofit executives working in domestic and international philanthropy, marketing, community relations, public policy, Six Sigma, and related fields.

CONTACT Point of contact

Michael Feller, Principal, NY Office: 917.692.0254 (Michael@spadvisors.com)

PAGE 56 : Corporate Philanthropy Resource Guide

Taproot Foundation
www.taprootfoundation.org

OVERVIEW Mission Type of organization Year of origin Headquarters location International scope Senior leadership Number of employees Target audiences

To lead, mobilize and engage professionals in pro bono service to drive social change. Nonprofit 501(c)(3) organization 2001 San Francisco, CA Offices in Chicago, Los Angeles, New York City, Washington, DC Partnerships not direct delivery Aaron Hurst, Founder and CEO 50 Thousands of nonprofits and pro bono consultants Top Fortune 500 companies, universities and trade associations Local, national and family foundations

SERVICES Services and programs

Other Services

Direct pro bono service delivery to nonprofits in our 5 cities. Consulting and Advisory Services for Fortune 500 companies, foundations, universities, trade associations and nonprofits. Thought Leadership initiatives Learning and sharing what works, prompting new thinking about and tools for strategy and management, distributing insights via media, website, publications, working sessions, speaking engagements and collaborations. Training and workshops for developing and scaling pro bono programs.
Pro Bono Service and Catalytic Philanthropy

Research Areas Recent news / developments

Addition of working with strategic partners to integrate pro bono service into their organizations to address specific social issues.

CONTACT Point of contact

Elizabeth Schwan-Rosenwald elizabeth@taprootfoundation.org 1612 K St, Suite 505 Washington DC 20006 T (312) 635-1120 C (773) 383-2574

PAGE 57 : Corporate Philanthropy Resource Guide

TCC Group
www.tccgrp.com

OVERVIEW Mission

TCC Group's mission is to develop strategies and programs that enhance the efficiency and effectiveness of nonprofit organizations, philanthropies, and corporate citizenship programs to achieve social impact. Consulting services for corporate community involvement, nonprofits, and philanthropy 1980 New York, NY; Philadelphia, PA; Chicago, IL Richard A. Mittenthal, President and CEO Shelly Kessler, Thomas W. Knowlton, Peter J. York, Paul Connolly 30+ professionals Corporations, nonprofits, philanthropic organizations, and governmental clients

Type of organization Year of origin Headquarters location Senior leadership Number of employees Target audience

SERVICES Services and programs

Services: Strategic planning, needs assessment & competitive analysis, evaluation, grantmaking assistance, organizational development, cross-sector partnerships Expertise: Arts & culture, children & youth, community development, education, environmental, health, and human services Core Capacity Assessment Tool (CCAT) Online survey tool that allows a nonprofit organization to analyze its four core capacities and organizational culture; anonymous and confidential self-assessment of core capacities; provides users with a report analyzing their strengths and providing recommendations for future growth and change Reports, briefing papers, articles, publications available online

Other services

Research areas

CONTACT Point of contact

Richard Mittenthal, CEO 212-949-0990 rmittenthal@tccgrp.com

PAGE 58 : Corporate Philanthropy Resource Guide

The Consulting Network
www.theconsultingnetwork.com

OVERVIEW Mission

To provide quality service and results to clients seeking support in maximizing their community outreach. The Consulting Network (TCN) commits to using our combination of experience, skills and professional networks to ensure that clients achieve their goals. We value integrity, responsiveness, professional growth and measurable outcomes in our work. When we serve our clients well, our own success will follow. Management consulting firm specializing in corporate citizenship, community relations, contributions and employee involvement. 1989 Roseland, Virginia Counsels corporations and nonprofits with international scope and interests. John F. Coy, Founder & President Coordinates teams and networks of experienced and highly seasoned self-employed consultants. Corporate citizenship, community relations, contributions and employee involvement professionals and functions. Clients include national and multinational Fortune 500 companies as well as a number of national and international nonprofit organizations.

Type of organization Year of origin Headquarters location International scope Senior leadership Number of employees Target audience

SERVICES Services and programs

Other services

Strategic planning. Program evaluation, benchmarking, development and integration. Grant evaluation. Organizational and staffing assessment. Community assessment. Management decentralization and program support. International program design. Resource allocation and budgeting. Signature program development. Cause marketing and sponsorship. Request for proposal management. Employee involvement program design and management. Employee workplace campaign assessment and management. Corporate volunteer and board leadership development. Staff training and development. Professional recruiting. TCN also provides supporting communications activities including

PAGE 59 : Corporate Philanthropy Resource Guide

Research areas

public relations, issue management, publishing and writing. In the course of our work, we have benchmarked hundreds of corporate citizenship programs and have identified the elements of effective practice. Our experience in benchmarking has resulted in the establishment of the Corporate Citizenship: Benchmark Center, SM known as CC: BenchmarkCENTER . This resource provides our clients with measures of comparison to their peers and information they can use in educating management about community relations and contributions. Over the last 12 years, we have collected annual giving figures for hundreds of companies. The financial information in the TCN database allows analysis by industry group, Fortune ranking and other selected comparisons. Other benchmarking documents employee involvement strategies, best-in-class programs and more. TCN has conducted years of research on employee workplace giving programs and has published several definitive guides for making this valued tradition responsive to employer and employee objectives.

Differentiating features of organization Recent news / developments

TCN is a firm that assigns only senior, experienced professionals to work with clients. We are nimble, responsive and efficient. TCN continues to undertake ongoing research projects related to contributions, community relations and corporate citizenship management.

CONTACT Point of contact

John F. Coy President 434-325-9287 tcncoy@msn.com

PAGE 60 : Corporate Philanthropy Resource Guide

The Philanthropic Initiative (TPI)
www.tpi.org

OVERVIEW Mission

The Philanthropic Initiative, Inc. (TPI) is an ally and consultant to ambitious and entrepreneurial corporations and donors willing to embrace creativity in their efforts to realize deep social impact. Retained by corporations, foundations and individuals to create and execute custom strategies to increase the impact of their giving, TPI has invested itself in the advancement of strategic philanthropy around the globe since 1989. Nonprofit philanthropy consulting firm 1989 Boston, Massachusetts TPI‘s work and client base is global Ellen Remmer, President and CEO Peter Karoff, Founder and Chairman Approximately 20 staff Corporations and corporate giving programs, individual/family donors, foundations

Type of organization Year of origin Headquarters location International scope Senior leadership Number of employees Target audience

SERVICES Services and programs

TPI is hired to develop and execute customized philanthropic strategies. As a thought partner, convener, subject matter expert, or staff, we work across the continuum—from visioning and strategy through implementation and evaluation—to help our clients reach their unique goals. By aligning philanthropic goals with business goals, companies will invest more deeply in work that produces positive outcomes for all stakeholders—boards, shareholders, consumers, employees, and the communities in which they live, work, and serve. Our work with corporations includes: Launching a new foundation or community involvement effort Creating a signature initiative to take leadership on an issue Facilitating a strategic planning process Strengthening existing programs through needs or impact assessments Identifying opportunities to leverage philanthropic investments Implementing programs Creating collaboratives and partnerships Tools and approaches include: Research, scans, benchmarking Stakeholder interviews, surveys, employee focus groups

PAGE 61 : Corporate Philanthropy Resource Guide

Other services

Requests for proposals, site visits, due diligence Employee engagement programs, giving circles Evaluation It is not uncommon for TPI to also work with company leadership and their families independent of our work with the company. TPI trains and supports professional advisors and other philanthropic advisors in their work with donors.

Research areas

Differentiating features of organization Competitive advantages

Research, scans and benchmarking across all interests/programmatic areas for our clients. Trends in philanthropy and international philanthropy originating from the U.S. Growth and trends in global philanthropy in BRIC and CIVETS countries. TPI pioneered the field of strategic philanthropy advising. Our strength lies in the team of individuals who are TPI. Team members distinguish themselves as thought leaders and trusted advisors with experience both broad and deep. Embracing rich internal collaboration and an external network built over 20 years, we assemble powerful teams with diverse perspectives. We view lessons learned through the lens of innovation. We couple deep issue area expertise with the understanding of process, organizations, and systems. Through fresh, creative thinking we uncover new possibilities for accelerating change. Whether conceptualizing a new strategic direction or identifying new ways to leverage a wider range of company resources, we deliver innovative ideas born from two decades of boots on the ground. Over the past 20 years, we have been fortunate to partner with extraordinary companies to achieve a level of impact that may not have been realized without our help. This track record instills confidence in our clients. With a proven partner alongside, our clients can pursue their goals for deep social impact more boldly.

Recent news / developments

As part of our field-building work, TPI leads workshops on various topics. Recent TPI workshops for corporate givers include ―Designing High-Impact Corporate Signature Initiatives‖ and ―Corporate Leadership: How to be a Responsive and Responsible Leader in Changing Times‖. Working in partnership with colleagues and clients around the world, TPI recently launched the Center for Global Philanthropy at TPI to catalyze philanthropy‘s global impact through improved knowledge, broader engagement, and strategic practice.

CONTACT Point of contact

Leslie Pine, Senior Vice President, 617-338-2590 x233, lpine@tpi.org Jim Coutre, Vice President, 617-338-2590 x259, jcoutre@tpi.org

PAGE 62 : Corporate Philanthropy Resource Guide

True Impact LLC
www.trueimpact.com

OVERVIEW Mission

Type of organization Year of origin Headquarters location International scope Senior leadership Target audience

True Impact LLC provides web-based software and consulting support to help organizations measure the social, financial, and environmental return on investment (ROI) of their community investment, environmental, human resource, and other corporate citizenship activities. Software and Consulting Services Firm 2002 Boston, MA We serve clients – and measure programs, activities, and initiatives – worldwide. Farron W. Levy, CEO Corporate, nonprofit, and government clients.

SERVICES Services and programs

▪ Do-It-Yourself Measurement. Subscribe to True Impact, our webbased ROI calculator, to measure the triple-bottom-line value of any program, activity, or initiative. We provide technical and analytic support. ▪ We-Do-It-For-You Measurement. You may also outsource your analyses to our staff, who will calculate the ROI of existing programs (or the expected ROI of prospective programs) on your behalf. ▪ Partnership Options. For professional services and software providers, we offer partnership and private-label licensing and support options. Visit us at www.trueimpact.com for a pre-recorded demo, and for further information. We specialize in quantifying – and gathering data on – CSR-related impacts on the following areas: sales, recruiting, retention, productivity, skill development, satisfaction, risk, cost of capital, and social-value creation (change in social condition, socio-economic value, and market value). A spin-off of a social auditing firm established in 1992, we offer unrivaled experience and expertise in social, financial, and environmental impact measurement. Two of our key strengths include: 1. The ability to help staff- and budget-constrained organizations leverage existing in-house data, or data from the public domain, as practical and credible (i.e., able to withstand C-level scrutiny)

Research areas

Differentiating features of organization

PAGE 63 : Corporate Philanthropy Resource Guide

alternatives to expensive ―gold-standard‖ measures (though we work with those too). 2. The only web-based, ―triple bottom line‖ (social, financial, environmental ROI) calculator on the market. True Impact offers powerful analytic and reporting functions, with user-friendly, stepby-step user guidance to accommodate even users with no background in measurement. True Impact has helped Allstate, Cox Communications, Deloitte, Home Depot, PNC Bank, and Verizon among others to measure the value of a broad range of corporate citizenship programs.

Recent news / developments

CONTACT Point of contact

Farron W. Levy, CEO 617.739.3899 flevy@trueimpact.com

PAGE 64 : Corporate Philanthropy Resource Guide

Walker Information
www.walkerinfo.com

OVERVIEW Mission

Walker Information is a research and consulting firm focused on customer loyalty and other customer strategies to accelerate business performance. With over 65 years of experience Walker helps companies solve their business issues through customer strategies to increase shareholder value. Professional services – research and consulting 1939 Indianapolis, Indiana Walker works with companies and partners around the world Management team: Steve Walker, Randy Shoemaker, Phil Bounsall, Mark Winzenread, Patrick Gibbons, Sonya McAllister Approximately 200 employees, most based in Indianapolis, Indiana. A branch office is also located in Toronto, Canada. While Walker‘s clients range in size and industry, the primary audience is business-to-business organizations in the technology, communications, manufacturing, financial services, and health care industries.

Type of organization Year of origin Headquarters location International scope Senior leadership Number of employees Target audience

SERVICES Services and programs

Complete Customer Strategy Work with clients to develop key customer strategies to improve the customer experience, encourage customer loyalty, and increase the value of their company. Employee Loyalty Solutions Work with clients to provide key measurements of employee loyalty and specific guidance on encouraging workforce development. Walker Solutions 1. In-person Research—focus groups, field and tab services, mock jury trials, call centers, zip codes, 2. Technology—web-based survey tools, data management systems, online reporting tools, and follow-up action systems 3. Consulting 4. Perspective—newsletter, client forums, roundtables, webcasts, and other client-only networking opportunities Walker Loyalty Reports Critical benchmarking information-providing key comparisons and perspectives for companies in many industries-as well as

PAGE 65 : Corporate Philanthropy Resource Guide

Other services

Research areas Differentiating features of organization

loyalty-related issues. Focus Groups WI has been conducting research through focus groups for over 50 years; State of the art focus group facilities; Used by Fortune 500 companies, law firms, and insurance companies (4 different rooms with extensive audio/visual equipment, speaker-phones, podiums, dry erase boards, and storage areas; experienced moderators). Walker Global Partners A collection of approximately 15 prominent research companies serving more than 75 countries; partners provide both local insights as well as global research. Research and reports on connecting customer strategies to shareholder value and the financial impact of customer loyalty Walker‘s focus and extensive experience in the area of customer loyalty and customer strategies set them apart from other research and consulting organizations. What‘s more, their comprehensive approach to solving business issues is unique. Walker‘s singular focus on customer loyalty and related strategies Walker‘s decades of experience serving hundreds of major corporations Walker‘s comprehensive approach to solving business issues Walker‘s broad range of services to include research services, technology tools, and business consulting

Competitive advantages

CONTACT Point of contact

Steven F. Walker Chairman, President, CEO 317.843.8890 swalker@walkerinfo.com Patrick Gibbons SVP, Marketing 317.843.8822 pgibbons@walkerinfo.com

PAGE 66 : Corporate Philanthropy Resource Guide

Wellspring Consulting
www.wellspringconsulting.net

OVERVIEW Mission

Wellspring Consulting is dedicated to helping nonprofit organizations achieve their mission. We use a strategic approach to help organizations set direction, build organizational capacity, and achieve desired results. We seek to create a positive difference in the world, both through the organizations that we serve, and for the individuals with whom we work. Nonprofit consultancy 2002 New Haven, Connecticut & Boston, MA Christopher Keevil, Managing Director Nonprofit organizations primarily along the U.S. Northeast Corridor

Type of organization Year of origin Headquarters location Senior leadership Target audience

SERVICES Services and programs

Other services Differentiating features of organization

Projects typically structured to include analytical fact-finding, combined with collaborative problem solving with multiple constituents Work includes: Direction Setting Organizational Development Achieving results Mentoring of junior consultants to build skills as contributors and leaders for the sector Founded by a former partner at The Boston Consulting Group (BCG)

CONTACT Point of contact

info@wellspringconsulting.net Christopher Keevil Tel: 203-387-7192 Fax: 203-387-1345

PAGE 67 : Corporate Philanthropy Resource Guide

ADMICAL
www.admical.org

OVERVIEW Mission

1. SUPPORTING and REPRESENTING companies involved in corporate philanthropy Maintaining and developing a NETWORK between key players participating in philanthropy 2. MANAGING and TRAINING practitioners 3. Spreading INFORMATION about corporate philanthropy Non-profit organization 1979 Paris Admical has built up a network of affiliations and partnerships: in Europe : - CEREC (the European Committee for Business, Arts and Culture) - EFC (European Foundation Center) Is actively involved in developing corporate sponsorship projects in Europe and around the world, advising its corporate members. Olivier Tcherniak, Chairman of ADMICAL Bénédicte Menanteau, General Delegate 10 Big companies, SME, corporate foundations 180 members Corporate members 8 500 € / 3 400 € / 2 300 € Non-profit organizations 1 400 €

Type of organization Year of origin Headquarters location International scope

Senior leadership Number of employees Target audience Size of membership / network Membership fee, if applicable

SERVICES Services and programs

Ad Advisory Admical is a resource centre for corporate philanthropists, executives, fundraisers, media representatives, students and the wider community. - Legal and tax advisory service Sponsors and fundraisers can address questions, and seek information from our specialist. 1. - European and international service Admical is also keeping up with the international news and is the ideal resource centre on questions about corporate philanthropy in

PAGE 68 : Corporate Philanthropy Resource Guide

Europe and in the world. Training Admical provides: - A monthly 2 days session for fundraisers. - Regular training for companies. - Specific training on demand. Events - International Summit ‗Les Assises‘ Every two years, Admical brings together for a big event all the people working in corporate giving. Many round tables are organized on current topics. - Awards ‗Les Oscars‘ Every two years an independent jury awards several prizes to companies for an outstanding work in the field of corporate giving. - Symposiums Admical regularly organizes symposiums on trends and issues in the sponsorship sector. - Breakfast conferences ‗Les Matinales‘ - Thematic workshops Publications Admical also provides publications: a magazine, a directory of corporate philanthropy, a legal and tax guide, a newsletter, special reports and surveys…
Other services Research areas

ADMICAL organizes regularly think tank on corporate philanthropy in France with its members through workshops and committees Corporate giving trends Corporate giving and CSR Corporate giving and Environment Corporate giving and communication Corporate giving at an international scale ADMICAL has been the 1 organization to promote corporate philanthropy in France since 1979 and has been certified as a public benefit association. It‘s also the only organization dealing with all the fields of corporate philanthropy : social services, arts and culture, environment, sport, research
st

Differentiating features of organization

Recent news / developments

A special intranet platform to help corporate members to select reliable projects.

CONTACT Point of contact

Laure Chaudey, International manager, lchaudey@admical.org Charlotte Dekoker, Communication manager, cdekoker@admical.org

PAGE 69 : Corporate Philanthropy Resource Guide

Association of Corporate Contributions Professionals (ACCP)
www.accprof.org

OVERVIEW Mission

ACCP is dedicated to the development of contributions professionals through education & training, defining best practices for the field, building relationships and benchmarking & measurement. Membership organization for corporate contributions professionals 2004 Mt. Pleasant, South Carolina Mark Shamley, President 20-member Board of Directors (5 are also Executive Committee) 5 Professionals and executives in the fields of corporate citizenship, contributions, community relations, volunteerism and social responsibility More than 130 business members that collectively contribute more than $6 billion in charitable donations each year $6,000 annual fee

Type of organization Year of origin Headquarters location Senior leadership Number of employees Target audience

Size of membership / network Membership fee, if applicable

SERVICES Services and programs

Training & Education: ACCP trains contributions professionals to align philanthropic strategies with business objectives, visions and values. Defining Best Practices: ACCP researches and reports best practices across a variety of topics and industries. Building Relationships: ACCP creates opportunities for contributions professionals with shared interests to connect and collaborate. Benchmarking & Measurement: ACCP provides resources for contributions professionals to analyze elements of corporate philanthropic programs. Members can receive no-cost consulting from staff at ACCP with more than 25 years combined experience in corporate philanthropy. ACCP offers numerous opportunities for in-person and virtual networking and idea sharing with colleagues across industries and around the country.

Other services

PAGE 70 : Corporate Philanthropy Resource Guide

Research areas Differentiating features of organization Competitive advantages

Annual giving trends and projections ACCP focuses on tactical, practical aspects of corporate citizenship for corporate giving professionals. ACCP membership includes a complimentary registration to the Annual Conference, plus multiple-seat discounts for additional registrations; free access to all webinars; a discount to the annual Contributions Academy Forum; one complimentary registration to each ACCP L.E.A.D.S. meeting; and unlimited access to the ACCP Member‘s Website with a philanthropic program Benchmarking Tool. ACCP launched within the past year the ACCP L.E.A.D.S. meetings, a series of easily accessible, regional and topic-based events that leverage the expertise of ACCP member companies, NGOs and public-sector agencies to develop solutions and tactics for corporate contributions professionals. L.E.A.D.S. meetings provide the opportunity for open dialogue and discussion between attendees and event presenters, allowing for the development of practical applications of knowledge gained

Recent news / developments

CONTACT Point of contact

Donna Kraemer, Director of Operations and Finance, donna@accprof.org, 843-216-3442 Kelly Russ, Manager of Communication and Marketing, kelly@accprof.org, 407-650-9748

PAGE 71 : Corporate Philanthropy Resource Guide

The Aspen Institute
www.aspeninstitute.org

OVERVIEW Mission Type of organization Year of origin Headquarters location International scope

The mission of The Aspen Institute is to foster enlightened leadership and open-minded dialogue. International nonprofit organization 1950 Washington, DC Campuses in Aspen, CO, New York, NY and Wye River, MD Partner Aspen Institutes in Berlin, Rome, Lyon, Tokyo, New Delhi, and Bucharest, and leadership programs in Africa, Central America the Middle East, and India Walter Isaacson, President & CEO Robert K. Steel, Chairman of Board of Trustees 204 CEOs and international leaders 1,400, including Society of Fellows, Aspen Wye Fellows, and Aspen Community and the Institute donors $2,500 – $50,000

Senior leadership Number of employees Target audience Size of membership / network Membership fee, if applicable

SERVICES Services and programs

Other services

Seminars and public programs including the Aspen Ideas Festival, the Aspen Seminar for executives and leaders on values-based leadership, the Wilderness Seminar, international seminars, the Aspen Health Forum, the Aspen Environment Forum, and more Policy work in range of areas including: 1. Business & Society Program Dedicated to developing leaders for a sustainable global society through dialogues and path-breaking research 2. Corporate Values Strategy Group Released the Aspen Principals 3. Center for Business Education Encourages future business leaders to innovate at the intersection of corporate profits and social impacts Leadership Development Initiatives whose aim is to ―put a dent in the universe‖ through intensive values-based leadership training with leaders in mostly developing countries. Conferences worldwide Nonprofit Sector and Philanthropy Program (NSPP) Research, leadership education, and communication initiatives focused on critical nonprofit and philanthropy issues. The Business and Society Program (B&S) Dedicated to developing leaders for a sustainable global

PAGE 72 : Corporate Philanthropy Resource Guide

Research areas

Differentiating features of organization

Competitive advantages Recent news / developments

society through dialogues and path-breaking research, creating opportunities for executives and educators to explore new pathways to sustainability and values-based leadership. Is also a leading source of innovative curriculum in top business schools around the world. Energy, Environment, Human Rights, Judicial System, Media & Communications Technology, Community Development, Microfinance, Medicine & Biomedical Science, Education, Middle East Policy and Investment Initiative, Foreign Policy, Nonprofit Sector and Philanthropy, Corporate Giving, Social Enterprise, Business & Society, Global Economics, Ethics & Globalization, Community Change, Education Entrepreneurship. Core mission is to foster enlightened leadership and open-minded dialogue. Through seminars, policy programs, conferences and leadership development initiatives, the Institute and its international partners seek to promote nonpartisan inquiry and an appreciation for timeless values. This is a unique mission that sets this organization apart. Nonpartisan, focused on values-based leadership and ethics, see above The Aspen Institute has tripled its Society of Fellows donor base in the last three years. It has also held and announced a series of major topical public events and forums. The Aspen Global Leadership Network, a network of international initiatives focused on values-based leadership, was announced and continues to expand to new countries and regions of the world.

CONTACT Point of contact

Aspen Institute: Susan Sherwin, Executive Vice President of Development, susan.sherwin@aspeninstitute.org, 202.736.1088 Elliot Gerson, Executive Vice President of Seminars and Public Programs, elliot.gerson@aspeninstitute.org, 202.736.3841 Aspen Institute Nonprofit Sector and Philanthropy Program: Alan Abramson, Executive Director, alan.abramson@aspeninstitute.org, 202.736.5829 Aspen Institute Business and Society Program: Judith Samuelson, Executive Director, judy.samuelson@aspeninstitute.org, 212.895.8001

PAGE 73 : Corporate Philanthropy Resource Guide

Association of Fundraising Professionals
www.afpnet.org

OVERVIEW Mission

Type of organization Year of origin Headquarters location International scope Senior leadership Number of employees Target audience Size of membership / network Membership fee, if applicable

Association of Fundraising Professionals (AFP), an association of professionals throughout the world, advances philanthropy by enabling people and organizations to practice ethical and effective fundraising. The core activities through which AFP fulfills this mission include education, training, mentoring, research, credentialing and advocacy. Professional Membership Association 1960 Washington, DC 213 Chapters Worldwide Roberta A. Healey, MBA, NHA, ACFRE Paulette Maehara, President and CEO 40 Fundraising staff, CEOs, Executive Directors, Volunteer Leaders Approximately 30,000 members in 213 chapters in North America and Asia $250 + local / chapter dues

SERVICES Services and programs

Other services

Ethics training, including AFP‘s Code of Ethical Principles and Standards and The Donor Bill of Rights Comprehensive fundraising education and training, covering all fundraising techniques and styles, through a variety of inperson, distance and online courses and sessions Fundraising research, including AFP‘s State of Fundraising Survey and annual Compensation and Benefits Survey Advocacy AFP‘s International Conference on Fundraising, the largest fundraising conference in the world. Advancing Philanthropy magazine, published bi-monthly, containing idea and strategy magazine for fundraisers in all sectors Fundraising Resource Center has over 3,200 reference works Legislative Updates and Action Alerts Kaleidoscope, focusing on diversity in philanthropy and fundraising Te Informa, focusing on fundraising in Latin America Directory of Consultants and Research Partner Pages

PAGE 74 : Corporate Philanthropy Resource Guide

Annual listing of consultants and resource partners Research areas Differentiating features of organization Other information

Fundraising, Giving, Professional Demographics and Compensation Largest professional fundraising association in the world Formerly the National Society of Fund Raising Executives

CONTACT Point of contact

Rebecca Knight; RKnight@afpnet.org

PAGE 75 : Corporate Philanthropy Resource Guide

Business Civic Leadership Center
www.uschamber.com/bclc

OVERVIEW Mission

The mission of the Business Civic Leadership Center (BCLC) is to promote better business and society relations and improve longterm social and economic conditions by: o o o Communicating the business community‘s unique and valuable contributions Cultivating strategies and practices that achieve positive results Coordinating public-private partnerships and coalitions

Type of organization Year of origin Headquarters location Senior leadership

501(c)(3) nonprofit organization Note: BCLC is an affiliate of the U.S. Chamber of Commerce 2000 Washington, DC Stephen Jordan, Senior Vice President and Executive Director, U.S. Chamber BCLC; Kathryn Traver, Senior Director, U.S. Chamber BCLC 9 full-time staff CSR/corporate citizenship departments, corporate foundations, chambers of commerce, nonprofits and government agencies that partner with businesses The U.S. Chamber is the world's largest business federation. As the CSR and arm of the U.S. Chamber, BCLC‘s network includes leading corporations, small and midsize businesses, and local chambers of commerce Sponsorship levels range from $5,000 to $100,000

Number of employees Target audience

Size of membership / network

Membership fee, if applicable

SERVICES Services and programs

BCLC is a resource and voice for businesses and their social and philanthropic interests. Our goal is to help build good will, good relations, and good markets by improving issues that affect the business sector from a social and economic standpoint. We focus on U.S. community investment, disaster assistance and recovery, global corporate citizenship, and attitudes toward business. We host three signature conferences, numerous webinars and forums, the annual Corporate Citizenship Awards, and an end-ofyear Awards gala. We are active editorial contributors on the subjects relating to corporate citizenship and CSR. Our leadership is frequently asked to do presentations and speeches around the

PAGE 76 : Corporate Philanthropy Resource Guide

Other services

world on these subjects. o Policies, strategies, and issues: As an information source for the business perspective on social and civic issues, BCLC researches and analyzes trends affecting corporate citizenship and recommends ways to improve the environment in which the business sector operates. Stakeholder communications: BCLC is a partner in sharing the positive story of corporate citizenship initiatives in the U.S. and around the world. Through our report series, awards competition, corporate citizenship web portal, and monthly e-newsletter, BCLC works with companies to offer industry, government, nonprofit, and media stakeholders a glimpse of corporate citizenship at its finest. U.S. corporate community investment, disaster response, global development, attitudes toward business, public-private partnerships, emerging social issues affecting business Affiliated with the U.S. Chamber of Commerce, located in Washington, DC Unique reach into local communities and international markets due to the U.S. Chamber of Commerce network o Expertise from the business-sector perspective on CSR and social issues that affect business o Credible convener of professionals from business, government, and nonprofit organizations who work together toward solutions to leading social and economic challenges BCLC manages corporate working groups dedicated to disaster response issues, U.S. corporate community investment, and global corporate citizenship. Interested companies and chambers should contact BCLC to learn more. o o

Research areas

Differentiating features of organization Competitive advantages

Recent news / developments

SERVICES Point of contact

Kitty Taylor 202-463-3133 ctaylor@uschamber.com 1615 H Street, NW Washington, DC 20062

PAGE 77 : Corporate Philanthropy Resource Guide

Business in the Community (BITC)
www.bitc.org.uk

OVERVIEW Mission

The values of Business in the Community (BITC) are to act with integrity, to inspire companies by sharing our knowledge and experience, and to develop innovative and challenging ways to be a catalyst for change. We support and challenge companies to integrate responsible business through their operations in order to have a positive impact on society and therefore be of 'public benefit'. Membership organization for businesses / CSR. A Not for Profit. 1982 London BITC members operate in +200 countries Stephen Howard, Chief Executive Peter Lambert, Deputy Chief Executive Sue Adkins, International Director and Founding Director of Cause Related Marketing 350 All companies regardless of size or commitment +800 members 63 of the FTSE 100 Fee corresponds to the size of company, determined using two of the following criteria: turnover, total assets, and number of employees. Fees range from ₤3,600 to ₤12,500 (approximately $5500.00 to $9,000)

Type of organization Year of origin Headquarters location International scope Senior leadership

Number of employees Target audience Size of membership / network Membership fee, if applicable

SERVICES Services and programs

Awards for Excellence 13-yr old program with on average 400 entries per year; many awards given each year in 12 categories: Company of the Year, Small Company of the Year, Workplace Impact , Environment Impact, Community Impact, Marketplace Impact, Northern Foods Rural Action Award, International Award, Regional - Work Inspiration, Regional - Sustainable Travel Award, Re-accreditation, Leadership Awards; All BITC members and other companies with UK presence eligible to enter competition HRH The Prince of Wales‘ Seeing is Believing Flagship programme set up by HRH The Prince of Wales in 1990 which has taken over 7,000 senior business leaders on visits into communities; Visits focus on a specific issue area

PAGE 78 : Corporate Philanthropy Resource Guide

Other services

(education, crime etc) to increase understanding of society‘s most pressing issues and to showcase the positive impact that business can have; Leaders follow up with written impressions recount how visit affected business operations; Provides firsthand exposure and creates network of engaged leaders. CR Index Business in the Community's Corporate Responsibility (CR) Index is the UK‘s leading voluntary benchmark of Corporate Responsibility. It is a framework which helps companies to integrate and improve CR throughout their operations by providing a systematic approach to managing, measuring and reporting on business impacts in society and on the environment. The CR Index performs two main functions: • A Management Tool, assisting companies in integrating CR into their core business practices • A public benchmark, published annually on our website and with our media partner, celebrating the achievement of companies that have gone through the process By participating in the CR Index, companies fill in a self assessed online survey, evaluating their management and impact within the key CR areas of community, environment, marketplace and workplace. Advisory Services BITC offers a range of advisory tools and bespoke services to members to assist in integrating responsible business practice and meeting business and sustainability goals. Companies can better understand their most significant social and environmental issues and develop strategies for systematically managing, measuring and reporting on how these issues are being addressed. Cares National campaign to promote employees to volunteer locally; More than 400 companies participate. Cares offers wellestablished expertise in employee engagement that delivers benefits for companies, employees and communities. In addition to providing a brokerage service for high-quality volunteering opportunities, Cares also campaigns nationally to increase the impact of employee volunteering in communities of greatest need and address social issues including education, employability and economic renewal. Advisory Services Advisory services on integrating responsible practices into strategy, community, environment, marketplace, workplace Partnership Programs 1. CSR Academy—provides networking, training, and support to those involved in building better business/public services/community sector partnerships 2. Business Broker Network—brings together brokers that build partnerships of businesses, public services, and voluntary/community sector UN Millennium Development Goals (MDGs) Advice, networking and events to raise awareness and help companies in achieving the UN Millennium Development goals, plus access to an online database of best practice case

PAGE 79 : Corporate Philanthropy Resource Guide

studies. CSR360 Global Partner Network (CSR360 GPN) Over 110 nonprofit partners in 60 countries around the world facilitate dialogue between business, government and civil society; the process helps to create partnerships that can reduce risk, build trust and develop innovative approaches that benefit from local market opportunities ENGAGE International employee engagement campaign; 19 Key Cities employee community investment projects currently running in 17 cities worldwide. Network of partners provide infrastructure of local support to member companies; Offering skills transfer, professional or technical advice, mentoring, one-off or strategic team projects and traditional volunteering. European Employee Volunteering Awards Run in conjunction with the 2011 European Year of Volunteering, the European Employee Volunteering Awards programme offers a profiling opportunity for companies in Europe and aims to recognise companies of all sizes across Europe that have developed employee volunteering schemes to help people facing barriers to work increase their employability skills. HRH The Prince of Wales‘ Mayday Network on climate change Convened by Business in the Community, a collaboration of businesses of all sizes and at all stages on the low carbon journey; BITC provides support and information on climate change; Annual summit Media Round-Up Daily round-up of news on responsible business practice
Research areas

Company case studies Numerous publications on five main issue areas: 1. Responsible business 2. Workplace 3. Community 4. Marketplace 5. Environment BITC is one of HRH The Prince of Wales‘ Charities, a group of notfor-profit organizations of which HRH The Prince of Wales is President Extensive range of offerings and comprehensive website Large, global membership BITC members employ 12.4 million people in +200 countries, including 1 in 5 of the UK private sector workforce 22 July 2010: HRH The Prince of Wales’ Countryside Fund, a unique collaboration of businesses working together to secure a sustainable future for British agriculture and the wider rural economy, was launched at St James‘s Palace by HRH The Prince of Wales and leaders of the food industry. HRH The Prince of Wales‘ Countryside Fund is the brainchild of HRH The Prince of Wales who has a long-held commitment to supporting Britain‘s hard pressed rural areas. The Fund is raising money from a wide range of businesses who have responded to HRH The Prince of Wales‘ call to action to help improve the long-term viability of the British countryside and its rural communities. The intention is to

Competitive advantages

Recent news / developments

PAGE 80 : Corporate Philanthropy Resource Guide

inspire other businesses and the general public to get involved and recognise the importance of the countryside to the nation‘s well-being and the wider British economy. Give & Gain Day is the UK's largest day of action for employee volunteers. Managed by Business in the Community, and sponsored by Eversheds LLP, Give & Gain Day mobilises employees to volunteer their expertise and time during work hours. On 9 July 2010 500 employee volunteers from 221 companies injected £1 million manhours into communities of greatest need by volunteering with over 190 community organisations across the UK. The recently launched Employee Volunteering Check Up is designed to help companies develop their employee volunteering whether they are just starting out, or turning a good programme into a great one. The tool assesses the current stage of an employee volunteering programme according to the answers provided in the quiz, and then gives tailored advice within five categories – business case, programme management, volunteering opportunities, employee engagement and reporting and sharing best practice. BITC‘s resources library contains examples from leading employers to illustrate each step of this journey.
CONTACT

Point of contact

Sue Adkins International Director and Founding Director of Cause Related Marketing sue.adkins@bitc.org.uk

PAGE 81 : Corporate Philanthropy Resource Guide

BSR (Business for Social Responsibility)
www.bsr.org

CONTACT Mission Type of organization

BSR works with business to create a just and sustainable world. A global business network and consultancy focused on sustainability. See www.bsr.org/member-list for more than 250 BSR member companies in multiple industries. 1992 San Francisco, California Offices in Asia, Europe & North America, and project work in more than 50 countries. Mats Lederhausen, Chair of Board Aron Cramer, President and CEO Kara Hurst, Vice President Eric Olson, Senior Vice President, Advisory Services 100 No matter where you are on the path toward sustainable business, we'll meet you there and help you advance. Our members benefit from the insights, expertise, and relationships we've built through years of hands-on work in the field. As a BSR member, your company will gain access to a powerful network of member companies, and thought leaders, peers, and stakeholders—all focused on creating viable sustainability solutions. You and your colleagues will connect to the network through our working groups, events, online collaboration tools, and the annual BSR Conference. As a member, you get exclusive access to an extensive set of solutions to help you learn, collaborate, and take action on corporate responsibility issues. Learn more at www.bsr.org/membership. Dues are based on company‘s gross annual revenue

Year of origin Headquarters location International scope Senior leadership

Number of employees Target audience

Membership fee, if applicable

SERVICES Services and programs

Consulting: With more than a decade of experience working with companies to understand, plan, implement, and account for their corporate social responsibility performance, we provide targeted and innovative solutions that address and advance social and environmental issues. Learn more at www.bsr.org/consulting

PAGE 82 : Corporate Philanthropy Resource Guide

Working Groups: BSR leads and partners in a wide-range of multi-company and stakeholder collaborative efforts to address critical and emerging issues. Connect with your peers and find collaborative solutions to critical and emerging issues. Learn more at www.bsr.org/workinggroups. The BSR Conference with 1,000+ attendees is regularly ranked among the top corporate responsibility events globally. Learn more at www.bsr.org/conference. Research and Innovation: From remote communities and factory floors to boardrooms worldwide, our Research and Innovation team creates independent, business-critical research to help you stay ahead of the curve and advance corporate responsibility in four critical areas: the environment, human rights, economic development, and governance and accountability. Learn more at www.bsr.org/research. BSR works with numerous partners and collaborators around the world: http://www.bsr.org/about/collaboration.cfm BSR is the go-to authority on sustainable business strategy, guiding global companies toward solutions that enable business success and create a just and sustainable world.

Other services

Research areas

Differentiating features of organization Competitive advantages

CONTACT Point of contact

Member Services: +1 415 984 3200 or memberservices@bsr.org

PAGE 83 : Corporate Philanthropy Resource Guide

Business Roundtable
www.brt.org

OVERVIEW Mission

Type of organization Year of origin Headquarters location Executive Committee (Senior Leadership)

Business Roundtable is an association of chief executive officers of leading U.S. companies with nearly $6 trillion in annual revenues and more than 12 million employees. Member companies comprise nearly a third of the total value of the U.S. stock markets and more than 60 percent of all corporate income taxes paid to the federal government. Annually, they pay $167 billion in dividends to shareholders and the economy. Association of chief executive officers of leading U.S. companies 1972 Washington, DC Ivan Seidenberg, Chairman of Business Roundtable, Chairman and CEO of Verizon Communications. For a full list of BRT‘s 18 member Executive Committee, click here. 17 staff CEOs, Members of Congress, Media 180 member company CEOs

Number of employees (inhouse) Target audience Size of membership / network

SERVICES Services and programs

Initiatives
Consumer Health & Retirement, Corporate Leadership, Education, Innovation & Workforce, International Engagement, Sustainable Growth

Special Initiatives
Partnership for Disaster Response BRICE: Business Roundtable Institute for Corporate Ethics Other information

BRT companies give more than $7 billion a year in combined charitable contributions, representing nearly 60 percent of total corporate giving. They are technology innovation leaders, with more than $111 billion in annual research and development spending — nearly half of all total private R&D spending in the U.S.

CONTACT Point of contact

Johanna Schneider, Executive Director, External Relations jschneider@brt.org; 202-496-3270

PAGE 84 : Corporate Philanthropy Resource Guide

Canadian Business for Social Responsibility
www.cbsr.ca

OVERVIEW Mission Type of organization Year of origin Headquarters location International scope Senior leadership

Changing the Way Business Does Business. Non-profit 1995 Vancouver, Canada Canadian focused, member of international networks CSR360 and Forum Empresa Adine Mees, President & CEO Barb Steele, Director, Membership Andrea Baldwin, Director, Advisory Services 20 Canadian business 106 companies <$1 Billion in annual gross revenues $7,900 >$1 Billion in annual gross revenues $15,800

Number of employees Target audience Size of membership / network Membership fee, if applicable

SERVICES Services and programs

Other services

Research areas

Network members receive access to Membership Services including: Customized CSR account management Access to member-only website Research Learning events Profiling opportunities Peer-to-peer networking CBSR also operates an active Advisory Services consulting practice working across the range of CSR activity – providing services to member and non-member companies 2010 Topics Include Building Sustainable Company Culture, Measuring Community Impact, Collaboration, Water, CSR Governance Staff located in Vancouver, Calgary and Toronto Work collaboratively with government, academics and NGO sector 15 years of CSR learnings within the CBSR network of companies are applied on-going to Membership Services, Advisory Services and Research activities. Canadian focused CSR support and advice for Canadian

Differentiating features of organization

Competitive advantages

PAGE 85 : Corporate Philanthropy Resource Guide

companies from experienced CSR professionals
Recent news / developments

The 8 Annual CBSR Summit on CSR will be held October 21, 2010 in Toronto. This year‘s theme is Collaborating for Sustainable Change. For more information visit www.cbsr.ca/summit

th

CONTACT Point of contact

Robyn Hall, Communications Manager 416-703-7435 ext. 232 robyn@cbsr.ca

PAGE 86 : Corporate Philanthropy Resource Guide

Cause Marketing Forum
www.causemarketingforum.com

OVERVIEW Mission Type of organization Year of origin Headquarters location Senior leadership Number of employees Target audience Size of membership / network Membership fee, if applicable

Cause Marketing Forum, Inc. was founded in 2002 to help companies and nonprofits do well by doing good. Service business 2002 Rye, New York David Hessekiel, Founder and President 4 Business and nonprofit executives interested in creating more successful, mutually-beneficial cross-sector alliances 400 members, 5,000 subscribers Corporate membership: $1,000 per year

SERVICES Services and programs

The Cause Marketing Forum Conference The Cause Marketing Halo Awards The CM Guide at causemarketingforum.com - Case studies, best practices, ―Cause Marketing 101‖ Cause Marketing Forum Workshops and Teleclasses Cause Alliance Research Service - Offers specialized background profiles on nonprofit organizations for corporations researching potential partners: Companies & Causes Days - regional workshop focused on promoting business/nonprofit alliances in major cities Monthly email newsletters on new developments in cause marketing Case studies of business/nonprofit alliances Tight focus on helping businesses and nonprofits succeed together at building better mutually-beneficial alliances.

Other services Research areas Differentiating features of organization

CONTACT Point of contact

David Hessekiel (914) 921-3914 dh@causemarketingforum.com

PAGE 87 : Corporate Philanthropy Resource Guide

Committee Encouraging Corporate Philanthropy
www.CorporatePhilanthropy.org
OVERVIEW

Mission

Type of organization Year of origin Headquarters location International scope Senior leadership

The mission of the Committee Encouraging Corporate Philanthropy (CECP) is to lead the business community in raising the level and quality of corporate philanthropy. CECP‘s three guiding principles are to represent the CEO voice in corporate giving, to promote business discipline in corporate philanthropy, and to set the standards for philanthropy practice and measurement International membership organization for business CEOs and chairpersons 1999 New York, NY International membership Harold McGraw III, Chairman of Board of Directors Charles Moore, Executive Director Margaret Coady, Director 8 Business CEOs and chairpersons (membership is by invitation). Supporting research and convenings are also available to senior corporate giving professionals at member companies. Over 150 CEOs and chairpersons, including representation from many of the world‘s largest companies. $10,000 – annual CECP membership fee includes access to research, CEO and corporate giving officer events, and Corporate Giving Standard (CGS) measurement system. OR $1,500 - $5,000 (based on a revenue scale) - annual subscription fee for the Corporate Giving Standard (CGS) measurement system.

Number of employees Target audience

Size of membership / network Membership fee, if applicable

SERVICES Services and programs CEO Conference CECP's annual 'Board of Boards' Conference is a CEOexclusive event for eminent business leaders to share their perspectives on leadership in corporate philanthropy. http://www.corporatephilanthropy.org/events/ceoconference.html Corporate Philanthropy Awards CECP presents Excellence Awards annually to companies demonstrating outstanding CEO leadership, innovation, dedication to measurement, and partnership in corporate

PAGE 88 : Corporate Philanthropy Resource Guide

giving, and to a nonprofit organization for excellence in sustainable corporate partnerships. http://www.corporatephilanthropy.org/events/excellenceawards.html Online Philanthropy Measurement CECP member companies gain access to the Corporate Giving Standard (CGS), an online peer benchmarking database containing more than $70 billion in cash and product giving in comparative philanthropy data. http://www.corporatephilanthropy.org/measurement/cgs.html International Corporate Philanthropy Day (ICPD) CECP leads an annual day of celebration, including a joint program with the United Nations and member initiatives, to build international awareness of corporate philanthropy among business leaders, employees, government organizations, and the general public. www.CorporatePhilanthropy.org/ICPD Corporate Philanthropy Summit CECP convenes 170 senior giving professionals each year, providing attendees the opportunity to learn from industry experts and engaged CEOs, as well as peers who share similar giving challenges and priorities. http://www.corporatephilanthropy.org/events/summit-upcoming.html Best Practice Publication CECP's publication, The Corporate Philanthropist, features thought leadership on key trends in corporate philanthropy from CEO members and leading industry thought leaders. http://www.corporatephilanthropy.org/research/bestpractices/the-corporate-philanthropist.html Research areas Corporate giving trend analyses from the Corporate Giving Standard measurement tool Summary Reports from CEO and Giving Officer Conferences Thought leadership publications with future-oriented research themes Impacts measurement of the social and business benefits of corporate giving CECP is the voice of corporate philanthropy, representing the CEO perspective on leadership in corporate giving to the public and the media. Peer networking opportunities for CEOs and corporate giving professionals through CECP hosted programs. Unparalleled philanthropy measurement through CECP's reporting and benchmarking program, the Corporate Giving Standard (CGS). Resources for corporate philanthropy professionals including industry roundtable discussions, media opportunities, publications, research, and unparalleled networking.

Differentiating features of organization

PAGE 89 : Corporate Philanthropy Resource Guide

Competitive advantages

The only international forum of business CEOs and chairpersons exclusively focused on corporate philanthropy. Unparalleled ability to convene leading CEOs and corporate giving professionals. Data repository for over $70 billion of cash and product philanthropic giving. Access to comprehensive data to analyze trends and compile industry knowledge. New cutting-edge research reports include: ―Shaping the Future: Solving Social Problems through Business Strategy,‖ based on research by McKinsey & Company; and ―Measuring the Value of Corporate Philanthropy: Social impact, business benefits, and investor returns.‖ First international Board of Boards CEO Conference held in London on May 7, 2010. th 6 Annual Board of Boards CEO Conference scheduled for February 28, 2011 (International Corporate Philanthropy Day), featuring panelists Indra Nooyi, Chairman and CEO, PepsiCo, William D. Green, Chairman and CEO, Accenture, and Emmy Award winning journalist Charlie Rose as moderator. CECP‘s 2011 Corporate Philanthropy Summit will be held on June 1-2, 2011, at the Time Warner Center in New York.

Recent news / developments

CONTACT Point of contact

Courtney King, Manager, Communications cking@corporatephilanthropy.org, 212-825-2126

PAGE 90 : Corporate Philanthropy Resource Guide

The Conference Board
www.conference-board.org

OVERVIEW Mission

The Conference Board creates and disseminates knowledge about management and the marketplace to help businesses strengthen their performance and better serve society. Working as a global, independent membership organization in the public interest, we conduct research, convene conferences, make forecasts, assess trends, publish information and analysis, and bring executives together to learn from one another.

Type of organization Year of origin Headquarters location International scope Senior leadership

Membership organization for businesses 1916 New York (world headquarters) Belgium, Hong Kong Additional offices in North America (1), Europe (11), Asia-Pacific (2) Jonathan Spector, President & CEO Chair of Board of Trustees: Douglas R. Conant, President and Chief Executive Officer, Campbell Soup Company Approximately 300 worldwide Large, global corporations Nearly 1800 companies in 63 countries. Combined, member companies have revenues totaling $10 trillion and employ over 34 million people 19 of the 20 largest U.S. companies, 80% of the Fortune 100 companies, and all of the 20 most respected companies in the world are members Membership fee varies

Number of employees Target audience Size of membership / network

Membership fee, if applicable

SERVICES Services and programs

Topic-based, senior executive peer-to-peer meetings in a confidential setting to discuss challenges, share best practices, advance thought leadership, and find solutions. In-depth, customer-driven research on trends, issues, and challenges facing corporate decision makers Research Publications Economic research, analyses, forecasts and publications, including Consumer Confidence , Leading Economic Indicators of 11 nations, Help-Wanted Online, Consumer Spending Trends, Straight Talk series Bi-monthly magazine: The Conference Board Review Program categories: CEO / C-Suite Citizenship & Sustainability

PAGE 91 : Corporate Philanthropy Resource Guide

Center for Corporate Citizenship & Sustainability: Conferences, councils, webcasts, research working groups, research publications, executive leadership summit, on-site executive briefings Founding members: Bayer, Boeing, Campbell Soup, Cox Enterprises, Disney, Dole Food, Dow Corning, Merck, Philip Morris USA, State Street Corporation, PriceWaterhouseCoopers, Time Warner, United States Postal Service www.conference-board.org/knowledge/citizenshipcenter Diversity Economics Ethics Governance Human Resources Leadership Development Marketing Mid-Market Sector Operations Risk Management Within Citizenship & Sustainability: Center for Corporate Citizenship and Sustainability Conferences Councils Working Groups Publications Partnerships with World Bank Institute, Kennedy School of Government, Pfizer, IBLF, and Global Alliance for Improved Nutrition Other Citizenship Programs: Conferences: Business & Education, Global Corporate Citizenship & Sustainability Councils: Business/Education Council, Community and Public Issues Council, Contributions Council (2), European Council on Corporate Responsibility and Sustainability Research Working Groups: Changing topics. For example: Corporate Response to Humanitarian Disasters, Stakeholder Engagement on the Global Stage/Special Focus: China Publications: Ongoing research reports. For example: Annual reports on Corporate Contributions, ―CEO Confidence Survey,‖ “Corporate Giving Priorities and Challenges,” “Risk and Opportunity in the Gathering Climate Change Storm”
Other services

Ron Brown Award for Corporate Leadership Administered by the Conference Board; Only Presidential award to honor companies for the exemplary quality of their relationships with employees and communities; Annual award presented at The White House to companies that have demonstrated a deep commitment to innovative initiatives that not only empower employees and communities but also advance strategic business interests. Business Information Service Comprehensive resource center for business intelligence; Staff of skilled information professionals uses online databases, CD-ROMs, and the Internet as well as the library‘s extensive collection of directories, periodicals, statistical sources and

PAGE 92 : Corporate Philanthropy Resource Guide

Research areas

Differentiating features of organization

Competitive advantages

Conference Board research to answer over 3,500 inquiries each year. -Extensive, timely research in above program areas -Business Information Service (see above) -See website for complete list of publications Preeminent, global business organization that equips the world‘s leading corporations with practical knowledge to improve business performance and better serve society through its deep network of information resources and experts, issues-oriented research, and senior executive peer-to-peer meetings. -Timely, relevant thought leadership and executive learning from a market-driven, cross-functional approach to challenges facing senior executives today. -Renowned, acclaimed researchers and economists on staff. -Large scale and network: Over 15,000 executives from six continents participate annually in more than 200 conferences, 120 councils, 20 research working groups and 50 webcasts -The Conference Board names Jonathan Spector, Vice Dean of the th Wharton School, as its 11 President th -Celebrated 90 anniversary in 2006 -Launched China Center for Economics and Business in 2006 -New Center for Corporate Citizenship and Sustainability Mission: to advance CC&S practice and thought leadership to strengthen the rationales for business models and decisions that produce both private and public value Role of center: to help companies find the opportunities and avoid the risks inherent to CC&S by helping them to develop a knowledge base and active strategies to meet CC&S needs, build the value proposition for CC&S initiatives, and publicly report on their CC&S performance Components: Advisory Board, Executive Leadership Summit, Councils, Conferences, Research working groups, Executive Action reports, Executive briefings, Webcasts -2006 emphasis on partnerships Worked with US Business Council (survey of CEO sentiment about business conditions), INSEAD & London Business School (joint research and seminars), military academies, National Safety Council, Harvard & Shorenstein Foundation, The Atlantic Philanthropies -Membership growth in Asia -Notable increased use of webcasts by members The Conference Board Global Counsellors A large network of leaders having international stature and outlook provide a vital network and critical insight to The Conference Board Chief Economist Bart van Ark of the Netherlands is the first nonAmerican chief economist in the history of The Conference Board.

Recent news / developments

Other information

PAGE 93 : Corporate Philanthropy Resource Guide

CONTACT Point of contact

Contact the following individuals based on area of interest: Membership: Janet Etsch, janet.etsch@conference-board.org, 212-339-0247 Center for Corporate Citizenship & Sustainability: David Vidal, david.vidal@conference-board.org, 212-339-0445 Conferences and Sponsorship opportunities: Marion Feigenbaum, marion.feigenbaum@conference-board.org, (212) 339-0378 Councils: Lorrie Foster, lorrie.foster@conference-board.org, 212339-0410 Research Working Groups: Willem Overmeer, Willem.overmeer@conference-board.org, 212-339-0332 Webcasts: Meg Gottemoeller, meg.gottemoeller@conferenceboard.org, 212-339-0318 Economics: Bart van Ark, bart.vanark@conference-board.org, (212) 339-0325 All other inquiries: U.S. Customer Service: 212-339-0345

PAGE 94 : Corporate Philanthropy Resource Guide

Corporate Responsibility Officer (CR Magazine)
www.thecro.com

OVERVIEW Mission

Type of organization Year of origin Headquarters location International scope Senior leadership

The mission of The Corporate Responsibility Officer (CRO) is to be the ―big tent‖ in which leaders in all Corporate Responsibility domains can gather to further the professionalization of CR functions of all types—governance, compliance/legal/accounting, sustainability, CSR, SRI, philanthropy, citizenship. Magazine, Conferences and Membership media organization for corporate responsibility officers 2006 Edison NJ US, Canada, European Community Elliot Clark, CEO Jay Whitehead, President & Publisher Dirk Olin, VP – Editorial Director Anne-Sophie Ribault - CMO 18 1) Corporate Responsibility practitioners, 2) Providers of corporate responsibility services, 3) Influencers in the field (NGOs, academics, and policy makers) CROA Corporate members total 160+ companies. CR Magazine is distributed to 27,000 executives at large and mid-size public and private companies and nonprofit organizations. TheCRO.com receives over 100,000 unique monthly visitors. CROA membership: Small Business/Non-Profit/Academic/Individual Member: US$1,495 / € 1,000 Mid-Sized Corporate Membership & Subscription. US$3,485 / € 3,000 Large-Sized Corporate Membership & Subscription. US$6,995 / € 6,000 Premium Corporate Membership & Subscription. US$20,000 / €16,000

Number of employees Target audience

Size of membership / network

Membership fee, if applicable

SERVICES Services and programs

Increases the strategic impact of corporate responsibility officers (CROs) by further professionalizing and integrating the following disciplines: Audit, Risk Management and Compliance & Ethics Corporate Responsibility, CSR, Citizenship Sustainability Socially Responsible Investing (SRI) and Philanthropy

PAGE 95 : Corporate Philanthropy Resource Guide

Other services

Research areas Differentiating features of organization

3 Annual Conferences (2 in US, 1 in Europe) CRO Magazine (6 issues/year) E-newsletter (26 issues/year) TheCRO.com Webinars CR research, including 100 Best list, and custom research 100 Best Corporate Citizens list in CR Magazine Provider Directory of 700+ CR-related service providers CRO Profiles Corporate Responsibility Reports on TheCRO.com 1) Sole focus on CR professional practices 2) Continuous collaboration between practitioners and providers as a community to advance all domains of Corporate Responsibility in corporations worldwide Launch of the CRO association in Europe, international partnership with NYSE Euronext

Competitive advantages

Recent news / developments

CONTACT Point of contact

Jay Whitehead, President & Publisher, jay.whitehead@sharedxpertise.com Phone 732-476-6160

PAGE 96 : Corporate Philanthropy Resource Guide

CSR Europe
www.csreurope.org

OVERVIEW Mission Type of organization Year of origin Headquarters location International scope Senior leadership

CSR Europe supports companies in integrating corporate social responsibility into the way they do business. Business network for corporate social responsibility 1995 Brussels, Belgium Europe Executive Director President 15-member Board of Directors 10 Businesses – multinational companies Membership of around 70 leading multinational corporations Membership of 27 national partner organisations reaching out to more than 2,000 companies across Europe The membership fee is €17,500/year paid on cyclical basis New members pay an additional fee of €5000 upon entry

Number of employees Target audience Size of membership / network

Membership fee, if applicable

SERVICES Services and programs

Expertise and information services: CSR Europe offers tailored support and information services to provide members with practical tools and updates on the latest European and international CSR developments. CSR Europe‘s website also offers a wide range of publicly available resources, e.g. publications and a database of more than 600 CSR case examples. Best practice exchange: CSR Europe connects member companies and national partners for the sharing and further development of CSR best practices through events, working groups and other activities. Collaborative projects with stakeholders: CSR Europe and its national partner organisations bring member companies together with relevant stakeholders to seek innovative solutions to socioeconomic challenges through joint projects. European stakeholder dialogue: CSR Europe has since its inception played an important role in providing input to the European CSR policy debate and acting as a platform for dialogue between companies, policymakers and other stakeholders at the European level. In addition to its corporate members, CSR Europe reaches out to

Other services

PAGE 97 : Corporate Philanthropy Resource Guide

Research areas

Differentiating features of organization Competitive advantages

the national and regional level through its national partner organisations – a network of 27 CSR organisations in 23 countries across Europe. CSR Europe offers tools and information resources on a range of topics, e.g. as part of the CSR Toolbox available at www.csreurope.org/toolbox. CSR Europe is the leading European business network for CSR. CSR Europe is the leading European reference organisation on CSR and works closely with the European Commission and other EU stakeholders.

CONTACT Point of contact

info@csreurope.org

PAGE 98 : Corporate Philanthropy Resource Guide

European Foundation Centre
www.efc.be

OVERVIEW Mission Type of organization Year of origin Headquarters location International scope Senior leadership Number of employees Target audience Size of membership / network Membership fee, if applicable

To strengthen the independent funding element of European philanthropy through robust cooperation with an array of partners. Independent international not-for-profit association. 1989 Brussels, Belgium International Gerry Salole, Chief Executive Officer 27 Foundations and corporate funders in Europe and around the world. 234 Members in 40 countries around the world. The annual EFC membership fee is 4,000 €. Members are encouraged to contribute a voluntary proportional membership contribution over and above the 4,000 € annual membership fee, based on either the organisation‘s expenditure or assets.

SERVICES Services and programs

The EFC develops and pursues activities in line with its objectives: Benchmarking and capacity-building - The EFC aims to set standards and build professional capacity in the sector through a wide range of benchmarking and training activities. All members undertake to respect the EFC Principles of Good Practice. Creating an enabling legal and fiscal environment The EFC is leading the campaign for the creation of a European Foundation Statute, which would make it easier for foundations that wish to develop cross-border activities in the EU. Documenting the foundation landscape - To facilitate the sharing of knowledge and information, and raise awareness about the valuable work foundations are doing, the EFC produces numerous publications including Effect magazine (twice per year). Networking and partnership building - The EFC

PAGE 99 : Corporate Philanthropy Resource Guide

promotes collaboration, both among foundations and between foundations and other actors, to advance the public good in Europe and beyond. The EFC’s annual conference is the most important opportunity for professionals in the European foundation sector to meet each other and share ideas. EFC members have established a range of Interest Groups and Forums which facilitate cooperation and exchanges of good practice in various fields of activity including: diversity, migration and integration; human rights and disability; protecting the environment; HIV/AIDS; global health challenges; social investment; central and eastern Europe. The EFC hosts the secretariat of Donors and Foundations' Networks in Europe (DAFNE), which supports cooperation among national networks which have been established in 22 European countries.
Other services

The EFC disseminates the latest news on foundations active in Europe, delivered through a monthly electronic news round-up, thematic newsletters, and EFFECT magazine. The Centre also undertakes: • Promotion of EFC member interests to the EU institutions on policy issues, close monitoring of developments that matter to foundations, and representation and advocacy from the Brusselsbased EFC Secretariat • Training and exchange programmes for European foundation professionals • Expert advice, small mappings, and information services produced using EFC databases: on tap know-how and resources about what foundations are doing when, where and how • Access to interest groups that gather like-minded funders and which promote the pooling of resources and expertise • Reduced rates and the opportunity to shape the content of EFC flagship events, including the Annual General Assembly and Conference, Grantmakers East Forum, and European Forum on Philanthropy and Research Funding • Available office and meeting space for members visiting Brussels

Research areas Differentiating features of organization

Not applicable Funders working effectively together for the public good increases the visibility of the sector, adds to public trust, and brings further legitimacy to the important work of foundations in Europe. A growing EFC membership over the past 20 years has allowed

PAGE 100 : Corporate Philanthropy Resource Guide

for stronger representation at the EU institutions, which is essential as EU policy unavoidably affects the work of foundations.

Competitive advantages

Recent news / developments

The EFC is the main portal, source of information, and reference point for the European Philanthropic market. The Centre provides an exceptional forum for meeting people with common interests and values, exchanging ideas, learning from others' experiences and cultures - all well beyond European boundaries. This is the basis of cooperation among foundations. European Economic and Social Committee gives strong backing to European Foundation Statute http://www.efc.be/News/Pages/EuropeanEconomicandSocialCom mitteegivesstrongbackingtoEuropeanFoundationStatute.aspx EFC hosts first-ever Foundation Week http://www.efc.be/AgaConference/Pages/2010-Brussels.aspx Anniversary book documents EFC's first 20 years http://www.efc.be/News/Pages/EFC20thAnniversaryBook.aspx Study on the Implementation of the UN Convention on the Rights of Persons with Disabilities presented to Commission’s High Level Group on Disability http://www.efc.be/News/Pages/StudyUNCRPD_HLGD.aspx EFC and Fondazione Cariplo launch new training series http://www.efc.be/News/Pages/EFCandFondazioneCariploareplea sedtoannouncethelaunchofadynamicnewtrainingseries.aspx

CONTACT Point of contact

Triona Keaveney European Foundation Centre, AISBL 78, avenue de la Toison d'Or 1060 Brussels, Belgium communications@efc.be tel.: +32.2.512.8938 • fax: +32.2.512.3265

PAGE 101 : Corporate Philanthropy Resource Guide

Forum of Regional Associations of Grantmakers
www.givingforum.org

OVERVIEW Mission

Type of organization Year of origin Headquarters location Senior leadership Number of employees Target audience Size of membership / network Membership fee, if applicable SERVICES Services and programs

The Forum of Regional Associations of Grantmakers supports, connects and expands geographic associations of grantmakers to strengthen and increase philanthropy. Membership association serving grantmakers First forum of RAs in 1940s Forum officially established 1996 Washington, DC Michael Litz, President & CEO George Espy, Chair of Board 5 Regional Associations of Grantmakers (RAs) Network of 34 RAs that represent 4,500+ foundations, corporations, organizations, and individual donors 1.1% of member‘s operating budget

Other services Differentiating features of organization CONTACT Point of contact

Networking: Meetings, workshops, teleconferences, conferences Conferences, Information and research, Brokered benefits Regional Association Capacity-Building & Peer Learning: Add value to regional associations in building and maximizing their financial and human resources, and to connect and learn from each other Grantmaker Education: Augment regional associations‘ own roles in helping their region‘s grantmakers be their most knowledgeable/effective Knowledge and Collective Leadership: Position the Forum - through its member regional associations and New Ventures partners - as collective nationwidelocal resources on philanthropy Forum Organizational Development: Ensure internal capacity to advance the member priorities above, by addressing the organization‘s funding, governance, communications and staffing needs Programs, services, and written materials that RAs can offer directly to their own members Only national organization focused on regional philanthropy

Mary O‘Neill moneill@givingforum.org 703-879-0811

PAGE 102 : Corporate Philanthropy Resource Guide

Independent Sector
www.independentsector.org

OVERVIEW Mission

The mission of Independent Sector is to advance the common good by leading, strengthening, and mobilizing the nonprofit and philanthropic community. Coalition of nonprofit, foundations, and corporate giving programs working together to make a greater difference in improving people‘s lives 1980 Washington, DC Brian Gallagher, Chairman of Board of Directors Diana Aviv, President and CEO 40 positions Nonprofits, foundations, and corporate giving programs, as well as those who work with them Approximately 550 organizations Varies according to payroll of organization or grantmaking budget

Type of organization

Year of origin Headquarters location Senior leadership Number of employees Target audience Size of membership / network Membership fee, if applicable

SERVICES Services and programs

Advocates for public policies that enable the nonprofit community to improve lives Helps the nonprofit community be more effective Connects leaders from across the nonprofit community so they can develop ideas and take action Helps demonstrate how the nonprofit community makes a difference in people‘s lives everywhere Independent Sector Annual Conference—annual gathering of 800 or more nonprofit leaders to respond to challenges facing our organizations and communities Principles for Good Governance and Effective Practices, 33 recommendations that help organizations meet high standards of legal compliance, effective governance, strong financial oversight, and responsible fundraising. NGen: Moving Leaders from Next to Now program, which build the networks and leadership skills of nonprofit professionals under age 40 Charting Impact initiative, which provides organizations of all sizes and missions with a common framework and language

Other services

PAGE 103 : Corporate Philanthropy Resource Guide

for conveying their efforts to achieve lasting, meaningful change. Policy Action Network, a growing network of staff at IS member organizations that work together on key policy issues in the federal government, state legislatures, and city halls. Envisioning Our Future, a sector-wide effort designed to all shape a more desirable 2020 for organizations and communities. Series of committees and task forces drawn from member organizations that focus on major areas such as public policy, ethics and accountability, communications, and effectiveness. Work on increasing diversity within the charitable sector
Research areas Differentiating features of organization Recent news / developments

Value of volunteer time Public perceptions of nonprofits IS is the only national organization where both nonprofits and foundations come together to address issues of common concern. Leading advocate in ensuring small nonprofits were included were included in health care reform provisions. Key part of coalition that helped Serve America Act become law. Individuals and for-profit companies who work with the nonprofit community and share the values of Independent Sector are also eligible for membership through our Individual and Business Associates program.

Other information

CONTACT Point of contact

Lorraine Snebold, 202-467-6132, lorraines@independentsector.org

PAGE 104 : Corporate Philanthropy Resource Guide

Giving Institute: Leading Consultants to Non-Profits
www.givinginstitute.org

OVERVIEW Mission

The mission of Giving Institute is to educate and engage members in the ethical delivery of counsel and related services to non-profits through research, advocacy, and best practices. Membership association – philanthropic resources 1935 Glenview, Illinois Nancy L. Raybin, Board of Directors Chair Karyn Humphries, Operations Manager 32 firms

Type of organization Year of origin Headquarters location Senior leadership Size of membership / network

SERVICES Services and programs

GIVING USA
Published annually by the Giving USA Foundation in partnership with The Center on Philanthropy at Indiana University; America's most frequently quoted and widely circulated reference compilation of annual giving; Statistical breakdown with year-by-year analysis by source, recipient, and location

Other services Competitive advantages Differentiating features of organization Other information

Standards of Practice Code of Ethics Summer symposium Code of Ethics, Thought Leadership Code of Ethics, Standards of Practice Formerly named the American Association of Fundraising Counsel (AAFRC)

CONTACT Point of contact

info@givinginstitute.org 847/375-4709 or toll free 800/462-2372

PAGE 105 : Corporate Philanthropy Resource Guide

Global Philanthropy Forum
www.philanthropyforum.org

OVERVIEW Mission

Type of organization Year of origin Headquarters location International scope Senior leadership

A project of the World Affairs Council of Northern California, the Global Philanthropy Forum aims to build a community of donors and social investors committed to international causes, and to inform, enable and enhance the strategic nature of their work. World Affairs Council of Northern California is a 501(c)(3) non-profit organization 2001 San Francisco, California International Jane Wales, President and CEO of the World Affairs Council of Northern California, Founding President, Global Philanthropy Forum 3 Donors, family foundations and social investors 750+ $1,700 - $75,000+

Number of employees Target audience Size of membership / network Membership fee, if applicable

SERVICES Services and programs

Through an annual conference, seminars, special events and learning opportunities, the GPF connects donors to issues; to effective strategies; to potential co-funding partners; and to emblematic agents of change from around the world. By building, and continually refreshing a lasting learning community, the GPF seeks to expand the number of philanthropists who will be strategic in pursuit of international causes.

CONTACT Point of contact

info@philanthropyforum.org

PAGE 106 : Corporate Philanthropy Resource Guide

Global Reporting Initiative (GRI)
www.globalreporting.org

OVERVIEW Mission

GRI‘s mission is to create conditions for the transparent and reliable exchange of sustainability information through the development and continuous improvement of the GRI Sustainability Reporting Framework. The Global Reporting Initiative (GRI) is an international networkbased organization that has pioneered the development of the world‘s most widely used sustainability reporting framework and is committed to its continuous improvement and application worldwide. GRI is a collaborating center of the United Nations Environment Programme (UNEP). 1997 Amsterdam, The Netherlands In 2009 over 1.300 organizations from over 65 countries actively declare the use of GRI Guidelines and disclose their sustainability 1 performance with reference to GRI (as of July 2010) . Ernst Ligteringen, Chief Executive Mervyn E. King, Chairman of the Board of Directors 16-member Board of Directors Up to 60-member Stakeholder Council 10-member Technical Advisory Committee Approximately 50 GRI reporters (all kinds of organizations of all sizes globally) GRI report users (media, employees, financial markets, governments, NGOs, public/consumers, trade unions) GRI network (international network from business, civil society, labor, and professional institutions) Organizational stakeholders: Over 550 organizations from varying backgrounds and sectors, from over 50 countries. Organizational Stakeholders voluntarily contribute annually on a sliding scale based on annual turnover. In exchange, OS enjoy voting rights in GRI Stakeholder Council and a set of additional benefits.

Type of organization

Year of origin Headquarters location International scope

Senior leadership

Number of employees Target audience

Size of membership / network Membership fee, if applicable

SERVICES Services and programs

Training: GRI‘s Certified Training Program – which is implemented by local GRI Certified Training Partners. Developed to help report makers and users to use the GRI Framework and GRI reports more effectively.

1

Please note that this is the number of GRI reports registered with the GRI Reporting Services. As the Guidelines are made freely available as a public good, with no obligation to notify GRI of their use, the actual figure is likely to be higher.

PAGE 107 : Corporate Philanthropy Resource Guide

Application Level Check: A GRI-checked Application Level is a service for reporters that are seeking to combine a high degree of transparency and demonstrate that their Application Level is confirmed. Learning Publications: The GRI Learning Publications series aims to help make sustainability practices part of the everyday practices of all organizations. The publications are divided into 3 categories, each aimed at a different target audience. GRI Software & Tools Certification Program: a program for certifying software and digital tools that contain any GRI copyright protected content, such as the GRI Sustainability Reporting Framework and GRI Learning Publications. Workshops – GRI has developed different Workshops which are given by GRI staff to provide participants with a general introduction to GRI and the services it provides. Research & Development publications series: Available for free download, they support the use of the Reporting Framework, either by providing specialized resources, issuespecific research, linkages with other corporate responsibility initiatives or other forms of reporting advice.
Research areas

Differentiating features of organization

Climate Change, Human Rights, Supply Chain Reporting, Reporting for Smaller Enterprises, Integrated Reporting, Materiality, Stakeholder Engagement. All research projects cover issues included in the Guidelines through performance indicators. GRI‘s resource documents help reporting organization to better explore the key issues between reporting and certain sustainability issues, fostering increased understanding of performance and accountability dimensions of these issues. GRI‘s Reporting Framework is recognized as the global standard in sustainability reporting and is developed and continuously improved using a consensus-seeking process involving practitioners worldwide with diverse backgrounds. Business, civil society, labor, accounting, investors, academics, governments, and practitioners are all included in multi-stakeholder negotiations. Strong market position, single global market player Standard in sustainability reporting Declared use by over 1,300 organizations worldwide Expanding and maturing network Captive and growing audience for reporting Partnership with UNEP, UN Global Compact and harmonization with other CSR initiatives Business case for investors emerging as a driver for sustainability reporting Consolidation of reporting enables rating/ranking, scoring, benchmarking within sectors Government Advisory Group - currently consists of representatives from 8 countries, the European Parliament and the UNEP. Working with Financial Markets (information providers, rating agencies and exchanges) on embedding GRI guidelines into their research methodologies. Strong supply chain and SME focus

Competitive advantages

PAGE 108 : Corporate Philanthropy Resource Guide

Recent news / developments

Implementation of international certified training program by Certified GRI Training Partners worldwide rd From 26 to 28 May 2010 the 3 ―Amsterdam Global Conference on Sustainability and Transparency‖ took place, with over 1200 participants and more than 200 speakers, to discuss and agree the next steps for sustainability reporting Technical improvements on issues covered in the GRI G3.1 Guidelines, Sector Supplements and moving towards Integrated Reporting

CONTACT Point of contact

Marjolein Baghuis, Director Marketing & Network Baghuis@globalreporting.org +31 20 531 00 00

PAGE 109 : Corporate Philanthropy Resource Guide

Grantmakers for Effective Organizations
www.geofunders.org

OVERVIEW Mission

Type of organization Year of origin Headquarters location International scope Senior leadership

Understanding that grantmakers are successful only to the extent that their grantees achieve meaningful results, GEO promotes strategies and practices that contribute to grantee success. Nonprofit, member organization 1997 Washington, DC Limited, around 15 international members Kathleen Enright, president and CEO; Courtney Bourns, vice president of programs; Nancy Murphy, vice president of special initiatives; J McCray, director of operations 12 Grantmakers More than 2,000 individuals representing 350 organizations Fees range, please visit http://www.geofunders.org/joinbenefits.aspx for details

Number of employees Target audience Size of membership / network Membership fee, if applicable

SERVICES Services and programs

Conferences: A biennial national conference and topical conferences. Action Learning: Brings together grantmakers to address pressing grantmaking challenges. Participants hear how their peers are creating change and translate collective lessons into immediate advances in their own work. Services: Peer-to-peer problem-solving, skill-building seminars and speaking engagements. Publications: Original research, action guides, and more. Resource Library: Online access to thousands of philanthropy related resources. Networking Opportunities: Connecting members through email listserv, event calendar, and online forums. Content areas include Learning for Improvement, Leadership Development, the Money and Stakeholder Engagement. Challenging the status quo is rarely easy, especially in a field traditionally resistant to change. But we believe that smarter grantmaking leads directly to stronger nonprofits and better results.

Research areas Differentiating features of organization

PAGE 110 : Corporate Philanthropy Resource Guide

To advocate for change, GEO provides its members with resources and learning opportunities to help them improve.
Recent news / developments

GEO‘s newest initiative, Scaling What Works, a nearly $5 million, three-year project of Grantmakers for Effective Organizations, will leverage what grantmakers are learning about how to best expand solutions to society‘s most pressing problems. By clarifying what‘s working on the ground, this project will ensure that public and private resources, including SIF dollars, can more effectively flow to the highest performing nonprofits.

CONTACT Point of contact

Membership inquiries: Laurel Jacobsen (Jacobsen@geofunders.org) or Jason Twiss (twiss@geofunders.org) Information on upcoming events: Kamasha Hendrickson (hendrickson@geofunders.org) Publication requests: Suzi Van Sickle (vansickle@geofunders.org)

PAGE 111 : Corporate Philanthropy Resource Guide

International Business Leaders Forum (IBLF)
www.iblf.org

OVERVIEW Mission

The International Business Leaders Forum (IBLF) works with business, governments and civil society to enhance the contribution that companies can make to sustainable development. Not-for-profit forum for businesses, NGOs, governments, development agencies and local organizations 1990 London IBLF has offices in London, Hong Kong, Moscow, Delhi and New York as well as partners and associates in over 60 countries Graham Baxter, Acting CEO E. Neville Isdell, Chairman of Board of Trustees & Former CocaCola Chairman & CEO Mark Foster, Vice Chairman IBLF and Group CEO, Accenture John Brock, Chairman, IBLF Americas and Chairman, Coca-Cola Enterprises Paul Walsh, Deputy Chairman and Chairman, IBLF Europe & IBLF Africa and Chief Executive, Diageo Businesses, NGOs, governments, development agencies, local organizations ―Supported by over 100 of the world‘s leading businesses‖ Lengthy list of Development partners Corporate supporters provide annual charitable donation in line with the extent of their engagement with IBLF‘s work, with additional payments linked to specific projects Tiered corporate membership 1. Global Corporate Partners 2. Regional Corporate Partners 3. Program supporters

Type of organization Year of origin Headquarters location International scope Senior leadership

Target audience Size of membership / network Membership fee, if applicable

Other information

SERVICES Services and programs

IBLF offers: The IBLF Forum, where Corporate Partners can meet and debate in a safe space, challenging issues at the highest level both globally and regionally. The opportunity to be at the edge of new thinking, shaping responses to new challenges A bridge to working with key stakeholders and development actors A connected ecosystem in programme areas designed to address the challenges of today and tomorrow

PAGE 112 : Corporate Philanthropy Resource Guide

Access to unique expertise of talented staff and a network of associates, partners and affiliates for strategic advice and practical approaches Action together with others in areas that matter to your company We enable companies to work collectively around key themes which are clustered in 5 areas: Business Standards To reduce operating costs/reputation risks in markets where government regulation is inadequate or ineffective Human Capital To improve the lives of vulnerable people through business action on education and health Prosperity To create sustainable employment via the core activities of responsible business, creating wealth and prosperity Environment To help companies and communities cope with climate change and other environmental issues Partnership To build the capacity of all sectors to work collaboratively to achieve sustainable development goals, positioning business as a lead partner in development IBLF invites Corporate Partners to engage with us specifically on one or more of these clusters. Each cluster has a number of key programme areas where we bring together interested parties to tackle issues, share and create new understanding, knowledge and ways of working, and come together to set standards and drive collective action. Corporate Partners also have the opportunity to work with us on tailored work around discrete issues or opportunities. Such work may be confidential to the Corporate Partner, but we will draw out generic lessons to disseminate within and across sectors on topics such as: employee and stakeholder engagement, cross-sector partnership, activity reviews and case studies, community investments and benchmarking, which will benefit all Corporate Partners through IBLF‘s shared learning platform. Numerous research publications and case studies Independent, unaligned to any political, partisan or national interests. It is not a representative or trade organization. We advocate and promote business leadership in corporate responsibility and development across multiple sectors, markets and issues and do not represent or endorse individual companies, sectors or markets.

Other services

Research areas Differentiating features of organization

CONTACT Point of contact

Telephone: +44 (0)20 7467 3600 Facsimile: +44 (0)20 7467 3610 Email: info@iblf.org Website: www.iblf.org

PAGE 113 : Corporate Philanthropy Resource Guide

International Society of Business, Economics, and Ethics (ISBEE)
www.isbee.org

OVERVIEW Mission

Year of origin International scope Senior leadership

The mission of the International Society of Business, Economics, and Ethics (ISBEE) is to provide a forum for the exchange of experiences and ideas; to enhance cooperation in cross-functional and cross-cultural projects; and to discuss the ethical dimension of economic, social, and environmental issues which affect companies nationally and internationally. 1989 Worldwide reach Patricia H Werhane, President Laura J Spence, Vice President Deon Rossouw, Past President Membership includes researchers, professors, business people, attorneys, consultants, foundation executives, economists, bankers, graduate students and others General public - $20.00/year Business firms - US$ 140.00/year Non-profit organizations - US$ 80.00/year World Congress of Business, Economics, and Ethics Held every four years (in Tokyo 1996, Sao Paulo 2000, Melbourne 2004) Networking opportunity - share information, develop joint research projects, and initiate important contacts Organize and present papers, discussion panels Online access and exchange of wealth of information and ideas Newsletter – three editions per year ISBEE Fund Enables people from developing countries and economies in transition to attend and participate in international business ethics meetings, in quadrennial ISBEE congresses and regional conferences Website that contains free access for ISBEE members to csr. literature.net, an online bibliography for business ethics with approximately 6,000 professional articles in major journals on business and economic ethics over the last 25 years Next World Congress of Business, Economics, and Ethics in 2012, Warsaw, Poland.

Target audience

Membership fee, if applicable

SERVICES Services and programs

Other services

Research areas

Recent news / developments

CONTACT Point of contact

Dr Patrica Werhane, President of ISBEE, DePaul University, (dpwerhane@depaul.edu) ISBEE Secretariat, Dr Lindsay Thompson, Johns Hopkins Carey Business School, 100 International Drive, Baltimore MD 21202 (ethics@jhu.edu)

PAGE 114 : Corporate Philanthropy Resource Guide

LBG Research Institute
www.lbgresearch.org

OVERVIEW Mission

Our mission is to empower companies to better communities through research, education and collaboration. Through our research we educate our clients and members on the trends and best practices in various areas of community involvement. Our network of members is a place for community relations professionals from both the nonprofit and for profit sectors to share and learn from each other. The research and education together with the collaboration, helps companies create a greater impact, improving communities wherever they operate. Nonprofit, membership organization 2005 Stamford, CT USA LBG Research Institute conducts research both domestically and globally Linda Gornitsky, President, Board of Directors Donna Devaul, Executive Director 1 Corporate community involvement, corporate philanthropy, and workplace giving and volunteerism professionals 15 $5,000 per year

Type of organization Year of origin Headquarters location International scope Senior leadership Number of employees Target client / customer / consumer Size of membership / network Membership fee, if applicable

SERVICES Services and programs

Research areas

Key Competitors Differentiating features of organization

Member newsletter, member networking events, audio conferences and webinars available to members and the philanthropic community. Custom research for members and non-members include benchmarking studies, vendor research, non-profit partner research, employee studies, attitudinal research. Strategic philanthropy, corporate volunteerism, workplace giving, community involvement, measurement and evaluation, disaster relief, community relations None LBG Research Institute is the only nonprofit organization that is solely devoted to conducting research in the area of community investment. By joining LBG, companies gain a trusted partner that can provide invaluable access to the knowledge, tools and expertise necessary to design, implement, manage and evaluate

PAGE 115 : Corporate Philanthropy Resource Guide

Competitive advantages

Recent news / developments

their national and international community investment programs, policies and initiatives. LBG Research Institute offers quality research under the direction of noted consultant and Institute founder Linda Gornitsky. Fast turnaround times and competitive pricing distinguish us from other organizations. Latest publication: ―Doing More With Less: How the Economic Downturn Will Affect Corporate Giving in 2009‖ had an international distribution and gained much attention from the trade press. Recent client projects include research on strategic employee giving programs, disaster relief, and benchmarking studies on corporate giving and employee volunteer programs.

CONTACT Point of contact

Donna Devaul, Executive Director lbgresearch@gmail.com, 203-240-5766

PAGE 116 : Corporate Philanthropy Resource Guide

Net Impact
www.netimpact.org

OVERVIEW Mission

Type of organization Year of origin Headquarters location International scope Senior leadership

Net Impact inspires, educates, and equips individuals to use the power of business to create a more socially and environmentally sustainable world. Nonprofit organization with global membership 1993 San Francisco, California Membership presence in 110 countries on 6 continents Chapter presence in 28 countries on 6 continents Liz Maw, Executive Director Jeni Izuel, Chief Operating Officer & Chief Financial Officer Maggie McArthur, Deputy Director Approximately 20 full-time employees Current and emerging leaders with an interest in topics such as sustainability, corporate responsibility, social entrepreneurship, nonprofit management, and international development. More than 20,000 members and 260 chapters around the world Net Impact offers annual membership to professionals, graduate students, and undergraduate students. Membership fees vary: Professional: US $55, International $30 Graduate Student: US $30, International $20 Undergraduate Student: US $10, International $10 Lifetime membership at all levels is $400 (one-time).

Number of employees Target audience

Size of membership / network Membership fee, if applicable

SERVICES Services and programs

Chapter Network More than 260 volunteer-led chapters around the world, who host 2,500 local events each year Impact Programs: Impact at Work, which empowers professionals to drive social and environmental change at their office, no matter what their job function Campus Greening, which equips students to raise environmental awareness and sustainability solutions at their schools Curriculum Change, which supports students to integrate sustainability themes in their MBA program curriculum Service Corps and Board Fellows, which offer pro-bono business consulting to local nonprofit organizations

PAGE 117 : Corporate Philanthropy Resource Guide

Publications Thought leadership reports, including student perspectives on impactful careers Business as UNusual , an annual guide to nearly 100 graduate business programs with a social and environmental focus Newsletters, including Leading Business (monthly) and Net Impact Weekly Career Center Net Impact Job Board, with leading sustainability and corporate responsibility positions around the world Exclusive internships and fellowships with leading organizations, foundations, and Fortune 500 companies Events Net Impact Conference, an annual event that brings together more than 2,500 professionals and students for an array of keynotes, panels, case studies, simulations, and special events
Differentiating features of organization

Members include both students and professionals, who are applying business skills to improve the world Members span for-profit, nonprofit, and government sectors Membership of 20,000 is the world‘s strongest networks of people using business to improve the world Global network enables local chapters to engage members on the ground Network-wide events span social and environmental topics across industries, sectors, and geography Net Impact Conference is one of the world‘s largest sustainability and corporate responsibility-focused events

Competitive advantages

CONTACT Point of contact

Liz Maw, Executive Director, lmaw@netimpact.org For general information: info@netimpact.org or +1 (415) 495-4230

PAGE 118 : Corporate Philanthropy Resource Guide

Worldwide Initiatives for Grantmaker Support
www.wingsweb.org

OVERVIEW Mission

WINGS is a worldwide network that seeks to strengthen philanthropy and a culture of giving through mutual learning and support, knowledge sharing and professional development among its participants. WINGS also strives to give voice and visibility to philanthropy at a global level. Network of grantmaker associations and philanthropy support organizations January 2000 Manila, Philippines (until December 31, 2010) Sao Paulo, Brazil (beginning January 2011) Worldwide Ma. Socorro Camacho-Reyes (Executive Director) 3 full-time, 2 part-time Grantmaker associations, philanthropy support organizations, community foundations, corporate foundations 143 network members

Type of organization Year of origin Headquarters location International scope Senior leadership Number of employees Target audience Size of membership / network SERVICES Services and programs

Research areas Differentiating features of organization Competitive advantages Recent news / developments

Global and Regional meetings Peer Learning Events One-2-One Exchange Visits Publication of Toolkits; Global Status Reports on Community Foundations and Global Status Report on Institutional Philanthropy Institutional Philanthropy and Community Foundations Global network for philanthropy support organizations and grantmaker associations Global reach with local presence in 54 countries WINGSForum 2010, with the theme Innovation and Impact: The Role of Grantmaker Associations in Changing Society, will be held from Nov. 18 – 20, 2010 in Como, Italy. WINGSForum is held every four years. Liza R. Agullo Office Manager (info@wingsweb.org)

CONTACT Point of contact

PAGE 119 : Corporate Philanthropy Resource Guide

Action Without Borders / Idealist.org
www.idealist.org

OVERVIEW Mission

Type of organization

Year of origin Headquarters location International scope Senior leadership

Action Without Borders (AWB) connects people, organizations, and resources to help build a world where all people can live free and dignified lives. AWB is independent of any government, political ideology, or religious creed. Our work is guided by the common desire of our members and supporters to find practical solutions to social and environmental problems, in a spirit of generosity and mutual respect. Action Without Borders runs the website Idealist.org, a global network of over 90,000 nonprofit organizations and 800,000 people from around the world. 1995 New York City Global Ami Dar, Executive Director Lorene Straka, Chief of Staff Amelia Byers, Director of Operations 23 Nonprofits and everyone interested in nonprofit organizations nonprofit careers, events, and resources, and volunteering 97,500 nonprofit organizations from around the world 800,000 members. 60,000 people from around the world visit Idealist each day. Daily Email Alerts (free): members can sign up to receive daily emails with content posted by organizations in the previous 24 hours that match their interests and geographic area. Nonprofit Career Center: a comprehensive online resource about nonprofit careers Volunteering Resource Center: a comprehensive online resource about volunteering. Graduate School Fairs for the Public Good: a series of fairs hosted in cities across the United States each fall. The fairs connect potential students with graduate school programs that focus on areas such as social work, public interest law and nonprofit management. Idealist is available in English, Spanish and French.

Number of employees Target audience Size of membership / network

SERVICES Services and programs

Differentiating features of organization

CONTACT Point of contact

Lorene Straka, Chief of Staff; Lorene@idealist.org

PAGE 120 : Corporate Philanthropy Resource Guide

American Institute of Philanthropy
www.charitywatch.org

OVERVIEW Mission

Type of organization Year of origin Headquarters location International scope Senior leadership Number of employees Size of membership / network Membership fee, if applicable

The mission of the American Institute of Philanthropy (AIP), a nonprofit charity watchdog and information service, is to maximize the effectiveness of every dollar contributed to charity by providing donors with the information they need to make more informed giving decisions. Nonprofit charity watchdog and information service 1992 Chicago, Illinois Focus on U.S. based non-profits Daniel Borochoff, President and Founder Ray Lay, Secretary/Treasurer 5 9,000 individual and corporate members $40 for individual membership; $200 for corporate membership; includes April, August and December issues of Charity Rating Guide

SERVICES Services and programs

Charity Rating Guide & Watchdog Report Informs donors about how over 500 national charities spend your money and keeps donors up to date on current issues related to charitable giving Resources for donors, media and government Nonprofit finances, governance, fundraising, accountability, and conflicts of interest Analyzes the finances of charities rather than simply repeating what charities report Fiercely independent, financially supported broadly by the general public – not by special interests; gives low rating to some nonprofits that competitors with less stringent standards rate highly Coverage in numerous media outlets One-time sample issue of Charity Rating Guide & Watchdog Report available

Other services Research areas Differentiating features of organization Competitive advantages

Recent news / developments Other information

CONTACT Point of contact

Meghan Davison, 773-529-2300, aipmail@charitywatch.org, www.charitywatch.org

PAGE 121 : Corporate Philanthropy Resource Guide

AngelPoints
www.angelpoints.com
OVERVIEW Mission

AngelPoints is where personal responsibility meets corporate strategy. Since 2001, AngelPoints has helped leading companies in every industry around the globe manage and measure the impact of their CSR and sustainability initiatives. Our mission is simple: by providing comprehensive products and services, we make it easy and efficient to execute and scale worldclass CSR and Sustainability programs. With our tools, your employees will commit to activities like never before and program impact will take off, credibly and transparently. B-Corporation 2001 Sausalito, CA Used by companies worldwide Andrew Mercy, CEO & Founder Reade Frank, COO 20 Corporations, government agencies Used by +100 brands worldwide None. Annual license fee.

Type of organization Year of origin Headquarters location International scope Senior leadership Number of employees Target audience Size of membership / network Membership fee, if applicable

SERVICES Services and programs

Web-based CSR management solutions, empowering companies to expand their capacity to make social investments. Specifically: TM Enterprise Volunteer Solution (EVS) Giving Personal Sustainability Practices (PSP) Tailored account management/training (tiered levels) Highest level of data security (SAS-70 Certified) Single Sign On (SSO) integration capability Rewards - Employee Recognition Module Community Reinvestment Act (CRA) Module for financial institutions Allforgood.org integration connecting clients with an extensive database of volunteer opportunities Benchmarking employee volunteer hours, participation and other key statistics. Integrated CSR Platform: Manage employee volunteering, giving and sustainability programs from one easy-to-use application Reporting and Program Metrics:

Other services

Research areas Differentiating features of organization

PAGE 122 : Corporate Philanthropy Resource Guide

Easily collect feedback, customize reports and share key data including impact dashboards with goal-setting Seamless communications: Create and promote events in minutes with seamless, targeted employee communications Language capabilities: Brazilian Portuguese, French, Mandarin, Spanish translation available, can input content in any language Ease of use: Clean design, quick-loading pages, intuitive navigation to ensure a great user experience and drive engagement
Recent news / developments

Please see www.angelpoints.com for up-to-date news

CONTACT Point of contact

AngelPoints Sales 415-331-4881 ext 6 sales@angelpoints.com 30 Liberty Ship Way, Suite 3150 Sausalito, CA 94965

PAGE 123 : Corporate Philanthropy Resource Guide

Charity Navigator
www.charitynavigator.org
OVERVIEW Mission

Charity Navigator works to guide intelligent giving. We help charitable givers make intelligent giving decisions by providing information on over five thousand charities and by evaluating the financial health of each of these charities. We ensure our evaluations are widely used by making them easy to understand and available to the public free of charge. By guiding intelligent giving, we aim to advance a more efficient and responsive philanthropic marketplace, in which givers and the charities they support work in tandem to overcome our nation's most persistent challenges. Charity Navigator is a 501 (c) (3) non-profit organization under the Internal Revenue Code and does not accept any contributions from any charities we evaluate.

Type of organization

Year of origin Headquarters location International scope

Charity Navigator is a 501 (c) (3) non-profit organization that rates the financial health of thousands of America‘s best-known charities to help donors make informed giving choices. PCWorld described Charity Navigator as ―the Consumer Reports of the nonprofit world." 2001 Glen Rock, New Jersey Charity Navigator only evaluates charities based in the U.S. and registered with the IRS. However, the scope of a charity's work can be international. Ken Berger, President & CEO Sandra Miniutti, Vice President, Marketing & CFO Tim Gamory, Chief Information Officer & HR Manager Joanne Reisser, VP, Development & Operations Manager 12 Charity Navigator‘s primary target audience is philanthropists. However, Charity Navigator has become a trusted source of data and analysis not just for donors, but also for corporate and foundation grantmakers, the media, government agencies, nonprofit managers and board members. More than 3 million unique visitors to the site annually. As of June 2010, over 200,000 individuals have become registered users and more than 100,000 subscribe to Charity Navigator‘s monthly newsletter. Ratings, articles and studies are accessible free of charge. Additional tools and data also available for free to registered users.

Senior leadership

Number of employees Target audience

Size of membership / network

Membership fee, if applicable

SERVICES Services and programs

Charity Navigator is the nation's largest and most-utilized evaluator

PAGE 124 : Corporate Philanthropy Resource Guide

of charities. In our quest to help donors, our team of professional analysts has examined tens of thousands of non-profit financial documents. As a result, we know as much about the true fiscal operations of charities as anyone. We've used this knowledge to develop an unbiased, objective, numbers-based rating system to assess the financial health of over 5,000 of America's best-known charities. Specifically, Charity Navigator's rating system examines two broad areas of a charity's financial health -- how responsibly it functions day to day as well as how well positioned it is to sustain its programs over time. Each charity is then awarded an overall rating, ranging from zero to four stars. The site is easily navigable by charity name, location or type of activity. Charity Navigator believes that there are three components to making a wise social investment. First, a social investor must determine whether the charity is financially healthy. Second, they should review the charity‘s accountability and transparency practices. Third, they need to assess the charity‘s ability to deliver social value (a sustained change for the better for people and communities who receive services). As of July 2010, Charity Navigator expanded its methodology to begin to include an analysis of each charity‘s commitment to accountability and transparency. In the near future, it plans to also include metrics that asses a charity‘s impact. Charity Navigator‘s web site features opinion pieces by its experts, donation tips, and top-10 and bottom-10 lists which rank efficient and inefficient organizations in a number of categories. Charity Navigator is also known for its in-depth studies such as Metro Market Study (analyzes the statistical differences that exist in the financial practices of charities located in different metropolitan markets across America) and CEO Compensation Study. Financial health of the largest charities in America that depend on the public‘s support Nonprofit executive compensation Variations in the fiscal performance of charities based on location, size and charitable mission Accountability and transparency issues Donors‘ rights Easy-to-understand ratings, financials, and other information profiling over 5,000 charities Rating system is a reliable measure of an organization‘s financial health and fiscal responsibility Objective evaluations No burdensome reporting requirements for charities User-friendly search tools Member tools enable donors to create and record content and to explore charity data in greater depth News, articles, and other giving tips and resources Charity Navigator evaluates ten times as many organizations than anyone else in America has ever attempted. Charity Navigator accepts no funding from the charities that

Other services

Research areas

Differentiating features of organization

Competitive advantages

PAGE 125 : Corporate Philanthropy Resource Guide

Recent news / developments

it evaluates, ensuring that the ratings remain objective. Charity Navigator‘s ratings are accessible online for free. Charity Navigator‘s ratings are objective, unbiased and timely. Charity Navigator‘s ratings methodology is completely transparent. Charity Navigator‘s rating system does not require that a charity participate in the process. Therefore, charities can not opt-out of being evaluated. Each year, million donors used the site that TIME Magazine called "One of America's 50 Coolest Websites for 2006." Additionally, the site is a two-time Forbes award winner for "Best of the Web," was selected by Reader's Digest as one of the "100 Best Things about America," and was chosen by PC World as "One of America's Top Websites." In 2007, BusinessWeek inducted Charity Navigator into its "Philanthropy Hall of Fame" for "revolutionizing the process of giving." Charity Navigator was singled out in 2006, 2007 and 2008 by Kiplinger's Financial Magazine as "One of the Best Services to Make Life Easier" and Esquire Magazine recently told its readers that using our service was one of "41 Ways to Save the World." Charity Navigator's leaders have provided expert analysis and commentary on the charitable sector for The Factor with Bill O'Reilly, most CNN programs, and each of the network morning shows--NBC's The Today Show, ABC's Good Morning America, and CBS's The Early Show. We have also appeared on FOX News, CNBC, NBC Nightly News with Brian Williams, The Newshour with Jim Lehrer, Nightline, and Comedy Central's The Daily Show, among others, and served as contributors to National Public Radio programs Morning Edition and All Things Considered. We have been profiled in Fast Company magazine, Contribute, CFO Magazine, and The Washington Post, and quoted in nearly every major American newspaper or weekly magazine. We have published editorials and articles on charity accountability, the role of government regulation in the charitable sector, fund-raising ethics, and non-profit leadership in such newspapers as The AtlantaJournal Constitution, The Chronicle of Philanthropy, The Seattle Post-Intelligencer, and The Los Angeles Times.

CONTACT Point of contact

Sandra Miniutti Vice President, Marketing & CFO P: 201.818.1288 x105 | F: 201.818.4694 sminiutti@charitynavigator.org

PAGE 126 : Corporate Philanthropy Resource Guide

CMO Council
www.cmocouncil.org

OVERVIEW Mission

Type of organization Year of origin Headquarters location International scope

The Chief Marketing Officer (CMO) Council is dedicated to highlevel knowledge exchange, thought leadership and personal relationship building among senior corporate marketing leaders and brand decision-makers across a wide-range of global industries. Peer Powered Network of High-Level Knowledge Exchange 2001 Palo Alto, California North America Africa Europe APAC Middle East Latin America India Donovan Neale-May: Executive Director & CEO Liz Miller: Vice President 20 5,500 No Fee

Senior leadership Number of employees Size of membership / network Membership fee, if applicable

SERVICES Services and programs

The CMO Council creates programs and services designed to add to the intellectual capital of the leading marketing thinkers that are members of the Council. Some of these programs and services include: * Thought leadership surveys and studies * Advocacy initiatives around strategic agendas * Intimate peer networking programs and events * Regular convocations and gatherings * Discussion groups and invention sessions * Web conferences, online dialogues and webcasts * Article sourcing and media commentary * Knowledge bank and content archive * Monthly eNewsletter & special eBulletins * Career opportunity referral * Internship placement Marketing Industry Outlook, Customer Experience, Marketing Supply Chains, CMO/CIO Alignment, Brand Protection, Customer Revenue Optimization, & Geo-Branding. The CMO Council's programs and services can be invaluable to

Research areas

Differentiating features of

PAGE 127 : Corporate Philanthropy Resource Guide

organization

Competitive advantages Recent news / developments Other information

members seeking to network and engage with others in the field. Many members are prolific producers of thoughtful content, views and opinions. These are frequently never captured, recorded or syndicated to others in the industry. Marketing is in a continuous state of change and staying current with the latest practices, processes, technologies and methodologies is a perennial problem. The Council's programs and services are designed and supervised by veteran marketing professionals, none of whom possess any particular agenda or vested interest. For those who are qualified to enter the CMO Council ranks, rich opportunities are available to participate in thoughtful, stimulating interactions. New channels and avenues are accessible for the presentation of views and opinions. New mentoring roles can be assumed and greater visibility and stature can be obtained in the industry. This is an enlightening, engaging and rewarding experience. The CMO Council‘s network spans 90 countries around the globe, offering in-region insights to hi-level marketing successes. http://www.cmocouncil.org/news/press_releases.asp Pause to Support a Cause will connect global corporations and public sector partners in a new initiative to "survey the socially beneficial way" by "donating on behalf of those participating" in funded market research programs around the world. http://www.surveyforgood.org/index.php

CONTACT Point of contact

Fabriano Angelo – Program Coordinator for the CMO Council fangelo@globalfluency.com

PAGE 128 : Corporate Philanthropy Resource Guide

GlobalGiving Foundation
www.globalgiving.org

OVERVIEW Mission

Type of organization Year of origin Headquarters location International scope Senior leadership

GlobalGiving is an online marketplace that connects individuals and organizations to the causes and countries they care about. Donors select the projects they want to support, make a tax-deductible contribution, and get regular progress updates – so they can see their impact. GlobalGiving works with companies of all shapes and sizes to make their CSR, community, and sustainability goals a reality. 501(c)3 non-profit organization 2003 Washington, DC GlobalGiving works with partner organizations in more than 90 countries around the world. Mari Kuraishi, President Dennis Whittle, CEO Donna Callejon, Chief Business Officer John Hecklinger, Chief Program Officer 25 full-time staff GlobalGiving implements philanthropy and CSR solutions for organizations of all types. Our clients range from Fortune 500 companies to mid-size non-profit organizations. We work with hundreds of small grassroots organizations around the world and have had more than 100,000 donors to date. To browse through our projects, visit our site at www.globalgiving.org.

Number of employees Target audience

Size of membership / network

SERVICES Services and programs

Other services Research areas

Strategic philanthropy: We find and vet projects to meet companies‘ strategic and philanthropic interests Cause marketing: We power cause marketing campaigns through unique, user-friendly branded platforms Employee engagement: We design customized giving portals, matching promotions, and other programs to engage employees in companies‘ philanthropic goals Gift cards: A specially-branded, unique solution for recognizing clients, employees and other stakeholders Programmatic services: Customized, specialized projects and campaigns to meet companies‘ specific requirements We offer the use of our API and other technological tools to facilitate the giving process. We are currently developing innovative new ways for beneficiaries to

PAGE 129 : Corporate Philanthropy Resource Guide

give feedback to program designers, leading to more effective and participatory development programs.
Differentiating features of organization/Competitive advantages

Recent news / developments

The breadth of our project network: we work with hundreds of high-impact organizations all over the world Our unique online platform that connects donors to social entrepreneurs Our flexibility: we leverage our platform and project network in many different ways to meet the needs of our clients Successful recent projects include supporting Pepsi‘s $20 million Refresh Everything project and designing an employee giving portal for Nike‘s worldwide employee base.

CONTACT Point of contact

Marisa Glassman Business Development Manager mglassman@globalgiving.org 202-232-5784 Ingrid Embree Director of Strategic Partnerships ingrid@globalgiving.org 202-232-5784

PAGE 130 : Corporate Philanthropy Resource Guide

GreenNonprofits.org
www.greennonprofits.org

OVERVIEW Mission

GreenNonprofits, Inc. is a 501 (c) 3 organization that aims to educate and assist nonprofit organizations, corporations and foundations in becoming more environmentally aware and friendly – through developing and executing a cutting-edge approach to the topic which has become more prominent over the past decade… with global warming at the forefront and the occurrence of a bevy of deadly, natural disasters around our globe. GreenNonprofits has published The Nonprofit Guide to Going Green with John Wiley and Sons. GreenNonprofits, Inc. seeks to foster relationships and partnerships that address the environmental needs in America and around the globe. It seeks to partner with nonprofit organizations and corporate foundations that focus on the environment and helping to highlight awareness and developing solutions to the atmospheric issues that face our society today. Through its fundraising, conference, certification, global awards program and membership activities, GreenNonprofits will encourage all members of our society to help make an environmental difference by donating their time, talents and money to the cause. Nonprofit Charitable organization 2007 Washington, DC Ted Hart, CEO Governed by a 7 member board of directors 2 Large and small nonprofits

Type of organization Year of origin Headquarters location Senior leadership Number of employees Target audience

SERVICES Services and programs

Other services Recent news / developments

Educational services The Nonprofit Guide to Going Green GreenNonprofits.org Newsletter GreenNonprofits Resource Center GreenNonprofits certification program The Nonprofit Guide to Going Green has been published and released.

CONTACT Point of contact

Ted Hart, CEO, 888-994-7336,tedhart@greennonprofits.org th 1101 15 St NW, Suite 200, Washington, DC 20005

PAGE 131 : Corporate Philanthropy Resource Guide

GuideStar
www.guidestar.org

OVERVIEW Mission

Type of organization Year of origin Headquarters location Senior leadership Number of employees Target audience Size of membership / network

GuideStar's mission is to revolutionize philanthropy and nonprofit practice by providing information that advances transparency, enables users to make better decisions, and encourages charitable giving. Nonprofit 1994 Washington, DC; additional office in Williamsburg, Virginia Robert Ottenhoff, President and CEO 60 Nonprofits, professionals, and individual donors 1.8 million organizations in GuideStar‘s database; approx. 16,148 nonprofits voluntarily providing updated information to GuideStar through the GuideStar Exchange program; 5.3 million IRS Forms 990 in GuideStar‘s database.

SERVICES Services and programs

Differentiating features of organization Competitive advantages

Provides tools that support: charity verification compensation benchmarking research on nonprofits and the nonprofit sector qualification market analysis outreach development oversight Provide information on the programs and finances of 1.8 million nonprofits recognized by the IRS; make data available through free and paid services. We are the largest and best-known provider of nonprofit information. We have data on 1.8 million charitable organizations in our database.

CONTACT Point of contact

Lindsay J.K. Nichols, (202) 637-7614 , lnichols@guidestar.org

PAGE 132 : Corporate Philanthropy Resource Guide

The JK Group, Inc.
www.easymatch.com

OVERVIEW Mission

Type of organization Year of origin Headquarters location International scope

Since our founding in 1989, JK Group‘s mission has been to provide its clients with the most comprehensive, technologically advanced and cost-effective solutions to corporate philanthropic programs. For profit company 1989 Plainsboro, New Jersey JK Group supports charitable programs for clients with programs in six continents and performs ―equivalency determination‖ vetting of charities regardless of location as well as issue payments in local currency. Roy Kaplan, President Rita Kusler, CFO/COO 205 employees Corporations, Corporate foundations JK Group currently supports nearly 275 clients worldwide. This year JK Group will process two million transactions, resulting in one million payments to charitable organizations totaling $920 million.

Senior leadership Number of employees Target audience Size of membership / network

SERVICES Services and programs

Other services

Research areas

Differentiating features of organization

Matching Gift Program Administration Volunteer Grants/ Event Management Administration Employee Giving Campaign Administration Grants Administration Disaster Relief Efforts PAC Match Programs International Programs Each year, JK Group holds Day of Learning events throughout the U.S., where representatives from companies across a wide ranges of industries gather to discuss and share issues critical to the success of corporate philanthropic programs. JK Group can offer its clients detailed benchmarking data across a wide variety of programs, and can gather specific program/industry information as requested by our clients—all at no additional cost. JK Group has established the most stringent financial protocols and data security measures in the industry, intended to provide companies with the highest level of confidence that corporate and employee funds, as well as sensitive information, are processed in the most professional and secure manner. In addition, no other company has the level of resources and industry experience to

PAGE 133 : Corporate Philanthropy Resource Guide

Competitive advantages

Recent news / developments

support corporate philanthropic programs. JK Group does not offer ―packaged applications‖ that offer little flexibility and are updated every six-twelve months. Our solutions are ―evergreen‖, continually being enhanced so that we may offer customized solutions that meet the ever-changing need of our clients. In addition to offering company branded, customized solutions, websites can be ―regionalized‖ so that employees can view different text, photos, giving options, etc. depending on their location, thus enhancing the user experience. JK Group does not commingle any of its client data or dollars, and can provide its clients with reporting that is integrated across all programs that we support on their behalf. JK Group is currently migrating all of its solutions to a .Net platform, which will allow our clients significantly higher levels of content management, as well as incredibly quick launch times.

CONTACT Point of contact

Paul Kalomeris, Director of Business Development, 415.459.8633, paul.kalomeris@easymatch.com

PAGE 134 : Corporate Philanthropy Resource Guide

National Committee for Responsive Philanthropy
www.ncrp.org

OVERVIEW Mission

Type of organization Year of origin Headquarters location Senior leadership Number of employees Target audience Size of membership / network Membership fee, if applicable

For more than 30 years, the National Committee for Responsive Philanthropy has served as the country‘s independent watchdog of foundations. NCRP promotes philanthropy that serves the public good, is responsive to people and communities with the least wealth and opportunity, and is held accountable to the highest standards of integrity and openness. 501(c)(3) public charity 1976 Washington, DC Diane Feeney, Board Chair Aaron Dorfman, Executive Director 11 Policymakers, media, foundation officials, general public Approximately 320 organizations Varies based on size and budget of institution

SERVICES Services and programs Research areas Differentiating features of organization Recent news / developments

Research and advocacy Philanthropy NCRP is the only independent watchdog of foundations Recent reports on benefits and return on investment from funding nonprofit advocacy and community organizing; http://www.ncrp.org/campaigns-research-policy/communities/gcip & Criteria for Philanthropy at Its Best http://www.ncrp.org/paib

CONTACT Point of contact

info@ncrp.org; www.ncrp.org 202-387-9177

PAGE 135 : Corporate Philanthropy Resource Guide

NPower NY
www.npowerny.org

OVERVIEW Mission

NPower‘s mission is to connect nonprofits to the best and most affordable IT. Founded ten years ago, NPower is a national nonprofit located in New York City that helps hundreds of nonprofits across the country improve their IT and the communities they serve. Nonprofit technology advisor and service provider 2000 New York, NY Christopher Wearing, Chairman of the Board Frank Bisignano, Vice Chairman of the Board Stephanie Cuskley, Executive Director 42 Over 600 nonprofits and other stakeholders throughout New York City N/A

Type of organization Year of origin Headquarters location Senior leadership

Number of employees Size of membership / network Membership fee, if applicable

SERVICES Services and programs

NPower‘s strategy is to reach more nonprofits by engaging more corporate IT leaders. We are making powerful connections between socially responsible companies and the nonprofits we serve. Three programs core to our strategy are: Professional Services NPower NY helps nonprofits operate, grow and transform their organizations through a range of professional services provided for discounted fees. Utilizing expertise provided by staff and partners, NPower offers best-in-class service and solutions that include: Planning, Solution Selection/Development, Websites and Infrastructure Support including Managed Network Services. IT Workforce Development NPower‘s IT Workforce Development programs provide disconnected young adults with skilled IT training to fill the need for a growing IT workforce. The program offers 24 weeks of free classroom training, professional and personal skills development, field internships and follow-up guidance and placement services to over 100 young adults each year. Additionally, students are offered Microsoft Outlook and Cisco

PAGE 136 : Corporate Philanthropy Resource Guide

Certification. As testimony to its success, the program has an 80% graduation rate and many of its alumni have ascended to management-level IT roles. The Community Corps NPower is building an online, skilled volunteer portal to connect corporate IT volunteers to nonprofits with IT needs. Developed in close partnership with founding partners JPMorgan Chase and Accenture, The Community offers IT projects ranging from Website Usability Assessment to SharePoint Fundamentals to Technology Advisory Assistance. Nonprofit IT, Skilled Volunteering, Workforce Development Corporate access, 10+ years of nonprofit experience

Research areas Competitive advantages

CONTACT Point of contact

Melinda Chang Manager, Strategic Projects 212-444-7248 Melinda.Chang@NPowerNY.org

PAGE 137 : Corporate Philanthropy Resource Guide

People to People Fundraising
www.p2pfundraising.org

OVERVIEW

Mission

People to People fundraising is an organization devoted to fostering the use of the Internet for philanthropic purposes. People to People Fundraising serves multiple constituencies, most importantly, non-profit organizations and the general public. People to People Fundraising has as its primary mission to provide the most current and accurate information for charities on website design, online fundraising, social media and mobile fundraising. The rapid onset of increasingly advanced and complex technologies has challenged nonprofits to invest with their sparse resources in attempting, and sometimes failing, to keep pace with strategies that work. Under the guidance of Ted Hart, ACFRE internationally acclaimed expert, this organization follows the ePhilanthropy Foundation and has expanded that work to include social media and mobile fundraising. Education organization 2000 Washington, DC Ted Hart, CEO Dianne Peach, Marketing, Education and Initiatives 4 Large and small nonprofits The major focus of People to People Fundraising is nonprofit organizations and the publics they serve, and to foster an online environment in which donors and potential donors can feel secure about their online transactions with non-profit organizations.

Type of organization Year of origin Headquarters location Senior leadership Number of employees Target audience

SERVICES

Services and programs

Educational services The Nonprofit Coach Radio Show Global and National training seminars Free Podcasts People to People Fundraising newsletter (23,000+ subscribers)

PAGE 138 : Corporate Philanthropy Resource Guide

eLearning: 40 + online courses Other services The Nonprofit Coach Radio Show on the BlogTalkRadio Network + podcasts available via iTunes. Global experts share their best information and tips on this weekly radio show. People to People Fundraising provides the industries annual estimate of online fundraising in the USA and Globally. Estimated that total online giving in the United States in 2009 reached approximately $15.48 billion (USD) and Globally surpassed $30 billion (USD)

Recent news / developments

CONTACT

Point of contact

Dianne Peach Manager: Marketing, Education and Initiatives 888-994-7336 dpeach@p2pfundraising.org th 1101 15 St NW, Suite 200 Washington, DC 20005

PAGE 139 : Corporate Philanthropy Resource Guide

Points of Light
www.pointsoflight.org

OVERVIEW Mission

Type of organization Year of origin Headquarters location International scope Senior leadership Target audience Size of membership / network SERVICES Services and programs

Points of Light Institute inspires, equips and mobilizes people to take action that changes the world. The institute has a global focus st to redefine volunteerism and civic engagement for the 21 century, putting people at the center of community problem-solving. We are organized to innovate, incubate, and activate new ideas that help people act upon their power to make a difference. We operate dynamic business units that share our mission: HandsOn Network, MissionFish, and the Civic Incubator, which includes a youth service division called generationOn and AmeriCorps alums. Nonprofit 1990 Atlanta, GA Includes 250 HandsOn Network action centers in 16 countries Michelle Nunn, CEO Neil Bush, Chairman of the Board Corporate, nonprofit, government agency, volunteers, schools HandsOn Network of 250 action centers working with 70,000 corporate, faith, and nonprofit associations. MissionFish, the charitable fundraising arm of eBay AmeriCorps alums generationOn, youth service and service learning Corporate Service Council, companies leading the way in volunteerism Global volunteering HandsOn University, volunteer leadership training Corporate employee engagement Skills-based volunteering President‘s Volunteer Service Awards Daily Point of Light Award The Extra Mile honorees Corporate Engagement Award of Excellence
st

Other services

Differentiating features of organization Competitive advantages Recent news / developments

Redefines service and volunteerism for the 21 century through action, mobilization, thought leadership, and innovation HandsOn Network division is the largest mobilizer of volunteers on the world. Co-Convener of annual National Conference on Volunteering and Service, the world‘s largest gathering of government, nonprofit, and corporate leaders around volunteerism In 2009, HandsOn Network action center volunteers provided 30 million volunteer hours valued at $626 million. Media: Catherine Shen, cshen@pointsoflight.org, 404-979-2903

Other information CONTACT Point of contact

PAGE 140 : Corporate Philanthropy Resource Guide

Public/Private Ventures (P/PV)
www.ppv.org

OVERVIEW Mission

Public/Private Ventures (P/PV) is a national nonprofit organization whose mission is to improve the effectiveness of social policies, programs and community initiatives, especially as they affect youth and young adults. In carrying out this mission, P/PV works with philanthropies, the public and business sectors, and nonprofit organizations. P/PV's staff is composed of policy leaders in various fields; evaluators and researchers in disciplines ranging from economics to ethnography; and experienced practitioners from the nonprofit, public, business and philanthropic sectors. P/PV's work addresses a wide range of critical social issues, and involves a varied group of sectors and institutions. This diversity provides us with the perspective and experience to assist policymakers, funders and communities in setting priorities and identifying realistic opportunities for advancing promising or proven policies and practices.

Type of organization Year of origin Headquarters location Senior leadership

Nonprofit 1978 Headquartered in Philadelphia, with offices in New York and Oakland, California. Matthew McGuire, Chair of Board Nadya K. Shmavonian, President Jacquelynne S. Eccles, Chair of Research Advisory Committee David Bernhardt, Chair of Institutional Review Board 55 Programs and policies that affect children, youth, young adults and families living in high-poverty communities. P/PV currently manages more than 70 projects, working with approximately 320 nonprofit partners.

Number of Employees Target audience Size of membership / network

SERVICES Services and programs

For 30 years, P/PV has taken a leadership role in tackling the challenges low-income communities face, using an approach rooted in three core principles: Innovation: We work with leaders in the field to identify promising existing programs or develop new ones; Research: We rigorously evaluate these programs to determine what is effective and what is not; and Action: We reproduce model programs in new locations, provide technical assistance where needed and inform

PAGE 141 : Corporate Philanthropy Resource Guide

policymakers and practitioners about what works.
Other services

Research Areas

Differentiating features of organization

P/PV welcomes the opportunity to partner with corporate philanthropists and social entrepreneurs interested in strengthening the quality of social programs and policies through rigorous research, strong training and technical assistance; the incubation of new ideas that improve the lives of children, youth and families in high-poverty communities, sharing of credible evidence about what works and what doesn‘t; and taking proven programs and initiatives to regional and national scale. Mentoring, after-school programming, juvenile justice, youth development, prisoner reentry, health, workforce development, program replication. As a leader in designing, managing and testing innovative programs that have national implications, P/PV has the experience and expertise to bring new ideas with significant financial backing to fruition. Multi-site Initiatives: P/PV is a leader in managing complex, largescale initiatives designed to mobilize promising national solutions to critical social problems. Quality Research & Evaluation: P/PV‘s research department specializes in blending qualitative and quantitative research methods to examine program effectiveness from various strategic vantage points. By combining outcomes studies with strong implementation research, our evaluations are designed to help programs and external audiences understand not just whether programs work but how they work. Program Replication: P/PV partners with funders, programs and communities to bring effective social programs to scale. P/PV helps programs define their essential elements, plan strategically for growth and manage replication efforts to ensure quality. 30-year-plus history of success. Capacity to advance local, state and national initiatives, and work with a range of community stakeholders. Fiscal stability: At the end of fiscal year 2008, P/PV had accumulated net assets in excess of $19 million—$9.8 million in cash and investments and $10.9 million in contracts and grants. Influence on public policy: All P/PV publications are circulated widely to key stakeholders, influential decision-makers, practitioners and funders, and all are available for free download on the web. Strong internal systems designed to ensure high-quality work, organizational effectiveness and accountability. Nadya K. Shmavonian, with close to 25 years of experience in and around philanthropy, assumed leadership of P/PV in 2010.

Competitive Advantage

Recent News / Developments

PAGE 142 : Corporate Philanthropy Resource Guide

P/PV recently published findings from the first random assignment evaluation of sector-focused job training efforts in the report Tuning In to Local Labor Markets. The encouraging outcomes from the study have been highlighted in many national publications, including The New York Times, TIME Magazine, Newsweek, The Huffington Post and the Chronicle of Philanthropy.
CONTACT Point of contact

Nadya K. Shmavonian President nshmavonian@ppv.org Chelsea Farley Vice President for Communications cfarley@ppv.org Phone: 215-557-4400

PAGE 143 : Corporate Philanthropy Resource Guide

TechSoup Global
www.techsoupglobal.org/

OVERVIEW Mission

TechSoup Global TechSoup Global (www.techsoupglobal.org) is a nonprofit working towards the day when every nonprofit and social benefit organization on the planet has the technology resources and knowledge it needs to operate at its full potential. TechSoup Global, a 501(c)(3) nonprofit, was founded on the belief that technology is a powerful enabler for social change. We‘ve assembled a worldwide network of individuals and organizations that share this conviction. This network includes foundations and corporations, governments and NGOs, social entrepreneurs and volunteers. Together, these unlikely allies have developed sustainable, community-driven technology solutions to meet today‘s most urgent social challenges. TechSoup Global and our TechSoup.org have become a fertile meeting ground for the nonprofit technology community, where organizations come to share and learn, get support from volunteer experts, and discover how to use technology in environmentally sustainable ways. Through our blogs, online forums, event listings, online social networks, and face-to-face meetups, organizations can easily ask questions, connect with others, and share experiences. As of June 2010, TechSoup Global has served more than 127,000 organizations, distributed almost 6.3 million software and hardware product donations, and enabled recipients to save more than US$1.8 billion in IT expenses in 33 countries around the world. 1987 435 Brannan Street, San Francisco, CA 94107 TechSoup Global now provides technology information to individuals and organizations in more than 190 countries, and, through the TechSoup Global Network of capacity-building NGOs, manages product donations to more than 80,000 organizations in 33 countries, NGOsource NGOsource, a project of the Council on Foundations and TechSoup Global, has been designed to be an equivalency determination information repository (EDIR) service to help U.S. grantmakers streamline their international grantmaking procedures. The NGOsource EDIR was conceived by grantmakers as a quick, reliable, affordable, and easy-to-use web-based service to help U.S. grantmakers evaluate whether an NGO outside of the U.S. is the equivalent of a U.S. public charity. NGOsource is expected to dramatically improve the efficiency of international grantmaking and

Type of organization

Year of origin Headquarters location International scope

PAGE 144 : Corporate Philanthropy Resource Guide

inspire a significant increase in cross-border philanthropy.
Senior leadership

Number of employees Size of membership / network

Daniel Ben-Horin, Founder and co-CEO Rebecca Masisak, co-CEO Marnie Webb, co-CEO 180 The Network manages product donations to more than 80,000 and provides information to individuals and organizations in more than 190 countries. The NetSquared network has ―NetSquared Local‖ groups in 70 cities around the world, reaching 24,500+. In the United States, TechSoup.org reaches more than 300,000 individuals, and has a blog read by 50,000. The number of unique monthly visitors to TechSoup.org is 459,000 (about 10% from outside the U.S.).

SERVICES Services and programs

TechSoup.org Our flagship program, TechSoup.org (www.Techsoup.org), helps nonprofit organizations and libraries access the technology resources and knowledge they need to operate at their full potential. Each month more than 300,000 individuals visit TechSoup.org to make informed technology decisions, become part of a community, and request product donations. TechSoup.org has a catalog of nearly 450 products generously donated by a growing roster of 42 technology corporations, including industry leaders such as Microsoft, Adobe, Cisco, Intuit, and Symantec. To date, these partners have made more than U.S. $1.5 billion in product donations available to the nonprofit sector. TechSoup for Libraries TechSoup for Libraries is a proving ground for peer-to-peer learning. In 2009, we completed a three-year project funded by the Bill & Melinda Gates Foundation to promote sustainable best practices for the technical support of public access computing in America‘s public libraries. The project, which created a vibrant nationwide community of librarians and library staff, was a proving ground for TechSoup Global, allowing us to demonstrate the efficacy of an open platform for peer-to-peer learning and collaboration. Based on the success of this program, we are now assisting the Bill & Melinda Gates Foundation in processing software donations for public and municipal libraries in several Eastern European countries, including Romania, Poland, Bulgaria, and Ukraine, and may expand the program to include other regions. NetSquared Partner Challenges In addition to the more than 24,500+ people participating in

Other services

PAGE 145 : Corporate Philanthropy Resource Guide

NetSquared Locals in 70 cities around the world, NetSquared also developed a challenge model in 2004 to identify, profile, and accelerate innovative projects. When we launched the first NetSquared Challenge, the model was a relatively new concept that has since ballooned into its own industry. Over the last five years, more than 680 social benefit projects have been submitted and a total of U.S. $376,000 has been awarded. In Fiscal Year 2009, we introduced NetSquared Partner Challenges, collaborating with institutions like UC Berkeley Human Rights Center and USAID to identify innovative projects addressing specific social issues. In 2009, NetSquared‘s USAID Development 2.0 Challenge was featured in President Obama‘s Open Government Innovation Gallery, for allowing the U.S. government to ―identify compelling projects and ideas being developed around the world, to bring attention and support to the best, and to enable great innovators to collaborate with each other.‖ GreenTech and the Refurbished Computer Initiative GreenTech and the Refurbished Computer Initiative are programs in which refurbished corporate IT equipment is made available at low cost to nonprofits and low-income families. (In 2008, the initiative was awarded a $500,000, two-year grant by the California Emerging Technology Fund). Nonprofits in Second Life Our efforts in Second Life began in 2005 with the founding of the Nonprofit Commons and today include four virtual locations and membership spanning 400 organizations in 62 countries. In our experience, a virtual community provides crucial opportunities for collaboration and networking that would be impossible in the real world for financial and physical reasons and for matters of safety and sensitivity. We continue to look for new ways to leverage our network to create far-reaching change. How do we gain insight from our unique perspective across thousands of NGOs around the world? How do we share it in a meaningful way? How can we make our structures more transparent, allowing more people to build on our work and contribute their knowledge and resources? What can a technologically empowered, networked, worldwide NGO sector accomplish? These are the questions that fuel our work. And we‘ll continue to collaborate with you, our network of contributors, on these and other critical questions facing us in 2010 and beyond. Leverage for Philanthropic Initiatives In FY 2009, TechSoup Global‘s $20 million operating budget included $15.5 million earned revenue and only $4.6 million in contributed revenue. Because this earned revenue is closely connected to the need it fills, it is a highly sustainable form of program funding. This

Research areas

Differentiating features of organization

PAGE 146 : Corporate Philanthropy Resource Guide

economically sustainable model gives us the freedom to pursue innovative ideas to uplift the nonprofit sector, while remaining a financially sound investment. The financial success of the TechSoup.org donation program has enabled TechSoup Global to obtain and leverage additional philanthropic support (primarily from the Gates, Surdna, Mott, Kellogg, Zero Divide and California Emerging Technology Fund foundations) and create a portfolio of innovative programs including NetSquared, TechSoup for Libraries, GreenTech, and the Refurbished Computer Initiative in which old corporate IT equipment is made available at low cost to nonprofits and lowincome families. (In 2008, the initiative was awarded a $500,000, two-year grant by the California Emerging Technology Fund,) Sustainability In the past 23 years, our work has profoundly enhanced the technology capacity of the U.S. nonprofit sector. When we started expanding our programs internationally, we found that the existing technology supply chain was often broken, NGOs used significant program resources to apply for product donation grants, technology corporations struggled to handle requests, and regulations governing NGOs varied from country to country. The TechSoup Global Network offers a more effective way of ensuring that NGOs have access to the technology they need. We partner with independent NGOs around the world, delivering the relationships, technology, and expertise necessary to allow them to become access points to information and donations for their communities. Our Partner NGOs customize these offerings, allowing their beneficiaries to receive the best local and global technology resources. It‘s a flexible solution that builds regional capacity and strengthens local relationships. But the most important achievement of the TechSoup Global Network has been the creation of a community of technology activists. April 2010: TechSoup Global and GuideStar International, a U.K.registered charity that promotes transparency and civil society organization (CSO) reporting, combined operations in order to strengthen their respective capacity-building programs for civil society. The two organizations share a mission to benefit global civil society through the provision of technology, information, and resources. TechSoup Global’s complete press coverage can be found at: www.techsoupglobal.org/press/mediacoverage

Competitive advantages

Recent news / developments

Other information

CONTACT Point of contact

Erica Scheidt, Director, Marketing and Communications escheidt@techsoupglobal.org

PAGE 147 : Corporate Philanthropy Resource Guide

VolunteerMatch
www.volunteermatch.org

OVERVIEW Mission Type of organization Year of origin Headquarters location International scope Senior leadership

The mission of VolunteerMatch is to strengthen communities by making it easier for good people and good causes to connect. National Nonprofit and Software Provider 1998 San Francisco, California Primarily United States with listings in 70 countries Greg Baldwin, President, William Holderness, CFO, Greg Price, Executive Sales Director Deborah Dinkelacker, Former President Jay Backstrand, Co-Founder 30 Local Nonprofits, National Nonprofits, Corporations, and Volunteers Membership over 1 million; over 73,000 nonprofits; 132 Corporate Clients; 14 National Nonprofit Partnership Clients (PPPs) Free Basic services for nonprofits Tools for Corporate Employee Volunteer Programs as well as Cause Marketing Campaigns.

Number of employees Target audience Size of membership / network Membership fee, if applicable

SERVICES Services and programs

Services for Corporations Tools: Special Event Manager, Single Sign-on, Search and Match, QuickStart, Metrics and Reporting, Hours Tracking, Group Invitations, Company-only Opportunities, Customized Home Page, Branding Package, Dollars for Doers Tracking, Service Support Other services: Best practice network (summit, web conferences, newsletter) 3 tiers of services: 1. Client Care (Basic support for Employee Volunteer Tools, set-up and launch, end user support, administrator training and support, and quarterly reporting; Benchmarked Metrics) 2. Program Support (Client Care, plus program launch & communications strategies, ongoing program planning, volunteer champion training, and best practices implementation support) 3. Site Administration (Program Support, plus assigned Client Relations Manager acting as extension of team for maintaining home-page and company-only event content, customized training, and ongoing strategic planning) Services for Nonprofits Preferred Partnership Program Formal partnerships with organizations like American Red Cross, Senior Corps, Habitat for Humanity, Easter Seals, and

PAGE 148 : Corporate Philanthropy Resource Guide

Other services

Research areas

Differentiating features of organization Recent news / developments

National Multiple Sclerosis Society to help affiliates recruit and manage volunteers Basic and Community Leader—2 levels of service offered (basic is free, CL has more enhanced offerings for a fee) Services for Individuals Search tools, features, newsletters to make it easy to find a volunteer opportunity that fits interests, skills and schedule Newsletter, Online, Conferences Cause Marketing support for corporations -Promote Volunteering and Build Brand Reputation. -VolunteerMatch-powered solutions help clients align their brands with positive action in their community, appeal to new customers, and promote volunteerism. Current client examples include Country Music Television, BMW Mini, Coca-Cola, Take Part/American Express Boomer Volunteering, Employee Volunteer Program benchmarks and Corporate Volunteering, Corporate and Nonprofit Technology, National Nonprofit Recruitment ―Preferred Internet recruiting service for more than 73,000 nonprofits and growing across the country‖ National Partnerships with the American Cancer Society, Feeding America, as well as Corporate Partnerships with NFL, The World Bank, 3M, and Tom‘s of Maine (Cause Campaign Client) New Boomer research study entitled ―Great Expectations: Boomers and the Future of Volunteering‖ – released second book in series 07/2010.

CONTACT Point of contact

Lauren Wagner, Senior Associate, Business Development (415) 241-6855, solutions@volunteermatch.org

PAGE 149 : Corporate Philanthropy Resource Guide

International Finance Corporation
www.ifc.org
OVERVIEW Mission

Type of organization

The mission of the International Finance Corporation (IFC): To fight poverty with passion and professionalism for lasting results. To help people help themselves and their environment by providing resources, sharing knowledge, building capacity, and forging partnerships in the public and private sectors IFC is owned by its 182 member countries. Corporate powers are vested in its Board of Governors, which meets annually and delegates many of its powers to a Board of Directors. Working at headquarters, the Board of Directors reviews all investment projects and major policy decisions. Both boards represent IFC‘s member countries. IFC coordinates its activities with other institutions of the World Bank Group but is legally and financially independent. IFC‘s share capital is provided by its member countries, who vote in proportion to the number of shares held.

Year of origin Headquarters location International scope Senior leadership Number of employees Target audience Size of membership / network

1956 Washington, DC More than 100 offices worldwide in 86 countries Robert B. Zoellick, President Lars H. Thunell, Executive Vice-President and CEO IFC has about 3,402 staff, of whom over half work in field offices. Private investors in emerging markets In IFC‘s 2009 Fiscal year it invested in 447 new projects in 103 countries and provided advisory services with 227 new projects in 69 countries. IFC spent $14.5 billion in financing: $10.5 billion for IFC‘s own account, $4.0 billion mobilized $34.5 billion committed portfolio, representing investments in 1,579 companies IDA countries account for half of IFC projects. Overall: IFC invested $1.8 billion in Sub-Saharan Africa This was a 30 percent increase over the past year. In contrast with the sharp decline in private capital flows worldwide, IFC investment held up well at $14.5 billion for the year IFC fulfilled its countercyclical role, providing help when and where it was needed most Despite the impact of the crisis on financial markets, IFC earned net income of $299 million for the year, before a $450 million transfer to IDA Last year IFC‘s clients provided:

PAGE 150 : Corporate Philanthropy Resource Guide

2.1 million jobs $90.6 billion in SME loans and $9.3 billion in microfinance loans 220 million telephone lines 20.5 million people with clean water 17 million people with power connections 5.5 million patients with health care services
SERVICES Services and programs

IFC promotes private businesses in developing countries by making loans and equity investments, helping companies mobilize financing in the international financial markets, and providing advisory services to businesses and governments. Financial Products:
Loans and intermediary services Equity and quasi-equity Syndications Structured and securitized products Risk management products Trade finance Subnational finance Treasury operations

Advisory Services:
Access to Finance Sustainable & Inclusive Markets Investment Climate Public-Private Partnerships Research areas

Poverty Reduction Health and Education Agriculture Environment and Sustainable Development Private Sector Development Development Impact. In addition to sound financial results for clients, IFC seeks ways to improve individual lives, broaden opportunities for entrepreneurs, and contribute to the economic, social, and environmental well-being of communities. IFC measures the impact of its investments and advisory services and applies lessons learned. World Bank Association. As a member of the World Bank Group, IFC can offer a greater breadth of advisory services than any other private sector development finance institution. Market Discipline. IFC has proved each year since 1956 that private investments—subject to the discipline of the marketplace — can result in profitable, sustainable businesses in developing countries. Financial Sector Influence. IFC‘s deep involvement with the financial sector, including commercial banks in both industrialized and developing countries, allows us to catalyze three to four private sector dollars for every dollar we invest and multiply the impact of these investments. Long-Term Partnerships. Over the course of long-term

Differentiating features of organization

PAGE 151 : Corporate Philanthropy Resource Guide

relationships with clients, IFC adds value through an array of financial products as well as advisory services. Sustainable Investments. IFC ensures that investments do more than simply improve a company‘s balance sheet — we help clients adopt practices that strengthen their business while simultaneously enhancing the development impact of the investment. Corporate Governance. IFC aims to help companies improve standards of governance, focusing on shareholder and stakeholder rights, board member duties, disclosure, and effective enforcement. Preferred Creditor Status. In the event of a currency crisis in a particular country, participants in IFC‘s syndicated loans share fully in our status as a preferred creditor, including access to foreign exchange.
Competitive advantages

Recent news / developments

Extensive network of clients, bilateral donors and foundations Extensive field presence Over 50 years of private sector knowledge and experience Monitoring and evaluating development impact Convening power within the development community Knowledge and expertise in project development & advisory services The Corporation is committed to increasing the development impact of its investments and advisory services, through five areas of special focus articulated in our strategic directions: In frontier markets—those with low per capita income, severe economic challenges, or political instability—IFC seeks to improve investment climates; enhance the competitiveness of smaller businesses, including agribusinesses; and increase access to finance. IFC is also becoming active in post conflict countries, with investments and advisory services in the Democratic Republic of Congo, Lebanon, and Liberia, among others. IFC is building long-term partnerships with client companies, providing the sustained financing and advisory services that improve business results and other performance measures in an ever-changing global business environment. Addressing climate change, and environment and social sustainability activities Addressing constraints to private-sector growth in infrastructure, health and education Developing local financial markets through institution building, the use of innovative financial products and mobilization

CONTACT Point of contact

Daniel F. Runde, Head, Foundations Unit International Finance Corporation 2121 Pennsylvania Avenue, NW Washington, DC 20433 (t) (202) 458-4376, drunde@ifc.org, ifc.org/foundations

PAGE 152 : Corporate Philanthropy Resource Guide

UN Global Compact
www.unglobalcompact.org

OVERVIEW Mission

Type of organization

Year of origin Headquarters location International scope Senior leadership

The United Nations Global Compact is a call to companies everywhere to voluntarily align their operations and strategies with ten universally accepted principles in the areas of human rights, labour, environment and anti-corruption, and to take actions in support of UN goals, including the Millennium Development Goals. Endorsed by chief executives, the UN Global Compact is a leadership platform for the development, implementation, and disclosure of responsible corporate policies and practices. Voluntary UN initiative consisting of businesses, civil society organizations, government entities, United Nations and other organizations. 2000 New York, NY International participation from over 135 countries including 90 plus country networks Georg Kell, Executive Director Board comprised of 20 international business, labour and civil society leaders Approximately 25 staff Businesses, governments, civil society organizations, labour, and UN agencies +8000 signatories—6000 business and 2000 other organizations— based in +135 countries Current participants account for approximately 40 million employees No mandatory fees. Funded by both Government and private sector donations. Business participants are asked to make a voluntary annual contribution. Two complementary objectives: 1. Making the Global Compact and its principles part of business strategy and operations 2. Taking action to advance broader UN goals and issues, including the Millennium Development Goals Networks 90+ country and regional networks globally to support implementation Communications on Progress (COP) Method of informing stakeholders about progress in implementing Global Compact‘s principles. The purpose is to ensure and deepen the commitment of Global Compact participants and to safeguard the integrity of the initiative.

Number of employees Target audience Size of membership / network

Membership fee, if applicable

SERVICES Services and programs

PAGE 153 : Corporate Philanthropy Resource Guide

Other services

Research areas Differentiating features of organization

Resources and Guidance Developed tools and resources in all issue areas as well as a number of issue-specific platforms. Dialogues and Events Action-oriented regional or international meetings on issues related to globalization and corporate citizenship; provides opportunities to share best practices and experiences Partnerships With UN agencies and civil society organizations Global Compact Leaders Summits (triennial) Annual Local Networks Forums UN Private Sector Forums Global Compact Cities Programme Dedicated to helping cities translate the 10 principles into dayto-day urban governance and management. Sharing of best practices and information on broad range of social issues available on website and in publications World‘s largest global voluntary corporate citizenship initiative Based on universal principles related to human rights, labour, the environment and anti-corruption Brings broad stakeholder base to engage with business Gateway for private-sector participants to collaborate with UN Convening power of the United Nations Broad base of participants from all regions, across all industry sectors Includes both large multinationals and small and medium-size enterprises UN Private Sector Forum on the Millennium Development Goals (22 September 2010, New York) Bringing together heads of business, civil society, Government and UN leaders to identify effective ways and means to help reach the MDGs by 2015 and to generate action towards this target. Global Compact Leaders Summit (24 – 25 June 2010, New York) Largest ever convened by UN on the issue of corporate citizenship, with more than 1200 leaders from business, civil society, labour and government. 30+ new resources launched. Participants approved by acclamation the New York Declaration by Business, encouraging business to recommit to the 10 Principles and contribute more substantially to peace and development. Launch of un.business.org (January 2010), providing a gateway for matching private sector and UN collaboration United Nations Global Compact DC2-612 United Nations New York, NY 10017 USA globalcompact@un.org

Competitive advantages

Recent news / developments

CONTACT Point of contact

PAGE 154 : Corporate Philanthropy Resource Guide

Boston College Center for Corporate Citizenship
www.bccorporatecitizenship.org

OVERVIEW Mission

Type of organization Year of origin Headquarters location Senior leadership Number of employees Target audience Size of membership / network Membership fee, if applicable

The Boston College Center for Corporate Citizenship engages with companies to redefine business success as creating measurable gains for business and society. The Center, part of the Carroll School of Management, achieves results through the power of research, education and member engagement. Educational institution, think tank and information resource for companies 1984 Chestnut Hill, MA Katherine Smith, Executive Director Peggy Connolly, Managing Director 19 Only for-profit corporations are eligible for membership 350 corporate members representing annual revenues of $4.5 trillion and 11 million employees Annual corporate membership fee is based on annual revenue

SERVICES Services and programs

Executive Education, Annual International Corporate Citizenship Conference, Benchmarking Custom training and custom research

Research areas Differentiating features of organization Competitive advantages Recent news / developments

Corporate Citizenship management, Community Involvement Provide only certificate-level training programs in Corporate Community Involvement; publish annual Corporate Citizen, largestcirculation CSR publication in North America Created an online member community; Developing new Impact Measurement framework and offering new one of a kind program, the Community Involvement Leadership Academy

CONTACT Point of contact

Peggy Connolly 617-552-0722, Peggy.connolly.1@bc.edu

PAGE 155 : Corporate Philanthropy Resource Guide

Center for Responsible Business
http://responsiblebusiness.haas.berkeley.edu/

OVERVIEW Mission

Type of organization Year of origin Headquarters location

The Center for Responsible Business is an ―action-tank‖ that builds on the Haas School of Business‘ culture of innovation and UC Berkeley‘s tradition to run—not walk—towards social progress. We bring students, companies and faculty together to explore issues of corporate responsibility and sustainability, and inspire leaders who redefine good business. Nonprofit/Educational Institution 2003 Center for Responsible Business Haas School of Business 545 Student Services Bldg #1900 Berkeley, CA 94720-1900 We have two board members who are non-US-based (Europe and South America), as well as several relationships with universities across the globe (e.g., Maastricht, Netherlands and Copenhagen Business School, Denmark) Jo Mackness, Executive Director Kellie McElhaney, Co-Faculty Director & Adjunct Assistant Professor 8 Business school students, influencer companies (over 30% of the companies we work with are Fortune 500; more than 20% are Corporate Responsibility Best Corporate Citizens ), cross-functional faculty Corporate partners include: Chevron, Dow, Gap, HP, KimberleyClark, Levis Strauss & Co, Walmart, Waste Management; 2,000 + in our network of companies and alumni $50,000 to become a corporate partner; $20,000 to become a corporate affiliate

International scope

Senior leadership

Number of employees Target audience

Size of membership / network

Membership fee, if applicable

SERVICES Services and programs

Student Engagement—courses, projects, grants, fellowships, competitions Thought Leadership—case studies, articles, speaking opportunities Convening Events—research-based symposiums, stakeholder dialogues, networking salons Research Sponsorship—faculty research, PhD and MBA student projects Sustainable Products and Solutions (SPS), managed in conjunction

Research areas

PAGE 156 : Corporate Philanthropy Resource Guide

with the UC Berkeley College of Chemistry, is a multi-disciplinary program that promotes a research environment that considers the foundations of sustainability—society, science, engineering, environment, and finance—as it creates new products and solutions. The Center‘s program in Sustainable Finance focuses on creating economic and social value through financial models, products and markets that are sustainable over time. We are building upon a strong foundation of activities, including the Haas Socially Responsible Investment Fund (HSRIF) and the Moskowitz Prize for Socially Responsible Investing. The Center offers students meaningful access within leading companies because of the strength of our corporate relationships. We also provide companies with fresh perspectives, new approaches and proven practices that can differentiate their brands as sustainable and responsible. The research faculty affiliated with the Center come from a diverse set of colleges on campus and work at the leading edge of corporate responsibility and sustainability research.
Competitive advantages

Differentiating features of organization

The Center serves as the catalyst for Berkeley-Haas advancing the practice of business leadership to create a sustainable world by connecting a large network of students and faculty on the UC Berkeley campus to companies and alumni. Ranked #2 MBA program in corporate responsibility by the Financial Times (2010) Catchpole report lists CRB in the top 12 CSR organizations worldwide. UC Berkeley's Center for Responsible Business joins notable organizations like the Global Reporting Initiative, Clinton Global Initiative and Net Impact as leaders in driving corporate responsibility. According to a recent report released by the Arthur W. Page Catchpole society, a select membership organization for senior public relations and corporate communications executives, has listed the CRB in the top 12 Corporate Social responsibility (CSR) organizations worldwide. After researching over 400 executive leadership forums and international organizations, many of which include CSR content in their makeup, twelve top organizations were chosen. Presence on social media networks Twitter, Facebook, LinkedIn, and YouTube goodbusiness newsletter, available on our website

Recent news / developments

CONTACT Point of contact

Jo Mackness, Executive Director at mackness@haas.berkeley.edu

PAGE 157 : Corporate Philanthropy Resource Guide

The Center on Philanthropy at Indiana University
www.philanthropy.iupui.edu
OVERVIEW Mission Type of organization Year of origin Headquarters location International scope

The Center on Philanthropy at Indiana University increases the understanding of philanthropy and improves its practice worldwide. Research, education and training 1987 Indianapolis, Indiana The Center has conducted fundraising training and educational programs on six continents. It has academic partners in several countries around the world. Ted R. Grossnickle, CFRE, Chair of the Board of Visitors Patrick M. Rooney, Executive Director 38 Nonprofit professionals, donors, volunteers, students, scholars, government officials, and corporate leaders.

Senior leadership Number of employees Target audience

SERVICES Services and programs

Other services

Research areas

Differentiating features of organization Competitive advantages

Recent news / developments

Research, including contract research; academic degree and certificate programs; professional development and continuing educations programs; The Fund Raising School; the Lake Institute on Faith & Giving; the Women‘s Philanthropy Institute Customized training and educational programs, reports on key topics in philanthropy, magazine and e-newsletter reporting latest research findings, their implications and how to apply them. Academic and applied research about giving by individuals, corporations and foundations, volunteering, and nonprofits nationally and in Indiana, including social science research that provides insight into human behavior. Leading academic center providing comprehensive and synergistic research, education and training for and about philanthropy and the nonprofit sector. Top-quality, objective research. Comprehensive in-house and faculty research team with a proven track record, including many of the top scholars in the field. Range of educational offerings from undergraduate to Ph.D. and certificate programs. Over thirty years of leadership in fundraising and nonprofit training and educational programs See website www.philanthropy.iupui.edu

CONTACT Point of contact

www.philanthropy.iupui.edu for full staff directory; 317-274-4200

PAGE 158 : Corporate Philanthropy Resource Guide

Center for Social Innovation, Stanford Graduate School of Business
http://csi.gsb.stanford.edu
OVERVIEW Mission

Our Approach: Break down boundaries and promote the mutual exchange of ideas and values across sectors and disciplines and between theory and practice. Our Purpose: Build and strengthen the capacity of individuals and organizations to develop innovative solutions to social problems. Our Vision: A networked community of leaders actively building a more just, sustainable, and prosperous world. Academic – Higher Education, Tax-exempt 2000 Stanford, CA Leveraging the assets of Stanford and the Graduate School of Business, the Center began serving GSB students and alumni and leaders around the globe through research, education, and community outreach. Dale T. Miller, Morgridge Professor of Organizational Behavior James A. Phills Jr., Professor of Organizational Behavior (Teaching), Claude N. Rosenberg Jr. Director of the Center for Social Innovation Jesper B. Sørensen, Walter Kenneth Kilpatrick Professor of Organizational Behavior Kriss Deiglmeier, Executive Director Center for Social Innovation (8) at the Stanford Graduate School of Business (200-250) The Center brings together the best people, organizations, and ideas from the worlds of nonprofits, business, and government. Our participants: lead corporate efforts to improve ethical and sustainable practices manage nonprofits through strategic growth launch social enterprises that bring life-changing solutions such as loans to small businesses and safe lighting to the world‘s poorest places 20,000+ The Center offers programs for MBA students, alumni, faculty, and field practitioners. Research: Academic research and ongoing evaluation are essential to understanding what works and what does not in this new era of

Type of organization Year of origin Headquarters location International scope

Senior leadership

Number of employees Target audience

Size of membership / network SERVICES Services and programs

PAGE 159 : Corporate Philanthropy Resource Guide

social innovation. Through the discovery of new ideas the center contributes new thinking on ways to achieve social impact: Case studies: Academic research, such as the Stanford Project on the Evolution of Nonprofits Education: The center‘s education activities disseminate important ideas to a global community of scholars, field practitioners, and students, providing social innovators with a tool box to increase their effectiveness. Education vehicles include: 1. Events, speakers series and conferences: Executive Education, programs for nonprofit, philanthropy, and responsible business leaders 2. Programs specifically for MBA students include: Elective courses, Public Management Certificate, Joint degrees 3. Action: The center provides a bridge between academia and practice. Our offerings have a direct social impact in the world and provide hands-on experience and inspiration that transform ordinary leaders into mission-driven leaders. MBA students learn, alumni engage, and nonprofits benefit through programs such as: Service Learning Initiative, a travel and service experience exploring global issues and innovative models of impact Board Fellows, a nonprofit board six-month apprenticeship Summer internships, a 10-12 week work experience in public benefit organizations Social Innovation Conversations educational podcast: http://sic.conversationsnetwork.org/ Arts, Culture, Religion Corporate Social Responsibility Economic Development Education Environment Government Healthcare Human Rights Leadership Nonprofit Management Philanthropy, Responsible Investing Social Entrepreneurship Our Theory of Change: Our mission is grounded in a strong theory of change. All our programs and initiatives are designed, coordinated, and integrated to achieve the following outcomes: Raise Awareness: We raise awareness about the principles, methods, and potential impact of social innovations. By bringing new knowledge to bear on social issues, we contribute innovative ways of achieving impact.

Other services Research areas

Differentiating features of organization

PAGE 160 : Corporate Philanthropy Resource Guide

Build Skills: Once aware, individuals need the correct skills to be effective change agents. Through our education programs we build the skills, both conceptual and practical, that enable individuals to successfully move social innovations forward. Advance Action: Finally, we provide opportunities to implement social innovation practices into action to actually make change. The Public Management Program (PMP) prepares and challenges Stanford GSB students to address problems affecting society by applying their management education in ways that create social, environmental, and economic value. PMP develops and supports students as they become the next generation of innovators, leaders, and managers for social and environmental impact. Our students leave the GSB prepared to become: Corporate executives transforming large industries from within Government leaders who can bridge the public and private worlds Social entrepreneurs leveraging markets and business for the greater good Effective nonprofit executives and board members Skillful advocates moving the social and environmental agenda forward Active volunteers Solving the world‘s toughest social and environmental problems favors leaders with an ability to bridge academic disciplines and tap into expertise spanning multiple areas. Stanford offers the opportunity to combine and strengthen the academic experience through the following joint degrees for MBA students: Master of Public Policy/MBA for students interested in pursuing careers in public policy or at the intersection of business and government. Offered in conjunction with the School of Humanities & Sciences. MS in Environment & Resources/MBA for students interested in a career addressing environmental issues. Offered in conjunction with the School of Earth Sciences. Social Innovation Fellowship: a year-long program provides a stipend to Stanford MBA students or teams to enable them to devote 100 percent of their first year after graduation building their vision for social change into a viable social enterprise. The Public Management Program is also piloting a partnership with the Silicon Valley Social Venture Fund (SV2), a Bay Area venture philanthropy partnership that will allow GSB students to participate as non-voting members in the learning, proposal, and decision process for making a grant to a nonprofit as a Venture Philanthropy Fellow. Students may also choose to engage with selected nonprofits for ongoing advising and assistance. twitter.com/gsbStanfordCSI facebook.com/gsbStanfordCSI 650.725.5399, http://csi.gsb.stanford.edu/contact

Competitive advantages

Recent news / developments CONTACT Point of contact

PAGE 161 : Corporate Philanthropy Resource Guide

Centre for Charitable Giving and Philanthropy
www.cgap.org.uk

OVERVIEW Mission

To conduct and promote high quality research on giving and philanthropy, foster creative knowledge exchange between academic and practice communities; develop and disseminate the evidence base to inform policy and practice; build the field through training new researchers; encourage the development of sector research capacity; work internationally and in a multi-disciplinary way Academic body 2008 London Yes Professors Jenny Harrow and Cathy Pharoah 20 (not FTE)

Type of organization Year of origin Headquarters location International scope Senior leadership Number of employees SERVICES Services and programs

We have three research programs: Individual and Business Giving Charity and Social Redistribution Grant-making, Foundations and Household Giving

Other services Research areas Differentiating features of organization Competitive advantages

We undertake knowledge transfer activities including a regular newsletter, seminars and conferences See programs above Our focus on building the evidence base for academia, policy and practice means we engage with and synthesize a range of different perspectives. CGAP is the only UK based academic centre looking at issues of philanthropy and charitable giving. Our distributed, multidisciplinary approach gives us a broad understanding of the issues at hand. For news see http://www.cgap.org.uk/cgap-news.html Karl Wilding, Head of Research, 0795 137 3511

Recent news / developments CONTACT Point of contact

PAGE 162 : Corporate Philanthropy Resource Guide

Yale School of Management Program on Social Enterprise
http://pse.som.yale.edu
OVERVIEW Mission

Type of organization Year of origin Headquarters location International scope Senior leadership

The Yale Program on Social Enterprise (PSE) supports scholars, students, alumni, and practitioners interested in exploring the ways in which business skills and disciplines can be harnessed to most effectively and efficiently achieve social objectives. PSE facilitates work on nonprofit and public sector social entrepreneurship, as well as initiatives in private sector social enterprise. Research center within a management school. 2000 New Haven, Connecticut The Program oversees courses in which students work with social enterprises in India, South Africa and Latin America. Faculty Director Sharon Oster (Dean and Frederic D. Wolfe Professor of Management and Entrepreneurship), Executive Director Tony Sheldon. 3 Scholars (Yale and beyond), Yale students and alumni, and practitioners (US and international).

Number of employees Target audience

SERVICES Services and programs

Research areas Differentiating features of organization Competitive advantages Recent news / developments

Our activities span courses, research, conferences, and publications. In addition to these formal activities, PSE also serves as a focal point for social enterprise-related activities at the School of Management, facilitating, advising, and drawing connections among students, faculty, the Yale community, and the broader network in the US and internationally of interested practitioners and institutions. Social entrepreneurship, sustainable energy, development finance. Integration of research, course work and extra-curricular activities. A central element of the School‘s mission: ―to educate leaders for business and society.‖ Securing support of Morgan Stanley for a Global Social Entrepreneurship course that links students with social enterprises in India in semester-long projects.

CONTACT Point of contact

Tony Sheldon, Executive Director tony.sheldon@yale.edu

PAGE 163 : Corporate Philanthropy Resource Guide

Acumen Fund
www.acumenfund.org

OVERVIEW Mission

Acumen Fund is a non-profit venture fund that exists to help end poverty by changing how the world addresses it. We invest patient capital to identify, strengthen and scale business models that effectively serve the poor. And we champion the spread of this approach as a complement to traditional aid, which can create dependence, or pure market approaches, which can bypass the actual needs of the poor. We raise philanthropic capital and invest in enterprises providing affordable healthcare, water, housing, energy and agricultural inputs to the poor in India, Pakistan and East Africa. We currently have $38 million in approved and active investments in these areas. Non-profit global venture fund 2001 New York, NY Work in five countries: India, Pakistan, Kenya, Tanzania, and South Africa Jacqueline Novogratz, Chief Executive Officer 62 globally People that earn less than $4 a day and do not have access to basic goods and services (healthcare, water, housing, energy and improved agriculture production) at affordable prices Our network includes more than 260 partners who have each given over $10,000 to Acumen Fund. We have more than 40,000 visitors to our website each month, 14,000 Friends on Facebook, 322,000 followers on Twitter and nearly 4,000 members of our Acumen Community website.

Type of organization Year of origin Headquarters location International scope Senior leadership Number of employees Target audience

Size of membership / network

SERVICES Services and programs

Other services

Acumen Fund invests in enterprises providing affordable healthcare, water, energy, housing and agricultural inputs to the poor. We have $38 million in approved investments in these areas. In addition to the capital we provide to social enterprises, we also provide intensive management support to help these enterprises scale and become financially sustainable.. We share lessons we are learning about breakthrough models that serve the poor to contribute to knowledge development in the sector. Provide needed, patient capital (debt and equity) at nearmarket rates to entrepreneurs who value sustainability and

Differentiating features of organization

PAGE 164 : Corporate Philanthropy Resource Guide

Recent news / developments

scalability Deliver intensive management support through our global portfolio team and Fellows Program Measure the social and financial impact these investments are making, and share insights with other development practitioners to enhance the impact of our work We have been recently featured in two separate episodes of PBS NewsHour with Jim Lehrer, our founder was interviewed by Katie Couric in Glamour magazine, and she writes a regular column for the Huffington Post. Jacqueline Novogratz also is author of bestselling book The Blue Sweater.

CONTACT Point of contact

Misbah Naqvi Business Development Manager 646-747-3980 mnaqvi@acumenfund.org

PAGE 165 : Corporate Philanthropy Resource Guide

Echoing Green
www.echoinggreen.org

OVERVIEW Mission

To accelerate social change, Echoing Green invests in and supports outstanding emerging social entrepreneurs to launch new organizations that deliver bold, high-impact solutions. Through a two-year fellowship program, we help our network of visionaries develop new solutions to society‘s most difficult problems. These social entrepreneurs and their organizations work to solve deeplyrooted social, environmental, economic, and political inequities to ensure equal access and to help all individuals reach their potential. To date, Echoing Green has invested over $28 million in seed funding to over 471 social entrepreneurs and their innovative organizations. Non-profit 1987 New York City Echoing Green Fellows have sparked social change in forty countries on five continents. General Geographic Impact Information (1987-2007) Number of countries influenced by fellows‘ organizations: 40 (list below) Number of countries fellows are based in: 30 (list below) Number of US states fellows are based in: 41 (list below) Percent of fellows with domestic impact: 79 percent Percent of fellows with international impact: 21 percent

Type of organization Year of origin Headquarters location International scope

Senior leadership Number of employees Target audience Size of membership / network Membership fee, if applicable

Cheryl Dorsey, President Lara Galinsky, Senior Vice President 15 Social entrepreneurs 450+ fellows/alums N/A

SERVICES Services and programs Other services Research areas Differentiating features of organization

Fellowship program Youth Leadership Program; Social Investment Council All program areas (Education, Civil & Human Rights, Environment, Health, Economic Development, Community Improvement, etc.) Echoing Green evaluates the impact of our work on a few different levels.

PAGE 166 : Corporate Philanthropy Resource Guide

Scale: To date, Echoing Green has invested over $28 million in seed grants to over 471 social entrepreneurs. Echoing Green Fellows have sparked social change in forty countries on five continents. Return on Investment: By year two, Echoing Green Fellows raise three times their Echoing Green grant. Five years after the completion of their fellowship, Echoing Green funded organizations raised total dollars equivalent to thirty-seven times their total Echoing Green seed investment. According to a 2004 study, Echoing Green Fellows‘ organizations raised approximately $930 million to support their work—an ROI of forty-four times our initial investment. Launching Organizations Built for Impact: By year two, 58 percent of Echoing Green organizations have budgets over $100,000, compared to 43 percent of peer organizations. By year two, 86 percent of Echoing Green Fellows hire at least one additional staff member, compared to 75 percent of peer organizations. Creating Long-Term Solutions: Approximately two out of three organizations founded through an Echoing Green investment reaches sustainability. Of the organizations without current fellow involvement, 75 percent continue to thrive under new leadership. Echoing Green is one of the only organizations solely focusing on seeding sustainable social change organizations. Echoing Green recently announced its newest class of fellows – promising social entrepreneurs with the drive, determination, and resilience to solve our world‘s biggest problems. The 2010 Echoing Green Fellows will develop a total of sixteen new nonprofit, for-profit, and hybrid organizations in the fields of human rights, health, the environment, and education, among other fields. Chosen from a pool of 1,000 applicants from 73 countries, Echoing Green will provide each venture with seed funding, leadership development and technical assistance, as well as mentoring from our network of 500 alumni fellows. To learn more about the Class of 2010 Fellows, please visit http://2010fellows.echoinggreen.org/.
CONTACT Point of contact

Competitive advantages Recent news / developments

Leighton Britton Development Associate leighton@echoinggreen.org / 212-400-3952

PAGE 167 : Corporate Philanthropy Resource Guide

Endeavor
www.endeavor.org

OVERVIEW Mission

Established in 1997, Endeavor (endeavor.org) is the global nonprofit that pioneered the concept of High-Impact Entrepreneurship in emerging markets. Headquartered in New York City, with 10 independently-run country affiliates, the organization transforms the economies of emerging markets by identifying and supporting high-potential entrepreneurs. In 13 years, Endeavor has screened 25,000+ candidates and selected 506 High-Impact Entrepreneurs from 328 companies. In turn, these entrepreneurs have created over 100,000 high-value jobs and generate more than $3.5 billion in annual revenues. Beyond this impact, Endeavor's "mentor capital" support catalyzes a chain reaction in the larger economy--driving investment, creating role models, and fostering the conditions for the next Silicon Valley in Rio, Capetown, Cairo or Jakarta. It is what led Thomas Friedman to hail our model as the ―best anti-poverty program of all.‖ Non-Profit: Economic Development & Entrepreneurial Support 1997 New York, NY, USA Operations in: Argentina, Brazil, Chile, Colombia, Egypt, Jordon, Mexico, South Africa, Turkey, Uruguay Linda Rottenberg, Co-founder & CEO 146 Corporations, Foundations, Entrepreneurs and Venture Capitalists

Type of organization Year of origin Headquarters location International scope Senior leadership Number of employees Target audience

SERVICES Services and programs

Endeavor provides customized local and global services, including access to hands-on tools, mentoring and networks that increase opportunity for success. The quality of Endeavor Entrepreneurs inspires a global network of top business professionals to dedicate thousands of pro-bono hours to mentoring. Here are some of the programs that Endeavor offers: NEEDS ASSESSMENT Immediately after selection, Endeavor Entrepreneurs meet with an international consulting firm, which produces a tailored 18-month needs assessment. This work-plan serves as the framework for each entrepreneur to receive customized services. Endeavor works with such firms as BCG, McKinsey and Deloitte. LOCAL MENTORSHIP

PAGE 168 : Corporate Philanthropy Resource Guide

Top-flight business professionals mentor Endeavor Entrepreneurs to help them overcome their long-term business challenges. Endeavor also connects entrepreneurs with experts who can address time-sensitive challenges. In 2008, Endeavor made a commitment to the Clinton Global Initiative to promoting cross-cultural mentorship between Latin America and the Middle East for High-Impact Entrepreneur in order to increase cross-border collaboration and business activity. SKILLS BUILDING WORKSHOPS Endeavor organizes regular workshops for entrepreneurs to build their skills and to confront challenges unique to their situation as entrepreneurs. Every month, Endeavor Turkey hosts an intimate breakfast featuring an industry expert or an Endeavor Entrepreneur who leads a discussion on one specific issue. EMBA PROGRAM Endeavor recruits MBA students from leading US business schools to spend 10 weeks during the summer to help Endeavor Entrepreneurs on-site with their most critical business issues. Endeavor is among the top 2% of employers at both Harvard and Stanford business schools. CORPORATE ENGAGEMENT PROGRAM Endeavor recruits blue-chip companies to dedicate staff and resources to help Endeavor Entrepreneurs scale their businesses. Each fellowship is crafted to meet the specific needs of the entrepreneurs and to make full use of the technical skills and talents of the fellow. In 2009, Ernst & Young sent 10 partners for 3month sabbaticals to support Endeavor Entrepreneurs in Argentina, Chile and Uruguay. GLOBAL IMMERSION TOURS Endeavor Immersion Tours enable Endeavor Entrepreneurs to meet a diverse group of top-flight entrepreneurs, academics and business executives. On these tours, Endeavor Entrepreneurs have the chance to meet inspiring role models, learn about the challenges successful entrepreneurs have faced and discuss some of their own challenges. Endeavor has held tours in India, Israel and Boston featuring business icons such as Ratan Tata and Barry Diller. In 2008, Endeavor will hold tours in Silicon Valley and New York. Mentor Capital Program - Endeavor‘s Mentor Capital Program (MCP) is a new initiative designed to assist our Endeavor Entrepreneurs as they prepare for and raise equity capital. The MCP educates Endeavor Entrepreneurs on the fundraising process and provides mentorship through a simulated due diligence process. Those who successfully complete the 4-month program have the opportunity to pitch to top investors and receive ongoing advice and support. Endeavor believes that supporting high-impact entrepreneurs goes far beyond providing the necessary technical assistance to scale businesses. It is just as important for Endeavor to tell the stories of these remarkable entrepreneurs. This is for two main reasons – the

Other services

PAGE 169 : Corporate Philanthropy Resource Guide

role model effect and systemic effect. The importance of role models cannot be underestimated. Endeavor‘s High-Impact entrepreneurs are operating in economies where there are few examples of self-made role models. As almost every Endeavor Entrepreneur says, the decision to become an entrepreneur was ―crazy.‖ Results from Endeavor‘s annual entrepreneur survey have consistently shown that the fear of failure and a lack of support are the greatest barriers to starting a business. Yet, once these psychological obstacles are overcome, starting a business is lucrative for the entrepreneur and transformative for the local economy. In terms of Endeavor‘s systemic effect, spreading the story equates to building the network. These entrepreneurs, who embody hardwork, honest business and smart risk-taking are attractive to potential mentors, investors, and clients. Sharing these stories engenders a virtuous circle of wealth creation: these stories inspire the next generation of entrepreneurs, who add their own value to the local economy. The ultimate goal of Endeavor‘s mission is to transform entrepreneurial ecosystems in emerging economies, helping them replicate the Silicon Valley story and create sophisticated, competitive capital markets. To do so, Endeavor works to engage key agents of change: the investment community, the government, universities, and the media. These organizations all play critical roles in supporting an entrepreneurial ecosystem. However, the recognition that they must work together is not always self-evident. This is the important role that Endeavor plays. By reaching out to these different players, Endeavor is able to better serve its entrepreneurs and serve as the catalyst for building entrepreneurial ecosystems. The cultural effect that Endeavor is having on emerging market economies is real. Now is the time to strengthen Endeavor‘s presence in these communities.
Differentiating features of organization

Recent news / developments

From 1997-2009, Endeavor screened over 25,000emergingmarket entrepreneurs and selected the – 506 entrepreneurs leading 328 companies with high-impact potential. In 2009 alone, Endeavor Entrepreneurs generated over $3.5 billion in revenues. Endeavor companies have created over 130,000 jobs,. Three quarters of new ventures in emerging markets expect to hire a maximum of two people. The average number that an Endeavor Entrepreneur employs is -. 167 Over 400,000 emerging-market citizens are receiving entrepreneurial education directly through Endeavor. In 2009 Endeavor launched offices in Egypt and Jordan. In that tough financial year, Endeavor conducted surveys about the impact of the economic crisis on High-Impact Entrepreneurs. RecessionWire, VentureBeat, the World Economic Forum and the Economist picked up these results. In 2010 Endeavor conducted scoping trips to Indonesia, Kenya, Lebanon and Vietnam. It expects to launch an office in Beirut by

PAGE 170 : Corporate Philanthropy Resource Guide

January 2011, expanding its presence in the Middle East. Endeavor‘s bolstered presence in the Middle East, President Obama asked Endeavor CEO Linda Rottenberg, Endeavor Jordan founding board member Fadi Ghandour and four Endeavor Entrepreneurs to participate in the Presidential Summit on Entrepreneurship hosted in Washington in April 2010.
CONTACT Point of contact

Dave Geary, SVP, Global Partnerships Dave@endeavor.org 900 Broadway, Suite 301 New York, NY 10003, USA 212-352-3200

PAGE 171 : Corporate Philanthropy Resource Guide

European Venture Philanthropy Association (EVPA)
http://www.evpa.eu.com/
OVERVIEW Mission

Type of organization Year of origin Headquarters location International scope Senior leadership Number of employees Target audience Size of membership / network Membership fee, if applicable

EVPA‘s mission is to promote the expansion and effectiveness of venture philanthropy in Europe, by promoting the impact of venture philanthropy and providing learning opportunities. Membership Association (registered charity) 2004 Brussels Europe Serge Raicher, Chairman Beate Trück, Managing Director 6 Individuals and organisations interested in or practising venture philanthropy 115 Ranging from €1,000 to €2,500

SERVICES Services and programs

Networking and events Training for key skills Research and publications Member-only forum Connecting practitioners Best practices and guidelines Country seminars Annual conference for thought leaders in the field Workshops and site visits Quarterly newsletter Venture Philanthropy, Social Impact Measurement, Social Enterprise Unique pan-European association dedicated to Venture Philanthropy Launch of the Knowledge Centre, a European Hub for Venture Philanthropy Knowledge

Research areas Competitive advantages Recent news / developments

CONTACT Point of contact

Beate Trück, Managing Director btrueck@evpa.eu.com +32 (2) 534.33.45

PAGE 172 : Corporate Philanthropy Resource Guide

Venture Philanthropy Partners (VPP)
www.vppartners.org

OVERVIEW Mission

Type of organization Year of origin Headquarters location Senior leadership

The mission of Venture Philanthropy Partners (VPP) is to concentrate investments of money, expertise, and personal contacts to improve the lives and boost the opportunities of children and youth of low-income families in the National Capital Region. We do so by helping effective community leaders build strong nonprofit institutions and by cultivating an engaged donor community to generate funding and influence in support of these institutions and of social change. Philanthropic investment organization 2000 Washington, DC Mario Morino, Chairman Carol Thompson Cole, Executive Committee Chair, President and CEO 13 High-performing nonprofit organizations serving core needs of children and youth from low-income families in the National Capital Region Individual philanthropists, foundations, and corporate partners interested in becoming part of VPP‘s investor community 78 individual and family investor, foundations, corporate partners

Number of employees Target audience

Size of membership / network

SERVICES Services and programs

VPP‘s approach combines large amounts of growth capital with strategic assistance to a select group of nonprofits serving children and youth of low-income families in the National Capital Region – its ―portfolio‖. VPP serves as a trusted advisor to its portfolio organizations to help them increase their impact on the communities they serve. Over multiple years (average commitment is 3-5 years) VPP focuses its capital and expertise to: Clarifying mission, vision and growth plans Building strong senior management teams Creating engaged boards Increasing fiscal accountability and stability Improving programs Developing systems to assess performance

PAGE 173 : Corporate Philanthropy Resource Guide

Differentiating features of organization

Recent news / developments

Large amounts of growth capital (average investment $4M) In depth strategic assistance Multi-year commitment Strategic assistance primarily conducted by VPP professional investment team (full time staff) comprised of seasoned executives Fully committed first fund of $32M, raised over $42M for second portfolio. Initiated Portfolio II in November 2009. Selected as one of 11 grantmaking intermediary organizations nationally for Social Innovation Fund federal grant award of $4M in July 2010.

CONTACT Point of contact

Victoria Vrana, Vice President of Communications and Assessment, vvrana@vppartners.org, 202.263.4789

PAGE 174 : Corporate Philanthropy Resource Guide

3BL Media, LLC
http://3blmedia.com

OVERVIEW Mission

To promote corporate responsibility through effective communications and content distribution leveraging new media methods and the social web Communications / Media 2009 Northampton, Massachusetts Worldwide – Primarily US, UK, Europe Greg Schneider, Co-Founder / CEO Cindy Esposito, Co-Founder / COO Doug Fulton, Co-Founder / CTO Clients include for profit and non-profit organizations of all sizes

Type of organization Year of origin Headquarters location International scope Senior leadership

Target audience

SERVICES Services and programs Differentiating features of organization Competitive advantages Recent news / developments

Distribution of corporate responsibility news and content on behalf of our clients throughout the social web Distribution of multiple media formats beyond press releases, including blogs, videos, reports, podcasts, white papers and more Largest CSR distribution network to media, professionals, practitioners and consumers using traditional and social media See 3blmedia.com – 3BL Media In the news

CONTACT Point of contact

Greg Schneider, gschneider@3blmedia.com 866-508-0993 x113

PAGE 175 : Corporate Philanthropy Resource Guide

Corporate Philanthropy Report
OVERVIEW Type of organization Headquarters location Senior leadership

Corporate Philanthropy Report is a monthly publication for corporate giving professionals San Francisco, CA Susan E. Lewis, Publisher Kelly J. Sullivan, Managing Editor Nicholas King, Editor
Note: The Corporate Philanthropy Report is a publication of JosseyBass, A Wiley Imprint

Target audience Membership fee, if applicable

Corporate giving professionals and nonprofit development officers Annual individual subscription rate in the United States and Canada (12 issues): $272

SERVICES Services and programs

Monthly 16-page publication Packed with details on philanthropic programs that work in all fields, including the arts, environment, health care, higher education, community development, and more. Opportunities for donations that go beyond cash, such as sponsorships, technology, equipment and use of personnel resources. Trends in corporate philanthropy Jossey-Bass publishes a number of resources for corporate and nonprofit leaders including: Leader to Leader Nonprofit Business Advisor Federal Grants & Contracts Board & Administrator—for administrators only Journal of Leadership Studies The Corporate Philanthropy Report provides the corporate as well as the nonprofit view, to show how both sides partner to create successful, long-term alliances.

Other services

Differentiating features of organization

CONTACT Point of contact

Kelly J. Sullivan, Managing Editor ksullivan@wiley.com Nicholas King, Editor nkelwr@comcast.net Sales and Subscriptions: jbsubs@jbp.com

PAGE 176 : Corporate Philanthropy Resource Guide

The Chronicle of Philanthropy
www.philanthropy.com

OVERVIEW Mission

Type of organization Year of origin Headquarters location International scope Senior leadership

The Chronicle of Philanthropy connects the nonprofit world to news, jobs, and ideas. The Chronicle and its Web site, Philanthropy.com, keep you informed about the latest trends in fund raising, giving, and nonprofit management, plus exclusive data and surveys, special features on the causes you support, and Philanthropy Careers – your source for jobs in the nonprofit world. Publisher 1988 Washington, DC Yes Stacy Palmer, Editor Jennifer Moore, Managing Editor Note: Owned by The Chronicle of Higher Education Inc. Charity leaders, fund raisers, grant makers, and other people involved in the philanthropic enterprise Approximately 30,000 paid subscribers to the print edition. 175,000 unique visitors to Philanthropy.com. 50,000 subscribers to Philanthropy Today e-mail newsletter. 20,000 followers on Twitter (@philanthropy).

Target audience Size of membership / network

SERVICES Services and programs

Sections: Front Page, Giving, Fund Raising, Managing, Causes, Facts & Figures, Philanthropy Today, Jobs, Community, Marketplace Published 18 times per year in print; Daily news published on Philanthropy.com; Daily e-mail newsletter ―Philanthropy Today‖ Calendar of events includes all conferences, workshops, and online courses known to The Chronicle Paid subscription includes 18 print issues per year plus full access Philanthropy.com. Digital subscriptions available. Sign up for a free account, including free subscription to the Philanthropy Today e-mail newsletter, at http://philanthropy.com/myaccount

Other services

CONTACT Point of contact

Michael Solomon: press@philanthropy.com 202-466-1764

PAGE 177 : Corporate Philanthropy Resource Guide

Philanthropy Journal
www.philanthropyjournal.org

OVERVIEW Mission

The vision of the Philanthropy Journal is to help people understand, support and work in the nonprofit and philanthropic world, and help them recognize and solve social problems. News source for the nonprofit and philanthropic world 2000 Raleigh, North Carolina Readers throughout U.S. and abroad Todd Cohen, Editor and publisher Suzie Koonce, Director of business development Note: The Philanthropy Journal is a program of the Institute for Nonprofits at NC State University. 5 Readers are nonprofit professionals, volunteers and people interested in news and information about the nonprofit sector 13,000 email newsletter subscribers; 110,000 page views per month; 40,000 unique monthly visitors to website Subscription is free. Additional benefits available to members, starting at $50 for an Individual membership. Philanthropy Journal delivers news, information and opinion about charitable giving, fundraising and management, focusing in particular on organizational effectiveness, donor engagement and collaboration. Website free and updated daily Weekly email bulletin Periodic special, in-depth reports Nonprofit Expertise Philanthropy Journal frequently is contacted by other news organizations (New York Times, The Economist, BBC and National Public Radio) as an expert source on nonprofit and philanthropic issues Nonprofit Resources section features how-to articles on charitable giving, fundraising, management and leadership, marketing and communications; monthly online webinars focus on same broad topics

Type of organization Year of origin Headquarters location International scope Senior leadership

Number of employees Target audience Size of membership / network Membership fee, if applicable SERVICES Services and programs

Other services

Differentiating features of organization

CONTACT Point of contact

Todd Cohen, editor and publisher, 919.515.0268, tcohen@philanthropyjournal.org; Suzie Koonce, director of business development, 919.515.0271, skoonce@philanthropyjournal.org

PAGE 178 : Corporate Philanthropy Resource Guide

Philanthropy News Digest
http://foundationcenter.org/pnd/

OVERVIEW Mission

Type of organization Year of origin Headquarters location Senior leadership Target audience Size of membership / network

Philanthropy News Digest (PND), a daily news service of the Foundation Center, is an online compendium, in digest form, of philanthropy-related articles and features. Nonprofit news digest published by the Foundation Center 1997 New York, New York Mitch Nauffts, Publisher and Editorial Director Professionals working in the nonprofit and philanthropic sectors 64,000 subscribers to weekly e-mail newsletter; 26,500+ web site visits per day

SERVICES Services and programs

Other services

Differentiating features of organization Competitive advantages

In addition to news stories culled from media outlets nationwide, PND publishes nonprofit job listings, RFPs, outside commentary and opinion, book reviews, and exclusive interviews with leaders in the field. • PhilanTopic, a blog of opinion and commentary (http://pndblog.typepad.com/pndblog/) • Twitter feed at http://twitter.com/pndblog Published by the Foundation Center, the nation‘s leading authority on philanthropy. Delivery options include: • Weekly e-mail newsletters for news, RFPs, and jobs • On-demand e-mail alerts for news, RFPs, and jobs based on subscriber‘s areas of interest • RSS feed of headlines PND Mobile: PND news abstracts, RFPs, and jobs are now available on a mobile-friendly web site (http://m.foundationcenter.org/pnd/)

Recent news / developments

CONTACT Point of contact

Mitch Nauffts, Publisher and Editorial Director, Philanthropy News Digest (212) 807-2433 mfn@foundationcenter.org

PAGE 179 : Corporate Philanthropy Resource Guide

Stanford Social Innovation Review
www.ssireview.org

OVERVIEW Mission

To advance, educate, and inspire the field of social innovation by seeking out, cultivating, and disseminating the best in researchand practice-based knowledge. Publish quarterly magazine, website, and blogs; sponsor conferences and webinars 2003 Stanford University, Stanford, California Coverage of international organizations. Global readership and website visitors. Eric Nee, managing editor Regina Ridley, publishing director Senior management at nonprofits, foundations, and socially responsible businesses Magazine circulation of 12,000. Unique monthly visitors to website 30,000.

Type of organization Year of origin Headquarters location International scope Senior leadership Target audience Size of membership / network

SERVICES Services and programs

Quarterly magazine. Website and blogs. Monthly webinars. Twice a year conferences.

CONTACT Point of contact

Eric Nee, managing editor, nee_eric@gsb.stanford.edu

PAGE 180 : Corporate Philanthropy Resource Guide

Participating Organizations

3BL Media, LLC AccountAbility Action Without Borders / Idealist.org Acumen Fund ADMICAL American Institute of Philanthropy AngelPoints APCO Worldwide The Aspen Institute Association of Corporate Contributions Professionals (ACCP) Association of Fundraising Professionals Boston College Center for Corporate Citizenship Bridgespan BSR (Business for Social Responsibility) Business Civic Leadership Center Business in Community (BITC) Business Roundtable CAFAmerica Canadian Business for Social Responsibility The Catchpole Corporation Cause Consulting Cause Marketing Forum The Center for Effective Philanthropy (CEP) Center for Responsible Business Center for Social Innovation, Center on Philanthropy at Indiana University Ceres Changing Our World, Inc. Charity Navigator The Chronicle of Philanthropy CMO Council Committee Encouraging Corporate Philanthropy Comunitas Cone The Conference Board The Consulting Network Corporate Philanthropy Report Corporate Responsibility Officer (CR Magazine) CSR Europe Echoing Green Endeavor Entrepreneurs Foundation E-Philanthropy Solutions Inc. European Foundation Centre European Venture Philanthropy Association (EVPA) Fleishman-Hillard Forum of Regional Associations of Grantmakers

The Foundation Center FSG Social Impact Advisors Giving Institute: Leading Consultants to Non-Profits Global Business Network (GBN) Global Philanthropy Forum Global Philanthropic Global Reporting Initiative (GRI) GlobalGiving Foundation Grantmakers for Effective Organizations GreenNonprofits.org GuideStar Independent Sector International Business Leaders Forum (IBLF) International Finance Corporation International Society of Business, Economics, & Ethics (ISBEE) The JK Group, Inc. LBG Associates LBG Research Institute Louder Than Words, Inc. Mission Measurement, LLC National Committee for Responsive Philanthropy The National Philanthropic Trust Net Impact NPower NY Oxford Analytica People to People Fundraising Philanthropic Initiative (TPI) Philanthropy Journal Philanthropy News Digest Points of Light Public/Private Ventures (P/PV) Rockefeller Philanthropy Advisors Stanford Graduate School of Business Stanford Social Innovation Review Strategic Philanthropy Advisors, LLC Taproot Foundation TCC Group TechSoup Global True Impact LLC UN Global Compact Venture Philanthropy Partners (VPP) VolunteerMatch Walker Information Wellspring Consulting Worldwide Initiatives for Grantmaker Support Yale School of Management Program on Social Enterprise

PAGE 181 : Corporate Philanthropy Resource Guide

PAGE 193 : Corporate Philanthropy Resource Guide

Sign up to vote on this title
UsefulNot useful