You are on page 1of 404

CONMETALL GmbH & Co.

KG
Hafenstraße 26
D-29223 Celle

Postfach 2126 Tel.: +49 (0) 5141 / 180 E-Mail: info@conmetall.de


D-29261 Celle Fax: +49 (0) 5141 / 18 264 www.conmetall.de

CONMETALL N.V./S.A. CONMETALL spol. s r.o. RuC Holding Conmetall, S.A.


Oudestraat 53 Partyzánská 18 $Y'LDJRQDO$
2860 Sint-Katelijne-Waver 747 05 Opava 5 08013 Barcelona
Czech Republic España

Tel.: +32 15293949 Tel.: +420 553662403 Tel.: +34 934774919


Fax: +32 15293333 Fax: +420 553662740 Fax: +34 934774918
E-Mail: info@conmetall.be E-Mail: info@conmetall.cz E-Mail: comercial@conmetall.es

CONMETALL en France Società Partner Wurth doo, Srbija


MASIDEF S.r.l. 6YHWRJ6DYHY6XUþLQ
Socio Unico Würth S.r.l. SRB-11271 Beograd.
Via Guglielmo Oberdan 125
I-21042 Caronno Pertusella (VA)
Tel.: +49 5141 18 161 Tel.: +39 029651011 Tel.: +381 11 2078 250
Fax: +49 5141 18 317161 Fax: +39 0296510100 Fax: +381 11 2260 250
E-Mail: france@conmetall.de E-Mail: info@masidef.com E-Mail: prodaja@wurth.rs

Wurth BH d.o.o. Würth-Hrvatska d.o.o. Ferrometal Oy


%LQMHåHYREE+DGåLüL%L+ )UDQMH/XþLüD Karhutie 9
HR-10000 Zagreb 01900 Nurmijärvi
Finnland
Tel.: + 387 (0) 33 775 024;
+ 387 (0) 33 775 031 Tel.: +385 1 3498 784 Tel.: + 358 10-308 11
Fax: + 387 (0) 33 775 025 Fax: +385 1 3498 783 Fax: +358 10-308 4501
E-Mail: info@wurth.ba E-Mail: wuerth@wuerth.com.hr (0DLO 6DOHV#IHUURPHWDO¿

John Murphy Castlerea Ltd.


Castlerea Business Park
IDA Industrial Park
The Demesne
Castlerea
Co Roscommon
Southern Ireland
Tel.: +353 949620182
Fax: +353 949620092
E-Mail:
info@johnmurphycastlerea.ie
7-147
Tools

148-299
Ironmongery

300-340
Garden

341-391
Sanitary

392-402
Index
Craft accessories

Craft knife
• With 6 different blades

No.: PU EAN Placement Clip Stripe Article

B20871 20 D22 X -
4 004722 624199

Craft knife set, 16 pieces


• 2 universal knives with 2-component-handles
and 14 different blades
• Simple blade changing with screw fastener
• In practical storage box

No.: PU EAN Placement Clip Stripe Article

B20896 12 K14 X -
4 004722 629293

Multi-polishing set, 20 pieces


‡0D[530
• ø approx. 3.1 mm
• In practical storage box

No.: PU EAN Placement Clip Stripe Article

B23703 8 M20. X X
4 004722 629682

8 Subjects to change without notice 09.2016


Craft accessories

Multi-grinding set, 31 pieces


‡0D[530
• ø approx. 3.1 mm
• In practical storage box

No.: PU EAN Placement Clip Stripe Article

B23704 8 M20. X X
4 004722 629675

High-performance tacker
• Stable metal construction
• Firepower regulation
• Minimal rebound
• Rapid charging system
• For staples from 4-14 mm
• Type 57
‡,QFOXGLQJFOLSVPP
• Lock guard

No.: PU EAN Placement Clip Stripe Article

B23821 10 K21 X X
4 004722 621525

09.2016 Subjects to change without notice 9


Craft accessories

Professional 2 in 1 tacker, with stapling function


• For 4 - 8 mm staples
• Type 53
• With stapler
• Also for tacking and stapling paper
• Includes tacker staples

No.: PU EAN Placement Clip Stripe Article

B23822 12 G40 X X
4 004722 627213

Professional tacker and nail gun in case


• Includes staples
‡ 8FODPSVDQGQDLOV8FODPSVDQGQDLOVLQFOXGLQJ
FODPSVPPW\SHPP8FODPSVPPQDLOV
• Solid metal construction
• Firepower regulation
• Minimal rebound
• Rapid charging system
• Lock guards
‡ )RUWDFNHUVWDSOHVPPW\SHIRU8FODPSV
PPIRUQDLOVPP
• In a practical storage case

No.: PU EAN Placement Clip Stripe Article

B23824 6 M45 X -
4 004722 627220

10 Subjects to change without notice 09.2016


Craft accessories

Tacker staples, 8 mm
• Type 53
• 3.000 pieces

No.: PU EAN Placement Clip Stripe Article

B23838 10 K9 X X
4 004722 621495

Terminal clamp
• Made of plastic

No.: PU EAN Placement Size Clip Stripe Article

B25158 60 K20 - 80 mm -
4 004722 620030

B25160 30 K20 - 160 mm -


4 004722 620047

Spring clamp set 22-pieces, 63/90 mm


• Plastic
• 18 x 63 mm
• 4 x 90 mm
• With movable jaw
• In a sturdy storage tin

No.: PU EAN Placement Clip Stripe Article

B25161 20 G48 X -
4 035300 894253

09.2016 Subjects to change without notice 11


Craft accessories

Screw clamps set 2 pieces


• 50 x 200 mm
• With plastic jaws
• With wooden handle

No.: PU EAN Placement Clip Stripe Article

B25621 16 G38 - -
4 035300 893546

Plastic F clamps set, 4 pieces


• Made from fibre-glass reinforced synthetic nylon
• Steel rail with
• With plastic jaws

• 2 pieces dimensions 105 x 200 mm


• Max. jaw width 105 mm
• Max. outreach 30 mm
• Max. spreading width 190 mm
• Thickness of the steel rail 3 x 8 mm
• Max. contact pressure 100N

• 2 pieces dimensions 155 x 345 mm


• Max. jaw width 155 mm
• Max. outreach 60 mm
• Max. spreading width 330 mm
• Thickness of the steel rail 6 x 19 mm
• Max. contact pressure 150N

No.: PU EAN Placement Clip Stripe Article

B25665 8 G52 X -
4 035300 893560

12 Subjects to change without notice 09.2016


Craft accessories

Hot glue gun, wireless


• Can be used with or without mains cable
• LED light for illuminating the working area
• Stand
• Anti-drip function
‡6XLWDEOHIRUERQGLQJPDQ\PDWHULDOVVXFKDVZRRG
SODVWLFIRDPFHUDPLFV
‡9ROWDJH9a+]SRZHUFRQVXPSWLRQ:
• Heating-up time: approx. 3 min.

Accessories:
• Charger for heating the device up
• 2 nozzles with a round nozzle outlet
• One precision nozzle (for targeted application of small
quantities of adhesive in hard-to-reach places)
• One spanner (for changing the nozzles)
• Anti-slip support stand
• 6 glue sticks 11 x 150 mm

No.: PU EAN Placement Clip Stripe Article

B27414 4 G57 - -
4 035300 905751

Hot glue gun with LED


• With LED light for illuminating the work area
• With stand
• Anti-drip function
• Including 6 glue sticks each 150 mm long
• For bonding many materials

No.: PU EAN Placement Clip Stripe Article

B27415 6 M42 X X
4 004722 629811

09.2016 Subjects to change without notice 13


Craft accessories

Hot glue sticks, 8 pieces


• ø 11 x 100 mm
• Fits all commercial hot glue guns

No.: PU EAN Placement Clip Stripe Article

B27416 24 K22 X X
4 004722 629828

Mitre clamp
GHJUHHVFODPSLQJUDQJHDSSUR[PP

No.: PU EAN Placement Clip Stripe Article

CP861175 10 K28 - -
4 035300 829514

14 Subjects to change without notice 09.2016


Fastening elements

Cable ties, 50 pieces


• 4 x 250 mm
• Black
• UV-resistant

No.: PU EAN Placement Clip Stripe Article

B20441 20 K20 X X
4 004722 622690

Cable ties, 50 pieces


• 450 mm
• Black
• UV-resistant

No.: PU EAN Placement Clip Stripe Article

B20450 10 K53 X X
4 004722 622829

09.2016 Subjects to change without notice 15


Fastening elements

Cable tie assortment, 75 pieces


• 25x 100 mm
• 25x 160 mm
• 25x 190 mm
• Black
• UV-resistant

No.: PU EAN Placement Clip Stripe Article

B20442 20 K20 X X
4 004722 622683

Cable ties
• White

No.: PU EAN Placement Size Clip Stripe Article

B20443 20 K20 X [PP X


4 004722 627169

B20444 20 K20 X [PP X


4 004722 627176

B20445 10 K53 X [PP X


4 004722 627183

16 Subjects to change without notice 09.2016


Fastening elements

Cable ties, 75 pieces


• 25x 100 mm
• 25x 160 mm
• 25x 190 mm
• White

No.: PU EAN Placement Clip Stripe Article

B20446 20 K20 X X
4 004722 627190

Cable tie assortment, 450 pieces


• UV-resistant
• 200x 2.6 x 100 mm white/black
• 200x 4.8 x 200 mm white/black
• 50x 4.8 x 280 mm white

No.: PU EAN Placement Clip Stripe Article

B20447 15 G50 X X
4 035300 890293

Velcro assortment, 5 pieces


• Strong Velcro fastener
• For labelling when routing or bundling cables or hoses
‡GLIIHUHQWFRORXUVJUHHQ\HOORZEOXHEODFNUHG
• 180 mm x 20 mm

No.: PU EAN Placement Clip Stripe Article

B20448 16 K14 X X
4 004722 635881

09.2016 Subjects to change without notice 17


Fastening elements

Reusable cable ties set


7KHFDEOHWLHFDQEHUHOHDVHGWLPHDQGDJDLQDQGUHXVHG
• Material: polyamide
• Colour: black
• UV resistant
It is not possible to remove standard/commercial cable ties
ZLWKRXWGHVWUR\LQJWKHPLIWKH\KDYHEHHQPRXQWHG
LQFRUUHFWO\RQWKHRWKHUKDQGWKH\FDQQRWEHUHXVHGHLWKHU

,I\RXYDOXHH[DFWO\WKHVHIHDWXUHV\RXVKRXOGRSWIRUD
re-usable cable tie set. This design features a small release
FRQWUROZKLFKDOORZV\RXWRRSHQWKHFDEOHWLH
• 3.5 mm x 150 mm - 25 pcs.
• 4.8 mm x 280 mm - 25 pcs.
• 7.6 mm x 300 mm - 25 pcs

No.: PU EAN Placement Clip Stripe Article

B20451 10 M40 X X
4 004722 636512

18 Subjects to change without notice 09.2016


Fastening elements

Reusable cable tie 7.5 x 300 mm


7KHFDEOHWLHFDQEHUHOHDVHGWLPHDQGDJDLQDQGUHXVHG
• Material: polyamide
• Colour: black
• UV resistant
It is not possible to remove standard/commercial cable ties
ZLWKRXWGHVWUR\LQJWKHP
LIWKH\KDYHEHHQPRXQWHGLQFRUUHFWO\RQWKHRWKHUKDQG
they cannot be reused either.
If you value exactly these
IHDWXUHV\RXVKRXOGRSWIRUDUHXVDEOHFDEOHWLHVHW7KLV
GHVLJQIHDWXUHVDVPDOOUHOHDVHFRQWUROZKLFKDOORZV\RXWR
open the cable tie
• 7.5 mm x 300 mm - 50 pieces

No.: PU EAN Placement Clip Stripe Article

B20452 10 M40 X X
4 004722 636529

Reusable cable tie 4.8 x 280 mm


7KHFDEOHWLHFDQEHUHOHDVHGWLPHDQGDJDLQDQGUHXVHG
• Material: polyamide
• Colour: black
• UV resistant
It is not possible to remove standard/commercial cable ties
ZLWKRXWGHVWUR\LQJWKHPLIWKH\KDYHEHHQPRXQWHG
LQFRUUHFWO\RQWKHRWKHUKDQGWKH\FDQQRWEHUHXVHGHLWKHU
,I\RXYDOXHH[DFWO\WKHVHIHDWXUHV\RXVKRXOGRSWIRUD
re-usable cable tie set. This design features a small release
FRQWUROZKLFKDOORZV\RXWRRSHQWKHFDEOHWLH
• 4.8 mm x 280 mm - 50 pieces

No.: PU EAN Placement Clip Stripe Article

B20453 20 M40 X X
4 004722 636536

09.2016 Subjects to change without notice 19


Bits

Torsion bit set, 25 pieces


:KHQXVLQJPHFKDQLFDOVFUHZFRQQHFWLRQVHJZLWK
FRUGOHVVVFUHZGULYHUVWKHUHDUHLQFUHDVHGVWUHVVSHDNV
which can frequently lead to premature wear or even to
breakage of the bit or to the destruction of the screw. Thanks
WRLWVWRUVLRQ]RQHWKHQHZ&210(7$/ELWDFKLHYHVD
shock-absorbing effect. The special form of the torsion bit
allows the bit to be twisted by more than 30%. This leads to
an extension of the life of the bit and the screw.

• Professional quality with colour-coding system


• In a new CONMETALL designer box with belt clip
• 23 bits (25 mm) made of silicon molybdenum steel ( S2)
in professional quality with colour-coding system
‡3+
‡3=
‡6ORW
‡+H[DJRQVRFNHW
‡7;75
• Patented bit holder with strong magnet and quick-change
adapter
• Adapter 6 Edge on square
• In a new CONMETALL designer box with belt clip

• Torsional zone = Shock absorption effect


• Shocking of load peaks
• Reduced wear and tear
• Reduction of the risk of fracture
• Increased service life

No.: PU EAN Placement Clip Stripe Article

COXB973725 12 D28 X X
4 035300 914852

20 Subjects to change without notice 09.2016


Bits

Handy bit set, 15 units


• Professional quality bits made from silicone molybdenum
steel (S2)
‡:LWK³GULYH
‡&RORXUFRGLQJIRUHDV\ELWVHOHFWLRQSDWHQWHGELWKROGHUZLWK
strong magnet and quick-action chuck•
• In a conveniently-sized plastic folding box with see-through
cover.

Contents consist of:


‡3+
‡3=
‡6ORWPP
‡7;

No.: PU EAN Placement Clip Stripe Article

COXB973915 12 D28 - -
4 035300 723638

Bit set, 31 pieces


• Professional quality bits made from silicone molybdenum
steel (S2)
• With 1/4“ drive
• Colour coding for easy bit selection
• Patented bit holder with strong magnet and quick-action
chuck
• Automatic opening by pressing a button

Content:
‡3+[3+[3+[
‡3=[3+[3+[
‡7;[[[[

No.: PU EAN Placement Clip Stripe Article

COXB973731 12 D35 - -
4 035300 764068

09.2016 Subjects to change without notice 21


Bits

Bit box, 32-piece


• Professional quality bits made from silicone molybdenum
steel (S2)
• With 1/4“ drive
• Colour coding for easy bit selection
• Patented bit holder with strong magnet and quick-action
chuck

Contents:
‡3+
‡3=
‡6ORWPP
‡+H[DJRQPP
‡7;
‡7;75

No.: PU EAN Placement Clip Stripe Article

COXB973932 12 D28 X X
4 035300 705214

Bit set, 32 pieces, with mini ratchet 1/4“


• Professional quality bits made from silicone molybdenum
steel (S2)
• With 1/4“ drive
• Ratchet and bit holder included
• Colour coding for easy bit selection
Contents:
‡3+
‡3=
‡6ORWPP
‡+H[DJRQPP
‡7;
‡7;75

No.: PU EAN Placement Clip Stripe Article

COXB973832 12 D28 X X
4 035300 713943

22 Subjects to change without notice 09.2016


Bits

Security bit set, 32 pieces


• Professional quality bits made from silicone molybdenum
steel (S2)
• With 1/4“ drive
• With all-purpose magnet holder
• Ideal storage of all parts with labelling in a practical folding
plastic box with see-through lid

No.: PU EAN Placement Clip Stripe Article

COXB973732 12 D28 X X
4 035300 740697

Set of bits and socket wrenches, 25 pieces, with ratchet


box wrench
• Silicon molybdenum steel bits (S2) professional quality
• CV steel socket wrench
• With 1/4“ drive
• Colour guide system for easy bit choice
• Mini ratchet box wrench for bits with right/left working
GLUHFWLRQFRQYHUWHU
‡6RFNHWZUHQFKLQVHUWVZLWK³DGDSWRUXVDEOHLQ
connection with box wrench
• In addition with universal magnet holder.
• Ideal storage of all parts with labelling in practical plastic
folding box with see-through lid
• Practical 360 degree rotatable belt clip

Contents:
‡3+
‡3=
‡6ORWPP
‡+H[DJRQPP
‡7;
‡6RFNHWVSDQQHULQVHUWVPP

No.: PU EAN Placement Clip Stripe Article

COXB973925 12 D28 X X
4 035300 713967

09.2016 Subjects to change without notice 23


Bits

Set of bits and socket wrenches, 46 pieces, with ratchet


‡%LWVRIVLOLFRQPRO\EGHQXPVWHHO 6 SURIHVVLRQDOTXDOLW\
• Sockets of chrome vanadium steel
• 1/4“ drive
• Patented bit holder with strong magnet and quick-change
FKXFN
• Mini-ratchet with right/left switcher
• Colour-coded system for easy bit selection

Contents:
‡3+
‡3=
‡6ORWPP
‡7;75
‡+H[DJRQPP
‡7;
• Push-through socket wrenches
PP
• Adapter

No.: PU EAN Placement Clip Stripe Article

COXB973946 6 D28 - -
4 035300 764051

Long design bit set, 18 pieces


• Professional quality long silicon molybdenum steel bits (S2)
• 1/4“ drive
• Colour guide system for easy bit choice

Contents:
‡6ORWPP
‡7;
‡3=
‡3+
‡+H[DJRQPP

No.: PU EAN Placement Clip Stripe Article

COXB973918 8 D25 - -
4 035300 712830

24 Subjects to change without notice 09.2016


Bits

Bit box, 71-piece


• Professional quality long silicon molybdenum steel bits
• Ideal storage of all parts with labelling in practical plastic
folding box
• 60x 25 mm bits in all sizes
‡ORQJELWVPPIRUGLIILFXOWWRUHDFKDUHDVGULYH³
• 2 different bit holders with magnet and quick-change
function

Contents:
75 mm Bits:
‡3+
‡3=
‡6ORWPP
‡7;

25 mm Bits
‡3+ [  [  [
‡3= [  [  [
‡6ORW [ PP [
‡+H[DJRQ [  [ PP [
‡7; [  [  [  [  [  [ 
40 (3x)

No.: PU EAN Placement Clip Stripe Article

COXB973971 8 D28 - -
4 035300 713974

Angle screws set


‡³KH[GULYHPDJQHWLF
• 1/4“ bit holder
• Overall size 30 mm
• Length 140 mm
• Tilt angle around 105 degrees
• Handle rotatable 306 degrees
• Makes it possible to reach difficult-to-access places
• Suitable for use with cordless screwdrivers

No.: PU EAN Placement Clip Stripe Article

B20908 12 M13 X X
4 004722 626452

09.2016 Subjects to change without notice 25


Bits

Bit holder
• Magnetic
• With quick-change nut
• Ideal for work in difficult-to-reach places

No.: PU EAN Placement Size Clip Stripe Article

B23062 12 K15 X 150 mm X


4 004722 626339

B23063 12 K20 X 300 mm X


4 004722 624083

B23064 12 K53 X 450 mm X


4 004722 626322

Universal bit holder set


• Usable as a bit holder with battery-powered screwdriver
or with 2-component handle as a screwdriver
‡,QFOXGLQJELWVPDGHRIVLOLFRQPRO\EGHQXPVWHHO
professional quality
‡3=
‡7;

No.: PU EAN Placement Clip Stripe Article

B23069 20 K14 X X
4 004722 626353

26 Subjects to change without notice 09.2016


Drills

Wood drill set, 5 pieces


• 4 mm - 5 mm - 6 mm - 8 mm - 10 mm
• In plastic cassette

No.: PU EAN Placement Clip Stripe Article

B23305 18 K20 X X
4 004722 619966

Hexagonal drill set, 32 pieces


• 6 pieces wood drill with hexagon holder:
3 - 3.5 - 4 - 4.5 - 5 - 6 mm
• 9 pieces HSS drill with hexagon holder:
1 - 1.5 - 2 - 2.5 - 3 - 3 - 3.2 - 3.5 - 4 mm
• 16 pieces bits 25 mm made of chrome-vanadium:
Slot 4 - 5 - 6 - 7; PH 0 - 1 - 2 - 3;
TX 10 - 15 - 20 - 25 - 27 - 30 - 35 - 40
• 1 bit holder with quick change function
• Suitable for commercial cordless screwdrivers and bit
holders
• With practical plastic box

No.: PU EAN Placement Clip Stripe Article

B23407 8 G45 X -
4 035300 897766

09.2016 Subjects to change without notice 27


Drills

Combo drill bit set, 27 pieces


• 6x wood drill ø 3 - 10 mm
• 6x stone drill ø 3 - 10 mm
• 15x metal drill ø 1.5 - 10 mm
• In a practical plastic storage box

No.: PU EAN Placement Clip Stripe Article

B23408 8 D36 - -
4 004722 631838

Combo drill bit set, 9 pieces


• HSS spiral drill 5 mm - 6 mm - 8 mm
• Stone drill 5 mm - 6 mm - 8 mm
• Wood drill 5 mm - 6 mm - 8 mm
• In plastic cassette

No.: PU EAN Placement Clip Stripe Article

B23409 16 K12 X X
4 004722 619980

Stone drilling set, 5 pieces


• 4 mm - 5 mm - 6 mm - 8 mm - 10 mm
• In plastic cassette

No.: PU EAN Placement Clip Stripe Article

B23795 24 K20 X X
4 004722 620009

28 Subjects to change without notice 09.2016


Drills

Drilling aid with drilling dust capture


• For drills with diameters from 4 to 12 mm
• Easier right-angled drilling
• Prevents drill slippage

No.: PU EAN Placement Clip Stripe Article

B23798 20 M20 X X
4 004722 632545

Forstner drill set, 5 pieces


In a practical wooden box
Shaft ø 8 mm

No.: PU EAN Placement Clip Stripe Article

BP302505 5 K18 - -
4 035300 769865

09.2016 Subjects to change without notice 29


Drills

Set of milling cutters, carbide, 6 pieces


,QSUDFWLFDOZRRGHQER[SDUWLDOO\ZLWKVSDFHUGLVNV
shaft ø 8 mm
Contents:
1 half groove profile cutter ø 22 mm
1 groove cutter ø 6 mm
1 rounding cutter ø 22 mm
1 edge miller ø 12.7 mm
1 groove cutter ø 12 mm
1 deburrer/ tooth miller ø 12.7 mm

No.: PU EAN Placement Clip Stripe Article

BP305006 5 K18 - -
4 035300 769810

Set of milling cutters, carbide, 12 pieces


,QSUDFWLFDOZRRGHQER[SDUWLDOO\ZLWKVSDFHUGLVNV
shaft ø 8 mm
Contents:
1 chamfer cutter ø 26 mm
1 rounding cutter ø 25 mm
1 half-groove profile cutter ø 22 mm
1 rounding cutter ø 33 mm
1 half-hollow groove profile cutter ø 29 mm
1 profile cutter ø 35 mm
1 groove cutter ø 8 mm
1 groove cutter ø 16 mm
1 edge miller ø 19 mm
1 groove profile cutter ø 12 mm
1 deburrer/ tooth miller ø 16 mm
1 engraving cutter ø 15 mm

No.: PU EAN Placement Clip Stripe Article

BP305012 5 K26 - -
4 035300 769841

30 Subjects to change without notice 09.2016


Hammers

Roofing hammer
',1ZLWKWXEXODUVWHHOVKDIWSODVWLFKDQGOHQDLOSXOOHU
DQGSRLQWURXJKIDFH

No.: PU EAN Placement Clip Stripe Article MA netto-EK

COX610750 3 - - -
4 035300 898718

Mason‘s hammer, Rhine form


:LWKWXEXODUVWHHOVKDIWSODVWLFKDQGOHURXJKIDFH

No.: PU EAN Placement Clip Stripe Article MA netto-EK

COX611750 3 - - -
4 035300 898732

09.2016 Subjects to change without notice 31


Hammers

Mason‘s hammer, Berlin form


:LWKWXEXODUVWHHOVKDIWSODVWLFKDQGOHURXJKIDFH

Clip Stripe
No.: PU EAN Placement MA netto-EK
Article

COX612750 3 - - -
4 035300 898725

32 Subjects to change without notice 09.2016


Handschuhe

Winter gloves
• Orange
• Robust highly-flexible working glove
• For medium to heavy mechanical loads
‡)OH[LEOHVHFXUHJULSQDWXUDOODWH[FRDWLQJ
• Breathable back of hand
• Good wet grip performance
• Good cold insulation
• 100% acrylic fibre terry fabric

No.: PU EAN Placement Size Clip Stripe Article

B22304 12 M40 X 8 X
4 035300 898312

B22305 12 M40 X 10 X
4 004722 624076

Soft gloves
• Real-feeling

No.: PU EAN Placement Size Clip Stripe Article

B22307 24 M16 X 7 X
4 004722 621891

B22308 24 M16 X 8 X
4 004722 621907

B22310 24 M16 X 10 X
4 004722 621914

09.2016 Subjects to change without notice 33


Motor vehicle sector

Parking disc
‡,FHVFUDSHUHGJHZLSHUOLSDQGLFH
• Additional benefit: chip for shopping cart and tyre profile
tester

No.: PU EAN Placement Clip Stripe Article

B29199 20 K15 X X
4 004722 637922

Anti-slip mat 90 cm x 125 cm


• Between the item to be secured and the loading area
• Friction between the two surfaces is increased due to the
anti-slip mat
• Honeycomb design with anti-slip coating
• Can be cut to size using scissors or a knife
• Black/anthracite

No.: PU EAN Placement Clip Stripe Article

B29200 10 G90 X -
4 035300 897476

34 Subjects to change without notice 09.2016


Motor vehicle sector

Car trailer lock


‡8QLYHUVDOWUDLOHUDQWLWKHIWGHYLFHZLWKNH\VVXLWDEOHIRUDOO
unbraked car trailers and caravans with ball joints
(except for anti-sliding coupling)
• Only for uncoupled trailers and caravans
• Bracket diameter: 12.7 mm
• Ball diameter: 4.7 cm
• Colour yellow

No.: PU EAN Placement Clip Stripe Article

B29203 4 K42 X -
4 004722 637274

Windscreen wipers repair set


‡:LWKWKHKHOSRIWKHZLQGVFUHHQZLSHUUHSDLUNLW\RXUROG
windscreen wipers will be as good as new again in seconds
‡SLHFHVHWFRQVLVWLQJRIZLSHUEODGHSXOOHUDQGPLFUR
fibre cloths
• Cleans and renews the rubber lip of the windscreen wiper
IRULPSURYHGVWUHDNIUHHZLSLQJSDWWHUQ
• Corrects small irregularities
using microcrystals; microfibre cloth polishes the rubber lip
• Reusable thanks to durable microcrystals
• Increases road safety
• Affordable alternative to expensive new products
• Can be used with many wiper blades

No.: PU EAN Placement Clip Stripe Article

B29204 12 K50. X -
4 004722 637076

09.2016 Subjects to change without notice 35


Motor vehicle sector

Car dehumidifier
Prevents fogged or frozen from inside car windows.
‡$OVRSUHYHQWVUXVWPRXOGIR[VSRWV
‡,GHDOIRUFDUVFDUDYDQVERDWV
‡5HXVDEOHHDV\WRGU\RQWKHKHDWLQJ
• 400 g

No.: PU EAN Placement Clip Stripe Article

B29205 10 M37 - -
4 004722 636376

Bicycle marking set


7\UHFKDQJHDQGHYHU\\HDUWKHVDPHTXHVWLRQZKLFK
tyre goes where? The permanent solution and answer to
this question are valve caps with labelling. No more chalk
PDUNLQJVRUVWLFNHUVRQWKHW\UHV1RPRUHPL[HGXSZKHHOV
Replace the valve caps of your tyres with these universal
wheel labelling caps.

No.: PU EAN Placement Clip Stripe Article

B29210 20 K25. X X
4 004722 636338

36 Subjects to change without notice 09.2016


Motor vehicle sector

Chargeable LED car pocket torch


• Metal housing
‡5HFKDUJHDEOH1L0+YROWEDWWHU\ZLWKRYHUFKDUJH
protection
• With integrated red light charge indicator during charging
• Charging via cigarette lighter or on-board socket in the
vehicle
• Fully charged in 5-6 hours
• Lighting duration 10 - 12 hours
‡:/('SRZHUEXOEVXSHUEULJKW212))E\VLPSO\
rotating the front lamp segment
‡6PDOOVL]HOLJKWZHLJKWHDV\WRVWRZ
• Size: ø 21 mm x 53 mm
‡&RORXUVVLOYHUEODFNEOXHUHG
‡,GHDOIRUFDUVWUXFNVPRWRUF\FOLVWVFDPSLQJDQGERDWLQJ

No.: PU EAN Placement Clip Stripe Article

B29885 20 D43 X X
4 035300 875290

Ice scraper
• Length approx. 27 cm for a long range
• Surface scraped about 10 cm
• ABS
• Stable and unbreakable
• Soft handle
• Available in red or blue

No.: PU EAN Placement Clip Stripe Article

B46160 36 M40. - X
4 004722 624007

09.2016 Subjects to change without notice 37


Motor vehicle sector

Ice scraper with glove


• Width approx. 110 mm
• With elastic and warm fleece inner lining

No.: PU EAN Placement Clip Stripe Article

B46161 25 G50 - -
4 004722 627107

Ice scraper with telescoping handle


‡,FHVFUDSHUVQRZEUXVKUXEEHUOLS
• With non-slip grip handle
• Telescopes from 83 - 127 cm
• Handle made of stable metal
• Broom tilts 90°

No.: PU EAN Placement Clip Stripe Article

B46162 20 SP - -
4 004722 627091

Ice scraper with snow brush


• ABS
• Stable and non-breakable
• Handle and brushes of polypropylene

No.: PU EAN Placement Clip Stripe Article

B46163 25 G64 - -
4 004722 627084

38 Subjects to change without notice 09.2016


Motor vehicle sector

Snow shovel, 3 pieces


• Stackable
• Clicking plug-in system
• Made with a sturdy metal handle
• Polypropylene scoop
• Practical and space-saving
• Black

No.: PU EAN Placement Clip Stripe Article

B46164 10 SP - -
4 004722 627077

Ice scraper
• Ice scraper edge including ice breaker
• Soft grip and aluminium tube
• Length 72 cm
• Scraper edge 11.5 cm
• Length of the broom 22 cm
• Assorted colours

No.: PU EAN Placement Clip Stripe Article

B46165 12 G70 - -
4 004722 637939

09.2016 Subjects to change without notice 39


Motor vehicle sector

Ice scraper comfort


• Ice scraper edge including ice breaker (PS)
• Body made of stable plastic (PS)
• Grip inlay made of soft material (SBS)
• Scraper edge 9.5 cm
• Assorted colours

No.: PU EAN Placement Clip Stripe Article

B46166 10 K40 - -
4 004722 637946

Ice scraper eco


• Ice scraper edge including ice breaker (PS)
• Scraper edge 7.5 cm
• Comfortable handle made of pleasantly soft material
• Assorted colours

No.: PU EAN Placement Clip Stripe Article

B46167 50 K40 - -
4 004722 637953

40 Subjects to change without notice 09.2016


Motor vehicle sector

Car sponge
18 x 12 x 6.5 cm

No.: PU EAN Placement Clip Stripe Article

BWW02108 10 G66 - -
4 009028 002108

Telescoping ratchet 1/2“


• 7-way adjustable and lockable 305 to 445 mm
• With right/left converter
• Drive about 72 teeth to 360 °
• Short follow-up from 5 °
• Quick release
• Chrome-vanadium
• Ergonomically shaped 2-component handle

No.: PU EAN Placement Clip Stripe Article

COXB364060 9 D21 X X
4 004722 628548

09.2016 Subjects to change without notice 41


Motor vehicle sector

Car rescue knife


• Anti-slip metal handle
• Fold-out blade approx. 80 mm
• Self-locking
• With belt cutter for emergencies
• With pointed tip for smashing car window panes
• With belt clip
• Length: approx. 200 mm
• Folded approx. 120 mm

No.: PU EAN Placement Clip Stripe Article

COXB897951 12 D18 - -
4 035300 889990

42 Subjects to change without notice 09.2016


Tapes

PVC adhesive tape


• 5 rolls each 19 mm x 3.5 m
• Colour assortment

No.: PU EAN Placement Clip Stripe Article

B20566 15 M46 X X
4 004722 620399

Adhesive tape dispenser incl. 1 roll


• With serrated edge
• Adjustable roller brake
‡,QFOUROORIDGKHVLYHWDSHP[PPWUDQVSDUHQW
• Ergonomic handle
‡)RUHDV\GLVSHQVLQJVLPSOHWRKDQGOH

No.: PU EAN Placement Clip Stripe Article

B22301 16 M45 - -
4 035300 893621

Package adhesive tape, 50 m x 5 cm


• Transparent
• Easy to unroll
• Rip-stop
• Good adhesive qualities

No.: PU EAN Placement Clip Stripe Article

B22302 20 K20 - -
4 004722 624212

09.2016 Subjects to change without notice 43


Tapes

Adhesive fabric repair tape, 25 m x 50 mm


• PVC-coated
‡([WUHPHO\WHDUUHVLVWDQWKLJKDGKHVLYHVWUHQJWK
• Very flexible
• Waterproof and water-repellent
• Adheres to almost all smooth and rough surfaces
• Easily torn off by hand and
• Universal use
‡6XLWDEOHIRUUHSDLULQJIL[LQJEXQGOLQJSURWHFWLQJHWF

No.: PU EAN Placement Clip Stripe Article

B22303 20 K 20 - -
4 004722 633146

44 Subjects to change without notice 09.2016


Measuring/Weighing

Folding ruler, 1 m
• With decimal divisions
• Double millimetre divisions
• Large numbers
• Plastic

No.: PU EAN Placement Clip Stripe Article

B26301 20 K15 - X
4 004722 624052

Folding ruler, 2 m
• With decimal divisions
• Double millimetre divisions
• Plastic

No.: PU EAN Placement Clip Stripe Article

B26310 40 K25 - X
4 004722 620207

09.2016 Subjects to change without notice 45


Measuring/Weighing

Measuring tape 2 m with carabiner hook


• With spring hook
• Stable steel tape measure
• Length scale in centimetres and inches
• With spring safety hook for mounting on belt or key chain

No.: PU EAN Placement Clip Stripe Article

B26320 36 SP - -
4 004722 636055

Aluminium ruler, 500 mm with 2 level vials


• Aluminium ruler with bevelled edge for precise cutting and
marking
• Good grip thanks to the wide handle
• Integrated horizontal and vertical vials
• 2 different metric scalings (0-500 mm / 250-0-250 mm)
• Total length 500 mm

No.: PU EAN Placement Clip Stripe Article

B26350 12 M53 - -
4 035300 878130

46 Subjects to change without notice 09.2016


Measuring/Weighing

Marking template
Do complex angles and shapes make your work difficult?
The problem is quickly and easily solved with the marking
template. Simply place the marking template on the
necessary contour or angle and screw the screws in firmly.
Now the shape can be transferred to any surface as often as
\RXOLNH,GHDOO\VXLWHGIRUODPLQDWHIORRUZDOOWLOHVFDUSHQWU\
work and plastering. Size: 2 pieces measuring 25 cm and 2
pieces measuring 12 cm

No.: PU EAN Placement Clip Stripe Article

B26353 20 G52 X -
4 035300 897889

Back square, 300 mm


• Measurement scale 30 cm
• Continuously stopped between 0 - 180°
• With locking device
• Of painted metal
• To display angles on working pieces
• Suitable for guiding machines

No.: PU EAN Placement Clip Stripe Article

B26680 8 M54 X X
4 004722 629668

09.2016 Subjects to change without notice 47


Measuring/Weighing

Spirit level set, 3 pieces


Torpedo-Level
‡:LWKYLDOVKRUL]RQWDOYHUWLFDODQGƒ
• With magnet
‡3ODVWLFUXEEHUEXWWFDSV

Cross spirit level


• With 2 vials in a rectangular array
• Surfaces and Objects can be adjusted horizontally in a
measurement process

Line level
• With 1 vial
‡)RUVWUDLJKWHQLQJOLQHVHJIRUVWUDLJKWHQLQJSLOHV

No.: PU EAN Placement Clip Stripe Article

B26820 8 M22 X X
4 004722 632859

Laser spirit lever with roller


• Length approx. 180 mm
‡:LWKEXEEOHOHYHOV[YHUWLFDO[KRUL]RQWDODQG
1x 45 degrees
‡/DVHUZLWKVHWWLQJRSWLRQVKRUL]RQWDOYHUWLFDODQG
crosswise
• Accuracy +/- 1 mm/m
‡0HDVXULQJWDSHOHQJWKPVFDOLQJLQLQFKHVDQGFP
• Spirit level
• Incl. batteries (2x AAA 1.5 V)
• Laser class II: <1 mw

No.: PU EAN Placement Clip Stripe Article

B26911 10 K22 X -
4 035300 894291

48 Subjects to change without notice 09.2016


Measuring/Weighing

Torpedo spirit level


• Length approx. 225 mm
‡ZLQJVKRUL]RQWDOYHUWLFDOGHJ
• Magnetic aluminium measurement surfaces
• Plastic

No.: PU EAN Placement Clip Stripe Article

B26831 20 K10 X X
4 004722 622362

Digital hanging scale


• Measurement range up to a max. of 40 kg
• Tare function
‡PHDVXUHPHQWXQLWV/%.*2=J
• Automatic conversion of measurement units
• Lighted display
• Incl. batteries (3x AAA)

No.: PU EAN Placement Clip Stripe Article

B26900 12 M20 X X
4 004722 629392

Spirit level, 200 mm


• With 2 wings
• With bumper caps
• Yellow

No.: PU EAN Placement Clip Stripe Article

B26912 30 D28 X -
4 004722 627237

09.2016 Subjects to change without notice 49


Measuring/Weighing

Spirit level
• Length approx. 40 cm
‡ZLQJVKRUL]RQWDOYHUWLFDO
• mm scale
‡/LJKWZHLJKWPHWDOSRZGHUFRDWHG
• With plastic bumper caps

No.: PU EAN Placement Clip Stripe Article

B26914 12 D41 X -
4 004722 620238

Spirit level 600 mm, foldable


• 5 foldable elements
• 4 vials: 0° / 45° / 90° / 180°
• Accuracy: +/- 1mm/m
• Folding dimensions: approx. 91 x 50 x 120 mm
• For measuring in corners and around obstacles
• The foldable level easily fits in every toolbox

No.: PU EAN Placement Clip Stripe Article

B26920 12 K14. X X
4 035300 876594

50 Subjects to change without notice 09.2016


Measuring/Weighing

Tracking device
‡7RGHWHFWPDLQVSRZHUPHWDODQGZRRGLQZDOOVFHLOLQJV
and floors
• Location depth for power cable approx. 76 mm
• Location depth for metal and wood approx. 19 mm
‡:LWKGLJLWDOGLVSOD\DFRXVWLFVLJQDOSRVLWLRQLQJKHOSDQG
voltage display for discovered power lines
• For use inside
• Batteries not included

No.: PU EAN Placement Clip Stripe Article

B29800 4 M33 X X
4 004722 628197

Material and wood moisture meter


‡7RGHWHUPLQHPRLVWXUHLQZRRGILUHZRRGFRQVWUXFWLRQ
material humidity and air temperature
‡7RGHWHUPLQHPRLVWXUHLQFHPHQWVFUHHGFRQFUHWHSODVWHU
DQK\GULWHVFUHHGFHPHQWPRUWDUOLPHPRUWDUEULFN
‡/LJKWHGHDVLO\UHDG/&'GLVSOD\
• Automatic shut-off
• Includes batteries (3x LR44)
• Size approx. 55 mm x 90 mm

No.: PU EAN Placement Clip Stripe Article

B29820 8 M25 X X
4 004722 632903

09.2016 Subjects to change without notice 51


Measuring/Weighing

Battery tester, analogue


• Works without additional power supply
• For 1.5 V and 9 V batteries
• Three-colour analogue display

Suitable types of batteries:


• 1.5 V: Micro (AAA)
• Mignon (AA)
• Mono (D)
• Baby (C)
• Button cells 9V
• 9 V-block (1604D)

No.: PU EAN Placement Clip Stripe Article

B29821 16 K33 X X
4 004722 635904

Laser range finder


Precise measurement even in difficult to reach areas
+DQG\KLJKTXDOLW\ODVHUGLVWDQFHPHWHULQFOFDUU\LQJFDVH
DQGEDWWHULHVSRVVLEOHDSSOLFDWLRQV0HDVXUHPHQWRIOLQHDU
GLVWDQFHVFDUU\LQJRXWLQGLUHFWPHDVXUHPHQWV 3\WKDJRUDV
IRUPXOD FDOFXODWLRQRIDUHDVDQGYROXPHV

• Laser 650nm / laser class II / <1 mW


• Measuring range 0.05 m - 60 m (0.17 Ft - 198 ft)
• Measurement Accuracy +/- 2 mm (+/- 1/13“)
• Smallest unit shown 1 mm
• Weight 70 g

No.: PU EAN Placement Clip Stripe Article

COXB364001 2 D15 - X
4 035300 905195

52 Subjects to change without notice 09.2016


Measuring/Weighing

Wooden folding yardstick, 2m, signal colours


• With decimal divisions
• Double millimetre divisions
• Red and yellow signals
• Assorted

No.: PU EAN Placement Clip Stripe Article

COXB700312 24 D25 - -
4 035300 737567

Rolling tape measure stops automatically, includes


magnet, 3 m
• Modern ergonomic housing in 2-component design
• 2 strong magnets at the beginning of the tape for
measuring metal
• Tape stops automatically in every position
• 2 tape return run keys
• Millimetre division
• With belt clip and carrying strap
• Measuring accuracy class EU II

No.: PU EAN Placement Clip Stripe Article

COXB702003 12 D28 X X
4 035300 708307

09.2016 Subjects to change without notice 53


Measuring/Weighing

Rolling tape measure stops automatically, includes


magnet, 5 m
• Modern ergonomic housing in 2-component design
• 2 strong magnets at the beginning of the tape for
measuring metal
•Tape stops automatically in every position
• 2 tape return run keys
• Millimetre division
• With belt clip and carrying strap
• Measuring accuracy class EU II

No.: PU EAN Placement Clip Stripe Article

COXB702005 12 D28 X X
4 035300 708314

54 Subjects to change without notice 09.2016


Knives/Scissors

Household scissors, 160 mm


• Stainless steel
• Ergonomically-formed 2-component handle

No.: PU EAN Placement Clip Stripe Article

COXB896900 12 D20 - -
4 035300 774395

Household scissors, 210 mm


• Stainless steel
• Ergonomically-formed 2-component handle

No.: PU EAN Placement Clip Stripe Article

COXB896901 12 D22 - -
4 035300 774401

09.2016 Subjects to change without notice 55


Knives/Scissors

Household scissors, 250 mm


• Stainless steel
• Ergonomically-formed 2-component handle

No.: PU EAN Placement Clip Stripe Article

COXB896902 12 D23 - -
4 035300 774418

Household scissors
• With plastic handles
• 210 mm

No.: PU EAN Placement Clip Stripe Article

CPT894200 10 K17 X X
4 035300 830947

56 Subjects to change without notice 09.2016


Knives/Scissors

Household scissors 205 mm, can be taken apart


• Blades made from stainless steel
• Very practical for opening screw caps and crown caps
‡&DQEHWDNHQDSDUWIRUHDV\FOHDQLQJGLVKZDVKHUVDIH

No.: PU EAN Placement Clip Stripe Article

B20322 12 K18 X X
4 035300 899722

Scissors set, 2 pieces


• 140 mm and 210 mm
‡6WDLQOHVVVWHHOEODGHUXVWIUHH
• Ergonomically-shaped 2-component handle

No.: PU EAN Placement Clip Stripe Article

B28692 12 M23 X X
4 004722 621976

09.2016 Subjects to change without notice 57


Knives/Scissors

Universal knife
• With ergonomic 2-component plastic handle
• 9 mm blade width
• With automatic storage for spares including 3 snap-off
blade strips:

Carrying out an automatic blade change:


1. Simply use the black clip to slide the worn blade
completely to the front
2. Remove the blade carefully
6OLGHWKHEODFNFOLSULJKWEDFNDJDLQORFNLQQHZEODGH
from the depot and
4. The all-round knife is ready for use again!

No.: PU EAN Placement Clip Stripe Article

COXB897909 30 D29 - -
4 035300 706211

Universal knife, metal, 9 mm


• Solid
• With break-off blades

No.: PU EAN Placement Clip Stripe Article

B20865 30 D19 - -
4 004722 624175

58 Subjects to change without notice 09.2016


Knives/Scissors

Universal knife, metal, 9 mm


• With clip

No.: PU EAN Placement Clip Stripe Article

B20869 60 D17 - -
4 004722 624182

Universal knife, metal, 18 mm


• Solid
• With break-off blades

No.: PU EAN Placement Clip Stripe Article

B20866 24 D21 - -
4 004722 624168

Universal knife 2 in 1, 9 mm
2 functions:
• 1. Blade adjustment by moving the slider
• 2. Blade adjustment by operating the safety catch for
retracting blade automatically
Ergonomically formed 2-component handle

No.: PU EAN Placement Clip Stripe Article

COXB897940 30 D25 - -
4 035300 749683

09.2016 Subjects to change without notice 59


Knives/Scissors

Universal knife 2 in 1, 18 mm
2 functions:
• 1. Blade adjustment by moving the slider
• 2. Blade adjustment by operating the safety catch for
retracting blade automatically
Ergonomically formed 2-component handle

No.: PU EAN Placement Clip Stripe Article

COXB897942 20 D29 - -
4 035300 749676

Plastic universal knife, 18 mm


• With 3 blades

No.: PU EAN Placement Clip Stripe Article

B20870 30 D22 - -
4 004722 624144

60 Subjects to change without notice 09.2016


Knives/Scissors

Universal knife, 18 mm
• With ergonomic 2-component plastic handle
• 18 mm blade width
• With automatic storage for spares including 4 snap-off
blade strips:
• Carrying out an automatic blade change:
1. Simply use the black clip to slide the worn blade
completely to the front
2. Remove the blade carefully
6OLGHWKHEODFNFOLSULJKWEDFNDJDLQORFNLQQHZEODGH
from the depot and
4. The all-round knife is ready for use again!

No.: PU EAN Placement Clip Stripe Article

COXB897918 20 D29 - -
4 035300 706228

Universal knife set, 2 pieces


• 9 mm and 18 mm
• Solid universal plastic knife
• With snap-in locking device
• Removable break-off at the rear of the handle
• Yellow

No.: PU EAN Placement Clip Stripe Article

B20872 18 M24 X X
4 004722 620450

09.2016 Subjects to change without notice 61


Knives/Scissors

Safety knife with belt clip


• Metal housing with ergonomically shaped soft handle
• The blade disappears automatically into the handle if the
knife slips from the item to be cut and the safety slider is not
held tight
• Take your thumb off the safety slider when cutting!
• Easy blade replacement without accessories
• Blade lock on the rear side of the knife
• Length of knife can be shortened to ~115 mm for keeping
on the belt clip by pushing together using the side slider
• Overall length ~145 mm

No.: PU EAN Placement Clip Stripe Article

COXB897950 12 D20 - -
4 035300 889983

Universal knife, professional


• Including 5 spare blades in the magazine
• Easy tool-free blade replacement
• Thumb push button for optimum power transmission
• It is possible to close the cutter
• With belt clip

No.: PU EAN Placement Clip Stripe Article

COXB897930 12 D36 X X
4 035300 715800

62 Subjects to change without notice 09.2016


Knives/Scissors

Miniature multi-purpose knife


• With 10 blades in the dispenser
• Release to fold the knife
‡(DV\WRROIUHHEODGHFKDQJH

No.: PU EAN Placement Clip Stripe Article

COXB897932 12 D33 X X
4 035300 732661

Mini knife
• Total length approx. 8 cm
• With 1 straight blade
• Colour assortment

No.: PU EAN Placement Clip Stripe Article

B20890 36 D21. - -
4 004722 624021

Snap-off blade strip, 9 mm


• In a practical plastic storage box
• Contents: 10 blades

No.: PU EAN Placement Clip Stripe Article

B20880 50 D28 X X
4 004722 621921

09.2016 Subjects to change without notice 63


Knives/Scissors

Snap-off blade strip, 18 mm


• In a practical plastic storage box
• Contents: 10 blades

No.: PU EAN Placement Clip Stripe Article

B20881 30 D26 X X
4 004722 621938

Trapezoidal blades
• 10 pieces

No.: PU EAN Placement Clip Stripe Article

B20882 30 D24 X X
4 004722 621945

Pocket knife, 9 in 1
‡.QLIHEODGHDSSUR[PP
‡6FLVVRUVVFUHZGULYHU3+VFUHZGULYHUVORWPPQDLOILOH
QDLOFOHDQHUFRUNVFUHZERWWOHRSHQHUFDQRSHQHU
• Knobbed handle for secure grip
• Foldable to save space
• With ring to attach to key chain

No.: PU EAN Placement Clip Stripe Article

B28850 24 K18 X X
4 004722 622331

64 Subjects to change without notice 09.2016


Knives/Scissors

Multi-purpose knife, 12 in 1

No.: PU EAN Placement Clip Stripe Article

B28900 12 K20 X X
4 004722 622812

Pocket knife with LED


‡.QLIHEODGHDSSUR[PPZLWKORFNSURWHFWLRQ
‡:LWK/('
• To be operated by pressing a button
• Ergonomic shape for optimal fit in the hand
• Foldable to save space

No.: PU EAN Placement Clip Stripe Article

B28860 24 K14. X X
4 004722 622348

09.2016 Subjects to change without notice 65


Surface treatment

Wire brush set small


• 3 pieces
• 1x steel brush
• 1x brass brush
• 1x plastic brush
• Plastic handle

No.: PU EAN Placement Clip Stripe Article

B20123 15 K27 X X
4 004722 621150

Wire brush set large


• 3 pieces
• 1x steel brush
• 1x brass brush
• 1x plastic brush
• Plastic handle

No.: PU EAN Placement Clip Stripe Article

B20133 15 K20 X X
4 004722 621167

66 Subjects to change without notice 09.2016


Surface treatment

Steel brush set


&RQVLVWLQJRIGLIIHUHQWEUXVKHVLGHDOIRUURXJKLQJ
EUXVKLQJFOHDQLQJGHUXVWLQJHWFPDWHULDO6WHHOZLUHZLWK
EUDVVFRDWLQJPD[VSHHG8PLQVKDQNDGDSWHU
ø 6 mm x 28 mm
set consisting of the following shapes and dimensions:
‡GLVFEUXVKHV³³³³
• 1 cup brush 2“
• 1 end brush 2“
• 1 wire brush with metal body and plastic handle

No.: PU EAN Placement Clip Stripe Article

B20143 12 G53 X -
4 004722 635874

Mini file set, 6 pieces


‡&RQLFDOGRXEOHVLGHGILOLQJEODGHV
• Length approx. 100 mm
• Hardened under HRC62
• 2-component handle
• For precision work with metals

No.: PU EAN Placement Clip Stripe Article

B20206 12 K27 X X
4 004722 629705

09.2016 Subjects to change without notice 67


Surface treatment

Diamond sharpener, 2 in 1
‡5HWUDFWDEOHEODGHZLWKGLIIHUHQWVXUIDFHVIODWKDOIURXQG
and with notch
• Carbon steel blade with diamond coating ø 6.5mm
‡$OXPLQLXPKDQGOHZLWKFOLSPP¡PP
‡)RUVKDUSHQLQJDQGGHEXUULQJEODGHVILVKKRRNVGDUWVHWF
• Overall length ~200 mm
• With practical Clip

No.: PU EAN Placement Clip Stripe Article

B20220 36 K17 X X
4 035300 897919

Mini knife sharpener


‡3UHJULQGLQJFRDUVHVLGH FDUELGH )RUUHJULQGLQJ
very blunt blades
• Fine side (ceramic): To strop the blade. Small burrs
are removed
• Non-slip standing surface
‡6PDOOSRUWDEOHDQGFRQYHQLHQWIRUWUDYHO
• With key chain
• Not suitable for blades with serrated edge and scissors!

No.: PU EAN Placement Clip Stripe Article

B20221 12 K19 X X
4 035300 899128

68 Subjects to change without notice 09.2016


Surface treatment

Multi-function knife sharpener


• Suitable for sharpening knives and scissors
• Ergonomic design for comfortable use
• Blades may be turned = longer life
• Finger guard for safe sharpening

No.: PU EAN Placement Clip Stripe Article

B20222 8 K21 X X
4 035300 899135

Sandpaper set, 10 pieces


• 230 mm x 280 mm
‡*UDLQVL]H[.[.[.

No.: PU EAN Placement Clip Stripe Article

B25700 20 M24 X X
4 004722 620542

Sandpaper set, 10 pieces


• 230 mm x 280 mm
• Water-resistant
‡*UDLQVL]HSLHFHVHDFK.....

No.: PU EAN Placement Clip Stripe Article

B25702 20 M24 X X
4 004722 620566

09.2016 Subjects to change without notice 69


Surface treatment

Hand sanding block


• 160 x 85 mm
• Underside of foam rubber
‡6WURQJVWDEOHEUDFNHWVIRUFODPSLQJVDQGSDSHU
‡,QFOXGLQJVDQGSDSHUHDFK...

No.: PU EAN Placement Clip Stripe Article

B23160 12 K35 X X
4 004722 622713

Sanding sponges, 2 pieces


• Rough and fine
• 95 x 70 mm

No.: PU EAN Placement Clip Stripe Article

B25712 20 M20 X X
4 004722 620825

Wire brush
With metal body and plastic handle

No.: PU EAN Placement Clip Stripe Article

CP937210 12 K30 - -
4 035300 830299

70 Subjects to change without notice 09.2016


Surface treatment

Firmer chisels set, 4 pieces


• With wooden handle
• 8 - 12 - 18 - 26 mm

No.: PU EAN Placement Clip Stripe Article MA netto-EK

CPT861000 6 M30 X -
4 035300 829521

Set of files, 3 pieces


• 1x Flat file 200 mm
• 1x Half-round file 200 mm
• 1x Round file 200 mm
• Cut 2

No.: PU EAN Placement Clip Stripe Article MA netto-EK

CPT966903 6 M40 X -
4 035300 830305

09.2016 Subjects to change without notice 71


PSA

Fine dust mask, 2 pieces


‡))3(1DJDLQVWVROLGSDUWLFOHV[0$.
‡$UHDRIDSSOLFDWLRQ)RUIORXUGXVWDOOHUJ\VDZLQJSODQLQJ
GULOOLQJJULQGLQJPLOOLQJEDJFHPHQWJ\SVXPJUDLQHWF
Note: Note the expiration date
(approx. 5 years after manufacture)

No.: PU EAN Placement Clip Stripe Article

B22002 15 M45 X X
4 004722 620481

Breathing mask, 5 pieces


‡$JDLQVWDOOW\SHVRIPDOLFLRXVGDQJHURXVFRDUVHGXVWVXFK
DVVZHHSLQJKD\LQJPRZLQJFURSKDUYHVWLQJHWF

No.: PU EAN Placement Clip Stripe Article

B22005 15 M45 X X
4 004722 620504

72 Subjects to change without notice 09.2016


PSA

Reflective safety vest, XL


‡,QDFFRUGDQFHZLWK',1(1,62&(FHUWLILHG
• With 2 Velcro® fasteners
‡:LWKKLJKTXDOLW\KRUL]RQWDOUHIOHFWLYHVWULSV
• 100% polyester
‡6L]H;/[FP
• Sturdy and hard-wearing

Note:
Drivers in the following countries are obligated to always
have a safety vest in the car and to wear it as needed:
$XVWULD)UDQFH&URDWLD3RUWXJDO
0RQWHQHJUR1RUZD\5RPDQLD&]HFK5HSXEOLF

No.: PU EAN Placement Clip Stripe Article

B22100 20 M40 X X
4 035300 891542

Reflective warning strip light 4 LED


‡5HIOHFWLYHFRDWHG39&VWULSDSSUR[FP
• Velcro® fastener
‡EULJKW/('VSHUVWULSNLQGVRIOLJKW
(continuous light and blinking light)
• Dimensions: approx. 43 x 3 cm
‡,QFOEDWWHU\&59
• In accordance with DIN EN 13356
• For more safety in the dark

No.: PU EAN Placement Clip Stripe Article

B22110 30 K26 X X
4 035300 893614

09.2016 Subjects to change without notice 73


PSA

Industrial safety kit, 3 pieces with protective suit


&RQWHQWV'LVSRVDEOHSURWHFWLYHVXLW RQHVL]H QLWULOHJORYHV
size 10 EN 388 and fold mask FFP 1 EN 148

No.: PU EAN Placement Clip Stripe Article

COX938602 5 - - -
4 035300 906222

74 Subjects to change without notice 09.2016


Renovate

Paint scraper, blade width 39 mm


• Ergonomically shaped 2-component handle
• With hanging loop
• Includes 5 replacement blades
• With blade cover

No.: PU EAN Placement Clip Stripe Article

B24200 20 K18 X X
4 004722 622591

Japanese spatula set, 4 pieces


• Of highly-elastic metal
• To work in oil and spackle
• Acid-resistant

No.: PU EAN Placement Clip Stripe Article

B27384 20 M24 - X
4 004722 620580

09.2016 Subjects to change without notice 75


Renovate

Multi-function tool and 20 installation wedges


‡8VHIXODVDWDSSLQJEORFNSXOOEDUIRUOHYHUDJH
OLPHVSDWXODUXOHU
• Including pencil
• Made of sturdy plastic
‡)RUIOXVKLQVWDOODWLRQRIODPLQDWHIORRULQJDQGIORRUERDUGV

No.: PU EAN Placement Clip Stripe Article

B27690 10 M30 X X
4 004722 625523

PU foam gun
• NBS fan system
• Suitable for all customary PU foams
• Nickel-plated
• Precise regulation screw for perfect work
• Ergonomically shaped handle

No.: PU EAN Placement Clip Stripe Article

B27430 6 M22 X X
4 004722 622676

76 Subjects to change without notice 09.2016


Renovate

Caulking gun
• Closed
• Suitable for cartridges and bags with 310 ml capacity

Replacement nozzles available (B27423)

No.: PU EAN Placement Clip Stripe Article

B27422 6 M22 X X
4 004722 622119

Replacement nozzles, 10 pieces


• For B27422 cartridge guns

No.: PU EAN Placement Clip Stripe Article

B27423 12 M15 X X
4 004722 622133

Replacement nozzles, 5 pieces


• For cartridges
• Plastic
• White

No.: PU EAN Placement Clip Stripe Article

B27424 25 K20 X X
4 004722 626551

09.2016 Subjects to change without notice 77


Renovate

Replacement nozzles with holder and cap


• 3 pieces
• For cartridges
• Plastic
• White
• Red cap

No.: PU EAN Placement Clip Stripe Article

B27425 20 K20 X X
4 004722 626568

Multifunction silicone gap puller set


• Various fibre widths and radia
• Practical cutter in handle

No.: PU EAN Placement Clip Stripe Article

B22540 20 K46 X X
4 004722 623642

Set of painter’s putty knives, 3 pieces


• With flat oval wooden handle
• Width approx. 30 - 50 - 60 mm

No.: PU EAN Placement Clip Stripe Article MA netto-EK

CP880303 12 K30 X X
4 035300 831067

78 Subjects to change without notice 09.2016


Renovate

Spatula set, 3 pieces


‡6WDLQOHVVVWHHOPPPPPP
• Ergonomically-shaped 2-component handle

No.: PU EAN Placement Clip Stripe Article

B27653 10 M30 X X
4 004722 620603

Shock spatula with bottle opener


• Polished blade with bevelled edge (bevel)
• With integrated bottle opener
• Lacquered wooden handle with ferrule
‡6XLWDEOHIRUUHPRYLQJSDLQWUXVW
• Spatula width: app. 60 mm
• Total length: app. 165 mm

No.: PU EAN Placement Clip Stripe Article

B27623 20 K20 X -
4 035300 876587

09.2016 Subjects to change without notice 79


Renovate

Plasterer set with 3 spatulas


• 3 scrapers 25 mm / 45 mm / 75 mm with wooden handle
• 1 plaster mixing bowl for plaster and putty: Height 100 mm
• ø max. 130 mm

No.: PU EAN Placement Clip Stripe Article

B27663 12 M50 X -
4 004722 636079

Colour mixing paddle, 60 x 400 mm


• Painted metal
• With hexagonal shaft
• For liquid materials
• Mixing effect from top to bottom

No.: PU EAN Placement Clip Stripe Article

B27260 24 M48 - X
4 004722 620313

Universal stirrers
[PPPHWDOZLWKKH[DJRQVKDIW

No.: PU EAN Placement Clip Stripe Article

CP781257 10 - - -
4 035300 830336

80 Subjects to change without notice 09.2016


Renovate

Flat brush set, 4 pieces


• In the following sizes:
• 1 1/2“ (38 mm)
• 2“ (51 mm)
• 2 1/2“ (63 mm)
• 3“ (76 mm)

No.: PU EAN Placement Clip Stripe Article

B21620 12 M31 X X
4 004722 622669

Flat brush set, 4 pieces


• In the following sizes:
• 1/2“ (13 mm)
• 1“ (25 mm)
• 1 1/2“ (38 mm)
• 2“ (51 mm)

No.: PU EAN Placement Clip Stripe Article

B21621 18 K19 X X
4 004722 622652

09.2016 Subjects to change without notice 81


Renovate

Flat brush set, 9 pieces


• In the following sizes:
• 1x 1/2“ (13 mm)
• 2x 1“ (25 mm)
• 3x 1 1/2“ (38 mm)
• 2x 2“ (51 mm)
• 1x 2 1/2“ (63 mm)

No.: PU EAN Placement Clip Stripe Article

B21622 12 M31 X X
4 004722 622645

Flat brush set, 10 pieces


• In the following sizes:
• 3 flat brushes
• 3/4“ (19 mm)
• 1“ (25 mm)
• 1 1/2“ (38 mm)
• 2 radiator brushes
• 1“ (25 mm)
• 1 1/2“ (38 mm)
• 2 round brushes ø 20 + 25 mm
• 3 small brushes

No.: PU EAN Placement Clip Stripe Article

B21623 12 M30 X X
4 004722 622638

82 Subjects to change without notice 09.2016


Renovate

Brush set, 7 pieces


• Straight sizes: 1“ - 1 1/2“ - 2“ - 2 1/2“ - 3“ - 4“
• Angular sizes: 2“
• Fine polyester bristles for the best varnishing results
• Stainless steel sheath
• With ergonomically shaped wooden handle

No.: PU EAN Placement Clip Stripe Article

B21624 20 G30 X -
4 035300 890286

Masking tape 50 mm x 50 m
• High-quality fine crepe adhesive strip
• For masking in all painting and varnishing jobs
• Can be easily unrolled
‡7HDUUHVLVWDQWFDQHDVLO\EHUHPRYHGZLWKRXWOHDYLQJD
UHVLGXHYHU\JRRGDGKHVLYHSURSHUWLHV
‡:LGWKPPOHQJWKPWKLFNQHVVDSSUR[PP

No.: PU EAN Placement Clip Stripe Article

B22298 20 M31 - -
4 004722 635928

09.2016 Subjects to change without notice 83


Renovate

Masking tape 3 pieces 25 mm x 50 m


• High-quality fine crepe adhesive strip
• For masking in all painting and varnishing jobs
• Can be easily unrolled
‡7HDUUHVLVWDQWFDQHDVLO\EHUHPRYHGZLWKRXWOHDYLQJD
residue
• Very good adhesive properties
‡:LGWKPPOHQJWKPWKLFNQHVVDSSUR[PP
• Set of 3 rolls

No.: PU EAN Placement Clip Stripe Article

B22299 20 M35 - -
4 004722 635935

Floor repair set


&RUUHFWVEXPSVRQODPLQDWHSDUTXHWFRUNDQGZRRG
surfaces by thermal melting.
‡&OHDQLQJVSDWXOD[$$%DWWHULHV9
• Planing
• Cleaning spatula
• 11 wax sticks in different colours
• Abrasive sponge
• Cleaning and polishing cloth
• Sturdy storage box
• Operating instructions
Not suitable for tiles!

No.: PU EAN Placement Clip Stripe Article

B27691 4 K20 - -
4 004722 637250

84 Subjects to change without notice 09.2016


Renovate

Wallpapering set, 5 pieces


‡0HWDOXQLNQLIHPP
‡6FLVVRUVPP
‡6SDWXODPP
‡%UXVKPP
• Seam roller

No.: PU EAN Placement Clip Stripe Article

B21628 15 G48 X -
4 035300 897759

Renovation set, 17 pieces


This renovation set is suited for almost all painting jobs at
home:
• 1x paint tray 37 x 29 cm
• 1x paint grid 27 x 26 cm
• 1x paint mixer
• 1x scraper 25 mm
• 1x flat brush 35 mm
• 1x round paint brush ø 20 mm
• 1x carpenter pencil 175 mm
• 1x uni-knife 9 mm
• 1x masking tape 24 mm x 25 m
• 4x acrylic paint rollers 100 mm
• 1x polyester paint roller 210 mm
• 1x bracket with plastic handle for 100 mm rolls
• 1x bracket with plastic handle for 210 mm rolls
• 1x protective film 4 x 2.5 m

No.: PU EAN Placement Clip Stripe Article

B21626 6 G66 - -
4 004722 636215

09.2016 Subjects to change without notice 85


Renovate

Furniture transport set, 5 pieces


• Ideal for renovating or relocating
‡)XUQLWXUHOLIWHUIRUHIIRUWOHVVOLIWLQJRIKHDY\EXON\
furniture and electrical equipment
• Steerable jogging rollers for easy moving of the
objects
• Sturdy plastic design
• 150 kg load bearing capacity

No.: PU EAN Placement Clip Stripe Article

B29930 6 G35 - -
4 035300 897896

Protective dust door, 3 pieces


‡3ODVWLFVL]H[FP
• Extra strong construction foil (100 microns)
• Opening for dust-free space removal
• Door closing with a self-adhesive zipper
• Including duct tape for attachment

No.: PU EAN Placement Clip Stripe Article

B34170 10 M40 X X
4 035300 764389

86 Subjects to change without notice 09.2016


Renovate

Sock liners, 20 pieces


‡8QLYHUVDOVL]HDSSUR[[PP
• With rubber layer
• Water-repellent

No.: PU EAN Placement Clip Stripe Article

B22009 20 M15 X -
4 004722 626308

Cartouche pistol skeleton type


0HWDOYDUQLVKHGIRUPOFDUWULGJHV

No.: PU EAN Placement Clip Stripe Article

CP781612 12 M40 - -
4 035300 829880

Caulking gun
0HWDOYDUQLVKHGIRUPOFDUWULGJHV

No.: PU EAN Placement Clip Stripe Article

CP781605 12 M40 - -
4 035300 829873

09.2016 Subjects to change without notice 87


Screwdrivers

Precision screwdriver set, 6 pieces


• PH 000 - PH 0
• Slot: 0.9 mm - 1.2 mm - 2.4 mm - 3.5 mm
• In plastic folding cassette

No.: PU EAN Placement Clip Stripe Article

B20556 15 K10 X X
4 004722 620382

Fine mechanical bit set, 18 pieces


• 16 fine mechanical bits of chrome-vanadium steel
• Ratchet screwdriver with right-/left change and
ergonomically shaped 2-component handle
• Lengthening to 120 mm
• In practical plastic storage box
‡6ORWPP
‡3+
‡7;

No.: PU EAN Placement Clip Stripe Article

B20557 8 K15 X -
4 004722 631821

88 Subjects to change without notice 09.2016


Screwdrivers

Mechanic’s bit set


• With mini-ratchet screwdriver and 10 fine mechanical bits
• Ergonomically-shaped 2-component handle
‡3+
‡3=
‡6ORWPP
‡+H[DJRQPP
‡7;

No.: PU EAN Placement Clip Stripe Article

B20558 24 K15 X X
4 004722 624045

Replacement precision screwdriver set


• 6 exchangeable blades
• Length approx. 110 mm
• made of chrome-vanadium steel
• Magnetic
• Plastic handle with rotatable mulden cap for ideal
rotating point
• Blade attachment with screw in the handle
• Optimal storage of all parts in a practical plastic
case with a viewer cover

‡3+3+
‡6ORWPPPP
‡6.PPPP
‡7;

No.: PU EAN Placement Clip Stripe Article

B20559 8 K12 X X
4 004722 632842

09.2016 Subjects to change without notice 89


Screwdrivers

T-ratchet screwdriver, 24 pieces


• T-handle
‡FRPSRQHQWKDQGOHUDWFKHWZLWKWHOHVFRSLFELWH[WHQVLRQ
(30 - 80 mm)
• 15 Cr-V bits (25 mm):
• TX 10 - 15 - 20 - 30
• PH 0 - 1 - 2 - 3
• PZ 1 - 2 - 3
• Slot 4 - 5 mm
• Hexagonal 3 - 3 - 6 mm
• 1 Cr-V adapter
‡VRFNHWV³FDUERQVWHHOFKURPHSODWHG
 PPPPPPPPPPPP
‡,QDSUDFWLFDOER[IRUVWRUDJHDQGDGGLWLRQDO
euro-slot suspension

No.: PU EAN Placement Clip Stripe Article

B20600 8 D28 X -
4 004722 636499

90 Subjects to change without notice 09.2016


Screwdrivers

T-ratchet screwdriver, 48 pieces


‡7KDQGOHFRPSRQHQWKDQGOHUDWFKHWZLWKWHOHVFRSLF
bit extension (40 - 120 mm)
• 35 Cr-V bits (25 mm):
‡[3+[3+[3+
‡[3=[3=[3=
‡7;7;[7;[7;[7;[7;7;
[7;7;
• Slot 3 - 4 - 5 - 6 mm
• Hexagon 2.5 - 3 - 4 - 5 - 6
‡&U9DGDSWHUVRFNHWV³FDUERQVWHHO
chrome-plated (4 mm - 4.5 mm - 5 mm - 6 mm -
7 mm - 8 mm - 9 mm - 10 mm - 11 mm)
‡,QDSUDFWLFDOER[IRUVWRUDJHDQGDGGLWLRQDOHXURVORW
suspension

No.: PU EAN Placement Clip Stripe Article

B20601 8 D39 X -
4 004722 636505

Voltage detector set, 2 pieces


• 60 mm and 100 mm
• ~120 - 250 V

No.: PU EAN Placement Clip Stripe Article

B20652 24 K20 X X
4 004722 620757

09.2016 Subjects to change without notice 91


Screwdrivers

Screwdriver set 6 pieces, VDE


• Safety tested
• Including phase tester

No.: PU EAN Placement Clip Stripe Article

B20702 8 M27 X X
4 004722 622157

Thumb wrench set, 6 pieces


• 3 thumb wrenches with 1/4“ socket
‡,QFOXGLQJELWVDQG³KH[PDOHDGDSWHUWR³
square outside

No.: PU EAN Placement Clip Stripe Article

B20703 12 K14 X X
4 004722 629309

Screwdriver set, 2 pieces, 300 mm


• Extra-long
• For difficult-to-reach places
• Chrome-vanadium
• Burnished tips
• Magnetic
• PH 2 and slot 6 mm
• 2-component handles

No.: PU EAN Placement Clip Stripe Article

B20704 10 M27 X X
4 004722 629378

92 Subjects to change without notice 09.2016


Screwdrivers

Screwdriver set, 18 pieces


• Chrome-vanadium
• Painted tips
• Magnetic
• 2-component handle
• Including wall holder and installation material

No.: PU EAN Placement Clip Stripe Article

B20705 6 G60. X -
4 004722 629699

Fine mechanical screwdriver, 9 in 1


• Including 9 fine mechanical bits
• Magnetic bit holder
• Bit magazine in the handle
• Rod form with pants- or shirt clip
‡3+
‡6ORWPP
‡7;

No.: PU EAN Placement Clip Stripe Article

B20719 20 K12 X X
4 004722 624090

09.2016 Subjects to change without notice 93


Screwdrivers

Set of screwdriver bits, 16 pieces


• 1 handle 110 mm
• With 1/4“ magnetic quick-change holder and
2-component handle
• 1 1/4“ magnetic quick-change holder for use on
cordless screwdriver or the like
‡ELWV³PP3+
• 12 bits 25 mm:
7;
3+
3=
6ORWPP
• In a plastic folding box with transparent lid

No.: PU EAN Placement Clip Stripe Article

B23065 16 K18 X -
4 035300 894260

Thread tap set, 6 pieces


• Chrome-vanadium
• With wrench or spanner
• Usable in a practical storage box

No.: PU EAN Placement Clip Stripe Article

B23796 10 K18 X X
4 004722 630091

94 Subjects to change without notice 09.2016


Screwdrivers

Precision screwdriver set


• Ideal for small screws and filigree work
• High-quality design
• Colour-coded screwdrivers:
• Yellow: TX 3 / TX 4 / TX 5
• Red: PH 00
• Green: Pentalob 0.8 mm / 1.2 mm
‡,QDSUDFWLFDOVWRUDJHER[IRUPRXQWLQJDQGVWRUDJH
with additional eurotab

No.: PU EAN Placement Clip Stripe Article

COXB364004 8 D22 X -
4 035300 904426

Smartphone repair set


• Complete solution for repair and maintenance of
VPDUWSKRQHVWDEOHWVDQG03SOD\HUV
The set includes:
• Premium precision screwdriver
• 10 bits (45 mm):
7;7;7;7;7;
3+3+
6/PP
Pentalob 0.8 mm
Y- Type 2 mm
• 2 plastic levers allows easy opening
• Suction cup and SIM slot opener
• Packed in practical box for storage and extra euro-slot
hanger

No.: PU EAN Placement Clip Stripe Article

COXB364006 9 D33 X -
4 004722 636345

09.2016 Subjects to change without notice 95


Screwdrivers

Ratchet screwdriver, 160 mm


‡5DWFKHWIXQFWLRQWHHWKULJKWOHIWIL[HG
• Detachable bit retainer
‡7URXVHUSRFNHWIRUPDWYHU\VSDFHVDYLQJ
• Incl. 6 bits 25 mm in the handle with coloured ring marker
‡3+3+6/6/7;7;
• With 2-component handle

No.: PU EAN Placement Clip Stripe Article

COXB364011 16 D24 - -
4 035300 894277

Ratchet screwdriver, 240 mm


‡5DWFKHWIXQFWLRQWHHWKULJKWOHIWIL[HG
• Incl. 6 bits 25 mm in the handle with coloured ring marker
‡3+3+6/6/7;7;
• With 2-component handle

No.: PU EAN Placement Clip Stripe Article

COXB364012 16 D24 - -
4 035300 893669

96 Subjects to change without notice 09.2016


Screwdrivers

Telescopic ratchet screwdriver


• Bit magazine holder with 12 bits made from
VLOLFRQHPR\EGHQXPVWHHO 6 ³GULYH
• Extendable telescopic extension approx. 125 mm
• With locking device
• All-purpose magnet bit holder.
• Ratchet function with right/left change-over

‡HDFK3+3+3+
‡HDFK3=3=3=
‡HDFKVORWPPVORWPP
‡HDFK7;7;7;7;

No.: PU EAN Placement Clip Stripe Article

COXB364013 20 D26 - -
4 035300 732654

Ratchet screwdriver with joint


‡ZD\DGMXVWDEOHLQVWUDLJKWIRUPDQGDVDSLVWROJULS
• Ratchet function with right/left switch and locking in the
middle position
• Ergonomically shaped 2-component handle with
RSSRUWXQLW\WRYLHZWKHLQQHUUHPRYDEOH%LWPDJD]LQH
holder with 12 bits of silicon molybdenum steel (S2)
• Professional Quality
• With 1/4“ drive
• Total length approximately 190 mm
• Colour-coded system for easy bit selection.
Contents:
‡&URVVUHFHVVHGHDFKRI3+3+3+
‡3R]LGULYHHDFKRI3=3=3=
‡6ORWHDFKRIPPPP
‡7;HDFKRI7;7;7;7;
‡[³8QLYHUVDOPDJQHWLFELWKROGHUPP

No.: PU EAN Placement Clip Stripe Article

COXB364015 20 D25 - -
4 035300 873128

09.2016 Subjects to change without notice 97


Screwdrivers

Pistol screwdriver
Screwdriver with special pistol grip and ratchet function.
Pistol grip: Its ergonomic shape makes it fit very well in the
KDQGDQGIDFLOLWDWHVWUDQVPLVVLRQRIIRUFH
Ratchet function: Forward/reverse/stop with 30 teeth

Other features:
• Magnetic bit holder
‡6WRUDJHFRPSDUWPHQWLQWKHKDQGOHIRUELWVVFUHZVHWF
• 2-component handle

No.: PU EAN Placement Clip Stripe Article

COXB364016 12 D19 - -
4 035300 907144

Mini ratchet screwdriver 4 in 1


• Bit magazine with 4 bits in handle
• 1/4“ drive
• Universal magnet bit holder
• Ratchet function with right/left
• Conversion and stops in the middle setting
‡6ORWPP
‡3+

No.: PU EAN Placement Clip Stripe Article

COXB364041 9 D17 - -
4 035300 740703

98 Subjects to change without notice 09.2016


Screwdrivers

Voltage detector, 65 mm
‡$FFRUGLQJWR9'(VWDQGDUG*6&(aYROW
• Slot
• With metal clip

No.: PU EAN Placement Clip Stripe Article

COXB370200 100 D15 - -


4 035300 897421

Voltage detector, 100 mm


‡$FFRUGLQJWR9'(VWDQGDUG*6&(aYROW
• Slot

No.: PU EAN Placement Clip Stripe Article

COXB370250 60 D15 - -
4 035300 897438

09.2016 Subjects to change without notice 99


Screwdrivers

Phasing tester, contactless


‡6DIHYROWDJHWHVWVLQFHQRGLUHFWFRQWDFWZLWKWKHYROWDJH
source is required
‡,GHQWLILFDWLRQRIFDEOHEUHDNVUHYLHZRIVRFNHWVHWFFDQ
be performed safely and easily

No.: PU EAN Placement Clip Stripe Article

COXB370260 12 D23 X X
4 035300 900947

Bit/ratchet screwdriver set, 43 pieces


• Ratchet screwdriver 240 mm
‡5DWFKHWIXQFWLRQWHHWKULJKWOHIWIL[HG
• Detachable bit retainer for 6 bits in the handle
• With 2-component handle
• Adapter square-end to hexagon 1/4“
‡)OH[LEOHH[WHQVLRQPP
• Incl. 40 bits 25 mm with coloured ring marker
 7; 
 7;75 
 3+ 
 3= 
 6ORW 
 6TXDUHHQG 
 +H[DJRQ
• In a sturdy plastic box with foldable bit holders

No.: PU EAN Placement Clip Stripe Article

COXB973943 8 M40 X -
4 035300 894284

100 Subjects to change without notice 09.2016


Socket wrenches/Wrenches

Combination spanner set, 6 pieces


• Chrome-vanadium
• 8 mm - 10 mm - 12 mm - 13 mm - 14 mm - 17 mm

No.: PU EAN Placement Clip Stripe Article

B20256 24 M21 X -
4 004722 619690

Adjustable wrench, 10 inch


• Chrome-plated
• Polished

No.: PU EAN Placement Clip Stripe Article

B20630 18 M15. - -
4 004722 619829

Allen key set TX long


• TX Allen key set made of chromium-vanadium steel
• 9-pieces
• Extra-long handle
• 10 % more torque compared to the DIN standard
• Practical folding support with anti-slip coating provides
a secure grip
‡6L]HV7;7;7;7;7;7;7;
7;7;

No.: PU EAN Placement Clip Stripe Article

B20780 10 M27 X -
4 004722 636581

09.2016 Subjects to change without notice 101


Socket wrenches/Wrenches

Allen key set hexagonal long


• Hexagonal key set made of chrome-vanadium steel
• 9-piece
• Extra long legs with ball head for screw connections in
angle of up to 30 °
• 30% more torque compared to DIN- Standard
• Practical hinged bracket with anti-slip and non-slip
coating provides secure grip
• Sizes: 1.5 mm - 2.0 mm - 2.5 mm - 3.0 mm - 4.0 mm -
5.0 mm - 6.0 mm - 8.0 mm - 10.0 mm

No.: PU EAN Placement Clip Stripe Article

B20781 10 M27 X -
4 004722 636604

Bit/ socket set, 23 pieces


• Ratchet with 43 teeth
• 50 mm extension adapter
• 4 edge/6 edge
‡VRFNHWVELWVRIFKURPHYDQDGLXPVWHHO
• In a practical plastic case
‡3+
‡3=
‡6ORWPP
‡7;
‡6RFNHWVPP

No.: PU EAN Placement Clip Stripe Article

B20785 10 K15 X -
4 004722 632569

102 Subjects to change without notice 09.2016


Socket wrenches/Wrenches

Socket spanners set


• 1/4“ + 3/8“
• 20 pieces

No.: PU EAN Placement Clip Stripe Article

B20795 8 M33 - -
4 004722 619928

Socket set, 27-piece


• 1/4“ ratchet with right/left converter made from
chromium-vanadium steel
• With 2-component handle
‡VRFNHWV
10 - 11 - 12 - 13 - 14 mm
• 13 socket screw bits
TX 10 - 15 - 20 - 25 - 30 - 40
PH 1 - 2
PZ 1 - 2
• Hexagon 3 - 4 - 5 mm
• With practical holder for storage

No.: PU EAN Placement Clip Stripe Article

B20796 6 M36 X -
4 035300 897704

09.2016 Subjects to change without notice 103


Socket wrenches/Wrenches

Wrench key set on ring, 8 pieces


• Made from chrome-vanadium steel
• Store the wrench keys in individual frames on the ring

No.: PU EAN Placement Clip Stripe Article

B20798 20 K17 X X
4 004722 620443

Adapter set, 3 pieces


• Consisting of:
• 1/4“ outside hexagonal x 1/4“ outside square with ball
• 1/4“ outside hexagonal x 1/2“ outside square with ball
• 1/4“ outside hexagonal x 3/8“ outside square with ball
‡6XLWDEOHIRUDOOVRFNHWVIRUGLUHFWGULYHRQWKHFKXFN
or with 1/4“ hexagonal holder

No.: PU EAN Placement Clip Stripe Article

B23003 12 M16 X X
4 004722 620764

104 Subjects to change without notice 09.2016


Socket wrenches/Wrenches

Multifunctional ratchet wrench


• 2 keys = 8 sizes
‡8QLYHUVDOO\VXLWDEOHIRUDOOGULYHVDOVRIRUVOXJJLVK
or broken bolts
• Suitable even for inch-sizes and E-sizes
• Ratchet wrench made of chromium-vanadium steel
ZLWKWHHWKPDWW
• 8 different sizes (small keys: 8 mm - 10 mm - 12 mm -
13 mm / large keys: 16 mm - 17 mm - 18 mm - 19 mm)
• Heads can be adjusted continuously by 90° each time
• Perfect for hard to reach places

No.: PU EAN Placement Clip Stripe Article

COXB364002 8 D19 X -
4 035300 904402

Multifunctional socket spanner set


‡8QLYHUVDOO\VXLWDEOHIRUDOOGULYHVDOVRIRUVOXJJLVK
or broken bolts
• Suitable even for inch-sizes and E-sizes
• Set consisting of 11 parts:
• 3/8“ ratchet with 72 teeth and 2-component handle
• 75 mm bit extension
• 9 high-quality sockets made of chrome-vanadium:
8 mm - 9 mm - 10 mm - 11 mm - 13 mm - 14 mm - 16 mm -
17 mm - 19 mm
• Theft protection is guaranteed in all components

No.: PU EAN Placement Clip Stripe Article

COXB364003 8 D35 X -
4 035300 904419

09.2016 Subjects to change without notice 105


Socket wrenches/Wrenches

Articulated ratchet wrench, 5 pieces


• Flexible ratchet function
‡)LQHWRRWKLQJGHSHQGLQJRIWKHVL]HXSWRWHHWK
• Ratchet can be continuously bent up to 90 degrees on both
VLGHVPDNHVZRUNHDVLHULQLQDFFHVVLEOHSODFHV
• Material: Chrome-Vandium
• Chrome-plated
• Practical plastic holder
• 6 mm - 44 teeth
• 7 mm - 48 teeth
• 8 mm - 48 teeth
• 10 mm - 60 teeth
• 13 mm - 72 teeth

No.: PU EAN Placement Clip Stripe Article

COXB541900 10 D37 X -
4 035300 899708

106 Subjects to change without notice 09.2016


Torches

Pocket torch set LED


• 3 pieces
• 9 LED lights per pocket torch
• Including 9 batteries (AAA microcells)
• Aluminium case
• With hand loop

No.: PU EAN Placement Clip Stripe Article

B29830 6 K29 X X
4 004722 621990

LED torch, 2 pieces


• 1 pocket torch with 6 LED lights and aluminium case
‡KHDGODPS/(' [UHG[ZKLWH 
• Robust plastic case
‡(ODVWLFDGMXVWDEOHKHDGEHOWKHDGSDG
• Tilt angle of the lights adjustable to 180 deg.
‡,QFOXGHVEDWWHULHV $$$PLFURFHOOSFPLJQRQFHOO
• Size approx. ø 25 mm x 85 mm

No.: PU EAN Placement Clip Stripe Article

B29840 12 M25 X X
4 004722 629316

09.2016 Subjects to change without notice 107


Torches

LED head torch set, 2 pieces


‡/(' [ZKLWH[UHG
• Beam of about 15 m
• Robust plastic housing
‡(ODVWLFDGMXVWDEOHKHDGEHOW
• Head pad
• Tilting angle of the lights can be adjusted up to 180°
• Including batteries (1 AA each)

No.: PU EAN Placement Clip Stripe Article

B29850 8 K12 X X
4 004722 629712

Aluminium light rod 3 LED


‡ZKLWH/('V ZDWWYROW
‡KRXUV/('OLIHVSDQEULJKWQHVVOXPHQV
‡+LJKTXDOLW\DOXPLQLXPKRXVLQJVLOYHU
• Horizontal or vertical installation possible
‡3UDFWLFDODGKHVLYHVXUIDFHDOWHUQDWLYHO\FDQDOVR
be screwed on
• Including batteries(4 x AAA)
‡/HQJWKP¡PPEDVH¡PP
‡&DQDOVREHLGHDOO\IDVWHQHGWRZDOOVVKHOYHVDQGPLUURUV
‡8VHLQZHWURRPVSRVVLEOHHJNLWFKHQEDWKURRP
• Screws not included

No.: PU EAN Placement Clip Stripe Article

B29861 10 M20. X -
4 035300 889525

108 Subjects to change without notice 09.2016


Torches

Triple pack cupboard and shelf lamps, 3 LEDs, 3 pieces


• Triple pack adhesive lamps with 3 LEDs
‡3URWHFWLRQFODVV,3WKHUHIRUHDOVRXVDEOHLQZHWURRPV
• Easy to switch on and off by pressing on the lamp
• Electrical connection not necessary
‡-XVWLQVHUWWKHEDWWHULHVVWLFNRQUHDG\
‡6WLFNVWRQHDUO\HYHU\VPRRWKVXUIDFHLGHDODVIXUQLWXUH
OLJKWIRUWKHFDUEDOFRQ\FDPSLQJHWF
• Incl. batteries (9x AAA 1.5 V)

No.: PU EAN Placement Clip Stripe Article

B29862 20 M80 X -
4 035300 886593

LED lamp, aluminium


‡$OXPLQLXPKRXVLQJFRORXUDQRGLVHG
‡7KHXOWUDOLJKWPLQLODPSLVEULJKWGRHVQRW
dazzle and fits in your pocket
‡+HLJKWZKHQSXVKHGWRJHWKHUDSSUR[PP
extended approx. 140 mm
• Practical hoop for hanging the lamp on a tent roof
or on branches
• Suitable as a lamp or torch
• 2 levels of brightness by repeatedly operating the
on/off switch lightly and as blinking light
• Light beam adjustable from point lighting (close-up range)
to searchlight setting (faraway)
• IP classification 64 = dust-proof and
• Protected against splash water on all sides
• Including batteries (3x AAA 1.5V)
• Dimensions approx. ø 37 mm x 100 mm

No.: PU EAN Placement Clip Stripe Article

B29871 12 D20 - -
4 035300 885855

09.2016 Subjects to change without notice 109


Torches

Sensor night light/torch LED, 2 in 1


‡OLJKWLQJPRGHVVDIHW\QLJKWOLJKWZLWK/('V
torch with 9 LEDs
• With rechargeable 3.7 V 700m Ah Li-Ion battery

Night light with movement sensor:


• Reacts to movements within a radius of 2-3 metres
• Automatic switching on if the lamp is removed from the
charging station
• Rechargeable torch battery charges automatically via
LQGXFWLRQ FRQWDFWOHVV ZKHQLWLVLQVHUWHGLQWRWKH
charging station
• Lights up automatically in the event of a power blackout

Torch:
• With on-off switch
• Includes charging station and operating instructions
• For better orientation and more safety at home

No.: PU EAN Placement Clip Stripe Article

B29872 10 M35 X -
4 035300 897926

LED light with motion detector


‡ORQJODVWLQJDQGHQHUJ\VDYLQJ/('VVWHSOHVV
SLYRWLQJPRWLRQ
• Sensor with 4 m range and a detection angle of 120°
• Automatic dusk sensor: prevents automatic switch-on at
sufficient light
• Automatic shut-off after 30 seconds without movement
• Manual on/off possible
• Simple attachment with hook and loop fastener without
drilling possible
• Including batteries: 3 x AA
• Dimensions: approx. W 16 x H 2.5 x D 5 cm

No.: PU EAN Placement Clip Stripe Article

B29873 12 M30 X -
4 004722 635911

110 Subjects to change without notice 09.2016


Torches

Pocket torch, 9 LED


• 9 LED lights
• Aluminium case
• Colour galvanized
• Structured handle with hand loop
• Long running time thanks to minimum power usage
‡,QFOXGLQJEDWWHULHV [$$$9
• Size approx. ø 30 mm x 95 mm

No.: PU EAN Placement Clip Stripe Article

B29875 12 D21 X X
4 004722 629385

Work light, 24 LED


• Light power approx. 4 - 5 lumens
‡:LWKKRRNVDQGPDJQHWRQWKHEDFNVLGHWRDIIL[
metal objects
• Long duration due to minimal power use
‡,QFOXGHVEDWWHULHV [$$9
• Size approx. 58 mm x 205 mm

No.: PU EAN Placement Clip Stripe Article

B29881 12 D30 X X
4 004722 629989

09.2016 Subjects to change without notice 111


Torches

Telescopic pocket torch, LED/Magnet


• 3 LED
• Extendible from 170 to 550 mm
• Light head can be rotated 360 deg.
• Integrated magnet on light head and end of handle
• Aluminium case
• 8-sided light head for secure positioning on level surfaces
• With shirt pocket clip
• Including batteries (4x LR 44)
• Size approx. ø 22 mm 170 mm

No.: PU EAN Placement Clip Stripe Article

B29882 16 D26 - -
4 004722 631807

Work light, 24 + 4 LED


• Light intensity approx. 4 to 5 lumen
• With swivel hook
• Magnet on the backside for fixing on metal items
• Long term use due to minimal consumption
• Handy design
‡%DWWHULHVLQFOXGHG [$$$9
• Size approx. 55 mm x 90 mm

No.: PU EAN Placement Clip Stripe Article

B29883 12 D24 X -
4 004722 633153

112 Subjects to change without notice 09.2016


Torches

Work light 24 + 6 LED, large


• 24 LEDs main light and additional 6 LEDs torch
• With swivel hook
• Magnet on the rear side for fixing to metal objects
• Long life span due to minimum consumption
• Handy shape
• Incl. batteries (3x AA 1.5 V)
• Approx. ø 55 mm x 210 mm

No.: PU EAN Placement Clip Stripe Article

B29884 12 D23 X -
4 035300 885848

LED lamp
• With key chain
• With bright LED
• Service life approx. 100.000 hours
• Strong key ring
• Incl. batteries (3x LR44)
• Dimensions approx. ø 18 mm x 55 mm

No.: PU EAN Placement Clip Stripe Article

B29886 24 K22 X X
4 035300 886654

09.2016 Subjects to change without notice 113


Torches

Penlight, LED
&RPSDFWDQGOLJKWZHLJKWSHQOLJKW
7KDQNVWRLWVGHVLJQWKHODPSILWVSHUIHFWO\LQDVKLUWSRFNHW
DQGLVDOZD\VDWKDQGOLNHHJDEDOOSRLQWSHQLGHDOO\VXLWHG
IRUZRUNLQJRQKDUGWRUHDFKSODFHVRULQSODFHVZKHUHOHVV
VSDFHLVDYDLODEOHHDV\WRVZLWFKRQDQGRIIZLWKWKHSUHVVX-
re switch at the end of the lamp
• Material: Aluminium
‡%DWWHU\[$$$ LQFOXGHGLQGHOLYHU\ 
• Length: approx. 100 mm
• Weight: approx. 25 g
• 1 bright 0.5W LED
‡&RORXUV%ODFNVLOYHUJUHHQEOXH

No.: PU EAN Placement Clip Stripe Article

B29887 16 K22 X X
4 004722 635898

Headlamp 1 LED
• 2 light levels with blinking mode
• Solid plastic housing
‡(ODVWLFDGMXVWDEOHKHDGEHOWZLWKIURQWSDG
• Tilting angle of the light approx. 180 deg. range
‡,QFOXGLQJEDWWHULHV [$$$9

No.: PU EAN Placement Clip Stripe Article

B34066 8 M34 X X
4 035300 746859

114 Subjects to change without notice 09.2016


Cutting wheels/Saws

Diamond cutter, 110 mm


• Suitable for dry and wet cutting
‡)RUWLOHVQDWXUDOVWRQHDQGJOD]HGWLOHV

No.: PU EAN Placement Clip Stripe Article

B23119 20 M16 X X
4 004722 621006

Diamond cutter
• Universal
• Suitable for wet and dry cutting
‡:LWKFXWWLQJVHJPHQWVIRUFRQFUHWHEULFNURRIWLOHV
and clinker

No.: PU EAN Placement Size Clip Stripe Article

B23120 20 M16 X 115 mm X


4 004722 619942

B23121 20 M16 X 125 mm X


4 004722 621013

B23125 12 M26 X 230 mm X


4 004722 619959

09.2016 Subjects to change without notice 115


Cutting wheels/Saws

Diamond blade set, 3 pieces


• Suitable for wet and dry cutting
• 1x 110 mm for tile and natural stone and glazed tile
‡[PPZLWKFXWWLQJVHJPHQWVIRUFRQFUHWHEULFNV
roof tiles and clinker
• 1x 115 mm turbo for concrete and bricks

No.: PU EAN Placement Clip Stripe Article

B23130 12 M16 X X
4 004722 621037

Auxiliary set, 12 pieces for multi-function tool


‡VDZEODGHVPPPPPP
‡ELPHWDOOLFVDZEODGHPP
‡VHPLFLUFXODUVDZEODGHURXQG
• 1 carbide-tipped triangular sanding pad
• 1 hard metal sprayed semicircular saw blade
‡VSDWXODRIIVHW
‡VSDWXODIODW
• 1 Delta sanding disc holder
• 10 metal grinding accessories
• 10 grinding accessories for wood
• In a practical aluminium case

No.: PU EAN Placement Clip Stripe Article

B23170 6 M35 - -
4 004722 630084

116 Subjects to change without notice 09.2016


Cutting wheels/Saws

Hole saw set, 5 pieces


‡¡PP
• C50 steel
• Max. cut depth approx. 25 mm
• Including centre driller
• Suitable for cuts in wood and plastic

No.: PU EAN Placement Clip Stripe Article

B23450 12 M15 X X
4 004722 629323

Folding saw horse


• Galvanized steel
• Material thickness 1.7 mm
• Holds up to max. 180 kg
• Incl. assembly instructions

No.: PU EAN Placement Clip Stripe Article

B44650 6 SP - -
4 004722 624571

09.2016 Subjects to change without notice 117


Cutting wheels/Saws

Jigsaw with aluminium handle


‡([WUDVKDUSKDUGHQHGWRRWKLQJIRUTXLFNFXWWLQJRIZRRG
and plastic
• Ergonomically shaped aluminium handle with 2-component
sheathing
• Particularly suitable for drywall construction
 HJIRUFXWWLQJRXWWLQVFDEOHGXFWVHWF
• With practical bag for fastening to a belt.

No.: PU EAN Placement Clip Stripe Article

COXB816150 12 D38 X X
4 035300 732685

Japanese mitre saw, 265 mm


• Material of the saw blade: Japan sk5 steel
• High cutting precision and long life
• Inductive hardened teeth
• 14 TPI
• Thickness of the blade: app. 0.60 mm
• Length of the saw blade: app. 265 mm
• Total length: app. 425 mm
• Saw blade change function
• For precision cuts in all types of wood and plastic

No.: PU EAN Placement Clip Stripe Article

B25320 10 G49 X X
4 035300 875795

118 Subjects to change without notice 09.2016


Cutting wheels/Saws

Aluminium mini handsaw


• 10“ saw blade (254 mm)
• High-speed steel
• With ergonomically-shaped 2-component handle

No.: PU EAN Placement Clip Stripe Article

B25350 12 K34 X X
4 004722 622607

Metal saw bow set


‡+DFNVDZLQFOXGLQJVDZEODGHVPPHDFK
• Practical storage box for saw blades in the frame
• Ergonomically-shaped 2-component handle
‡$QJOHRIWKHVDZEODGHVFDQEHDGMXVWHGƒƒƒ
‡8QLYHUVDOSODVWLFVDZEODGHVLQFOXGLQJVDZEODGHV
150 mm
‡$QJOHRIWKHVDZEODGHVFDQEHDGMXVWHGƒƒƒ
• Ergonomically shaped soft handle

No.: PU EAN Placement Clip Stripe Article

B25370 10 M54. - -
4 004722 629590

09.2016 Subjects to change without notice 119


Cutting wheels/Saws

Box of circular saw blades, 3 pieces


• 3 circular saw blades 190 mm diameter x thickness 2.4 mm
‡:LWKDQGFDUELGHWLSSHGWHHWKIRUORQJOLIH
• Mounting hole ø 30 mm
• With reducer rings ø 20 and ø 16 mm (2 of each diameter)
for use of the saw blades in various saws
• Made of high quality carbon steel
‡,GHDOIRUSUHFLVHVDZLQJRISO\ZRRG0')26%HWF

When inserting pay attention to correct direction of rotation!


Max. 7000 U/min

No.: PU EAN Placement Clip Stripe Article

B23110 4 G22. X -
4 004722 633139

Metal mitre box set, 2 pieces


$OXPLQLXPPLWUHER[[[PPLQFOXGLQJKDFNVDZ
with metal blade 150 mm

No.: PU EAN Clip Stripe Article MA netto-EK

CP804162 6 - -
4 035300 828975

120 Subjects to change without notice 09.2016


Cutting wheels/Saws

Mitre box set, 2 pieces


&RQWHQWVZRRGVDZER[[[PPILQHVDZ
straight 250 mm

No.: PU EAN Placement Clip Stripe Article MA netto-EK

CP822702 6 M47 - -
4 035300 830459

All-purpose saw
With metal saw blade 150 mm

No.: PU EAN Clip Stripe Article MA netto-EK

CP804160 10 - -
4 035300 828968

09.2016 Subjects to change without notice 121


Cutting wheels/Saws

Metal saw bow


%ODGHWHQVLRQLQJZLWKZLQJQXWPHWDOVDZEODGHPP

No.: PU EAN Placement Clip Stripe Article MA netto-EK

CP910001 6 M50 - -
4 035300 828982

122 Subjects to change without notice 09.2016


Pliers

12 in 1 mini multi-tool
• Versatile tool
• Of high-quality metal construction
• Stainless steel
• 2-component handle
• Folding to save space
• With a key ring and a short chain

No.: PU EAN Placement Clip Stripe Article

COXB899015 12 D23 - -
4 035300 773794

16 in 1 multi-tool
• Versatile tool
• Of high-quality metal construction
• Stainless steel
• 2-component handle
• Folding to save space

No.: PU EAN Placement Clip Stripe Article

COXB899016 12 D33 - -
4 035300 755738

09.2016 Subjects to change without notice 123


Pliers

Multitool/torch set in a gift box, 2 pieces


0XOWLWRROPPSLHFHV
• Stainless steel
‡IXQFWLRQVFRPELQDWLRQSOLHUVWHOHSKRQHSOLHUVFDEOH
FXWWHUFDEOHVWULSSHUNQLIHERWWOHRSHQHUWLQRSHQHUILOH
ILVKVFDOHUZLWKVFDOHILVKKRRNUHPRYHUVKHDUV
VFUHZGULYHUPPVFUHZGULYHUPPVFUHZGULYHUPP
FURVVWLSVFUHZGULYHUVTXDUHEDUVWHHO
‡/HQJWKDSSUR[PPIROGHGDSSUR[PP

Torch
• Dimensions ø 29 x 90 mm
‡$OXPLQLXPKRXVLQJFRORXUDQRGLVHG
• 9 LED lamps
• Very bright (approx. 18.000 lumens)
• Structured handle
• With hand strap
‡/RQJOLIHVSDQGXHWRPLQLPXPFRQVXPSWLRQ
DSSUR[K
• Incl. batteries (3x AAA 1.5V)

No.: PU EAN Placement Clip Stripe Article

B29845 12 M36 X -
4 035300 890279

124 Subjects to change without notice 09.2016


Pliers

Multifunction tool set, 3 pieces


• Stainless steel
‡IXQFWLRQVFRPELQDWLRQSOLHUVWHOHSKRQHSOLHUVFDEOH
FXWWHUNQLIHERWWOHRSHQHUWLQRSHQHUVFUHZGULYHUPP
VFUHZGULYHUPPFURVVWLSVFUHZGULYHUVDZILOHDZO
‡/HQJWKDSSUR[PPIROGHGDSSUR[PP

Cutter knife
• Aluminium handle
• Stainless steel blade holder
• Self-locking
• Incl. 1 blade
‡/HQJWKDSSUR[PPIROGHGDSSUR[PP

Dual reversible screwdriver:


‡5HYHUVLEOHELWV[FURVVWLSPP[3+3+
• In addition 6+8 mm Allen key
• 2-component handle
• Length 165 mm

No.: PU EAN Placement Clip Stripe Article

B20210 12 M48 X -
4 035300 893652

09.2016 Subjects to change without notice 125


Pliers

Automatic water pump pliers


Puts an end to the constant search for the right size setting.
Automatic water pump pliers make sure you always get
optimum size setting by simply squeezing the handles.
)XUWKHUPRUHWKHEXLOWLQVSULQJIDFLOLWDWHVJULSSLQJDQG
adjusting when working.
Other features:
• Length 250 mm
• Chromium-vanadium steel
• 2-component handle
• Anti-trap protection

No.: PU EAN Placement Clip Stripe Article

COXB364005 8 D23 X -
4 035300 904433

Wire end sleeve pliers set


Including 150x cable end sleeves:
‡[PPð
‡[PPð
‡[PPð
‡[PPð
‡[PPð

No.: PU EAN Placement Clip Stripe Article

B20423 10 M12 X X
4 004722 621143

126 Subjects to change without notice 09.2016


Pliers

Hole punch and riveting pliers


• Punch pliers with 6 attachments from 2.5 to 5 mm
• Rivets for rivets up to 5 mm
‡5LYHWVLQGLIIHUHQWFRORXUV%URQ]H6LOYHU *ROG
‡)RUGHFRUDWLQJWH[WLOHVIRUDGGLQJEHOWVKROHV

No.: PU EAN Placement Clip Stripe Article

B20622 12 K39 X -
4 004722 636130

Bolt cutters
With tubular steel shafts and plastic handles

No.: PU EAN Length Placement Clip Stripe Article MA netto-EK

CP180470 2 450 mm M55 - -


4 035300 828869

CP180630 2 600 mm G70 - -


4 035300 828876

09.2016 Subjects to change without notice 127


Pliers

Set of blind rivets with pliers


%OLQGULYHWSOLHUVZLWKDQDVVRUWPHQWRIEOLQGULYHWVLQSODVWLF
box

No.: PU EAN Placement Clip Stripe Article MA netto-EK

CP195270 4 M35 - -
4 035300 828906

Pipe wrench

No.: PU EAN Size Placement Clip Stripe Article MA netto-EK

CP232025 4 1 Zoll M35 - -


4 035300 829989

CP232040 4 1 1/2 Zoll M45 - -


4 035300 829996

128 Subjects to change without notice 09.2016


Pliers

Pincers
• Varnished
• 200 mm

No.: PU EAN Placement Clip Stripe Article MA netto-EK

CPT100200 6 K28 X -
4 035300 828487

Securing pliers with 4 heads


‡KHDGVWUDLJKWIRULQQHUULQJ
‡KHDGFXUYHGIRULQQHUULQJ
‡KHDGVWUDLJKWIRURXWHUULQJ
‡KHDGFXUYHGIRURXWHUULQJ

No.: PU EAN Placement Clip Stripe Article

CPT179004 6 K25 X -
4 035300 828791

09.2016 Subjects to change without notice 129


Pliers

Tower pincers
• Varnished
• 250 mm

No.: PU EAN Placement Clip Stripe Article MA netto-EK

CPT110250 6 M31 X -
4 035300 828500

Cable shoe vice-grip wrench


• For insulated cable lugs
• With plastic handles

No.: PU EAN Placement Clip Stripe Article MA netto-EK

CPT190221 8 K10 X X
4 035300 828814

130 Subjects to change without notice 09.2016


Pliers

Lever sheet metal shears


3ODVWLFKDQGOHVZLWKDQWLVOLSSURWHFWLRQVSULQJDQGFODVS

Clip Stripe
No.: PU EAN Length Type Placement MA netto-EK
Article

CPT243260 4 250 mm M12 X -


4 035300 828913

CPT243261 4 250 mm M12 X -


4 035300 828920

CPT243262 4 250 mm M12 X -


4 035300 828937

Grip wrench
• With quick release lever
• 250 mm

No.: PU EAN Placement Clip Stripe Article MA netto-EK

CPT251250 6 M13 X -
4 035300 829385

09.2016 Subjects to change without notice 131


Pliers

Combination pliers
• With two-component handles
• 180 mm

No.: PU EAN Placement Clip Stripe Article MA netto-EK

CPT112180 6 K20 X -
4 035300 828586

Side cutting pliers


• For standard wire
• With two-component handles
• 160 mm

No.: PU EAN Placement Clip Stripe Article MA netto-EK

CPT130160 6 K20 X -
4 035300 828593

132 Subjects to change without notice 09.2016


Pliers

Heavy-duty diagonal cutter


• With two-component handles
• 180 mm

No.: PU EAN Placement Clip Stripe Article MA netto-EK

CPT137180 6 K20 X -
4 035300 828609

Radio & telephone pliers


• Straight
• With two component-handles
• 160 mm

No.: PU EAN Placement Clip Stripe Article MA netto-EK

CPT170160 6 K20 X -
4 035300 828616

09.2016 Subjects to change without notice 133


Pliers

Radio & telephone pliers


• Curved
• With two-component handles
• 160 mm

No.: PU EAN Placement Clip Stripe Article MA netto-EK

CPT176160 6 K20 X -
4 035300 828630

Wire stripping pliers


• With spring and adjusting screw
• With two-component handles
• 160 mm

No.: PU EAN Placement Clip Stripe Article MA netto-EK

CPT178160 6 K20 X -
4 035300 828678

134 Subjects to change without notice 09.2016


Pliers

Water pump pliers


• Pierced joint
• 2-component handles
• 250 mm

No.: PU EAN Placement Clip Stripe Article MA netto-EK

CPT202240 6 K20 X -
4 035300 828685

Set of precision pliers, 3 pieces


‡[3UHFLVLRQVLGHFXWWLQJSOLHUVPPZLWKGLSLQVXODWHG
handles
‡[3UHFLVLRQIODWWDSHUQRVHSOLHUVVWUDLJKWZLWKEODGH
PPZLWKGLSLQVXODWHGKDQGOHV
‡[3UHFLVLRQIODWWDSHUQRVHSOLHUVFXUYHGZLWKEODGH
PPZLWKGLSLQVXODWHGKDQGOHV

No.: PU EAN Placement Clip Stripe Article MA netto-EK

CPT188003 4 M11 X -
4 035300 828784

09.2016 Subjects to change without notice 135


Pliers

Electrician‘s flat-taper-nose pliers


• With double spring
• 2-component handles
• 145 mm

No.: PU EAN Placement Clip Stripe Article MA netto-EK

CPT187084 6 K10 X -
4 035300 828722

Electrician‘s side cutting pliers


• With double spring
• 2-component handles
• 120 mm

No.: PU EAN Placement Clip Stripe Article MA netto-EK

CPT187082 6 K10 X -
4 035300 828715

136 Subjects to change without notice 09.2016


Pliers

Electrician‘s combination pliers


• With double spring
• 2-component handles
• 120 mm

No.: PU EAN Placement Clip Stripe Article MA netto-EK

CPT187081 6 K10 X -
4 035300 828708

Electrician‘s flat-taper-nose pliers


• Straight
• With cutter
• Double spring
• 2 component handles
• 120 mm

No.: PU EAN Clip Stripe Article MA netto-EK

CPT187087 6 X -
4 035300 828739

09.2016 Subjects to change without notice 137


Accessories

Breakdown truck
The new CONNEX workshop station offers ample storage
space and convinces due to its many extras. It is absolutely
LQGLVSHQVDEOHLQHYHU\ZRUNVKRSWKDQNVWRLWVKLJKTXDOLW\
workmanship and a stable design.

• 900 x 665 x 365 mm (H x W x D)


‡1HWZHLJKWNJJURVVZHLJKWNJ
• Steel housing
• Workshop station up to 300 kg
‡VPDOODQGODUJHEDOOEHDULQJIXOO\H[WHQGDEOH
and adjustable drawers
• Small drawers each loadable up to 20 kg
• Large drawers each loadable up to 35 kg
• Cover made of polystyrene with compartments
• Central lock with 2 keys
‡0RELOHFDVWRUVZLWKSDUNLQJEUDNHVZLYHOFDVWRUV
• Sturdy sliding handle
• Incl. 2 containers and a screwdriver holder for
4 screwdrivers for lateral fastening

No.: PU EAN Placement Clip Stripe Article

COXB364100 1 SP - -
4 035300 923304

Universal funnel
• Flexible hose allows easy filling of cold and non-acidic
liquids
• Matching for all standard vessel openings
‡(YHQVXLWDEOHIRURLOSHWURODQGGLHVHO

No.: PU EAN Placement Clip Stripe Article

COXB897953 12 D14 - -
4 028354 030500

138 Subjects to change without notice 09.2016


Accessories

(De-)magnetiser
This indispensable helper is a must for every home-builder.
6PDOODQGHIILFLHQWLWILWVLQWRDQ\GUDZHU
,QRUGHUWRPDJQHWLVH\RXUWRROPRYHLWWKURXJKWKH
magnetiser and therefore prevent accidentally dropping any
screws or small metal parts.
The tool can also be quickly demagnetised. This is
particularly recommended when working on sensitive
electronic components.
• „+ opening“ for magnetising
• „opening“ for demagnetising

No.: PU EAN Placement Clip Stripe Article

B20698 12 K25 X X
4 004722 637885

Funnel set, 4 pieces


‡¡PPPPPPPP
• With holder and hanging eyelet
• Orange

No.: PU EAN Placement Clip Stripe Article

B20844 12 M49 - X
4 004722 621174

09.2016 Subjects to change without notice 139


Accessories

Water pump for drilling machine


• 2 hose connectors with 3/4“ threads for 1/2“ hose
• Max. 2000-3000 RPM
‡)RUIDVWDQGHDV\IOXLGSXPSLQJLGHDOIRUWUDQVIHUULQJ
Not suitable for flammable liquids
Do not let it out dry
Not suitable for drinking water

No.: PU EAN Placement Clip Stripe Article

B20930 8 M23 X X
4 004722 622720

Claw gripper, 600 mm


• 4 grip claws
• Claw action with a push-button on the handle
• Very bendable
‡7RJULSDQGKROGVPDOOSLHFHVLQGLIILFXOWWRUHDFKVSRWV
such as screws

No.: PU EAN Placement Clip Stripe Article

B22600 60 M40 X -
4 004722 623994

140 Subjects to change without notice 09.2016


Accessories

Magnifying glass, LED/UV


• Biconvex glass lenses
• Lens size approx. 53 mm x 53 mm
• 4x enlargement
• 5 LEDs for optimal lighting of the object
• 1 UV LED for checking authenticity of banknotes
• Total length: approx. 200 mm
• Includes batteries (4x AG10)

No.: PU EAN Placement Clip Stripe Article

B24810 12 D31 - -
4 004722 632613

Telescope mirror
• Mirror diameter 30 mm
• Extendible from 160 to 590 mm
• With clip

No.: PU EAN Placement Clip Stripe Article

B24830 20 K13 X X
4 004722 620788

Telescoping magnet, 2 lb (900g)


• Extendible from 130 - 650 mm
• Pulling weight up to 900 g
• With clip

No.: PU EAN Placement Clip Stripe Article

B24840 20 K13 X X
4 004722 620795

09.2016 Subjects to change without notice 141


Accessories

Telescoping magnet with LED


• Infinitely adjustable from 190 to 800 mm (with handle)
• Built-in magnet on the light head
• Pulls about 1.5 lbs (approx. 700 g)
• Targeted spot lighting for LED lighting in confined
spaces on the light head
• The practical on/off LED switch is on the lamp head
‡1RQVOLSHUJRQRPLFVRIWKDQGOH
• Includes batteries (3x LR44)

No.: PU EAN Placement Clip Stripe Article

B24870 12 D16 - -
4 004722 632897

Flexible magnet with LED, 56 cm


• Tension up to 5 lb (2270 g)
• Targeted spot LED lighting for confined spaces with a
magnetic head
• Plastic handle
• Includes 3 x 1.5 V / G13-A batteries

No.: PU EAN Placement Clip Stripe Article

B24860 12 M33 X X
4 004722 629576

142 Subjects to change without notice 09.2016


Accessories

Carpenter‘s pencil set, 7 pieces


• 6 carpenter‘s pencils 175 mm
‡)RUPDUNLQJRQPDWHULDOVZLWKDURXJKVROLGVXUIDFH
• Incl. 1 sharpener

No.: PU EAN Placement Clip Stripe Article

B26327 20 M22 X X
4 035300 893553

Carpenter’s pencil
• No more sharpening with knife or sharpener
• No more ever-shorter pencil
• Simply press the clip and the cartridge is like new again
• The pencil retains its length
• Scope of delivery: Pencil with cartridge and 2 refills

No.: PU EAN Placement Clip Stripe Article

B26328 16 K20 X -
4 004722 636482

Siphon
• Carrying power up to 15 kg
‡¡FP
• Plastic
• Simple suction through moving the lever
• One-handed operation

No.: PU EAN Placement Clip Stripe Article

B29640 8 K26 - -
4 004722 622744

09.2016 Subjects to change without notice 143


Accessories

Double vacuum lifting pad


3ODVWLFOLIWLQJFDSDFLW\XSWRNJPPLQGLDPHWHU

No.: PU EAN Placement Clip Stripe Article

CP885552 5 M36 - -
4 035300 830824

Mini table USB fan


• Material ABS
‡5RWRUEODGHVDUHPDGHRI(9$PDWHULDOVRWKHUHLVQR
risk of injury when touching rotating blades
‡USP
• USB cable with a length of 1 m
• For connection to all USB ports at all commercial
computers or laptops
‡&RORXUVEOXHJUHHQSLQN

No.: PU EAN Placement Clip Stripe Article

B29960 12 M45. - -
4 004722 636161

144 Subjects to change without notice 09.2016


Accessories

Self-adhesive blackboard foil


• 1 roll of sheet film in the format of 45 x 200 cm
• For many application areas
‡6HOIDGKHVLYHLQVFULEDEOHZLWKKLJKZULWLQJFRQWUDVW
adheres to almost all smooth surfaces and is also
removable
• Can be cut into any shape using safety scissors
‡,QFOXGHVFKDONERDUGV[ZKLWHHDFK[EOXH
\HOORZSLQN

No.: PU EAN Placement Clip Stripe Article

B29206 16 M47 - -
4 004722 636352

Fireplace screen cleaner


• 2 pieces
• Perfect and dry cleaning for al fireplace-/ oven slices
• Absolutely scratch-free
• Without chemicals

No.: PU EAN Placement Clip Stripe Article

B46419 12 D12 - -
4 003364 606419

09.2016 Subjects to change without notice 145


Accessories

Thread cutting set, WS, 20 pieces


Per 1x Machine taps
00000000DQG0
Per 1x Dies taps Ø 25 x 9 mm
00000000DQG0
[7DSHZUHQFK00
1x Machine tap holder 25 x 9 mm

No.: PU EAN Clip Stripe Article MA netto-EK

CP676014 2 X -
4 035300 830343

Hand cleaner liquid, 200 ml


/LTXLGKDQGFOHDQVHUVNLQIULHQGO\GHUPDWRORJLFDOO\WHVWHG
in a tube

No.: PU EAN Placement Clip Stripe Article MA netto-EK

COX591201 10 - - -
4 035300 874767

146 Subjects to change without notice 09.2016


Household goods

Lint rollers, 3 pieces


UROOHUOLQWUROOHUVPHDFK

No.: PU EAN Placement Clip Stripe Article

B34097 24 M36 X X
4 035300 739585

Billiard ball keyring


:LWKVKRUWFKDLQDQGNH\ULQJ¡DSSUR[PP
Sorted by colour per unit

No.: PU EAN Placement Clip Stripe Article

B34098 16 K15 - X
4 035300 739592

Retractable (fishing) tape, 3 mm x 15 m


)RUHDV\SXOOLQJRIHOHFWULFDODQWHQQDWHOHSKRQHRUVSHDNHU
FDEOHVHWFLQHPSW\FRQGXLWVYHU\IOH[LEOHWUDQVSDUHQW
UHWUDFWDEOHWDSHIOH[LEOHVHDUFKVSULQJPPSXOOLQJH\H
ø 2 mm

No.: PU EAN Placement Clip Stripe Article

B34137 12 M20 X X
4 035300 752751

09.2016 Subjects to change without notice 149


Household goods

Flipchart marker set, 3 pieces


)DVWGU\LQJZDWHUEDVHGLQNVPXGJHIUHHUHGEOXHEODFN

No.: PU EAN Placement Clip Stripe Article

B34130 12 K15 X X
4 035300 740512

Bag clips, 12 pieces


5HXVDEOHSODVWLFFRORXUDVVRUWPHQW
Contents:
4 pieces yellow 11 cm
4 pieces red 8 cm
4 pieces turquoise 6 cm

No.: PU EAN Placement Clip Stripe Article

B34121 24 M19 X X
4 035300 748099

150 Subjects to change without notice 09.2016


Household goods

Key chains
&RORXUDVVRUWPHQWSODVWLF

No.: PU EAN Placement Clip Stripe Article

B33310 18 M19 X X
4 004722 571660

Flexible binder
)OH[LEO\SOLDEOHVWHHOV\QWKHWLFFRDWHG 39&

No.: PU EAN Placement Colour Clip Stripe Article

B34025 12 M36 X green X


4 035300 915248

B34026 12 M36 X black X


4 035300 915255

B34027 12 M36 X yellow X


4 035300 915262

B34028 12 M36 X gray X


4 035300 915279

09.2016 Subjects to change without notice 151


Household goods

Flexible binder
)OH[LEO\SOLDEOHUXEEHU39&&RORXUUHG

No.: PU EAN Placement Clip Stripe Article

B34090 12 M47 X X
4 035300 735891

Baggage strap
$GMXVWDEOHOHQJWKZLWKSODVWLFEXFNOHSRO\HVWHU

No.: PU EAN Placement Clip Stripe Article

DY270609 5 K26 X X
4 035300 395965

152 Subjects to change without notice 09.2016


Household goods

Furniture carrying strap


:LWKORFNSRO\HVWHUNHHSEHOWRIIVKDUSHGJHV

No.: PU EAN Placement Clip Stripe Article

DY270608 5 M36 X X
4 035300 395958

Aluminium carabiner hook set, 4 pieces


:LWKVQDSDOXPLQLXPFRORXUJDOYDQL]HG

(not suitable for people or load securing)

No.: PU EAN Placement Clip Stripe Article

B34120 24 K12 X X
4 035300 746866

09.2016 Subjects to change without notice 153


Household goods

Aluminium carabiner hook set, 2 pieces


:LWKVRIWKDQGOHDQGVQDSFRORXUDQRGLVHG

(not suitable for people or load securing)

No.: PU EAN Placement Clip Stripe Article

B34128 24 M26 X X
4 035300 752768

154 Subjects to change without notice 09.2016


Magnets

Signal magnets, 10 pieces


¡FPSODVWLFFRDWHGFRORXUDVVRUWPHQW

No.: PU EAN Placement Clip Stripe Article

B34085 12 K12 X X
4 035300 717620

Designer magnets, 4 pieces


¡FPGHVLJQYDULRXVPRWLIVSODVWLFFRYHUHGDQGSULQWHG

No.: PU EAN Placement Clip Stripe Article

B34103 24 K12 X X
4 035300 906970

09.2016 Subjects to change without notice 155


Magnets

Power neodymium magnet


1HRG\PLXPGLVFPDJQHWQLFNHOSODWHGZLWKVWURQJDGKHVLRQ

No.: PU EAN Placement Adhesion Content Clip Stripe Article

DY7100001 5 K12 X NJ 20 X


4 035300 924004

DY7100002 5 K12 X NJ 10 X


4 035300 924011

DY7100003 5 K12 X 6 kg 5 X
4 035300 923892

DY7100004 5 K12 X 11 kg 2 X
4 035300 923908

Power neodymium magnet


1HRG\PLXPURGPDJQHWQLFNHOSODWHGZLWKVWURQJDGKHVLRQ

No.: PU EAN Placement Adhesion Content Clip Stripe Article

DY7100005 5 K12 X NJ 10 X


4 035300 923915

156 Subjects to change without notice 09.2016


Magnets

Power neodymium magnet


1HRG\PLXPUHFWDQJXODUPDJQHWQLFNHOSODWHGZLWKVWURQJ
adhesion

No.: PU EAN Placement Adhesion Content Clip Stripe Article

DY7100006 5 K12 X NJ 20 X


4 035300 923922

DY7100007 5 K12 X NJ 20 X


4 035300 923939

DY7100008 5 K12 X 4 kg 6 X
4 035300 923946

DY7100009 5 K12 X 18 kg 2 X
4 035300 923953

Power neodymium magnet


1HRG\PLXPGLVFPDJQHWZLWKURXQGKROHQLFNHOSODWHGZLWK
VWURQJDGKHVLRQLQFOXGLQJFRXQWHUVXQNKHDGVFUHZ3=LQ
stainless steel A2

No.: PU EAN Placement Adhesion Content Clip Stripe Article

DY7100010 5 K12 X 4 kg 1 X
4 035300 923960

DY7100011 5 K12 X NJ 1 X


4 035300 923977

DY7100012 5 K12 X NJ 1 X


4 035300 923984

DY7100013 5 K12 X NJ 1 X


4 035300 923991

09.2016 Subjects to change without notice 157


Universal holders

Wall hook assortment, 10 pieces


Galvanized
Pieces Size Load limit
2 pieces 145 x 114 mm 9 kg
2 pieces 159 x 113 mm 9 kg
SLHFHV[PPNJ
SLHFHV[PPNJ
SLHFHV[PPNJ

No.: PU EAN Placement Clip Stripe Article

DY30000 20 G56 X -
4 035300 682805

Wall hook assortment, 6 pieces


Galvanized
Pieces Size Load limit
2 pieces 123 x 82 mm 9 kg
2 pieces 145 x 114 mm 9 kg
2 pieces 205 x 200 mm 11 kg

No.: PU EAN Placement Clip Stripe Article

DY31000 20 G56 X -
4 035300 682812

158 Subjects to change without notice 09.2016


Universal holders

Wall hooks assortment, 32 pieces


*DOYDQL]HGSODVWLFFRDWHG
with matching fixing materials
‡SLHFH[PP/RDGOLPLWNJ
‡SLHFH[PP/RDGOLPLWNJ
‡SLHFH[PP/RDGOLPLWNJ
‡SLHFHV[PP/RDGOLPLWNJ
‡SLHFHV[PP/RDGOLPLWNJ
‡SLHFHV[PP/RDGOLPLWNJ
‡SLHFHV[PP/RDGOLPLWNJ
‡SLHFHV[PP/RDGOLPLWNJ
‡SLHFHV[PP/RDGOLPLWNJ
‡SLHFHV[PP/RDGOLPLWNJ
‡SLHFHV[PP/RDGOLPLWNJ
‡SLHFHV[PP/RDGOLPLWNJ
‡SLHFHV[PP/RDGOLPLWNJ
‡SLHFHVPP/RDGOLPLWNJ

No.: PU EAN Placement Clip Stripe Article

DY250829 4 M38 - -
4 035300 878253

Bracket set for beer tent fittings


)RUEHQFKHVDQGWDEOHJDOYDQL]HGLQFOXGLQJ
fixing materials
2 pcs 130 x 160 x 145 mm
2 pcs 130 x 80 x 225 mm

No.: PU EAN Placement Clip Stripe Article

DY250830 2 M77 - -
4 035300 899500

09.2016 Subjects to change without notice 159


Ropes & Cords

Packing twine, 2 pieces


UROOVHDFKPSRO\SURS\OHQHWULSOHWZLVWHGFRORXUIDVW
IORDWDEOH89UHVLVWDQW

Clip Stripe
No.: PU EAN Placement Size Content
Article

B34171 12 K18 - ø 1 mm x 30 m 2 pieces -


4 035300 915798

Packing twine, 3 pieces


7ULSOHWZLVWHGSRO\SURS\OHQHFRORXUIDVW89UHVLVWDQW
&RORXUV\HOORZEOXHUHG

Clip Stripe
No.: PU EAN Placement Size Content
Article

B34175 12 K18 - ø 1 mm x 50 m 3 Pieces -


4 035300 915835

160 Subjects to change without notice 09.2016


Ropes & Cords

Packing twine
7ULSOHWZLVWHGSRO\SURS\OHQHFRORXU
1DWXUHFRORXUIDVWIORDWDEOH89UHVLVWDQW

No.: PU EAN Placement Size Content Clip Stripe Article

B34051 12 K18 - ¡PP[P 1 Pieces -


4 035300 713196

B34050 12 K18 - ¡PP[P 1 Pieces -


4 035300 713189

Natural fibre netting


6LVDOWULSOHWZLVWHG89UHVLVWDQW

No.: PU EAN Placement Size Content Clip Stripe Article

B34173 12 K18 - ø 2 mm x 25 m 1 Pieces -


4 035300 915811

09.2016 Subjects to change without notice 161


Ropes & Cords

Packing twine
7ULSOHWZLVWHGSRO\SURS\OHQHFRORXUIDVW89UHVLVWDQW

Clip Stripe
No.: PU EAN Placement Size Content
Article

B34174 12 K18 - ø 2 mm x 30 m 1 Pieces -


4 035300 915828

Packing twine
7ULSOHWZLVWHGSRO\SURS\OHQHFRORXUIDVW89UHVLVWDQW

Clip Stripe
No.: PU EAN Placement Size Content
Article

B34172 12 K18 - ø 2 mm x 50 m 1 Pieces -


4 035300 915804

162 Subjects to change without notice 09.2016


Ropes & Cords

Packing twine, 3 pieces


7ULSOHWZLVWHGSRO\SURS\OHQHFRORXUIDVW89UHVLVWDQW

Clip Stripe
No.: PU EAN Placement Size Content
Article
¡PP[P
3
B34054 20 M20 - ¡PP[P -
4 035300 740628 Pieces
¡PP[P

Polypropylene twine
7ULSOHWZLVWHGSRO\SURS\OHQH89UHVLVWDQW

Clip Stripe
No.: PU EAN Placement Size Content
Article

B34177 12 M33 - ø 2 mm x 50 m 1 Pieces -


4 035300 915859

09.2016 Subjects to change without notice 163


Ropes & Cords

Polypropylene twine
WLPHVEUDLGHGSRO\SURS\OHQHFRORXUIDVW89UHVLVWDQW

Clip Stripe
No.: PU EAN Placement Size Content
Article

B34178 12 M33 - ø 1 mm x 100 m 1 Pieces -


4 035300 915866

Polypropylene twine
7ULSOHWZLVWHGSRO\SURS\OHQHFRORXUIDVW89UHVLVWDQW

Clip Stripe
No.: PU EAN Placement Size Content
Article

B34179 12 M33 - ø 1 mm x 125 m 1 Pieces -


4 035300 915873

164 Subjects to change without notice 09.2016


Ropes & Cords

Polypropylene twine, 3 pieces


7ULSOHWZLVWHGSRO\SURS\OHQHFRORXUIDVW89UHVLVWDQW
&RORXUV\HOORZZKLWHEOXH

Clip Stripe
No.: PU EAN Placement Size Content
Article

B34180 12 M33 - ø 1 mm x 50 m 3 Pieces -


4 035300 915880

Packing twine, 4 pieces


7ULSOHWZLVWHGSRO\SURS\OHQHFRORXUVJUHHQEOXHZKLWH
QDWXUDOFRORXUIDVW89UHVLVWDQW

No.: PU EAN Placement Size Content Clip Stripe Article

¡PP[P
¡PP[P
B34176 12 M33 - 4 Pieces -
4 035300 915842 ¡PP[P
¡PP[P

09.2016 Subjects to change without notice 165


Ropes & Cords

Universal polypropylene rope


7ULSOHWZLVWHGSRO\SURS\OHQHFRORXU2UDQJHFRORXUIDVW
IORDWDEOH89UHVLVWDQW

Clip Stripe
No.: PU EAN Placement Size Content
Article

B34081 12 M33 - ø 4 mm x 20 m 1 Pieces -


4 035300 717583

Universal polypropylene rope


7ULSOHWZLVWHGSRO\SURS\OHQHFRORXU2UDQJHFRORXUIDVW
IORDWDEOH89UHVLVWDQW

No.: PU EAN Placement Size Content Clip Stripe Article

B34082 12 M33 - ø 6 mm x 20 m 1 Pieces -


4 035300 717590

166 Subjects to change without notice 09.2016


Ropes & Cords

Universal polypropylene rope


7ULSOHWZLVWHGSRO\SURS\OHQHFRORXU2UDQJHFRORXUIDVW
IORDWDEOH89UHVLVWDQW

Clip Stripe
No.: PU EAN Placement Size Content
Article

B34083 12 M33 - ø 8 mm x 20 m 1 Pieces -


4 035300 717606

Sisal rope
7ULSOHWZLVWHG89UHVLVWDQWVWUHQJWKORVVZKHQNQRWWHG
DEUDVLRQUHVLVWDQFHYHU\JRRGHORQJDWLRQ
approx. 2-4%

No.: PU EAN Placement Size Content Clip Stripe Article

B34020 12 M28 - ø 4 mm x 20 m 1 Pieces -


4 035300 713080

09.2016 Subjects to change without notice 167


Ropes & Cords

Cotton rope
7ULSOHWZLVWHG89UHVLVWDQWVWUHQJWKORVVZKHQNQRWWHG
DEUDVLRQUHVLVWDQFHYHU\JRRGHORQJDWLRQ
approx. 2-4 %

Clip Stripe
No.: PU EAN Placement Size Content
Article

B34181 10 M44 - ø 5 mm x 50 m 1 Pieces -


4 035300 915897

Polypropylene rope, twisted


WLPHVWZLVWHG89UHVLVWDQWFRORXUIDVWIORDWDEOHVWUHQJWK
ORVVZKHQNQRWWHGDEUDVLRQUHVLVWDQFHYHU\JRRG
elongation approx. 14-24 %

Clip Stripe
No.: PU EAN Placement Size Content
Article

B34182 10 M44 - ø 6 mm x 30 m 1 Pieces -


4 035300 915903

168 Subjects to change without notice 09.2016


Ropes & Cords

Polypropylene rope
WLPHVWZLVWHG89UHVLVWDQWFRORXUIDVWIORDWDEOHVWUHQJWK
ORVVZKHQNQRWWHGDEUDVLRQUHVLVWDQFHYHU\JRRG
elongation approx. 14-24 %

Clip Stripe Ar-


No.: PU EAN Placement Size Content
ticle

B34183 8 M44 - ø 4 mm x 30 m 1 Pieces -


4 035300 915910

B34184 8 M44 - ø 6 mm x 30 m 1 Pieces -


4 035300 915927

B34185 8 M44 - ø 8 mm x 30 m 1 Pieces -


4 035300 915934

Polypropylene rope
WLPHVEUDLGHGSRO\SURS\OHQHZLWKUHIOHFWLYHILEUHV
FRORXUIDVWIORDWDEOH89UHVLVWDQW

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY2701854 5 M44 X ø 4 mm x 20 m 1 Pieces X


4 035300 915392

09.2016 Subjects to change without notice 169


Ropes & Cords

Polypropylene rope
WLPHVEUDLGHGZLWKUHIOHFWLYHILEUHVSRO\SURS\OHQH
FRORXUIDVWIORDWDEOH89UHVLVWDQW

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY2701855 5 M44 X ø 4 mm x 20 m 1 Pieces X


4 035300 915415

Polypropylene rope
WLPHVEUDLGHGSRO\SURS\OHQHZLWKIOXRUHVFHQWILEUHV
FRORXUIDVWIORDWDEOH89UHVLVWDQW

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY2701856 5 M44 X ø 4 mm x 20 m 1 Pieces X


4 035300 915422

170 Subjects to change without notice 09.2016


Ropes & Cords

Polypropylene rope
WLPHVEUDLGHGSRO\SURS\OHQHEOXHUHGZKLWHFRORXUIDVW
IORDWDEOH89UHVLVWDQW

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY2701713 3 M44 X ¡PP[P 1 Pieces X


4 035300 923670

Polypropylene rope, braided


WLPHVEUDLGHGSRO\SURS\OHQHFRORXUIDVWIORDWDEOH
UV-resistant

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY2701851 5 M44 X ø 3 mm x 20 m 1 Pieces X


4 035300 539703

09.2016 Subjects to change without notice 171


Ropes & Cords

Polypropylene rope
(1
WULSOHWZLVWHGSRO\SURS\OHQHFRORXUIDVWIORDWDEOH89
resistant

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY2701761 5 M44 X ø 6 mm x 20 m 1 Pieces X


4 035300 199433

Polypropylene rope
(1
WULSOHWZLVWHGSRO\SURS\OHQHFRORXUIDVWIORDWDEOH89
resistant

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY2701771 5 M44 X ø 8 mm x 15 m 1 Pieces X


4 035300 199440

172 Subjects to change without notice 09.2016


Ropes & Cords

Polyester rope
WLPHVEUDLGHGSRO\HVWHUFRORXUIDVWIORDWDEOH
UV-resistant

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY2702887 5 M44 X ¡PP[P 1 Pieces X


4 035300 923687

Sisal rope
7ULSOHWZLVWHGQDWXUDOILEUHVFRORXUQDWXUHFRORXUIDVW
UV-resistant

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY2701781 5 M44 X ø 5 mm x 20 m 1 Pieces X


4 035300 199457

09.2016 Subjects to change without notice 173


Ropes & Cords

Sisal rope
7ULSOHWZLVWHGQDWXUDOILEUHVFRORXUQDWXUHFRORXUIDVW
UV-resistant

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY2701791 5 M44 X ø 8 mm x 10 m 1 Pieces X


4 035300 199464

Clotheslines
:LWKSRO\SURS\OHQHFRUHSODVWLFFRDWHGDVVRUWHGLQGLIIHUHQW
FRORXUVFRORXUIDVW89UHVLVWDQW

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY2701451 12 M44 - ¡PP[P 1 Pieces X


4 035300 120857

DY2701461 6 M44 - ¡PP[P 1 Pieces X


4 035300 120864

174 Subjects to change without notice 09.2016


Ropes & Cords

Clotheslines
:LWKVWHHOZLUHLQVHUWVSODVWLFFRDWHGFRORXUIDVW
89UHVLVWDQWDVVRUWPHQWRIFRORXUV

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY2701481 12 M44 - ¡PP[P 1 Pieces X


4 035300 120888

DY2701491 6 M44 - ¡PP[P 1 Pieces X


4 035300 120895

Replacement clotheslines tensioner


For rotary dryers
0DWHULDOSODVWLFZLWKSRO\SURS\OHQHFRUHFRORXUIDVW
UV-resistant

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY2701581 5 M44 - ø 4 mm x 60 m 1 Pieces X


4 035300 120949

09.2016 Subjects to change without notice 175


Padlocks

Brass cylinder padlock


Brass
incl. 2 keys

No.: PU EAN Placement Size Content Clip Stripe Article

B34000 12 K10 X PP 1 Pieces X


4 035300 713011

B34001 12 K10 X 40 / 5 mm 1 Pieces X


4 035300 713028

B34002 12 K10 X 50 / 6 mm 1 Pieces X


4 035300 713035

Brass cylinder padlock, 40 mm


:LWKKLJKKDVSEUDVV
incl. 2 keys

Clip Stripe
No.: PU EAN Placement Size Content
Article

B34003 12 K10 X 40 / 63 / 5 mm 1 Pieces X


4 035300 713042

176 Subjects to change without notice 09.2016


Padlocks

Brass cylinder padlock set, 3 pieces


Brass
incl. 2 keys per lock

Clip Stripe
No.: PU EAN Placement Size Content
Article
25 / 4
B34007 12 K15 X  3 Pieces X
4 035300 740574
40 / 5 mm

Brass cylinder padlock set, 4 pieces


.H\HGDOLNHEUDVV
incl. 8 keys

Clip Stripe
No.: PU EAN Placement Size Content
Article

B34006 12 K15 X 40 / 5 mm 4 Pieces X


4 035300 740567

09.2016 Subjects to change without notice 177


Padlocks

Disc padlock, stainless steel


¡PPEROWGLDPHWHUDSSUR[PPVWDLQOHVVVWHHO
SROLVKHGZLWKNH\V

No.: PU EAN Placement Size Content Clip Stripe Article

B34063 10 K12 X 70 mm 1 Pieces X


4 035300 717484

Padlock, 30 mm
0DVVLYHJDOYDQL]HGPHWDOFRQVWUXFWLRQFRQGHQVDWLRQZDWHU
DQGGXVWUHSHOOHQWZDWHUSURRISODVWLFVKHDWKZLWKVSODVK
SURRIFRYHUF\OLQGHUFRUHPDGHRIVROLGEUDVVLQFOXGLQJ
3 keys

No.: PU EAN Placement Size Content Clip Stripe Article

B34217 6 K10 X 30 mm 1 Pieces X


4 035300 746606

178 Subjects to change without notice 09.2016


Padlocks

Padlock, 40 mm
0DVVLYHJDOYDQL]HGPHWDOFRQVWUXFWLRQFRQGHQVDWLRQZDWHU
DQGGXVWUHSHOOHQWZDWHUSURRISODVWLFVKHDWKZLWKVSODVK
SURRIFRYHUF\OLQGHUFRUHPDGHRIVROLGEUDVVLQFOXGLQJ
3 keys

No.: PU EAN Placement Size Content Clip Stripe Article

B34218 6 K10 X 40 mm 1 Pieces X


4 035300 746613

Padlock, 50 mm
0DVVLYHJDOYDQL]HGPHWDOFRQVWUXFWLRQFRQGHQVDWLRQZDWHU
DQGGXVWUHSHOOHQWZDWHUSURRISODVWLFVKHDWKZLWKVSODVK
SURRIFRYHUF\OLQGHUFRUHPDGHRIVROLGEUDVVLQFOXGLQJ
3 keys

No.: PU EAN Placement Size Content Clip Stripe Article

B34219 6 K10 X 50 mm 1 Pieces X


4 035300 746620

09.2016 Subjects to change without notice 179


Padlocks

Designer padlock, 30 mm
+DVSWKLFNQHVVPPLQFONH\V

No.: PU EAN Placement Size Content Clip Stripe Article

B34012 12 K10 X 30 mm 1 Pieces X


4 035300 915194

Designer padlock, 40 mm
+DVSWKLFNQHVVPPLQFONH\V

No.: PU EAN Placement Size Content Clip Stripe Article

B34013 12 K10 X 40 mm 1 Pieces X


4 035300 915200

180 Subjects to change without notice 09.2016


Padlocks

Designer padlock, 50 mm
+DVSWKLFNQHVVPPLQFONH\V

No.: PU EAN Placement Size Content Clip Stripe Article

B34014 12 K10 X 50 mm 1 Pieces X


4 035300 915217

Brass combination padlock


6ROLGEUDVVERG\FKURPHSODWHGKDVSVLPSOHFRPELQDWLRQ
setting using number wheels

Clip Stripe
No.: PU EAN Placement Size Content
Article

B34122 12 K15 X 29 x 3 mm 1 Pieces X


4 035300 746873

B34123 12 K15 X [PP 1 Pieces X


4 035300 746880

B34124 8 K8 X 41 x 5 mm 1 Pieces X
4 035300 746897

B34125 8 K8 X 49 x 5 mm 1 Pieces X
4 035300 746903

09.2016 Subjects to change without notice 181


Padlocks

Travel lock
ILJXUHFRPELQDWLRQFDQEHIUHHO\VHWFRORXUVLOYHU

No.: PU EAN Placement Size Content Clip Stripe Article

B34060 10 K8 X 60 x 22 mm 1 Pieces X
4 035300 717446

Travel lock
ILJXUHFRPELQDWLRQFDQEHIUHHO\VHWFRORXUEODFN

No.: PU EAN Placement Size Content Clip Stripe Article

B34061 10 K8 X 49 x 33 mm 1 Pieces X
4 035300 717453

Travel lock
ILJXUHFRPELQDWLRQFDQEHIUHHO\VHWFRORXUVLOYHU

No.: PU EAN Placement Size Content Clip Stripe Article

B34062 10 K8 X 49 x 33 mm 1 Pieces X
4 035300 717460

182 Subjects to change without notice 09.2016


Padlocks

TSA padlock
:LWKILJXUHFRPELQDWLRQWRVHFXUH\RXUOXJJDJHRQWULSV
WRWKH8686VHFXULW\VWDIIFDQRSHQWKHJHQHUDOORFN
ZLWKRXWGDPDJLQJWKHORFNLQRUGHUWRIDFLOLWDWHFRQWURODQG
save time

No.: PU EAN Placement Size Content Clip Stripe Article

B34073 10 K11 X 65 x 32 mm 1 Pieces X


4 035300 735884

09.2016 Subjects to change without notice 183


Furniture glides

Felt glides assortment box, self-adhesive, 275 pieces


3URWHFWGHOLFDWHVXUIDFHVLQDSUDFWLFDOSODVWLFVWRUDJHFDVH
Contents:
• Brown felt pads
25 pieces 20 x 20 mm
• Brown felt pads
20 pieces 25 x 25 mm
• Brown felt pads
24 pieces 30 x 30 mm
• White felt pads
25 pieces 20 x 20 mm
• White felt pads
20 pieces 25 x 25 mm
• White felt pads
15 pieces 30 x 30 mm
• White felt pads
8 pieces ø 30 mm
• White felt pads
30 pieces ø 20 mm
• White felt pads
25 pieces ø 25 mm
• Brown felt pads
30 pieces ø 20 mm
• Brown felt pads
25 pieces ø 25 mm
• Brown felt pads
28 pieces ø 30 mm
• Material: polypropylene

No.: PU EAN Placement Clip Stripe Article

B34140 6 M28 - -
4 035300 746927

184 Subjects to change without notice 09.2016


Furniture glides

Felt glides assortment box, self-adhesive, 272 pieces


Protects delicate surfaces
3UDFWLFDOUHXVDEOHDVVRUWPHQWER[
Contents:
• White felt pads
24 pieces ø 15 mm
• Grey felt pads
24 pieces ø 15 mm
• White felt pads
48 pieces ø 20 mm
• White skid stops
40 pieces ø 15 mm
• White skid stops
16 pieces ø 25 mm
• White skid stops
6 pieces ø 38 mm
• Skid stops
50 pieces 9 x 21 mm
• Black skid stops
20 pieces 20 x 20 mm
• White skid stops
18 pieces 25 x 25 mm
• White impact stops
3 pieces ø 40 mm
• Black impact stops
3 pieces ø 40 mm
• Red felt pads
10 pieces 40 x 90 mm
• Green felt pads
10 pieces 40 x 90 mm

No.: PU EAN Placement Clip Stripe Article

DY200809 10 M31 - -
4 035300 894000

09.2016 Subjects to change without notice 185


Furniture glides

Felt glides assortment box, self-adhesive, 122 pieces


Protects delicate surfaces
3UDFWLFDOUHXVDEOHDVVRUWPHQWER[
Contents:
‡)HOWSDGEURZQ
32 pieces ø 15 mm
‡)HOWSDGZKLWH
18 pieces ø 20 mm
‡)HOWSDGEURZQ
8 pieces ø 25 mm
• Skid stop
16 pieces ø 15 mm
• Skid stop
12 pieces ø 25 mm
• Skid stop
30 pieces 9 x 21 mm
• Plastic slides
6 pieces ø 25 mm

No.: PU EAN Placement Clip Stripe Article

DY200810 10 M31 - -
4 035300 894017

186 Subjects to change without notice 09.2016


Furniture glides

Assortment of felt pads with pin, 32 pieces


Protects delicate surfaces
3UDFWLFDOUHXVDEOHDVVRUWPHQWER[
Contents:
• Metal slide with pin
6 pieces ø 18 mm
• Metal slide with pin
8 pieces ø 22 mm
• Metal slide with pin
4 pieces ø 30 mm
• Felt pad with pin
6 pieces ø 20 mm
• Felt pad with pin
6 pieces ø 25 mm
• Felt pad with pin
6 pieces ø 30 mm

No.: PU EAN Placement Clip Stripe Article

DY200811 10 M31 - -
4 035300 894024

Felt glides assortment box, self-adhesive


104 self-adhesive felt glides
Pieces Size
96 ø 22 mm
8 ø 28 mm

No.: PU EAN Placement Clip Stripe Article

DY200700 24 M24 X X
4 035300 877355

09.2016 Subjects to change without notice 187


Furniture glides

Felt glides assortment box, self-adhesive


131 self-adhesive felt glides
Pieces Size A
32 ø 10 mm
36 ø 15 mm
54 ø 20 mm
8 ø 38 mm
1 200 x 200 mm

No.: PU EAN Placement Clip Stripe Article

DY200701 24 M44 X X
4 035300 877379

Assorted felt pads with pin


20 pin-type felt glides
Pieces Size
16 ø 22 mm
4 ø 28 mm

No.: PU EAN Placement Clip Stripe Article

DY200702 24 K29 X X
4 035300 877386

188 Subjects to change without notice 09.2016


Furniture glides

Felt strips, white


VHOIDGKHVLYHIHOWVWULSVFDQEHLQGLYLGXDOO\FXWWRVL]H

No.: PU EAN Placement Clip Stripe Article

DY200703 24 M24 X X
4 035300 877393

Felt strips, brown


VHOIDGKHVLYHIHOWVWULSVFDQEHLQGLYLGXDOO\FXWWRVL]H

No.: PU EAN Placement Clip Stripe Article

DY200704 24 M24 X X
4 035300 877409

09.2016 Subjects to change without notice 189


Cargo securing

Luggage belt with carabiner hook


3RO\SURS\OHQHDOXPLQLXP7h9*6WHVWHG

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY270651 6 M25 X ø 8 x 600 mm 2 Pieces X


4 035300 899999

DY270652 6 M25 X ø 8 x 800 mm 2 Pieces X


4 035300 900008

DY270653 6 M25 X ø 8 x 1000 mm 2 Pieces X


4 035300 000012

DY270654 6 M25 X ø 8 x 1200 mm 2 Pieces X


4 035300 000029

DY270655 6 M25 X ø 8 x 1500 mm 2 Pieces X


4 035300 000036

Luggage belt with steel hooks


)ODWVWUDSVWDEOHSODVWLFFRDWHGVWHHOKRRNVSRO\SURS\OHQH
7h9*6DSSURYHG

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY270656 6 M25 X 20 x 700 mm 2 Pieces X


4 035300 000043

DY270657 6 M25 X 20 x 1250 mm 2 Pieces X


4 035300 000050

190 Subjects to change without notice 09.2016


Cargo securing

Luggage clamps, with adjustable plastic hooks


$GMXVWDEOHOHQJWKVWXUG\SODVWLFKRRNSRO\SURS\OHQH
7h9*6DSSURYHG

No.: PU EAN Placement Size Content Clip Stripe Article

B34077 8 M21 X ø 8 x 800 mm 1 Pieces X


4 035300 717545

Tensioner set, with large steel hook rotatable by 360°


:LWKODUJHURWDWDEOHVWHHOKRRNƒDGMXVWDEOHOHQJWKV
1 7HQVLOHIRUFH1aNJFRORXUDVVRUWPHQW
polypropylene

Clip Stripe
No.: PU EAN Placement Size Content
Article
400-600 mm
DY270662 6 M21 X 550-800 mm 3 Pieces X
4 035300 915644
700-1200 mm

09.2016 Subjects to change without notice 191


Cargo securing

Luggage belt
3ODVWLFFRDWHGKRRNVSRO\SURS\OHQH7h9*6WHVWHG

Clip Stripe
No.: PU EAN Placement Size Content
Article

B34075 10 M21 X ø 8 x 600 mm 2 Pieces X


4 035300 717521

B34076 10 M21 X ø 8 x 750 mm 2 Pieces X


4 035300 717538

Luggage belt
3ODVWLFFRDWHGKRRNVSRO\SURS\OHQH7h9*6WHVWHG

Clip Stripe
No.: PU EAN Placement Size Content
Article

B34407 10 K26 X ø 10 x 1000 mm 1 Pieces X


4 004722 619003

192 Subjects to change without notice 09.2016


Cargo securing

Luggage belt set, 6 pieces


3ODVWLFFRYHUHGKRRNSRO\SURS\OHQH7h9*6WHVWHG
Contents:
2 pcs. 8 ø x 600 mm
2 pcs. 8 ø x 800 mm
2 pcs. 8 ø x 1000 mm

No.: PU EAN Placement Content Clip Stripe Article

B34078 8 M21 X 6 Pieces X


4 035300 717552

Luggage belt set, 10 pieces


3RO\SURS\OHQH7h9*6WHVWHG
Contents:
2 pcs. ø 4.0 x 250 mm
2 pcs. ø 8.0 x 450 mm
2 pcs. ø 8.0 x 500 mm
2 pcs. ø 8.0 x 600 mm
2 pcs. ø 8.0 x 750 mm

No.: PU EAN Placement Content Clip Stripe Article

DY270616 10 D56 - 10 Pieces -


4 035300 876969

09.2016 Subjects to change without notice 193


Cargo securing

Luggage spider
DUPHGSODVWLFFRDWHGKRRNVSRO\SURS\OHQH
7h9*6WHVWHG

No.: PU EAN Placement Size Content Clip Stripe Article

B34040 6 K26 X ø 8 x 750 mm 1 Pieces X


4 035300 713158

B34041 6 K26 X ø 8 x 900 mm 1 Pieces X


4 035300 713165

Tarpaulin tensioner, with ball


3RO\SURS\OHQH7h9*6WHVWHG

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY270650 8 K26 X ø 4 x 250 mm 10 Pieces X


4 035300 000067

194 Subjects to change without notice 09.2016


Cargo securing

Tarpaulin tensioner, adjustable, with ball


/HQJWKDGMXVWDEOHVWDEOHSODVWLFKRRNVZLWKVDIHW\FDWFK
3RO\SURS\OHQH7h9*6WHVWHG

No.: PU EAN Placement Size Content Clip Stripe Article

B34042 4 M32 X Ø 8 x 600 mm 8 Pieces X


4 035300 759200

Clamping hook set for trailer nets , 10 pieces


3ODVWLFFRYHUHGKRRNEODFNSRO\SURS\OHQH

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY270612 6 K26 X ø 6 x 180 mm 10 Pieces X


4 035300 889914

09.2016 Subjects to change without notice 195


Cargo securing

One-piece load restraint assembly with clamping lock


EN 12195-2
/& ODVKLQJFDSDFLW\GD1aNJPD[ODVKLQJVWUDS
H[SDQVLRQLV3RO\SURS\OHQHVHZQLQODEHOZLWK
LQIRUPDWLRQDQGVSHFLILFDWLRQV7h9*6WHVWHGVL]H6

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY270554 6 K26 X P[PP 1 Pieces X


4 035300 223282

One-piece load restraint assembly with clamping lock


EN 12195-2
/& ODVKLQJFDSDFLW\GD1aNJPD[ODVKLQJVWUDS
H[SDQVLRQVHZQLQODEHOZLWKLQIRUPDWLRQDQG
VSHFLILFDWLRQV3RO\SURS\OHQH7h9*6WHVWHG6L]H6

No.: PU EAN Placement Size Content Clip Stripe Article

B34408 8 K20 X 5 m x 25 mm 1 Pieces X


4 035300 724864

196 Subjects to change without notice 09.2016


Cargo securing

One-piece load restraint assembly with ratchet tensioner


EN12195-2
/& /DVKLQJFDSDFLW\GD1aNJ 67) 6WDQGDUGWHQVLRQ
IRUFHGD1aNJ 6+) 6WDQGDUGKDQGIRUFHGD1aNJ
PD[ODVKLQJVWUDSH[SDQVLRQLVSRO\SURS\OHQHVHZQ
LQODEHOZLWKLQIRUPDWLRQDQGVSHFLILFDWLRQV7h9*6WHVWHG
size S

No.: PU EAN Placement Size Content Clip Stripe Article

DY270555 6 K26 X P[ 1 Pieces X


4 035300 223299

Two-piece load restraint assembly with ratchet tensioner


and S-hook
EN 12195-2
/& /RDGFDSDFLW\VWUDLJKWOLQHWHQVLRQGD1aNJ /& 
/RDGFDSDFLW\LQVWUDSSLQJGD1aNJ 67) 6WDQGDUG
WHQVLRQIRUFHGD1aNJ 6+) 6WDQGDUGKDQGIRUFH
GD1aNJPD[ODVKLQJVWUDSH[SDQVLRQLV
SRO\SURS\OHQH6HZQLQODEHOZLWKLQIRUPDWLRQDQG
VSHFLILFDWLRQV7h9*6WHVWHG6L]H6

Clip Stripe
No.: PU EAN Placement Size Content
Article

B34405 6 K26 X P[PP 1 Pieces X


4 004722 618976

09.2016 Subjects to change without notice 197


Cargo securing

One-piece load restraint assembly with ratchet tensioner


EN12195-2
/& /DVKLQJFDSDFLW\GD1aNJ 67) 6WDQGDUGWHQVLRQ
IRUFHGD1aNJ 6+) 6WDQGDUGKDQGIRUFHGD1aNJ
PD[ODVKLQJVWUDSH[SDQVLRQLVSRO\SURS\OHQHVHZQ
LQODEHOZLWKLQIRUPDWLRQDQGVSHFLILFDWLRQV7h9*6WHVWHG
size S

No.: PU EAN Placement Size Content Clip Stripe Article

B34403 6 K26 X 5 m x 25 mm 1 Pieces X


4 004722 392050

Two-piece load restraint assembly with ratchet tensioner


and S-hook
EN 12195-2
/& /RDGFDSDFLW\VWUDLJKWOLQHWHQVLRQGD1aNJ
/& /DVKLQJFDSDFLW\N1aNJ 67) 6WDQGDUGWHQVLRQ
IRUFHGD1aNJ 6+) 6WDQGDUGKDQGIRUFHGD1aNJ
PD[ODVKLQJVWUDSH[SDQVLRQLVVHZQLQODEHOZLWK
LQIRUPDWLRQDQGVSHFLILFDWLRQVSRO\HVWHU7h9*6WHVWHG
size M

:KHQRYHULWHPVRUGHUHGWKLVLVDOVRDYDLODEOH
with the customer‘s logo

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY270630 4 M22 X 4 m x 25 mm 1 Pieces X


4 035300 709052

198 Subjects to change without notice 09.2016


Cargo securing

One-piece load restraint assembly with ratchet tensioner


EN 12195-2
/& /DVKLQJFDSDFLW\N1aNJ 67) 6WDQGDUGWHQVLRQ
IRUFHGD1aNJ 6+) 6WDQGDUGKDQGIRUFHGD1aNJ
PD[ODVKLQJVWUDSH[SDQVLRQLV
VHZQLQODEHOZLWKLQIRUPDWLRQDQGVSHFLILFDWLRQV
SRO\HVWHU7h9*6WHVWHGVL]H0

:KHQRYHULWHPVRUGHUHGWKLVLVDOVRDYDLODEOHZLWKWKH
customer‘s logo

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY270601 4 M22 X 5 m x 25 1 Pieces X


4 035300 378579

Two-piece load restraint assembly with ratchet tensioner


and claw hook
EN 12195-2
/& /RDGFDSDFLW\VWUDLJKWOLQHWHQVLRQGD1aNJ
/& /DVKLQJFDSDFLW\N1aNJ
67) 6WDQGDUGWHQVLRQIRUFHGD1 6+) 6WDQGDUG
KDQGIRUFHGD1aNJ0D[ODVKLQJVWUDSH[SDQVLRQLV
6HZQLQODEHOZLWKLQIRUPDWLRQDQGVSHFLILFDWLRQV
SRO\HVWHU7h9*6WHVWHGVL]H0

:KHQRYHULWHPVRUGHUHGWKLVLVDOVRDYDLODEOHZLWKWKH
customer‘s logo

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY270604 4 M22 X 5 m x 25 mm 1 Pieces X


4 035300 378586

09.2016 Subjects to change without notice 199


Cargo securing

One-piece load restraint assembly with ratchet tensioner


EN 12195-2
/RDGLQJFDSDFLW\RIVWUDSSLQJN1aNJ 67) VWDQGDUG
WHQVLRQIRUFHGD1aNJ 6+) VWDQGDUGKDQGIRUFH
GD1aNJVHZQLQODEHOZLWKLQIRUPDWLRQDQG
VSHFLILFDWLRQVSRO\HVWHU7h9*6WHVWHGVL]H0

No.: PU EAN Placement Size Content Clip Stripe Article

B34410 3 M31 - 5 m x 25 mm 1 Pieces -


4 035300 736867

Two-piece load restraint assembly with ratchet tensioner


and claw hook
EN 12195-2
/& /RDGFDSDFLW\VWUDLJKWOLQHWHQVLRQN1aNJ
/& /DVKLQJFDSDFLW\N1aNJ
67) 6WDQGDUGWHQVLRQIRUFHGD1aNJ
6+) 6WDQGDUGKDQGIRUFHGD1aNJPD[ODVKLQJVWUDS
H[SDQVLRQLVRSHUDWLQJLQVWUXFWLRQVLQGLIIHUHQW
ODQJXDJHVSRO\HVWHU7h9*6WHVWHGVL]H0

No.: PU EAN Placement Size Content Clip Stripe Article

B34415 3 M24 - 5 m x 25 mm 1 Pieces -


4 035300 736911

200 Subjects to change without notice 09.2016


Cargo securing

One-piece load restraint assembly with ratchet tensioner


EN 12195-2
/& /DVKLQJFDSDFLW\N1aNJ
67) 6WDQGDUGWHQVLRQIRUFHGD1aNJ 6+) 6WDQGDUG
KDQGIRUFHGD1aNJPD[ODVKLQJVWUDSH[SDQVLRQLV
VHZQLQODEHOZLWKLQIRUPDWLRQDQGVSHFLILFDWLRQV
SRO\HVWHU7h9*6WHVWHGVL]H/

Clip Stripe
No.: PU EAN Placement Size Content
Article

B34419 3 M36 - 5 m x 38 mm 1 Pieces -


4 035300 750283

Two-piece load restraint with soft touch ratchet tensio-


ner and claw hooks
EN 12195-2
/RFNDEOH /& /RDGFDSDFLW\VWUDLJKWOLQHWHQVLRQN1a
NJ /& /DVKLQJFDSDFLW\N1aNJ
67) 6WDQGDUGWHQVLRQIRUFHGD1aNJ 6+) 6WDQGDUG
KDQGIRUFHGD1aNJPD[ODVKLQJVWUDSH[SDQVLRQLV
VHZQLQODEHOZLWKLQIRUPDWLRQDQGVSHFLILFDWLRQV
SRO\HVWHU7h9*6WHVWHGVL]H/

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY270664 3 M36 - 5 m x 38 mm 1 Pieces -


4 035300 916511

09.2016 Subjects to change without notice 201


Cargo securing

Two-piece load restraint assembly with ratchet tensioner


and claw hook
EN 12195-2
/& /RDGFDSDFLW\VWUDLJKWOLQHWHQVLRQN1aNJ
/& /DVKLQJFDSDFLW\N1aNJ
67) 6WDQGDUGWHQVLRQIRUFHGD1aNJ 6+) 6WDQGDUG
KDQGIRUFHGD1aNJPD[ODVKLQJVWUDSH[SDQVLRQLV
VHZQLQODEHOZLWKLQIRUPDWLRQDQGVSHFLILFDWLRQV
SRO\HVWHU7h9*6WHVWHGVL]H/

Clip Stripe
No.: PU EAN Placement Size Content
Article

B34416 3 G27 - 6 m x 38 mm 1 Pieces -


4 035300 736928

One-piece load restraint assembly with ratchet tensioner


EN 12195-2
(LC) Lashing capacity: 30 kN ~ 3000 kg:
67) 6WDQGDUGWHQVLRQIRUFHGD1aNJ 6+) 6WDQGDUG
KDQGIRUFHGD1aNJPD[ODVKLQJVWUDSH[SDQVLRQ
LVVHZQLQODEHOZLWKLQIRUPDWLRQDQGVSHFLILFDWLRQV
SRO\HVWHU7h9*6WHVWHGVL]H/

:KHQRYHULWHPVRUGHUHGWKLVLVDOVRDYDLODEOHZLWKWKH
customer‘s logo

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY270603 2 G39 - 8 m x 38 mm 1 Pieces -


4 035300 378616

202 Subjects to change without notice 09.2016


Cargo securing

Two-piece load restraint assembly with ratchet tensioner


and claw hook
EN 12195-2
/& /RDGFDSDFLW\VWUDLJKWOLQHWHQVLRQN1aNJ
/& /DVKLQJFDSDFLW\N1aNJ
67) 6WDQGDUGWHQVLRQIRUFHGD1aNJ 6+) 6WDQGDUG
KDQGIRUFHGD1aNJVHZQLQODEHOZLWKLQIRUPDWLRQDQG
VSHFLILFDWLRQV3RO\HVWHU0D[ODVKLQJVWUDSH[SDQVLRQLV
7h9*6WHVWHGVL]H/

:KHQRYHULWHPVRUGHUHGWKLVLVDOVRDYDLODEOHZLWKWKH
customer‘s logo

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY270606 2 G39 - 8 m x 38 mm 1 Pieces -


4 035300 378623

One-piece load restraint assembly with ratchet tensioner


EN 12195- 2
/& /DVKLQJFDSDFLW\N1aNJ
67) 6WDQGDUGWHQVLRQIRUFHGD1aNJ 6+) 6WDQGDUG
KDQGIRUFHGD1aNJPD[ODVKLQJVWUDSH[SDQVLRQLV
VHZQLQODEHOZLWKLQIRUPDWLRQDQGVSHFLILFDWLRQV
3RO\HVWHU7h9*6WHVWHGVL]H;/

:KHQRYHULWHPVRUGHUHGWKLVLVDOVRDYDLODEOHZLWKWKH
customer‘s logo

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY270636 2 G39 - 8 m x 50 mm 1 Pieces -


4 035300 905836

09.2016 Subjects to change without notice 203


Cargo securing

Two-piece load restraint assembly with ratchet tensioner


and claw hook
EN 12195-2
(LC) Load capacity straight line tension: 20 kN ~ 2000kg:
/& /DVKLQJFDSDFLW\N1aNJ 67) 6WDQGDUG
WHQVLRQIRUFHGD1aNJ 6+) 6WDQGDUGKDQGIRUFH
GD1aNJVHZQLQODEHOZLWKLQIRUPDWLRQDQGVSHFLILFDWLRQV
SRO\HVWHU7h9*6WHVWHGVL]H;/

:KHQRYHULWHPVRUGHUHGWKLVLVDOVRDYDLODEOHZLWKWKH
customer‘s logo

Clip Stripe
No.: PU EAN Placement Size Content
Article

B34412 2 G39 - 8 m x 50 mm 1 Pieces -


4 035300 736881

Two-piece load restraint with tension ratchet and carabi-


ner hooks
EN 12195-2
/& /RDGFDSDFLW\VWUDLJKWOLQHWHQVLRQN1aNJ
/& /DVKLQJFDSDFLW\N1aNJ
67) 6WDQGDUGWHQVLRQIRUFHGD1aNJ 6+) 6WDQGDUG
KDQGIRUFHGD1aNJPD[ODVKLQJVWUDSH[SDQVLRQLV
VHZQLQODEHOZLWKLQIRUPDWLRQDQGVSHFLILFDWLRQV
SRO\HVWHU7h9*6WHVWHGVL]H;/

:KHQRYHULWHPVRUGHUHGWKLVLVDOVRDYDLODEOHZLWKWKH
customer‘s logo

No.: PU EAN Placement Size Content Clip Stripe Article

B34417 2 G39 - 8 m x 50 mm 1 Pieces -


4 035300 736935

204 Subjects to change without notice 09.2016


Cargo securing

Two-piece load restraint assembly with ratchet tensioner


and claw hook
EN 12195-2
/& /RDGFDSDFLW\VWUDLJKWOLQHWHQVLRQN1aNJ
/& /DVKLQJFDSDFLW\N1aNJ
67) 6WDQGDUGWHQVLRQIRUFHGD1aNJ 6+) 6WDQGDUG
KDQGIRUFHGD1aNJPD[ODVKLQJVWUDSH[SDQVLRQLV
VHZQLQODEHOZLWKLQIRUPDWLRQDQGVSHFLILFDWLRQV
SRO\HVWHU7h9*6WHVWHGVL]H;/

:KHQRYHULWHPVRUGHUHGWKLVLVDOVRDYDLODEOHZLWKWKH
customer‘s logo

No.: PU EAN Placement Size Content Clip Stripe Article

B34413 2 G47 - 12 m x 50 mm 1 Pieces -


4 035300 736898

Two-piece load restraint assembly with ratchet tensioner


and claw hook
EN 12195-2
(LC) Load capacity straight line tension: 25 kN ~ 2500kg:
/& /DVKLQJFDSDFLW\N1aNJ
67) 6WDQGDUGWHQVLRQIRUFHGD1aNJ 6+) 6WDQGDUG
KDQGIRUFHGD1aNJPD[ODVKLQJVWUDSH[SDQVLRQLV
VHZQLQODEHOZLWKLQIRUPDWLRQDQGVSHFLILFDWLRQV
SRO\HVWHU7h9*6WHVWHGVL]H;/

:KHQRYHULWHPVRUGHUHGWKLVLVDOVRDYDLODEOHZLWKWKH
customer‘s logo

No.: PU EAN Placement Size Content Clip Stripe Article

B34414 2 G39 - 8 m x 50 mm 1 Pieces -


4 035300 736904

09.2016 Subjects to change without notice 205


Cargo securing

Two-piece load restraint with large ratchet tensioner and


claw hooks
EN 12195-2
/& /RDGFDSDFLW\VWUDLJKWOLQHWHQVLRQN1aNJ
/& /DVKLQJFDSDFLW\N1aNJ
67) 6WDQGDUGWHQVLRQIRUFHGD1aNJ 6+) 6WDQGDUG
KDQGIRUFHGD1aNJPD[ODVKLQJVWUDSH[SDQVLRQLV
VHZQLQODEHOZLWKLQIRUPDWLRQDQGVSHFLILFDWLRQV
SRO\HVWHU7h9*6WHVWHGVL]H;/

:KHQRYHULWHPVRUGHUHGWKLVLVDOVRDYDLODEOHZLWKWKH
customer‘s logo

No.: PU EAN Placement Size Content Clip Stripe Article

B34418 2 G39 - 8 m x 50 mm 1 Pieces -


4 035300 736942

Two-piece load restraint with four-piece ratchet tensio-


ner and S-hooks
EN 12195-2
/& /RDGFDSDFLW\VWUDLJKWOLQHWHQVLRQGD1aNJ
/& /DVKLQJFDSDFLW\N1aNJ
67) 6WDQGDUGWHQVLRQIRUFHGD1aNJ 6+) 6WDQGDUG
KDQGIRUFHGD1aNJPD[PD[ODVKLQJVWUDS
H[SDQVLRQLVSRO\HVWHU6HZQLQODEHOZLWKLQIRUPDWLRQ
DQGVSHFLILFDWLRQ7h9*6WHVWHGVL]H0

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY270643 2 M53 X P[PP 4 Pieces -


4 035300 876976

206 Subjects to change without notice 09.2016


Cargo securing

One-piece lashing strap with tension ratchet, pointed


hook and automatic retraction
EN 12195- 2
$XWRPDWLFUHWUDFWLRQ /& /RDGFDSDFLW\VWUDLJKWOLQH
WHQVLRQGD1aNJ /& /DVKLQJFDSDFLW\N1a
NJ 67) 6WDQGDUGWHQVLRQIRUFHGD1aNJ 6+) 
6WDQGDUGKDQGIRUFHGD1aNJ
PD[ODVKLQJVWUDSH[SDQVLRQLVVHZQLQODEHOZLWK
LQIRUPDWLRQDQGVSHFLILFDWLRQVSRO\HVWHU7h9*6WHVWHG
size M

No.: PU EAN Placement Size Content Clip Stripe Article

DY270623 2 G47 X 3 m x 25 mm 1 Pieces -


4 035300 877416

One-piece lashing strap with tension ratchet, pointed


hook and automatic retraction
EN 12195- 2
$XWRPDWLFUHWUDFWLRQ /& /RDGFDSDFLW\VWUDLJKWOLQH
WHQVLRQN1aNJ /& /DVKLQJFDSDFLW\N1a
NJ 67) 6WDQGDUGWHQVLRQIRUFHGD1aNJ 6+) 
6WDQGDUGKDQGIRUFHGD1aNJ
PD[ODVKLQJVWUDSH[SDQVLRQLVVHZQLQODEHOZLWK
LQIRUPDWLRQDQGVSHFLILFDWLRQVSRO\HVWHU7h9*6WHVWHG
size M

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY270624 2 G47 X 3 m x 50 mm 1 Pieces -


4 035300 877423

09.2016 Subjects to change without notice 207


Cargo securing

Luggage compartment holding strap


EN 12195-2
:LWKFODPSVQDSKRRNDQG'ULQJ
0D[ODVKLQJVWUDSH[WHQVLRQLV /& /RDGFDSDFLW\
GD1aNJSRO\HVWHU

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY270665 5 K26 X 2 m x 25 mm 1 Pieces X


4 035300 916528

Load securing set


Contents:
‡ODVKLQJVWUDSVZLWK6KRRNVP[PP
 /& ORDGFDSDFLW\GD1aNJ
(LC) Lashing capacity 5 kN ~ kg
• 2 lashing straps one-piece with clamping buckle
P[PP
(LC) Lashing capacity 250 daN ~ kg
‡OXJJDJHEHOWV¡[PP
tensile force (N) 70N ~ 7 kg
‡OXJJDJHEHOWV¡[PP
tensile force (N) 70N ~ 7 kg
‡7h9*66GWHVWHG
• Packed in a reusable bag

No.: PU EAN Placement Content Clip Stripe Article

DY270644 5 G39 - 8 Pieces X


4 035300 915347

208 Subjects to change without notice 09.2016


Cargo securing

Belt and edge protection


Protects the belts against damages. Material: PVC

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY270633 6 M15 X 35 x 500 mm 1 Pieces X


4 035300 709106

DY270634 6 M15 X 50 x 500 mm 1 Pieces X


4 035300 709113

Edge protector
)RUEHOWZLGWKVXSWRPPSURWHFWVWKHORDGIURPGDPDJH
material: polypropylene

No.: PU EAN Placement Content Clip Stripe Article

DY270637 5 K26 X 4 Pieces X


4 035300 915323

09.2016 Subjects to change without notice 209


Cargo securing

Edge protector
)RUEHOWZLGWKVXSWRPPSURWHFWVWKHORDGIURPGDPDJH
material: polystyrene

No.: PU EAN Placement Content Clip Stripe Article

DY270638 5 K26 - 1 Pieces -


4 035300 915330

Anti-slip mat
They reduce the total pretensioning forces when lowering
loads between goods to be transported and the loading area
DQGWRJHWKHUZLWKODVKLQJVWUDSVRURWKHUORDGVHFXULQJ
GHYLFHVHQVXUHDILUPKROGRIWKHORDGPDWHULDOJUDQXODWH

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY270635 6 D28 X 180 x 120 x 8 mm 1 Pieces X


4 035300 709120

210 Subjects to change without notice 09.2016


Cargo securing

CONNEX warning flag


:LWKH\HOHWZLWK&211(;SULQW

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY270613 20 M32 - 300 x 300 mm 1 Pieces X


4 035300 901494

Round slings
EN 1492-1/2
3RO\HVWHUSRO\HVWHU\DUQFRUH6WUDSSLQJORDGVXSWR :// 
NJVHZQLQODEHOZLWKLQIRUPDWLRQDQGVSHFLILFDWLRQ
7h9*6WHVWHG

No.: PU EAN Placement Size Content Clip Stripe Article

B34420 6 G47 - 2 m x 40 mm 1 Pieces -


4 035300 746576

B34421 4 G47 - 4 m x 40 mm 1 Pieces -


4 035300 746637

09.2016 Subjects to change without notice 211


Cargo securing

Round slings
EN 1492-1/2
3RO\HVWHUSRO\HVWHU\DUQFRUH6WUDSSLQJORDGVXSWR :// 
NJVHZQLQODEHOZLWKLQIRUPDWLRQDQGVSHFLILFDWLRQ
7h9*6WHVWHG

No.: PU EAN Placement Size Content Clip Stripe Article

B34422 4 G47 - 2 m x 50 mm 1 Pieces -


4 035300 746644

B34423 2 G47 - 4 m x 50 mm 1 Pieces -


4 035300 746651

Round slings
EN 1492-1/2
3RO\HVWHUSRO\HVWHU\DUQFRUH6WUDSSLQJORDGVXSWR :// 
NJVHZQLQODEHOZLWKLQIRUPDWLRQDQGVSHFLILFDWLRQ
7h9*6WHVWHG

No.: PU EAN Placement Size Content Clip Stripe Article

B34424 2 G47 - 2 m x 60 mm 1 Pieces -


4 035300 746668

B34425 2 G47 - 4 m x 60 mm 1 Pieces -


4 035300 746675

212 Subjects to change without notice 09.2016


Cargo securing

Lifting belts
EN 1492-1/2
3RO\HVWHUSRO\HVWHU\DUQFRUH6WUDSSLQJORDGVXSWR :// 
NJVHZQLQODEHOZLWKLQIRUPDWLRQDQGVSHFLILFDWLRQ
7h9*6WHVWHG

Clip Stripe
No.: PU EAN Placement Size Content
Article

B34440 6 G47 - 2 m x 30 mm 1 Pieces -


4 035300 746682

B34441 4 G47 - 4 m x 30 mm 1 Pieces -


4 035300 746699

Lifting belts
EN 1492-1/2
3RO\HVWHUSRO\HVWHU\DUQFRUH6WUDSSLQJORDGVXSWR :// 
NJVHZQLQODEHOZLWKLQIRUPDWLRQDQGVSHFLILFDWLRQ
7h9*6WHVWHG

Clip Stripe
No.: PU EAN Placement Size Content
Article

B34442 2 G47 - 2 m x 60 mm 1 Pieces -


4 035300 746705

B34443 2 G47 - 4 m x 60 mm 1 Pieces -


4 035300 746712

09.2016 Subjects to change without notice 213


Cargo securing

Lifting belts
EN 1492-1/2
3RO\HVWHUSRO\HVWHU\DUQFRUH6WUDSSLQJORDGVXSWR :// 
NJVHZQLQODEHOZLWKLQIRUPDWLRQDQGVSHFLILFDWLRQ
7h9*6WHVWHG

No.: PU EAN Placement Size Content Clip Stripe Article

B34444 2 G47 - 2 m x 90 mm 1 Pieces -


4 035300 746729

B34445 2 G47 - 4 m x 90 mm 1 Pieces -


4 035300 746736

Luggage compartment netting


For securing luggage
:LWKFDUDELQHUKRRNDQGVXUURXQGLQJHODVWLFFRUG
Material: Polypropylene

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY270639 5 M31 X 700 x 900 m 1 Pieces X


4 035300 915149

214 Subjects to change without notice 09.2016


Cargo securing

Trailer net
.QRWWHG7KUHDGVL]HPP0DFKLQHZLGWK
PP[PP%UHDNLQJVWUHQJWKSHUPDFKLQHNJ
HQFLUFOLQJHODVWLFFRUGIRUDWWDFKPHQW WKLFNPP 
ZHDWKHUUHVLVWDQW0DGHRIUHF\FODEOHSRO\HWK\OHQH
packaged in a reusable bag

Clip Stripe
No.: PU EAN Placement Size Content
Article

B34067 3 G33 - 1400 x 2500 mm 1 Pieces -


4 035300 746941

B34068 3 G33 - 1600 x 3000 mm 1 Pieces -


4 035300 746958

B34069 3 G33 - 1800 x 3500 mm 1 Pieces -


4 035300 746965

Foil barrier tape


3RO\HWK\OHQHP\WHDUUHVLVWDQWFRORXUIDVW

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY2701592 5 M44 X 80 mm x 50 m 1 Pieces X


4 035300 905713

09.2016 Subjects to change without notice 215


Cargo securing

Foil barrier tape


3RO\HWK\OHQHP\WHDUUHVLVWDQWFRORXUIDVW

No.: PU EAN Placement Size Content Clip Stripe Article

B34030 10 M33 - 80 mm x 50 m 1 Pieces -


4 035300 713110

Warning tape, self-adhesive


3RO\SURS\OHQHFRORXUIDVW89UHVLVWDQW

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY2700594 5 M33 - 60 mm x 66 m 1 Pieces -


4 035300 916405

216 Subjects to change without notice 09.2016


Cargo securing

Warning tape, self-adhesive


3RO\SURS\OHQHFRORXUIDVW89UHVLVWDQW

Clip Stripe
No.: PU EAN Placement Size Content
Article

DY2700595 5 M33 - 60 mm x 66 m 1 Pieces -


4 035300 916412

Ratchet cable
&DEOHOHQJWKPFDEOHGLDPHWHUPPPD[OLIWLQJZHLJKW
NJZLWKVDIHW\KRRNKRRNRSHQLQJDERXWPP
ZLQJVSDQPZLWKSXOOH\

Clip Stripe
No.: PU EAN Placement Size Content
Article

B34461 1 SP - ¡PP[P 1 Pieces -


4 035300 761821

09.2016 Subjects to change without notice 217


Cargo securing

Trailer winch
&DEOHOHQJWKPFDEOHGLDPHWHUPPPD[OLIWLQJZHLJKW
NJZLWKVDIHW\KRRNKRRNRSHQLQJDERXWPP
wingspan 7.5 m

Clip Stripe
No.: PU EAN Placement Size Content
Article

B34463 1 SP - ‘PP[P 1 Pieces -


4 035300 761838

218 Subjects to change without notice 09.2016


Ironmongery & Accessories

Universal screws
:LWK7;VWDUKHDGGULYHFRXQWHUVXQNKHDGZLWKVOLGH
FRDWLQJ\HOORZJDOYDQL]HGLQFOXGLQJPDJQHWKROGHU
DQGELWV

This item is also available with customer’s own logo.

Clip Stripe
No.: PU EAN Placement Size Content
Article

B30173 8 G60 - [PP 455 Pieces -


4 035300 745807

B30174 8 G60 - [PP 385 Pieces -


4 035300 745814

B30175 8 G60 - [PP 195 Pieces -


4 035300 745821

B30176 8 G60 - [PP 160 Pieces -


4 035300 745838

B30177 8 G60 - [PP 140 Pieces -


4 035300 745845

B30178 8 G60 - [PP 85 Pieces -


4 035300 745852

B30179 8 G60 - [PP 70 Pieces -


4 035300 745869

09.2016 Subjects to change without notice 219


Ironmongery & Accessories

Universal screws
:LWK7;VWDUKHDGGULYHFRXQWHUVXQNKHDGZLWKVOLGH
FRDWLQJ\HOORZJDOYDQL]HG
This item is also available with customer’s own logo.

Clip Stripe
No.: PU EAN Placement Size Content
Article

B30192 8 G60 - [PP 455 Pieces -


4 035300 839797

B30193 8 G60 - [PP 385 Pieces -


4 035300 839803

B30194 8 G60 - [PP 195 Pieces -


4 035300 839810

B30195 8 G60 - [PP 160 Pieces -


4 035300 839827

B30196 8 G60 - [PP 140 Pieces -


4 035300 839834

B30197 8 G60 - [PP 85 Pieces -


4 035300 839841

B30198 8 G60 - [PP 70 Pieces -


4 035300 839858

220 Subjects to change without notice 09.2016


Ironmongery & Accessories

Universal screws
:LWK7;VWDUKHDGGULYHFRXQWHUVXQNKHDGZLWKVOLGH
FRDWLQJ\HOORZJDOYDQL]HGZLWKELW
from 35 mm with partial threads

Clip Stripe
No.: PU EAN Placement Size Content
Article

B30080 8 G60 - [PP 850 Pieces -


4 004722 566352

B30081 8 G60 - [PP 500 Pieces -


4 004722 566369

B30082 8 G60 - [PP 425 Pieces -


4 004722 566376

B30083 8 G60 - [PP 240 Pieces -


4 004722 566383

B30084 8 G60 - [PP 175 Pieces -


4 004722 566390

B30085 8 G60 - [PP 85 Pieces -


4 004722 566406

09.2016 Subjects to change without notice 221


Ironmongery & Accessories

Universal screws
:LWK7;VWDUKHDGGULYHFRXQWHUVXQNKHDGZLWKVOLGH
FRDWLQJVWDLQOHVVVWHHO$ZLWKELW
from 35 mm with partial threads

Clip Stripe
No.: PU EAN Placement Size Content
Article

B30135 5 G60 - [PP 200 Pieces -


4 004722 613353

B30136 5 G60 - [PP 175 Pieces -


4 004722 613360

B30137 5 G60 - [PP 140 Pieces -


4 004722 613377

B30138 5 G60 - [PP 80 Pieces -


4 004722 613384

B30139 5 G60 - [PP 45 Pieces -


4 004722 613391

B30140 5 G60 - [PP 30 Pieces -


4 004722 613407

222 Subjects to change without notice 09.2016


Ironmongery & Accessories

Universal screws
:LWK3= 3R]LGULY GULYHFRXQWHUVXQNKHDGZLWKVOLGH
FRDWLQJ\HOORZJDOYDQL]HG
from 35 mm with partial threads

Clip Stripe
No.: PU EAN Placement Size Content
Article

B30041 8 G60 - [PP 850 Pieces -


4 004722 556827

B30042 8 G60 - [PP 500 Pieces -


4 004722 556834

B30043 8 G60 - [PP 425 Pieces -


4 004722 556841

B30111 8 G60 - [PP 300 Pieces -


4 035300 701131

B30112 8 G60 - [PP 260 Pieces -


4 035300 701148

B30044 8 G60 - [PP 240 Pieces -


4 004722 556858

B30045 8 G60 - [PP 175 Pieces -


4 004722 556865

B30113 8 G60 - [PP 120 Pieces -


4 035300 701162

B30114 8 G60 - [PP 100 Pieces -


4 035300 701179

B30046 8 G60 - [PP 85 Pieces -


4 004722 556872

09.2016 Subjects to change without notice 223


Ironmongery & Accessories

Universal screws
:LWK3= 3R]LGULY GULYHFRXQWHUVXQNKHDGZLWKVOLGH
FRDWLQJVWDLQOHVVVWHHO$

No.: PU EAN Placement Size Content Clip Stripe Article

B30130 5 G60 - [PP 300 Pieces -


4 035300 695232

B30132 5 G60 - [PP 240 Pieces -


4 035300 634286

B30131 5 G60 - [PP 170 Pieces -


4 035300 695249

B30133 5 G60 - [PP 135 Pieces -


4 035300 634293

224 Subjects to change without notice 09.2016


Ironmongery & Accessories

Universal screws
:LWK3= 3R]LGULY GULYHFRXQWHUVXQNKHDGZLWKVOLGH
FRDWLQJVWDLQOHVVVWHHO$
from 35 mm with partial threads

Clip Stripe
No.: PU EAN Placement Size Content
Article

B30086 6 K25 X [PP 250 Pieces X


4 004722 572544

B30087 6 K25 X [PP 300 Pieces X


4 004722 572551

B30088 6 K25 X [PP 250 Pieces X


4 004722 572568

B30089 6 K25 X [PP 225 Pieces X


4 004722 572575

B30090 6 K25 X [PP 180 Pieces X


4 004722 572582

B30091 6 K25 X [PP 160 Pieces X


4 004722 572599

B30092 6 K25 X [PP 125 Pieces X


4 004722 572605

B30093 6 K25 X [PP 120 Pieces X


4 004722 572612

B30094 6 K25 X [PP 85 Pieces X


4 004722 572629

B30095 6 K25 X [PP 70 Pieces X


4 004722 572643

B30096 6 K25 X [PP 55 Pieces X


4 004722 572636

09.2016 Subjects to change without notice 225


Ironmongery & Accessories

PZ universal screws with dowels


:LWK3=3R]LGULYGULYHFRXQWHUVXQNKHDGZLWKVOLGH
FRDWLQJ\HOORZJDOYDQL]HGZLWKGRZHO
from 35 mm with partial threads

Clip Stripe
No.: PU EAN Placement Size Content
Article

B33382 12 K25 X [P 25 Pieces X


4 035300 755547

B33383 12 K25 X [P 25 Pieces X


4 035300 755554

B33384 12 K25 X [P 25 Pieces X


4 035300 755561

B33385 12 K25 X [P 25 Pieces X


4 035300 755578

226 Subjects to change without notice 09.2016


Ironmongery & Accessories

Universal screws set with dowels


:LWK3=3R]LGULYGULYHZLWKVOLGHFRDWLQJ
\HOORZJDOYDQL]HGWKLVLWHPLVDOVRDYDLODEOHZLWKFXVWRPHU¶V
own logo
Contents:
8QLYHUVDOVFUHZVJDOYDQL]HG
Pieces Size A x B
150 pcs. 3.5 x 30 mm
100 pcs. 4.0 x 40 mm
50 pcs. 4.5 x 50 mm
40 pcs. 5.0 x 60 mm
'RZHOVSODVWLF
Pieces Size A
80 pcs. ø 5 mm
50 pcs. ø 6 mm
40 pcs. ø 8 mm

No.: PU EAN Placement Content Clip Stripe Article

B30029 8 G60 - 510 Pieces -


4 004722 616316

09.2016 Subjects to change without notice 227


Ironmongery & Accessories

Universal screws set with dowels


:LWK7;VWDUGULYHKHDGZLWKVOLGHFRDWLQJ\HOORZ
galvanized
LQFOELWV 7;7;7;
This item is also available with the customer’s own logo
Contents:
Universal screws, galvanized
Size Size A x B
150 pcs. 3.5 x 30 mm
100 pcs. 4.0 x 40 mm
50 pcs. 4.5 x 50 mm
40 pcs. 5.0 x 60 mm
Dowels, polypropylene
Size Size A
80 pcs. ø 5 mm
50 pcs. ø 6 mm
40 pcs. ø 8 mm

No.: PU EAN Placement Content Clip Stripe Article

B30129 8 G60 - 510 Pieces -


4 035300 885787

228 Subjects to change without notice 09.2016


Ironmongery & Accessories

Universal screws with dowels


:LWK7;VWDUKHDGGULYHZLWKVOLGHFRDWLQJ
\HOORZJDOYDQL]HGLQFOXGLQJ7;ELW
This item is also available with customer’s own logo.

No.: PU EAN Placement Size Content Clip Stripe Article

B30270 8 G60 - [PP 500 Pieces -


4 035300 899579

B30271 8 G60 - [PP 300 Pieces -


4 035300 899586

B30272 8 G60 - [PP 200 Pieces -


4 035300 899593

B30273 8 G60 - [PP 180 Pieces -


4 035300 899609

Universal screws set


:LWK3=3R]LGULYGULYHZLWKVOLGHFRDWLQJ\HOORZJDOYDQL]HG

This item is also available with the customer’s own logo


Pieces Size A x B
300 pcs. 3.5 x 30 mm
150 pcs. 4.0 x 40 mm
100 pcs. 4.5 x 50 mm
75 pcs. 5.0 x 60 mm

No.: PU EAN Placement Content Clip Stripe Article

B30047 8 G60 - 625 Pieces -


4 004722 616323

09.2016 Subjects to change without notice 229


Ironmongery & Accessories

Universal screws set


:LWK7;VWDUKHDGGULYHZLWKVOLGHFRDWLQJ\HOORZJDOYDQL]HG
This item is also available with the customer’s own logo
Pieces Size A x B
300 pcs. 3.5 x 30 mm
150 pcs. 4.0 x 40 mm
100 pcs. 4.5 x 50 mm
75 pcs. 5.0 x 60 mm

No.: PU EAN Placement Content Clip Stripe Article

B30048 8 G60 - 625 Pieces -


4 004722 616330

Universal screws set


:LWK3=3R]LGULYGULYHFRXQWHUVXQNKHDGZLWKVOLGHFRDWLQJ
galvanized
Pieces Size A x B
150 pcs. 3.5 x 25 mm
150 pcs. 4.0 x 30 mm
100 pcs. 4.0 x 40 mm
50 pcs. 5.0 x 50 mm
30 pcs. 5.0 x 60 mm
From 35 mm with partial thread

No.: PU EAN Placement Content Clip Stripe Article

B30304 12 G60 - 480 Pieces -


4 035300 893690

230 Subjects to change without notice 09.2016


Ironmongery & Accessories

Universal screws set


:LWK7;VWDUGULYHFRXQWHUVXQNKHDGZLWKVOLGHFRDWLQJ
galvanized
Pieces Size A x B
150 pcs. 3.5 x 25 mm
150 pcs. 4.0 x 30 mm
100 pcs. 4.0 x 40 mm
50 pcs. 5.0 x 50 mm
30 pcs. 5.0 x 60 mm
From 35 mm with partial thread

No.: PU EAN Placement Content Clip Stripe Article

B30305 12 G60 - 480 Pieces -


4 035300 893706

Universal screws set


:LWK3=3R]LGULYHGULYHFRXQWHUVXQNKHDGZLWKVOLGH
FRDWLQJVWDLQOHVVVWHHO$
Contents:
100 pcs. 4.0 x 30 mm
100 pcs. 4.0 x 40 mm
30 pcs. 5.0 x 50 mm
30 pcs. 5.0 x 60 mm
From 35 mm with partial thread

No.: PU EAN Placement Content Clip Stripe Article

B30306 8 G60 - 260 Pieces -


4 035300 893713

09.2016 Subjects to change without notice 231


Ironmongery & Accessories

Nail plug
3=3R]LGULYHGULYHFRXQWHUVXQNKHDGJDOYDQL]HG
Dowel made from polyamide

No.: PU EAN Placement Size Content Clip Stripe Article

B30279 8 G60 - [PP 120 Pieces -


4 035300 899661

B30280 8 G60 - [PP 80 Pieces -


4 035300 899678

Fin-type wall plugs


3RO\SURS\OHQH
suitable for solid masonry and concrete

Clip Stripe
No.: PU EAN Placement Size Content
Article

B30025 8 G60 - ø 5 x 25 mm 700 Pieces -


4 004722 571578

B30026 8 G60 - ø 6 x 30 mm 450 Pieces -


4 004722 571585

B30027 8 G60 - ø 8 x 40 mm 200 Pieces -


4 004722 571592

B30028 8 G60 - ø 10 x 50 mm 100 Pieces -


4 004722 597653

232 Subjects to change without notice 09.2016


Ironmongery & Accessories

Fin-type wall plugs set


Polypropylene
suitable for solid masonry and concrete
Pieces Size A x B
200 pieces 5 x 25 mm
120 pieces 6 x 30 mm
50 pieces 8 x 40 mm
25 pieces 10 x 50 mm

No.: PU EAN Placement Content Clip Stripe Article

B30024 8 G60 - 395 Pieces -


4 004722 597660

Fin-type wall plugs set


Polypropylene
suitable for solid masonry and concrete
Pieces Size A x B
235 pcs. 5 x 25 mm
200 pcs. 6 x 30 mm
60 pcs. 8 x 40 mm
35 pcs. 10 x 50 mm

incl. 4 drill bits ø 5 mm/ ø 6 mm/ ø 8mm/ ø 10 mm

No.: PU EAN Placement Content Clip Stripe Article

B30012 8 G60 - 530 Pieces -


4 035300 876990

09.2016 Subjects to change without notice 233


Ironmongery & Accessories

Fin-type wall plugs set


Polypropylene
suitable for solid masonry and concrete
Pieces Size A x B
150 pcs. 5 x 25 mm
110 pcs. 6 x 30 mm
70 pcs. 8 x 40 mm
20 pcs. 10 x 50 mm

No.: PU EAN Placement Content Clip Stripe Article

B30015 8 G60 - 350 Pieces -


4 035300 877027

Fin-type wall plugs set


Polypropylene
suitable for solid masonry and concrete
Pieces Size A x B
400 pcs. 5 x 25 mm
250 pcs. 6 x 30 mm
100 pcs. 8 x 40 mm
50 pcs. 10 x 50 mm

No.: PU EAN Placement Content Clip Stripe Article

B30016 8 G60 - 800 Pieces -


4 035300 877034

234 Subjects to change without notice 09.2016


Ironmongery & Accessories

Dowels set
Polypropylene
suitable for solid masonry and concrete
Pieces Size A x B
200 pcs. 5 x 25 mm
150 pcs. 6 x 30 mm
50 pcs. 8 x 40 mm

No.: PU EAN Placement Content Clip Stripe Article

B30013 20 G60 X 400 Pieces X


4 035300 877003

Fin-type wall plugs


3RO\DPLGH
suitable for solid masonry and concrete

Clip Stripe
No.: PU EAN Placement Size Content
Article

B33387 10 G60 X ø 6 x 30 mm 100 Pieces X


4 035300 877966

B33388 10 G60 X ø 8 x 40 mm 100 Pieces X


4 035300 877997

B33389 10 G60 X ø 10 x 50 mm 50 Pieces X


4 035300 877980

09.2016 Subjects to change without notice 235


Ironmongery & Accessories

All-purpose dowels set


3RO\SURS\OHQHGXHWRWKHVSOD\VXLWDEOHIRUFRQFUHWHVROLG
masonry and aerated concrete
Pieces Size A x B
130 pcs. 6 x 36 mm
100 pcs. 8 x 50 mm
25 pcs. 10 x 60 mm

No.: PU EAN Placement Content Clip Stripe Article

B30011 8 G60 - 255 Pieces -


4 035300 876983

Dowels set
Polypropylene
‡6\QWKHWLFGRZHOSFV¡PP
suitable for solid brick and concrete
‡6SUHDGLQJGRZHOSFV¡PP
ZLWKFROODUWKLVSUHYHQWVDSHQHWUDWLRQLQWRWKHERUHKROH
suitable for all perforated and hollow chamber bricks
and concrete and masonry construction materials
‡$OOSXUSRVHGRZHOSLHFHV¡PPZLWKFROODUWKLV
SUHYHQWVSHQHWUDWLRQLQWRWKHERUHKROHVXLWDEOHIRU
FRQFUHWHVROLGVWRQHDQGFDYLW\EORFNV
‡3ODVWHUERDUGVHOIWDSSLQJSLHFHV¡PP
suitable for gypsum boards / gypsum plaster boards
• Includes bit

No.: PU EAN Placement Content Clip Stripe Article

B30014 20 G60 X 200 Pieces X


4 035300 877010

236 Subjects to change without notice 09.2016


Ironmongery & Accessories

Plastic wheel chock set


54 pieces
16 pcs. each 30 x 45 mm
38 pcs. each 100 x 50 mm
each in 1-6 mm thickness
VL]HVFRORXULQGLFDWHGIRUFRPSDULVRQRIGLVWDQFHVHJIRU
IXUULQJKROGLQJHWF

No.: PU EAN Placement Content Clip Stripe Article

B34134 24 M30 X 54 Pieces X


4 035300 823833

Coarse thread screws


:LWK3+3KLOOLSVGULYHFRQLFDOKHDGZLWKILQHWKUHDGEODFN
phosphated

Clip Stripe
No.: PU EAN Placement Size Content
Article

B30070 8 G60 - [PP 750 Pieces -


4 004722 560855

B30071 8 G60 - [PP 500 Pieces -


4 004722 560862

B30072 8 G60 - [PP 400 Pieces -


4 004722 560879

09.2016 Subjects to change without notice 237


Ironmongery & Accessories

Coarse thread screws


:LWK3+3KLOOLSVGULYHFRQLFDOKHDGZLWKGULOOLQJSLQEODFN
phosphated

Clip Stripe
No.: PU EAN Placement Size Content
Article

B30073 8 G60 - [PP 750 Pieces -


4 035300 655069

B30074 8 G60 - [PP 500 Pieces -


4 035300 655076

B30075 8 G60 - [PP 400 Pieces -


4 035300 655083

Coarse thread screws


:LWK3+3KLOOLSVGULYHFRQLFDOKHDGZLWKFRDUVHWKUHDG
black phosphated

No.: PU EAN Placement Size Content Clip Stripe Article

B30076 8 G60 - [PP 750 Pieces -


4 004722 615807

B30077 8 G60 - [PP 500 Pieces -


4 004722 615814

B30078 8 G60 - [PP 400 Pieces -


4 004722 615821

238 Subjects to change without notice 09.2016


Ironmongery & Accessories

Drywall screws with accessories


:LWK3+3KLOOLSVGULYHFRQLFDOKHDGILQHWKUHDGEODFN
SKRVSKDWHGLQFOGHSWKVWRS

Clip Stripe
No.: PU EAN Placement Size Content
Article

B30122 8 G60 - [PP 1000 Pieces -


4 035300 839698

B30123 8 G60 - [PP 750 Pieces -


4 035300 839704

B30124 8 G60 - [PP 650 Pieces -


4 035300 839711

B30125 8 G60 - [PP 600 Pieces -


4 035300 839728

Drywall screws with accessories


:LWK3+3KLOOLSVGULYHFRQLFDOKHDGFRDUVHWKUHDGEODFN
SKRVSKDWHGLQFOGHSWKVWRS

Clip Stripe
No.: PU EAN Placement Size Content
Article

B30126 8 G60 - [PP 650 Pieces -


4 035300 839735

B30127 8 G60 - [PP 600 Pieces -


4 035300 839742

B30128 8 G60 - [PP 500 Pieces -


4 035300 839759

09.2016 Subjects to change without notice 239


Ironmongery & Accessories

Adjusting bolts
Adjustment screws are used in wood materials in order to
be able to position wood plates in a continuous manner after
assembly
:LWK7;VWDUKHDGGULYHFRXQWHUVXQNKHDGZLWKVOLGH
FRDWLQJ\HOORZJDOYDQL]HGIRUZRRGZRRGFRQQHFWLRQV

This item is also available with the customer’s own logo

Clip Stripe
No.: PU EAN Placement Size Content
Article

B30274 8 G60 - [PP 150 Pieces -


4 035300 899616

B30275 8 G60 - [PP 130 Pieces -


4 035300 899630

B30276 8 G60 - [PP 110 Pieces -


4 035300 899623

B30277 8 G60 - [PP 100 Pieces -


4 035300 899647

B30278 8 G60 - [PP 80 Pieces -


4 035300 899654

Flooring screws
([WUDVPDOOFRXQWHUVXQNKHDGZLWK7;6WDUKHDGGULYH
7; QRVSOLWWLQJRIWKHZRRGZLWKGULOOLQJSLQZLWKFXWWLQJ
ULEVXQGHUWKHKHDGJDOYDQL]HGLQFOXVLYHELW 7; YHU\
ZHOOVXLWHGWRVROLGZRRGHQIORRUVUHGXFHVWKHFUHDNLQJRI
floorboards

Clip Stripe
No.: PU EAN Placement Size Content
Article

DP3213240 5 G40 - [PP 350 Pieces -


4 035300 689651

DP3213250 5 G40 - [PP 200 Pieces -


4 035300 689668

DP3213260 5 G40 - [PP 150 Pieces -


4 035300 689675

240 Subjects to change without notice 09.2016


Ironmongery & Accessories

Terrace screws
([WUDVPDOOFRXQWHUVXQNKHDGZLWK7;6WDUKHDGGULYH
7; QRVSOLWWLQJRIWKHZRRGZLWKGULOOLQJSLQZLWKFXWWLQJ
ULEVXQGHUWKHKHDGVWDLQOHVVVWHHOUXVWIUHH&LQFOXVLYH
ELW 7; YHU\ZHOOVXLWHGWRVHFXULQJKDUGZRRGEORFNVLQ
RXWGRRUDSSOLFDWLRQVVXFKDVRDN%DQJNLUDLHWF

No.: PU EAN Placement Size Content Clip Stripe Article

DK3230002 5 G40 - [PP 100 Pieces -


4 035300 652211

DK3230003 5 G40 - [PP 120 Pieces -


4 035300 652228

Terrace screws
([WUDVPDOOFRXQWHUVXQNKHDGZLWK7;6WDUKHDGGULYH
7; QRVSOLWWLQJRIWKHZRRGZLWKGULOOLQJSLQZLWKFXWWLQJ
ULEVXQGHUWKHKHDGVWDLQOHVVVWHHOUXVWIUHH&LQFOXVLYH
ELWV 7; DQGELWKROGHUYHU\ZHOOVXLWHGWRVHFXULQJ
KDUGZRRGEORFNVLQRXWGRRUDSSOLFDWLRQVVXFKDVRDN
Bangkirai etc.
This item is also available with the customer’s own logo

No.: PU EAN Placement Size Content Clip Stripe Article

B30250 4 G60 - [PP 270 Pieces -


4 035300 724833

B30251 4 G60 - [PP 240 Pieces -


4 035300 724840

09.2016 Subjects to change without notice 241


Ironmongery & Accessories

Post screws
:LWKSUHVVHGRQZDVKHUZLWK7;VWDUKHDGGULYHZLWK
GULOOLQJSLQQRSUHGULOOLQJGXHWRFDVHKDUGHQLQJVXLWDEOHIRU
KDUGDQGVRIWZRRGYHULILHGTXDOLW\JDOYDQLVHGZLWKELW
The post screws are specifically for outdoor use. They are
highly resistant against the weather thanks to a special
zinc-aluminium baked coating.

No.: PU EAN Placement Size Content Clip Stripe Article

B30260 12 G40 X [PP 8 Pieces X


4 035300 736034

B30261 12 G40 X [PP 8 Pieces X


4 035300 736041

Post screws
:LWKSUHVVHGRQZDVKHUZLWK7;VWDUKHDGGULYHZLWK
GULOOLQJSLQQRSUHGULOOLQJGXHWRFDVHKDUGHQLQJVXLWDEOHIRU
KDUGDQGVRIWZRRGYHULILHGTXDOLW\JDOYDQLVHGZLWKELW
The post screws are specifically for outdoor use. They are
highly resistant against the weather thanks to a special
zinc-aluminium baked coating.

No.: PU EAN Placement Size Content Clip Stripe Article

B30146 5 G60 - [PP 48 Pieces -


4 004722 614480

B30147 5 G60 - [PP 48 Pieces -


4 004722 614497

242 Subjects to change without notice 09.2016


Ironmongery & Accessories

Countersunk head wood screws


:LWK7;VWDUKHDGGULYHZLWKZHDWKHUUHVLVWDQWVHDOLQJGLVFV
VWDLQOHVVVWHHO$ZLWKELW

No.: PU EAN Placement Size Content Clip Stripe Article

B30165 5 G60 - [PP 100 Pieces -


4 035300 718764

B30166 5 G60 - [PP 100 Pieces -


4 035300 718771

B30167 5 G60 - [PP 100 Pieces -


4 035300 718788

Countersunk head wood screws


:LWK3= 3R]LGULY GULYHFRXQWHUVXQNKHDGZLWKZHDWKHU
UHVLVWDQWVHDOLQJGLVFVVWDLQOHVVVWHHO$

Clip Stripe
No.: PU EAN Placement Size Content
Article

B30155 5 G60 - [PP 100 Pieces -


4 035300 655090

B30156 5 G60 - [PP 100 Pieces -


4 035300 655106

B30157 5 G60 - [PP 100 Pieces -


4 035300 655113

09.2016 Subjects to change without notice 243


Ironmongery & Accessories

Hexagonal head wood screws set


)RUGULYHLQJURXQGVOHHYHVDQGVXSSRUWVKRHVJDOYDQL]HG
including large diameter washers

Clip Stripe
No.: PU EAN Placement Size Content
Article

B30160 5 G60 - [PP 20 Pieces -


4 035300 655120

B30161 5 G60 - [PP 20 Pieces -


4 035300 655144

Hexagonal head wood screws set


)RUGULYHLQJURXQGVOHHYHVDQGVXSSRUWVKRHVJDOYDQL]HG
including large diameter washers

Clip Stripe
No.: PU EAN Placement Size Content
Article

B30020 10 M40 - 10 x 30 mm 20 Pieces -


4 004722 582390

B30021 10 M40 - 10 x 40 mm 20 Pieces -


4 004722 582406

244 Subjects to change without notice 09.2016


Ironmongery & Accessories

Hexagonal head wood screws set


)RUGULYHLQJURXQGVOHHYHVDQGSRVWVXSSRUWVKRHV
VWDLQOHVVVWHHO$LQFOXGLQJODUJHGLDPHWHUZDVKHUV

No.: PU EAN Placement Size Content Clip Stripe Article

B30268 10 M40 - 10 x 40 mm 12 Pieces -


4 035300 739523

Hexagonal head screws set


:LWKPHWULFWKUHDGIRUGULYHLQJURXQGVOHHYHVDQGSRVW
VXSSRUWVKRHVJDOYDQL]HGLQFOODUJHGLDPHWHUZDVKHUV
spring washers and hexagonal nuts

Clip Stripe
No.: PU EAN Placement Size Content
Article

B30162 5 G60 - M10 x 90 mm 10 Pieces -


4 035300 655151

B30163 5 G60 - M10 x 110 mm 10 Pieces -


4 035300 655168

09.2016 Subjects to change without notice 245


Ironmongery & Accessories

Hexagonal head screws set


:LWKPHWULFWKUHDGIRUGULYHLQJURXQGVOHHYHVDQGSRVW
VXSSRUWVKRHVJDOYDQL]HGLQFOODUJHGLDPHWHUZDVKHUV
spring washers and hexagonal nuts

Clip Stripe
No.: PU EAN Placement Size Content
Article

B30018 10 M40 - M10 x 90 mm 10 Pieces -


4 004722 582376

B30019 10 M40 - M10 x 110 mm 10 Pieces -


4 004722 582383

Hexagonal head screws set


:LWKPHWULFWKUHDGIRUGULYHLQJURXQGVOHHYHVDQGSRVW
VXSSRUWVKRHVVWDLQOHVVVWHHO$
/DUJHGLDPHWHUZDVKHUVVSULQJZDVKHUVDQGKH[DJRQDOQXWV

Clip Stripe
No.: PU EAN Placement Size Content
Article

B30265 10 M40 - M10 x 90 mm 6 Pieces -


4 035300 739493

B30266 10 M40 - M10 x 110 mm 6 Pieces -


4 035300 739509

246 Subjects to change without notice 09.2016


Ironmongery & Accessories

Tar paper pins


',1JDOYDQL]HG

No.: PU EAN Placement Size Content Clip Stripe Article

B30058 8 G60 - [PP 1400 g -


4 004722 560916

B30121 8 G60 - [PP 1000 g -


4 035300 576777

B30120 8 G60 - [PP 1200 g -


4 035300 541911

B30059 8 G60 - [PP 900 g -


4 004722 560923

Wire nails
',1FRXQWHUVXQNKHDGJDOYDQL]HG

No.: PU EAN Placement Size Content Clip Stripe Article

B30050 8 G60 - [PP 1500 g -


4 004722 558463

B30051 8 G60 - [PP 1500 g -


4 004722 558470

B30052 8 G60 - [PP 1500 g -


4 004722 558487

09.2016 Subjects to change without notice 247


Ironmongery & Accessories

Wire nails set


',1FRXQWHUVXQNKHDGEODQN
This item is also available with the customer’s own logo
Content Size A x B
350 g 1.8 x 30 mm
350 g 2.0 x 40 mm
350 g 2.5 x 55 mm
350 g 2.8 x 65 mm

No.: PU EAN Placement Size Content Clip Stripe Article

[[[
B30053 8 G60 - 1400 g -
4 004722 616347 [PP

Chair angle set


Galvanized
Pieces Size A x B x C
10 pieces 25 x 25 x 16 mm
10 pieces 30 x 30 x 16 mm
10 pieces 40 x 40 x 16 mm
8 pieces 50 x 50 x 16 mm
6 pieces 60 x 60 x 16 mm

No.: PU EAN Placement Content Clip Stripe Article

B30023 5 G60 - 44 Pieces -


4 004722 614091

248 Subjects to change without notice 09.2016


Ironmongery & Accessories

Assortment box range of connectors


Including universal screws
Contents:
• Angle
4 pieces 75 x 75 x16 x 2 mm
4 pieces 60 x 60 x 16 x 2 mm
8 pieces 40 x 40 x 16 x 2 mm
4 pieces 25 x 25 x 16 x 2 mm
• Flat connector
4 pieces 80 x 15 x 2 mm
4 pieces 40 x 15 x 2 mm

No.: PU EAN Placement Content Clip Stripe Article

HV4560 10 K27 - 180 Pieces -


4 035300 893720

09.2016 Subjects to change without notice 249


Ironmongery & Accessories

Universal screws assortment box


Contents:
‡8QLYHUVDOVFUHZVZLWK3= 3R]LGULY GULYH
FRXQWHUVXQNKHDGZLWKIULFWLRQFRDWLQJJDOYDQL]HG
[PPSFV
[PPSFV
[PPSFV
[PPSFV
[PPSFV
[PPSFV
[PPSFV
[PPSFV
[PPSFV
[PPSFV
[PPSFV
[PPSFV

No.: PU EAN Placement Content Clip Stripe Article

DP8500001 8 M36 - 145 Pieces -


4 035300 180134

250 Subjects to change without notice 09.2016


Ironmongery & Accessories

Threaded screws assortment box


Contents:
‡7KUHDGHGVFUHZV3+3KLOOLSVGULYHFRXQWHUVXQNKHDG
',1JDOYDQL]HG
30 pieces M4 x 10 mm
10 pieces M5 x 20 mm
5 pieces M5 x 30 mm
‡7KUHDGHGVFUHZV3+3KLOOLSVGULYHSDQKHDG
',1JDOYDQL]HG
30 pieces M3 x 16 mm
30 pieces M4 x 10 mm
15 pieces M4 x 20 mm
10 pieces M4 x 40 mm
10 pieces M5 x 20 mm
8 pieces M5 x 40 mm
‡1XWV',1JDOYDQL]HG
30 pieces M3
40 pieces M4
40 pieces M5

No.: PU EAN Placement Content Clip Stripe Article

DP8500002 8 M36 X 258 Pieces X


4 035300 099306

09.2016 Subjects to change without notice 251


Ironmongery & Accessories

Screw hooks assortment box


Contents:
‡6FUHZKRRNVFXUYHGZRRGZRUNWKUHDGJDOYDQL]HG
6 pieces 3.0 x 40 mm
4 pieces 4.0 x 50 mm
‡5LQJEROWVZRRGZRUNWKUHDGJDOYDQL]HG
6 pieces 3.8 x 25 x 12 mm
‡6FUHZKRRNVVWUDLJKWZRRGZRUNWKUHDGJDOYDQL]HG
8 pieces 2.7 x 30 mm
5 pieces 3.3 x 50 mm
‡6ORWWHGVFUHZKRRNVVWUDLJKWZRRGZRUNWKUHDGJDOYDQL]HG
4 pieces 5.2 x 40 mm
4 pieces 5.2 x 50 mm
‡+RRNQDLOVVWUDLJKWJDOYDQL]HG
5 pieces 3.5 x 40 mm
‡5RXQGVWHHOKRRNVVWUDLJKWJDOYDQL]HG
5 pieces 3.0 x 40 mm
• Synthetic dowels
31 pieces 5 x 25 mm / 6 x 30 mm / 8 x 40 mm

No.: PU EAN Placement Content Clip Stripe Article

DP8500005 8 M36 X 79 Pieces X


4 035300 040308

252 Subjects to change without notice 09.2016


Ironmongery & Accessories

Picture hooks assortment box


Contents:
‡)ROGLQJH\HVEUDVV
12 pieces size 1
10 pieces size 1 1/2
4 pieces size 2
• Pins for folding eyes
52 pieces
‡0LUURUVKHHWVJDOYDQL]HG
4 pieces 21 x 30 mm
‡8QLYHUVDOVFUHZVJDOYDQL]HG
8 pieces 3.0 x 16 mm
‡&RQFUHWHZDOOKRRNVSODVWLF
4 pieces
‡:DOOKRRNVJDOYDQL]HG
8 pieces No. 0
6 pieces No. 1
4 pieces No. 3
‡6WHHOKRRNVVWUDLJKWJDOYDQL]HG
4 pieces 3.5 x 30 mm
4 pieces 3.5 x 40 mm

No.: PU EAN Placement Content Clip Stripe Article

DP8500014 8 G36 X 142 Pieces X


4 035300 458196

09.2016 Subjects to change without notice 253


Ironmongery & Accessories

Coarse thread screws assortment box


Contents:
‡4XLFNUHOHDVHVFUHZV3+3KLOOLSVGULYHILQHWKUHDG
phosphated:
17 pcs. 3.5 x 25 mm
15 pcs. 3.5 x 28 mm
13 pcs. 3.5 x 32 mm
12 pcs. 3.5 x 40 mm
18 pcs. 3.5 x 50 mm
15 pcs. 3.9 x 50 mm
15 pcs. 3.9 x 64 mm

No.: PU EAN Placement Content Clip Stripe Article

DP8500050 8 M36 X 105 Pieces X


4 035300 767823

Universal screws assortment box


Contents:
‡8QLYHUVDOVFUHZVFRXQWHUVXQNKHDG3=3R]LGULYGULYH
galvanized
48 pcs. 3.0 x 12 mm
30 pcs. 3.0 x 16 mm
22 pcs. 3.5 x 25 mm
17 pcs. 3.5 x 30 mm
19 pcs. 4.0 x 40 mm
14 pcs. 4.5 x 50 mm
10 pcs. 5.0 x 60 mm

No.: PU EAN Placement Content Clip Stripe Article

DP8500051 8 M36 X 160 Pieces X


4 035300 767830

254 Subjects to change without notice 09.2016


Ironmongery & Accessories

Wood screws assortment box


Contents:
‡:RRGVFUHZV/LQVHQKHDG3+3KLOOLSVGULYH
galvanized
58 pcs. 3.0 x 12 mm
38 pcs. 3.5 x 12 mm
18 pcs. 3.5 x 20 mm
18 pcs. 4.0 x 20 mm
14 pcs. 4.0 x 25 mm
12 pcs. 4.0 x 32 mm
‡:RRGVFUHZVURXQGKHDGVORWGULYHJDOYDQL]HG
25 pcs. 3.5 x 20 mm
12 pcs. 4.0 x 25 mm
12 pcs. 4.0 x 32 mm
8 pcs 5.0 x 38 mm

No.: PU EAN Placement Content Clip Stripe Article

DP8500052 8 M36 X 215 Pieces X


4 035300 767847

09.2016 Subjects to change without notice 255


Ironmongery & Accessories

Sheet metal screws assortment box


Contents:
‡6HOIWDSSLQJVFUHZV/LQVHQKHDG3+3KLOOLSVGULYH
galvanized
50 pcs. 2.8 x 12 mm
38 pcs. 3.5 x 12 mm
20 pcs. 3.5 x 16 mm
16 pcs. 4.2 x 16 mm
12 pcs. 4.2 x 20 mm
12 pcs. 4.2 x 25 mm
12 pcs. 4.8 x 12 mm
10 pcs. 4.8 x 20 mm
8 pcs. 4.8 x 25 mm
7 pcs. 4.8 x 32 mm

No.: PU EAN Placement Content Clip Stripe Article

DP8500053 8 M36 X 185 Pieces X


4 035300 767854

256 Subjects to change without notice 09.2016


Ironmongery & Accessories

Nails and pins assortment box


Contents:
‡6FUHZQDLOVJDOYDQL]HG
50 pieces 2.2 x 20 mm
‡:DOOSDSHUSLQVEOXHG
50 pieces 1.2 x 14 mm
‡6WHHOQDLOVEODFN
40 pieces 2.0 x 25 mm
35 pieces 2.0 x 40 mm
‡3LQVEUDVV
50 pieces 1.5 x 25 mm
‡1DLOVFRPSUHVVHGJDOYDQL]HG
52 pieces 1.5 x 25 mm
50 pieces 1.6 x 30 mm
‡1DLOVFRXQWHUVXQNJDOYDQL]HG
73 pieces 1.5 x 25 mm
50 pieces 1.6 x 30 mm
35 pieces 2.0 x 40 mm

No.: PU EAN Placement Content Clip Stripe Article

DP8500054 8 M36 X 485 Pieces X


4 035300 767861

09.2016 Subjects to change without notice 257


Ironmongery & Accessories

Threaded screws assortment box


Contents:
‡7KUHDGHGVFUHZVURXQGKHDG3+3KLOOLSVGULYH
galvanized
42 pieces M3 x 10 mm
28 pieces M3 x 12 mm
20 pieces M4 x 10 mm
14 pieces M4 x 12 mm
13 pieces M4 x 20 mm
10 pieces M5 x 12 mm
8 pieces M5 x 25 mm
‡1XWV',1JDOYDQL]HG
73 pieces M3
48 pieces M4
19 pieces M5

No.: PU EAN Placement Content Clip Stripe Article

DP8500055 8 M36 X 275 Pieces X


4 035300 767878

258 Subjects to change without notice 09.2016


Ironmongery & Accessories

Large-diameter washers and spring washers assortment


box
Contents:
6SULQJZDVKHUV',1%JDOYDQL]HG
100 pieces 3 mm
93 pieces 4 mm
58 pieces 5 mm
40 pieces 6 mm
20 pieces 8 mm
/DUJHGLDPHWHUZDVKHUVJDOYDQL]HG
68 pieces 3 mm
45 pieces 4 mm
40 pieces 5 mm
20 pieces 6 mm
16 pieces 8 mm

No.: PU EAN Placement Content Clip Stripe Article

DP8500056 8 M36 X 500 Pieces X


4 035300 767885

09.2016 Subjects to change without notice 259


Ironmongery & Accessories

Wood screws and dowels assortment box


Contents:
‡:RRGVFUHZVFRXQWHUVXQNKHDG3+3KLOOLSVGULYH
galvanized
25 pcs. 3.5 x 25 mm
20 pcs. 4.0 x 25 mm
15 pcs. 4.0 x 32 mm
20 pcs. 5.0 x 32 mm
‡'RZHOSODVWLF
25 pcs. 5 mm
20 pcs. 6 mm
15 pcs. 7 mm
20 pcs. 8 mm

No.: PU EAN Placement Content Clip Stripe Article

DP8500057 8 M36 X 160 Pieces X


4 035300 767892

260 Subjects to change without notice 09.2016


Ironmongery & Accessories

Picture hooks assortment box


Contents:
‡3LFWXUHKRRNVEUDVVFRDWHG
12 pcs. Size 0
10 pcs. Size 1
8 pcs. Size 2
5 pcs. Size 3
‡:DOOKRRNVVPDOOEUDVVFRDWHG
5 pcs.
‡6SDUHSLQVEUDVVFRDWHG
10 pcs. 1.5 x 12 mm
64 pcs. 1.5 x 25 mm
• Eye bolts for picture hooks
25 pcs.
‡3LQERDUGSLQVFRORXUHG
10 pcs.
‡7KXPEWDFNVEUDVVFRDWHG
50 pcs.
• Picture wire
1.8 m

No.: PU EAN Placement Content Clip Stripe Article

DP8500058 8 M36 X 200 Pieces X


4 035300 767908

09.2016 Subjects to change without notice 261


Ironmongery & Accessories

Household assortment box


Contents:
‡3LQERDUGSLQVFRORXUHG
12 pieces
‡7KXPEWDFNVEUDVVFRDWHG
40 pieces
‡7KXPEWDFNVFRORXUHG
30 pieces
‡(QYHORSHIDVWHQHUVEUDVVFRDWHG
20 pieces 25 mm
‡0XOWL&OLSVEODFN
3 pieces 19 mm
2 pieces 25 mm
‡3DSHUFOLSVFRORXUHG
20 pieces 28 mm
20 pieces 33 mm
10 pieces 50 mm
‡3DUW\FOLSVFRORXUHG
5 pieces 32 mm

No.: PU EAN Placement Content Clip Stripe Article

DP8500059 8 M36 X 162 Pieces X


4 035300 767915

262 Subjects to change without notice 09.2016


Ironmongery & Accessories

Household assortment box


Contents:
‡'RZHOVV\QWKHWLF
12 pieces 6 mm
‡6KHHWPHWDOVFUHZVILOOLVWHUKHDGJDOYDQL]HG
12 pieces 4.2 x 32 mm
‡3DSHUFOLSVFRORXUHG
30 pieces 28 mm
‡3LQERDUGSLQVFRORXUHG
8 pieces
‡7KXPEWDFNVEUDVVFRDWHG
50 pieces
‡3LFWXUHKRRNVEUDVVFRDWHG
8 pieces size 2
‡6FUHZKRRNVVWUDLJKWZLWKFROODUDQGZRRGZRUNWKUHDG
brass-coated
6 pieces 2.5 x 25 mm
‡6FUHZKRRNVFXUYHGZLWKFROODUDQGZRRGZRUNWKUHDG
brass-coated
10 pieces 2.2 x 16 mm
5 pieces 2.5 x 25 mm
‡1DLOVFRXQWHUVXQNJDOYDQL]HG
54 pieces 1.6 x 30 mm

No.: PU EAN Placement Content Clip Stripe Article

DP8500060 8 M36 X 195 Pieces X


4 035300 767922

09.2016 Subjects to change without notice 263


Ironmongery & Accessories

Hooks assortment box


Contents:
‡&RQFUHWHZDOOKRRNVSODVWLF
2 pcs. 30 mm
2 pcs. 40 mm
‡3LFWXUHKRRNVEUDVVFRDWHG
8 pcs. Size 1
3 pcs. Size 4
‡(\HVFUHZVEUDVVFRDWHG
12 pcs. 2.0 x 25 mm
‡6FUHZKRRNVVWUDLJKWZLWKFROODUDQGZRRGZRUNWKUHDG
brass-coated
8 pcs. 2.5 x 25 mm
‡6FUHZKRRNVFXUYHGZLWKFROODUDQGZRRGZRUNWKUHDG
brass-coated
10 pcs. 2.2 x 16 mm
6 pcs. 2.5 x 25 mm
‡5RXQGHGVWHHOKRRNVJDOYDQL]HG
4 pcs. 4.0 x 50 mm
‡+RRNQDLOVJDOYDQL]HG
15 pcs. 2.3 x 30 mm

No.: PU EAN Placement Content Clip Stripe Article

DP8500061 8 M36 X 70 Pieces X


4 035300 767939

264 Subjects to change without notice 09.2016


Ironmongery & Accessories

Household assortment box


Contents:
• Slotted screw hooks
2 pieces 4.4 x 40 mm
2 pieces 4.4 x 50 mm
• Picture hooks
8 pieces size 0
• Steel hooks
3 pieces 3.0 x 40 mm
3 pieces 3.0 x 50 mm
• Steel nails
20 pieces 2.0 x 30 mm
20 pieces 2.0 x 40 mm
• Thumb tacks
30 pieces
• Hinge hook rings
6 pieces 11 x 16 mm
6 pieces 13 x 20 mm
• Bottom beam
16 pieces
• Wire nails countersunk
60 g 2.2 x 45 mm
60 g 2.8 x 65 mm
• Wood screws
16 pieces 3.5 x 25 mm
16 pieces 4.0 x 40 mm
16 pieces 5.0 x 50 mm
• Dowels
18 pieces 6 mm and 8 mm
‡6FUHZKRRNVVWUDLJKW
7 pieces 3.3 x 40 mm
• Eye bolt
7 pieces 20.0 x 8 mm
• Pinboard pins
15 pieces

No.: PU EAN Placement Content Clip Stripe Article

DP8500006 6 G36 - 221 Pieces + 120 g -


4 035300 131433

09.2016 Subjects to change without notice 265


Ironmongery & Accessories

Nails and pins assortment box


Contents:
‡:LUHQDLOVFRXQWHUVXQN
J[PP
J[PP
160 g 2.5 x 55 mm
100 g 2.8 x 65 mm
‡:LUHQDLOVFRPSUHVVHG
30 g 1.2 x 20 mm
30 g 1.4 x 25 mm
60 g 1.8 x 35 mm
• Wallpaper pins
10 g 1.4 x 13 mm
• Skirting pins
30 pieces 1.4 x 25 mm
‡6WHHOQDLOVEOXHG
20 pieces 2.0 x 30 mm
10 pieces 2.0 x 40 mm
‡6FUHZQDLOVJDOYDQL]HG
5 pieces 2.7 x 40 mm
• Profiled steel hooks
5 pieces 3.0 x 40 mm

No.: PU EAN Placement Content Clip Stripe Article

DP8500010 6 G36 - 70 Pieces + 530 g -


4 035300 083152

266 Subjects to change without notice 09.2016


Ironmongery & Accessories

Universal screws assortment box


Contents:
‡8QLYHUVDOVFUHZVZLWK3= 3R]LGULY GULYH
FRXQWHUVXQNKHDGIXOOWKUHDGZLWKVOLGHFRDWLQJJDOYDQL]HG
40 pcs. 3.0 x 12 mm
40 pcs. 3.0 x 16 mm
25 pcs. 3.0 x 20 mm
20 pcs. 3.0 x 25 mm
30 pcs. 3.5 x 30 mm
20 pcs. 4.0 x 30 mm
20 pcs. 4.0 x 40 mm
20 pcs. 4.0 x 50 mm
10 pcs. 5.0 x 60 mm
10 pcs 5.0 x 70 mm
10 pcs. 5.0 x 80 mm

No.: PU EAN Placement Content Clip Stripe Article

DP8500020 6 G36 - 245 Pieces -


4 035300 083145

09.2016 Subjects to change without notice 267


Ironmongery & Accessories

Nails and pins assortment box


Contents:
‡:DOOSDSHUSLQVEOXHG
60 pieces 1.2 x 11 mm
60 pieces 1.2 x 14 mm
‡1DLOVFRPSUHVVHGJDOYDQL]HG
200 pieces 1.2 x 12 mm
80 pieces 1.2 x 20 mm
35 pieces 1.6 x 30 mm
‡1DLOVFRXQWHUVXQNJDOYDQL]HG
200 pieces 1.2 x 12 mm
80 pieces 1.2 x 20 mm
35 pieces 1.6 x 30 mm

No.: PU EAN Placement Content Clip Stripe Article

DP8500030 10 M28 - 750 Pieces -


4 035300 767731

Wood screws assortment box


Contents:
‡:RRGVFUHZV3+3KLOOLSVGULYHJDOYDQL]HG
50 pcs. 3.0 x 12 mm
40 pcs. 3.5 x 10 mm
30 pcs. 3.5 x 12 mm
20 pcs. 3.5 x 20 mm
15 pcs. 4.0 x 20 mm
10 pcs. 4.0 x 25 mm
10 pcs. 5.0 x 32 mm

No.: PU EAN Placement Content Clip Stripe Article

DP8500031 10 M28 - 175 Pieces -


4 035300 767748

268 Subjects to change without notice 09.2016


Ironmongery & Accessories

Threaded screws assortment box


Contents:
‡7KUHDGHGVFUHZV3+3KLOOLSVGULYH
',1JDOYDQL]HG
16 pieces M4 x 10 mm
16 pieces M4 x 12 mm
8 pieces M4 x 20 mm
5 pieces M4 x 25 mm
10 pieces M5 x 20 mm
8 pieces M5 x 25 mm
1XWV',1JDOYDQL]HG
45 pieces M4
18 pieces M5

No.: PU EAN Placement Content Clip Stripe Article

DP8500032 10 M28 - 126 Pieces -


4 035300 767755

Nuts assortment box


Contents:
‡1XWV',1JDOYDQL]HG
50 pcs. M3
40 pcs. M4
30 pcs. M5
18 pcs. M6
9 pcs. M8
3 pcs. M10

No.: PU EAN Placement Content Clip Stripe Article

DP8500033 10 M28 - 150 Pieces -


4 035300 767762

09.2016 Subjects to change without notice 269


Ironmongery & Accessories

Picture hooks assortment box


Contents:
‡3LFWXUHKRRNVEUDVVFRDWHG
15 pieces size 2
10 pieces size 4
6 pieces size 6
‡6SDUHSLQVEUDVVFRDWHG
24 pieces
‡:DOOKRRNVEUDVVFRDWHG
4 pieces 38 mm
• Picture wire
P
‡5LQJEROWVJDOYDQL]HG
24 pieces

No.: PU EAN Placement Content Clip Stripe Article

DP8500034 10 M28 - 84 Pieces -


4 035300 767779

Self-tapping screws and dowels assortment box


Contents:
‡6KHHWPHWDOVFUHZVSDQKHDG3+3KLOOLSVGULYH
galvanized
35 pieces 3.5 x 25 mm
15 pieces 4.2 x 25 mm
‡'RZHOVSODVWLF
20 pieces 5 mm
15 pieces 6 mm
15 pieces 8 mm

No.: PU EAN Placement Content Clip Stripe Article

DP8500035 10 M28 - 100 Pieces -


4 035300 767786

270 Subjects to change without notice 09.2016


Ironmongery & Accessories

Screws and accessories assortment box


Contents:
‡1XWV',1JDOYDQL]HG
30 pieces M4
‡/DUJHGLDPHWHUZDVKHUV',1JDOYDQL]HG
30 pieces 4 mm
‡7KUHDGHGVFUHZVSDQKHDG3+3KLOOLSVGULYHJDOYDQL]HG
20 pieces M4 x 12 mm
10 pieces M4 x 25 mm
‡6KHHWPHWDOVFUHZVILOOLVWHUKHDG3+3KLOOLSVGULYH
galvanized
25 pieces 3.5 x 12 mm
12 pieces 4.2 x 25 mm
‡:RRGVFUHZVFRXQWHUVXQNKHDG3+3KLOOLSVGULYH
galvanized
13 pieces 3.5 x 20 mm
10 pieces 4.0 x 25 mm

No.: PU EAN Placement Content Clip Stripe Article

DP8500036 10 M28 - 150 Pieces -


4 035300 767793

09.2016 Subjects to change without notice 271


Ironmongery & Accessories

Sheet metal screws assortment box


Contents:
‡:RRGVFUHZV3+3KLOOLSVGULYH/LQVHQKHDGJDOYDQL]HG
50 pcs. 2.8 x 12 mm
40 pcs. 3.5 x 10 mm
30 pcs. 3.5 x 12 mm
20 pcs. 3.5 x 20 mm
15 pcs. 4.2 x 20 mm
10 pcs. 4.2 x 25 mm
10 pcs. 4.8 x 32 mm

No.: PU EAN Placement Content Clip Stripe Article

DP8500037 10 M28 - 175 Pieces -


4 035300 767809

Large-diameter washers and spring washers assortment


box
Contents:
‡&LUFOLSV',1%JDOYDQL]HG
76 pieces 4 mm
35 pieces 5 mm
22 pieces 6 mm
16 pieces 8 mm
‡/DUJHGLDPHWHUZDVKHUV',1JDOYDQL]HG
45 pieces 4 mm
25 pieces 5 mm
18 pieces 6 mm
13 pieces 8 mm

No.: PU EAN Placement Content Clip Stripe Article

DP8500038 10 M28 - 250 Pieces -


4 035300 767816

272 Subjects to change without notice 09.2016


Ironmongery & Accessories

Spring washers assortment box


Galvanized
Contents:
200 pcs. M4 - 4 mm
200 pcs. M5 - 5 mm
150 pcs. M6 - 6 mm
100 pcs. M8 - 8 mm
80 pcs. M10 - 10 mm
50 pcs. M12 - 12 mm

No.: PU EAN Placement Content Clip Stripe Article

B34150 6 D22 - 780 Pieces -


4 035300 750955

09.2016 Subjects to change without notice 273


Ironmongery & Accessories

External snap rings assortment box


Contents:
20 pcs. 3 mm
10 pcs. 4 mm
15 pcs. 5 mm
25 pcs. 6 mm
15 pcs. 8 mm
20 pcs. 10 mm
15 pcs. 11 mm
15 pcs. 12 mm
25 pcs. 13 mm
15 pcs. 14 mm
20 pcs. 16 mm
25 pcs. 19 mm
15 pcs. 20 mm
20 pcs. 22 mm
15 pcs. 25 mm
15 pcs. 26 mm
10 pcs. 28 mm
5 pcs. 32 mm

No.: PU EAN Placement Content Clip Stripe Article

B34151 6 D22 - 300 Pieces -


4 035300 750962

274 Subjects to change without notice 09.2016


Ironmongery & Accessories

Internal snap rings assortment box


Contents:
30 pcs. 1.5 mm
30 pcs. 3.0 mm
40 pcs. 5.0 mm
50 pcs. 6.0 mm
50 pcs. 10.0 mm
40 pcs. 12.0 mm
20 pcs. 15.0 mm
20 pcs. 19.0 mm
20 pcs. 22.0 mm

No.: PU EAN Placement Content Clip Stripe Article

B34152 6 D22 - 300 Pieces -


4 035300 750979

09.2016 Subjects to change without notice 275


Ironmongery & Accessories

Springs assortment box


Galvanized
Content:
• Spring:
10 pcs. 7.0 x 12.5 mm
10 pcs. 6.5 x 10.0 mm
10 pcs. 5.5 x 17.0 mm
6 pcs. 9.5 x 16.0 mm
12 pcs. 9.5 x 19.0 mm
8 pcs. 9.0 x 35.0 mm
10 pcs. 5.5 x 38.0 mm
10 pcs. 7.0 x 19.0 mm
• Tension spring
10 pcs. 5.0 x 20.5 mm
10 pcs. 5.5 x 25.5 mm
10 pcs. 6.5 x 22.0 mm
8 pcs. 8.0 x 28.5 mm
10 pcs. 8.0 x 31.5 mm
12 pcs. 8.5 x 47.0 mm
12 pcs. 8.0 x 44.5 mm
12 pcs. 7.0 x 51.0 mm
12 pcs. 4.0 x 79.5 mm
8 pcs. 4.5 x 44.5 mm
10 pcs. 7.0 x 38.0 mm
10 pcs. 8.5 x 36.5 mm

No.: PU EAN Placement Content Clip Stripe Article

B34153 6 D22 - 200 Pieces -


4 035300 750986

276 Subjects to change without notice 09.2016


Ironmongery & Accessories

Grease nipples assortment box


Galvanized
Content:
• Straight
10 pcs. M8 x 1
50 pcs. M6 x 1
10 pcs. M10 x 1
SFV0[
• 45°
5 pcs. M6 x 1
10 pcs. M8 x 1
5 pcs. M10 x 1
• 90°
5 pcs. M6 x 1
5 pcs. M8 x 1
5 pcs. M10 x 1

No.: PU EAN Placement Content Clip Stripe Article

B34154 6 D22 - 110 Pieces -


4 035300 750993

09.2016 Subjects to change without notice 277


Ironmongery & Accessories

Collets assortment box


Black
Contents:
50 pcs. 2 x 20 mm
50 pcs. 3 x 30 mm
30 pcs. 3 x 40 mm
30 pcs. 4 x 30 mm
15 pcs. 4 x 40 mm
20 pcs. 4 x 50 mm
20 pcs. 5 x 40 mm
5 pcs. 5 x 50 mm
5 pcs. 5 x 60 mm
15 pcs. 6 x 40 mm
5 pcs. 6 x 50 mm
4 pcs. 6 x 60 mm
8 pcs. 8 x 40 mm
4 pcs. 8 x 50 mm
4 pcs. 8 x 60 mm
3 pcs. 8 x 80 mm
6 pcs. 10 x 40 mm
6 pcs. 10 x 80 mm

No.: PU EAN Placement Content Clip Stripe Article

B34155 6 D22 - 280 Pieces -


4 035300 751006

278 Subjects to change without notice 09.2016


Ironmongery & Accessories

Washers assortment box


Copper
Contents:
10 pcs. 10.0 x 0.5x1.0 mm
10 pcs. 10.0 x 6.0 x 1.0 mm
10 pcs. 10.0 x 7.0 x 1.0 mm
10 pcs. 12.0 x 8.0 x 1.0 mm
10 pcs. 16.0 x 10.0 x 1.0 mm
SFV[[PP
10 pcs. 17.0 x 11.0 x 1.5 mm
10 pcs. 18.0 x 14.0 x 1.0 mm
10 pcs. 20.0 x 12.0 x 1.5 mm
10 pcs. 20.0 x 12.5 x 1.5 mm
10 pcs. 20.0 x 14.0 x 1.5 mm
10 pcs. 20.0 x 15.0 x 2.0 mm
10 pcs. 22.0 x 16.0 x 2.0 mm
10 pcs. 24.0 x 16.5 x 2.0 mm
SFV[[PP

No.: PU EAN Placement Content Clip Stripe Article

B34157 6 D22 - 150 Pieces -


4 035300 751020

09.2016 Subjects to change without notice 279


Ironmongery & Accessories

Lock nuts assortment box


Galvanized
Contents:
30 pcs. M3
25 pcs. M4
50 pcs. M5
50 pcs. M6
30 pcs. M8
10 pcs. M10

No.: PU EAN Placement Content Clip Stripe Article

B34158 6 D22 - 195 Pieces -


4 035300 751037

Cotter pin assortment box


Galvanized
Contents:
42 pcs. 2.40 x 31 mm
30 pcs. 2.00 x 33 mm
25 pcs. 2.00 x 40 mm
25 pcs. 2.78 x 41 mm
20 pcs. 3.57 x 44 mm
8 pcs. 3.97 x 74 mm

No.: PU EAN Placement Content Clip Stripe Article

B34159 6 D22 - 150 Pieces -


4 035300 751044

280 Subjects to change without notice 09.2016


Ironmongery & Accessories

Cotter pins assortment box


Galvanized
Contents:
150 pcs. 1.6 x 25.4 mm
150 pcs. 2.4 x 25.4 mm
100 pcs. 2.4 x 38.1 mm
75 pcs. 3.2 x 31.2 mm
50 pcs. 3.2 x 50.8 mm
30 pcs. 4.0 x 63.5 mm

No.: PU EAN Placement Content Clip Stripe Article

B34160 6 D22 - 555 Pieces -


4 035300 751051

Wood screws/dowels assortment box


Galvanized
Contents:
• Dowels
40 pcs. 5 mm
30 pcs. 6 mm
16 pcs. 8 mm
12 pcs. 10 mm
• Wooden screws
20 pcs. 4 x 25 mm
8 pcs. 4 x 40 mm
16 pcs. 5 x 30 mm

No.: PU EAN Placement Content Clip Stripe Article

B34161 6 D22 - 142 Pieces -


4 035300 751068

09.2016 Subjects to change without notice 281


Ironmongery & Accessories

Wing nut assortment box


Galvanized
Contents:
56 pcs. M5
48 pcs. M6
42 pcs. M8

No.: PU EAN Placement Content Clip Stripe Article

B34162 6 D22 - 146 Pieces -


4 035300 751075

Shrink-wrap tubing assortment box


Contents:
30 pcs. 2.0 x 40 mm
25 pcs. 2.5 x 40 mm
20 pcs. 3.5 x 40 mm
20 pcs. 5.0 x 40 mm
16 pcs. 7.0 x 80 mm
8 pcs. 10.0 x 80 mm
8 pcs. 13.0 x 85 mm

No.: PU EAN Placement Content Clip Stripe Article

B34165 6 D22 - 127 Pieces -


4 035300 751105

282 Subjects to change without notice 09.2016


Ironmongery & Accessories

Shrinking tube set


Flexible heatshrink tubes with high shrinking capability for
+L)L3&DQWHQQDHDQGZRUNSODFHZLUHVDVZHOODVIRUIDVW
KRXVHKROGUHSDLUVEODFN

No.: PU EAN Placement Content Clip Stripe Article

B34132 24 K32 X 32 Pieces X


4 035300 752775

PZ universal screws assortment box


8QLYHUVDOVFUHZVZLWK3= 3R]LGULYH GULYHFRXQWHUVXQN
KHDGZLWKVOLGHFRDWLQJJDOYDQL]HG
Contents:
150 pcs. 3.0 x 16 mm
120 pcs 3.0 x 20 mm
80 pcs. 3.5 x 25 mm
60 pcs. 3.5 x 30 mm
50 pcs. 4.0 x 30 mm
35 pcs. 4.0 x 35 mm
40 pcs. 4.0 x 40 mm
30 pcs 4.5 x 50 mm
30 pcs. 5.0 x 40 mm
25 pcs. 5.0 x 50 mm
25 pcs. 5.0 x 60 mm
15 pcs. 6.0 x 60 mm

No.: PU EAN Placement Content Clip Stripe Article

DP8500079 6 M57 - 660 Pieces -


4 035300 784318

09.2016 Subjects to change without notice 283


Ironmongery & Accessories

TX universal screws assortment box


8QLYHUVDOVFUHZVZLWK7;VWDUKHDGGULYHFRXQWHUVXQNKHDG
ZLWKVOLGHFRDWLQJJDOYDQL]HG
Contents:
150 pcs. 3.0 x 16 mm
20 pcs. 3.0 x 20 mm
80 pcs. 3.5 x 25 mm
60 pcs. 3.5 x 30 mm
50 pcs. 4.0 x 30 mm
35 pcs. 4.0 x 35 mm
40 pcs. 4.0 x 40 mm
30 pcs. 4.5 x 50 mm
30 pcs. 5.0 x 40 mm
25 pcs. 5.0 x 50 mm
25 pcs. 5.0 x 60 mm
15 pcs. 6.0 x 60 mm

No.: PU EAN Placement Content Clip Stripe Article

DP8500080 6 M57 - 660 Pieces -


4 035300 819324

284 Subjects to change without notice 09.2016


Ironmongery & Accessories

Universal screws assortment box


8QLYHUVDOVFUHZVZLWK3= 3R]LGULY GULYHFRXQWHUVXQNKHDG
ZLWKVOLGHFRDWLQJJDOYDQL]HG
Contents:
200 pcs. 3.0 x 12 mm
200 pcs. 3.0 x 16 mm
100 pcs. 3.0 x 20 mm
70 pcs. 3.5 x 20 mm
60 pcs. 3.5 x 25 mm
50 pcs. 3.5 x 30 mm
45 pcs. 4.0 x 25 mm
45 pcs. 4.0 x 30 mm
40 pcs. 4.0 x 35 mm
40 pcs. 4.0 x 40 mm
30 pcs. 4.5 x 40 mm
20 pcs. 4.5 x 50 mm

No.: PU EAN Placement Content Clip Stripe Article

DP8500084 6 M57 - 900 Pieces -


4 035300 784325

09.2016 Subjects to change without notice 285


Ironmongery & Accessories

Universal screws assortment box


8QLYHUVDOVFUHZVZLWK7;VWDUKHDGGULYHFRXQWHUVXQNKHDG
ZLWKVOLGHFRDWLQJJDOYDQL]HG
Contents:
200 pcs. 3.0 x 12 mm
200 pcs. 3.0 x 16 mm
100 pcs. 3.0 x 20 mm
70 pcs. 3.5 x 20 mm
60 pcs. 3.5 x 25 mm
50 pcs. 3.5 x 30 mm
45 pcs. 4.0 x 25 mm
45 pcs. 4.0 x 30 mm
40 pcs. 4.0 x 35 mm
40 pcs. 4.0 x 40 mm
30 pcs. 4.5 x 40 mm
20 pcs. 4.5 x 50 mm

No.: PU EAN Placement Content Clip Stripe Article

DP8500085 6 M57 - 900 Pieces -


4 035300 819331

286 Subjects to change without notice 09.2016


Ironmongery & Accessories

TX universal screws assortment box


8QLYHUVDOVFUHZVZLWK7;VWDUKHDGGULYHFRXQWHUVXQNKHDG
ZLWKVOLGHFRDWLQJJDOYDQL]HG
Contents:
SFV[PP
SFV[PP
SFV[PP
SFV[PP
SFV[PP
SFV[PP
SFV[PP
SFV[PP
SFV[PP
SFV[PP

No.: PU EAN Placement Content Clip Stripe Article

DP8500086 8 G30 - 1700 Pieces -


4 035300 893676

09.2016 Subjects to change without notice 287


Ironmongery & Accessories

TX universal screws and dowels assortment box


Content:
‡8QLYHUVDOVFUHZVZLWK7;VWDUKHDGGULYHFRXQWHUVXQN
KHDGZLWKVOLGHFRDWLQJJDOYDQL]HG
SFV[PP
SFV[PP
SFV[PP
SFV[PP
SFV[PP
SFV[PP
SFV[PP
SFV[PP
• Dowels
60 pcs. 6 mm
30 pcs. 8 mm

No.: PU EAN Placement Content Clip Stripe Article

DP8500087 8 G30 - 580 Pieces -


4 035300 893683

Mounting set for lightweight curtains


For use in wood and when used with dowels in solid brick
Contents:
‡6ORWWHGVFUHZKRRNVJDOYDQL]HG
8 pieces 5.8 x 80 mm
‡$OOSXUSRVHGRZHOVSRO\SURS\OHQH
8 pieces 8 x 50 mm

No.: PU EAN Placement Content Clip Stripe Article

DY5110001 8 K26 X 16 pieces X


4 035300 917587

288 Subjects to change without notice 09.2016


Ironmongery & Accessories

Mounting set for curtains


For use in wood and when used with dowels in solid brick
Contents:
‡&XUYHGVFUHZKRRNVJDOYDQL]HG
16 pieces 4.0 x 60 mm
‡6\QWKHWLFGRZHOVSRO\DPLGH
16 pieces 6 x 30 mm

No.: PU EAN Placement Content Clip Stripe Article

DY5110002 8 K26 X 32 pieces X


4 035300 917600

Mounting kit for decorations


For use in wood and when used with dowels in solid and
perforated brick
Contents:
‡5LQJVFUHZVZLWKFROODUJDOYDQL]HG
4 pieces 5.0 x 62 x 14 mm
‡$OOSXUSRVHGRZHOVSRO\SURS\OHQH
4 pieces 8 x 50 mm

No.: PU EAN Placement Content Clip Stripe Article

DY5110003 8 K26 X 8 pieces X


4 035300 917617

09.2016 Subjects to change without notice 289


Ironmongery & Accessories

Mounting set for lamps


For use in wood and when used with dowels in solid and
perforated brick
Contents:
‡6FUHZKRRNVFXUYHGZLWKFROODUJDOYDQL]HG
4 pieces 5.0 x 75 mm
‡$OOSXUSRVHGRZHOVSRO\SURS\OHQH
4 pieces 8 x 50 mm

No.: PU EAN Placement Content Clip Stripe Article

DY5110004 8 K26 X 8 pieces X


4 035300 917624

Mounting set for picture frames


For use in wood and when used with dowels in solid and
perforated brick
Contents:
‡6ORWWHGVFUHZKRRNVJDOYDQL]HG
4 pieces 5.0 x 65 mm
‡$OOSXUSRVHGRZHOVSRO\SURS\OHQH
4 pieces 8 x 50 mm

No.: PU EAN Placement Content Clip Stripe Article

DY5110005 8 K26 X 8 pieces X


4 035300 917631

290 Subjects to change without notice 09.2016


Ironmongery & Accessories

Mounting kit for surface-mounted sockets and switches


For use in wood and when used with dowels in solid and
perforated brick
Contents:
‡8QLYHUVDOVFUHZVFRXQWHUVXQNKHDG7;JDOYDQL]HG
32 pieces 4.5 x 50 mm
‡$OOSXUSRVHGRZHOVSRO\SURS\OHQH
32 pieces 6 x 36 mm

No.: PU EAN Placement Content Clip Stripe Article

DY5110006 8 K26 X 64 pieces X


4 035300 917648

Mounting kit for radiator brackets


For use in wood and when used with dowels in solid and
perforated brick
Contents:
‡+H[DJRQDOVFUHZVJDOYDQL]HG
4 pieces 8.0 x 70 mm
‡:DVKHUVJDOYDQL]HG
4 pieces 8.4 x 16 mm
‡$OOSXUSRVHGRZHOVSRO\SURS\OHQH
4 pieces 10 x 60 mm

No.: PU EAN Placement Content Clip Stripe Article

DY5110007 8 K26 X 12 pieces X


4 035300 917655

09.2016 Subjects to change without notice 291


Ironmongery & Accessories

Mounting set for picture frames


For use in wood and when used with dowels in solid brick
Contents:
‡/KRRNVJDOYDQL]HG
16 pieces 3.8 x 60 mm
‡6\QWKHWLFGRZHOVSRO\DPLGH
16 pieces 6 x 30 mm

No.: PU EAN Placement Content Clip Stripe Article

DY5110008 8 K26 X 32 pieces X


4 035300 917662

Mounting kit for exterior decorations


For use in wood and when used with dowels in solid brick
Contents:
‡5LQJKRRNVVWDLQOHVVVWHHO$
8 pieces 4.0 x 30 x 14 mm
‡6\QWKHWLFGRZHOVSRO\DPLGH
8 pieces 6 x 30 mm

No.: PU EAN Placement Content Clip Stripe Article

DY5110010 8 K26 X 16 pieces X


4 035300 917686

292 Subjects to change without notice 09.2016


Ironmongery & Accessories

Mounting kit for letterboxes


For use in wood and when used with dowels in solid and
perforated brick
Contents:
‡8QLYHUVDOVFUHZVFRXQWHUVXQNKHDG3R]LGULYGULYH
stainless steel A2
8 pieces 4.0 x 50 mm
‡$OOSXUSRVHGRZHOVSRO\SURS\OHQH
8 pieces 6 x 36 mm

No.: PU EAN Placement Content Clip Stripe Article

DY5110011 8 K26 X 16 pieces X


4 035300 917693

Mounting kit for outdoor lights small


For use in wood and when used with dowels in solid brick
Contents:
‡8QLYHUVDOVFUHZVFRXQWHUVXQNKHDG3R]LGULYGULYH
stainless steel A2
8 pieces 5.0 x 60 mm
‡6\QWKHWLFGRZHOVSRO\DPLGH
8 pieces 8 x 40 mm

No.: PU EAN Placement Content Clip Stripe Article

DY5110012 8 K26 X 16 pieces X


4 035300 917709

09.2016 Subjects to change without notice 293


Ironmongery & Accessories

Mounting kit for outdoor lights large


For use in wood and when used with dowels in solid and
perforated brick
Contents:
‡8QLYHUVDOVFUHZVFRXQWHUVXQNKHDG3R]LGULYGULYH
stainless steel A2
6 pieces 5.0 x 80 mm
‡$OOSXUSRVHGRZHOVSRO\SURS\OHQH
6 pieces 8 x 50 mm

No.: PU EAN Placement Content Clip Stripe Article

DY5110013 8 K26 X 12 pieces X


4 035300 917716

Key accessories set


For an organised key box
Contents:
‡&DUDELQHUKRRNVRUWHGIRUNH\ULQJDOXPLQLXP
4 pcs.
‡.H\ULQJIRUODEHOOLQJZLWK6KRRN
FRORXUHGSRO\HWK\OHQH
6 pcs.
‡.H\ULQJVPPDVVRUWHGFRORXUVSODVWLF
6 pcs.

No.: PU EAN Placement Content Clip Stripe Article

DY5110015 8 K26 X 16 pieces X


4 035300 917730

294 Subjects to change without notice 09.2016


Ironmongery & Accessories

Office supplies set


Small helpers for a tidy office
Content:
‡0XOWLOLSVVWHHO
6 pcs. 19 mm
‡6DPSOHEDJFODPSVEUDVV
50 pcs. 15 mm
‡2IILFHFODPSVFRORXUHGVWHHO
50 pcs. 26 mm

No.: PU EAN Placement Content Clip Stripe Article

DY5110016 8 K26 X 104 pieces X


4 035300 917747

Veneer pins, sorted by colour


For the perfect organisation on every pinboard
Content:
‡9HQHHUQHHGOHVVRUWHGE\FRORXUSRO\VW\UHQHZLWKVWHHOSLQ
150 pieces

No.: PU EAN Placement Content Clip Stripe Article

DY5110017 8 K26 X 150 Pieces X


4 035300 917754

09.2016 Subjects to change without notice 295


Timber connectors

Post corner, single


UHFHSWDFOHVKRWGLSJDOYDQL]HG
Contents: 1 piece

Clip Stripe
No.: PU EAN Placement Size Content
Article

HV4241 5 SP - 91 x 200 x 200 mm 1 Pieces -


4 035300 916849

Post corner, double


UHFHSWDFOHVKRWGLSJDOYDQL]HG
Contents: 1 piece

Clip Stripe
No.: PU EAN Placement Size Content
Article

HV4242 5 SP - 91 x 200 x 200 x 200 mm 1 Pieces -


4 035300 916856

296 Subjects to change without notice 09.2016


Timber connectors

Post connector, single


UHFHSWDFOHVKRWGLSJDOYDQL]HG
Contents: 1 piece

Clip Stripe
No.: PU EAN Placement Size Content
Article

HV4243 5 SP - 91 x 305 x 200 mm 1 Pieces -


4 035300 916863

Post connector, double


UHFHSWDFOHVKRWGLSJDOYDQL]HG
Contents: 1 piece

Clip Stripe
No.: PU EAN Placement Size Content
Article

HV4244 5 SP - 91 x 305 x 200 x 200 mm 1 Pieces -


4 035300 916870

09.2016 Subjects to change without notice 297


Timber connectors

Firewood rack
For 60 x 80 mm wood vertical and for 40 x 60 mm
KRUL]RQWDOGLPHQVLRQV[[PPPDWHULDO
KRWGLSJDOYDQL]HGFRQWHQWVSLHFH

No.: PU EAN Placement Content Clip Stripe Article

HV4245 5 SP - 1 Pieces -
4 035300 916887

298 Subjects to change without notice 09.2016


Garden accessories

Frankfurt shovel
6L]HKDUGHQHGDVSHU',1SRZGHUFRDWHGZLWKKDQGOH
length approx. 1.30 m

No.: PU EAN Placement Clip Stripe Article

B40605 15 SP - -
4 004722 601367

Holstein shovel
6L]HKDUGHQHGDVSHU',1SRZGHUFRDWHGZLWKKDQGOH
length approx. 1.30 m

No.: PU EAN Place Clip Stripe Article

B40610 15 SP - -
4 004722 601374

Stainless steel garden spade


5XVWIUHHSROLVKHGEODGHOHDIZLGWKPPOHDIKHLJKW
PPDVK7KDQGOHVRFNHWW\SHVZDQQHFNWRWDOOHQJWK
approx. 115 cm

No.: PU EAN Placement Clip Stripe Article

B40650 5 SP - -
4 004722 624779

09.2016 Subjects to change without notice 301


Garden accessories

Holstein shovel
6L]HKDUGHQHGDFF',1SRZGHUFRDWHG

No.: PU EAN Placement Clip Stripe Article

B40611 15 SP - -
4 035300 917594

Folding spade with belt pocket


IXQFWLRQVKRHVSDGHVDZZLGWKFPZLWKEHYHOOHG
HGJHWRWDOOHQJWKFPIROGHGOHQJWKFPEURDG
WULDQJXODUKDQGOHIRUFRPIRUWLQFOXGLQJDFRQYHQLHQWVWRUDJH
bag to attach to belt

No.: PU EAN Placement Clip Stripe Article

B40450 10 M30 - X
4 004722 624601

Leaf rake
3ODVWLFFPZLWKKDQGOHOHQJWKDSSUR[PWLQHV

No.: PU EAN Placement Clip Stripe Article

B41475 10 SP - -
4 004722 618204

302 Subjects to change without notice 09.2016


Garden accessories

Leaf rake
*DOYDQL]HGDGMXVWDEOHZLGWKZLWKKDQGOHDSSUR[P

No.: PU EAN Placement Clip Stripe Article

B41202 5 SP - -
4 004722 561012

Garden rake
WLQHVSRZGHUFRDWHGZLWKKDQGOHDSSUR[P

No.: PU EAN Placement Clip Stripe Article

B41201 5 SP - -
4 004722 561005

Grubber
WLQHVSRZGHUFRDWHGZLWKKDQGOHDSSUR[P

No.: PU EAN Placement Clip Stripe Article

B41203 5 SP - -
4 004722 561029

09.2016 Subjects to change without notice 303


Garden accessories

Double hook
WLQHVSRZGHUFRDWHGZLWKKDQGOHDSSUR[P

No.: PU EAN Placement Clip Stripe Article

B41204 5 SP - -
4 004722 561036

Garden hoe
FPSRZGHUFRDWHGZLWKKDQGOHDSSUR[P

No.: PU EAN Placement Clip Stripe Article

B41205 5 SP - -
4 004722 561043

Fruit picker
Galvanized

No.: PU EAN Placement Clip Stripe Article

B41525 30 M40 - -
4 004722 564778

304 Subjects to change without notice 09.2016


Garden accessories

Telescopic handle
([WHQGDEOHOHQJWKPD[PUHWUDFWHGOHQJWKP
VXUIDFHUHGSRZGHUFRDWHGPDWHULDOVKHHWVWHHO

No.: PU EAN Placement Clip Stripe Article

B41900 12 SP - -
4 004722 582123

Terrace broom
FP39&EUXVKHVZLWKKDQGOHDSSUR[P

No.: PU EAN Placement Clip Stripe Article

B46030 5 SP - -
4 004722 608939

09.2016 Subjects to change without notice 305


Garden accessories

Broom, V bristles
0DGHLQ*HUPDQ\ZLGWKFPZLWKKDQGOH
FP[¡PPKROGHUIRUPHWDORUZRRGKDQGOHZLWK
¡PPWR¡PPEOXQWRUZLWKWKUHDGFOHDQVLQGHHS
MRLQWVDQGJDSVZHOOVXLWHGWRXQHYHQVWUXFWXUHVRQO\KDOI
WKHSUHVVLQJIRUFHRIDVWDQGDUGEURRPUHTXLUHGZRUNVZLWK
QRUPDOKRUL]RQWDOVZHHSLQJPRWLRQV SXVKLQJDQGSXOOLQJ 
improved cleaning action due to axial pushing effect

No.: PU EAN Placement Clip Stripe Article

FLORP46031 12 SP. - -
4 035300 900084

Broom with scrape level


)RUUHPRYLQJVQRZDQGLFHRXWVLGH[GRXEOHURZHODVWRQ
LQVLGHGRXEOHURZVWHHOZLUHFPZLGWKEURRPKHDGPDGH
RIEHHFKZRRGZLWKVFUDSHUHGJHIURPPHWDOZLWKPHWDO
KROGHUVKDIWDOUHDG\IL[HG VKDIWFP[¡PP

No.: PU EAN Placement Clip Stripe Article

FLORP46032 5 SP. - -
4 035300 905430

306 Subjects to change without notice 09.2016


Garden accessories

Joint brush
%UXVKKHDGVL]H[[PPPDGHRIEHHFKZRRG
VKDIWOHQJWKFPHIIRUWOHVVHDV\WRFOHDQMRLQWVLQWKH
JDUGHQRQVLGHZDONVSDWLRVRUGULYHZD\V
(e.g. removal of moss)

No.: PU EAN Placement Clip Stripe Article

B46060 5 SP. - -
4 004722 622515

Joint brush with steel scraper


%UXVKKHDGVL]H[[PPPDGHRIEHHFKZRRG
VKDIWOHQJWKFPHIIRUWOHVVHDV\WRFOHDQMRLQWVLQWKH
JDUGHQRQVLGHZDONVSDWLRVRUGULYHZD\V
(e.g. removal of moss)

No.: PU EAN Placement Clip Stripe Article

B46061 5 SP - -
4 004722 627619

09.2016 Subjects to change without notice 307


Garden accessories

Weeding brush/scraper telescopic handle, 3 pieces


Telescopic shaft with two exchangeable heads for joint
FOHDQLQJFRQWHQWVH[WHQGDEOHWHOHVFRSLFVKDIWPDGHRI
PHWDOZLWKDOHQJWKRIFPVODSMRLQWFOHDQHUPDGHRI
hardened steel and joint brush with steel scraper and
brushes made of steel wire (in line 3 x 10). A matching
display can be ordered under VH47112

No.: PU EAN Placement Clip Stripe Article

B46062 28 SP - -
4 004722 638141

Plate joint cleaner


Plastic handle

No.: PU EAN Placement Clip Stripe Article

B42560 30 M12 - X
4 004722 597028

Small brush
3RZGHUFRDWHGSODVWLFKDQGOH

No.: PU EAN Placement Clip Stripe Article

B42460 20 G48 - X
4 004722 578508

308 Subjects to change without notice 09.2016


Garden accessories

Small grubber
3RZGHUFRDWHGSODVWLFKDQGOH

No.: PU EAN Placement Clip Stripe Article

B42463 20 M74 - X
4 004722 578539

Small double hook


3RZGHUFRDWHGSODVWLFKDQGOH

No.: PU EAN Placement Clip Stripe Article

B42464 20 M46 - X
4 004722 578546

Trowel
3RZGHUFRDWHGSODVWLFKDQGOH

No.: PU EAN Placement Clip Stripe Article

B42465 20 M33 - X
4 004722 578553

09.2016 Subjects to change without notice 309


Garden accessories

Trowel
3ODVWLFDQWKUDFLWH

No.: PU EAN Placement Clip Stripe Article

B42475 10 K33 - X
4 004722 623246

Multi-purpose shovel
3ODVWLFEOXH

No.: PU EAN Placement Clip Stripe Article

B42480 12 M53 - X
4 004722 623260

Dustpan
6WDEOHSODVWLF\HOORZSDFNDJHGLQDGLVSOD\

No.: PU EAN Placement Clip Stripe Article

B42666 24 D35 - X
4 004722 636406

310 Subjects to change without notice 09.2016


Garden accessories

Trowel
6WDEOHSODVWLFJUHHQSDFNHGLQDGLVSOD\

No.: PU EAN Placement Clip Stripe Article

B42667 36 D35 - X
4 004722 636413

Culture equipment
6WDEOHSODVWLFRUDQJHSDFNHGLQDGLVSOD\

No.: PU EAN Placement Clip Stripe Article

B42668 32 D35 - X
4 004722 637571

Weeder
6WDEOHSODVWLFDQWKUDFLWHSDFNHGLQDGLVSOD\

No.: PU EAN Placement Clip Stripe Article

B42669 60 D35 - X
4 004722 636543

09.2016 Subjects to change without notice 311


Garden accessories

Coconut coir compact 1 L


1DWXUDOSRWWLQJVRLOLQFRPSDFWIRUPDWFOHDUDQGOLJKWLQ
ZHLJKWFRPSDUHGWRFRPPHUFLDOO\DYDLODEOHEDJVRIVRLO
SHDWIUHHIURPFRFRQXWFRLUSODQWVSHFLILFIHUWLOLVHG

No.: PU EAN Placement Clip Stripe Article

FLOR79098 32 D24 - -
4 035300 915675

Coconut coir compact 10 L


1DWXUDOSRWWLQJVRLOLQFRPSDFWIRUPDWFOHDUDQGOLJKWLQ
ZHLJKWFRPSDUHGWRFRPPHUFLDOO\DYDLODEOHEDJVRIVRLO
SHDWIUHHIURPFRFRQXWFRLUSODQWVSHFLILFIHUWLOLVHG

No.: PU EAN Placement Clip Stripe Article

FLOR79099 10 K20 - -
4 035300 915682

Shovel and rake set


&RQVLVWLQJRIVFRRSDQGUDNHSODVWLFFRQYHQLHQWWRXVHIRU
VPDOODUHDVOLNHWKHJXWWHURUWRFROOHFWGHIRODWLRQRUWUDVK
UDNHHDV\WRVWRZLQVFRRSOHQJWKFP

No.: PU EAN Placement Clip Stripe Article

B42727 12 G97. - -
4 004722 636444

312 Subjects to change without notice 09.2016


Garden accessories

Flower bulbs set, 3 pieces


&RQVLVWVRIDIORZHULQJSODQWDIORZHUER[DQGDGLJJLQJ
GHYLFHVXLWDEOHIRUWKHSODQWLQJIORZHUEXOEVRURWKHUVPDOO
plants

No.: PU EAN Placement Clip Stripe Article

B42571 10 M30. - -
4 004722 637168

Tie wire
3ODVWLFFRYHUHGPJUHHQZLWKFXWWHU

No.: PU EAN Placement Clip Stripe Article

B43030 15 M42 X X
4 004722 618235

Plant clips small


SFVPP[PPZHDWKHUUHVLVWDQWVWDEOHSODVWLF

No.: PU EAN Placement Clip Stripe Article

B43130 24 K20 X X
4 004722 623284

09.2016 Subjects to change without notice 313


Garden accessories

Garden apron
)RUVWRULQJWULPPHGJDUGHQZDVWHVXFKDVSHWDOVVPDOO
WZLJVZLWKHUHGOHDYHVGLUHFWO\LQWRWKHDSURQ$IWHUZRUNWKH
DSURQFDQEHRSHQHGDWWKHERWWRPRIWKHEDJZLWKDQ
DGMXVWDEOHVKRXOGHUVWUDSKLJKTXDOLW\'SRO\HVWHU
VL]HFP[FPRSHQ
Dimension 45 cm x 45 cm closed

No.: PU EAN Placement Clip Stripe Article

B46726 20 M60. - -
4 004722 636451

Gardening gloves
&RWWRQZLWKHPERVVHGGRW39&SDOPVJUHHQ

No.: PU EAN Placement Size Clip Stripe Article

B46300 24 K28 X 7 X
4 035300 708758

B46305 24 K28 X 9 X
4 035300 708765

314 Subjects to change without notice 09.2016


Garden accessories

Gardening gloves, 3 pairs


6L]HFRWWRQZLWKHPERVVHGGRW39&SDOPVHODVWLFILQHNQLW
FXIISLHFHVRQHSDLUHDFKLQJUHHQSXUSOHDQGSLQNZLWK
white dots

No.: PU EAN Placement Clip Stripe Article

B46356 12 K16 X X
4 004722 637083

Designer gardening gloves


$VVRUWHGFRORXUVSDWWHUQVZLWKSLHFHVLQHDFKVDOHVXQLW
cotton with embossed dot palms

No.: PU EAN Placement Size Content Clip Stripe Article

B46357 12 K16 X 7 1 X
4 035300 900039

B46358 12 K16 X 8 1 X
4 035300 900046

09.2016 Subjects to change without notice 315


Garden accessories

Mini shears set, 2 pieces


&RQWHQWV[PLQLIORZHUSUXQHU[PLQLWULPPHUSUXQHU
ZLWKFRORXUFRDWHGEODGHHUJRQRPLFDOO\VKDSHGVRIWKDQGOH
WKXPERSHUDWHGVDIHW\ORFNOLJKWDQGKDQG\
FRORXUVJUHHQSXUSOHSLQN
DVVRUWHGFRORXUVFRORXUVHDFKZLWKLQRQHXS

No.: PU EAN Placement Clip Stripe Article

B44500 12 K20. X X
4 004722 636178

Mini flower pruners in display box


&XWWLQJSRZHU¡PPZLWKVWDLQOHVVVWHHOEODGHVHUJRQRPL-
FDOO\VKDSHGVRIWKDQGOHWKXPERSHUDWHGVDIHW\ORFNVXLWDE-
OHIRUFXWWLQJWKLQQHUEUDQFKHVDQGIORZHUVOLJKWDQGKDQG\

No.: PU EAN Placement Clip Stripe Article

FLOR70367 20 D31 - -
4 035300 756353

316 Subjects to change without notice 09.2016


Garden accessories

Mini trimming shears in display box


&XWWLQJSRZHU¡PPZLWKVWDLQOHVVVWHHOEODGHV
HUJRQRPLFDOO\VKDSHGVRIWKDQGOHWKXPERSHUDWHGVDIHW\
ORFNVXLWDEOHIRUFXWWLQJWKLQQHUEUDQFKHVDQGIORZHUVOLJKW
and handy

No.: PU EAN Placement Clip Stripe Article

FLOR70368 20 D31 - -
4 035300 756346

Bypass secateurs
&XWWLQJSRZHU¡PPHUJRQRPLFDOO\VKDSHGDQGGLPSOHG
FRPSRQHQWKDQGOHWKXPERSHUDWHGVDIHW\ORFNVOLGLQJ
MRLQWIRURSWLPXPOHYHUDJHDQJOHGFXWWLQJKHDGDQGUXEEHU
VKRFNDEVRUEHUVIRUHDV\RQWKHMRLQWVZRUNVXLWDEOHIRU
right-handed and left-handed persons

No.: PU EAN Placement Clip Stripe Article

FLOR70365 12 D19 - -
4 035300 737703

09.2016 Subjects to change without notice 317


Garden accessories

Flower pruners
&XWWLQJSRZHU¡PPHUJRQRPLFDOO\VKDSHGDQGGLPSOHG
FRPSRQHQWKDQGOHWKXPERSHUDWHGVDIHW\ORFNVOLGLQJ
MRLQWIRURSWLPXPOHYHUDJHDQJOHGFXWWLQJKHDGDQGUXEEHU
VKRFNDEVRUEHUVIRUHDV\RQWKHMRLQWVZRUNVXLWDEOHIRU
right-handed and left-handed persons

No.: PU EAN Placement Clip Stripe Article

FLOR70366 12 D19 - -
4 035300 737710

Garden shears Bypass


&XWWLQJSHUIRUPDQFH¡PPPPOHQJWKEODGHVRI
FDUERQVWHHORSHQLQJZLGWKDGMXVWDEOHLQWZRVWHSV
RQHKDQGVDIHW\FORVXUHFRPSRQHQWKDQGOH

No.: PU EAN Placement Clip Stripe Article

B44213 10 K30 X X
4 004722 636420

318 Subjects to change without notice 09.2016


Garden accessories

Garden shears Amboss


&XWWLQJSHUIRUPDQFH¡PPPPOHQJWKEODGHVRI
FDUERQVWHHORSHQLQJZLGWKDGMXVWDEOHLQWZRVWHSV
RQHKDQGVDIHW\FORVXUHFRPSRQHQWKDQGOH

No.: PU EAN Placement Clip Stripe Article

B44214 10 K30 X X
4 004722 636437

Garden shears set


%\SDVVVKHDUV¡PPFXWWLQJFDSDFLW\DQYLOVKHDUV
¡PPVOLSUHVLVWDQWDQGFRPIRUWDEOHKDQGOHSUDFWLFDO
RQHKDQGQRQVWLFNFRDWHGEODGHV

No.: PU EAN Placement Clip Stripe Article

FLOR70349 10 K57 X X
4 035300 915668

09.2016 Subjects to change without notice 319


Garden accessories

Secateurs
&DVWDOXPLQLXPZLWKVWHHOEODGHVGLSFRDWHGKDQGOH

No.: PU EAN Placement Clip Stripe Article

B44200 20 M27 - -
4 004722 597004

Bypass pruning shears


&XWWLQJFDSDFLW\PD[¡PPRYHUDOOOHQJWKDSSUR[
FPFDUERQVWHHOEODGHRYDOSDLQWHGVWHHOWXEHV33
handles

No.: PU EAN Placement Clip Stripe Article

B44021 12 G70 - -
4 004722 637120

Amboss pruning shears


&XWWLQJFDSDFLW\PD[¡PPRYHUDOOOHQJWKDSSUR[
FPFDUERQVWHHOEODGHRYDOSDLQWHGVWHHOWXEHV33
handles

No.: PU EAN Placement Clip Stripe Article

B44022 12 G70 - -
4 004722 637137

320 Subjects to change without notice 09.2016


Garden accessories

Hedge trimmer
7RWDOOHQJWKDSSUR[FPFDUERQVWHHOEODGHVKDUGHQHG
RYDOSDLQWHGVWHHOWXEHV33KDQGOHV

No.: PU EAN Placement Clip Stripe Article

B44361 12 G60 - -
4 004722 637144

Aluminium gripping shears


&XWWLQJFDSDFLW\PD[¡PPFXWWLQJVDUHKHOGE\KROGLQJ
GHYLFHDSSOLFDWLRQIRUURVHFXWIRUSURWHFWLRQDJDLQVWWKRUQV
IUXLWWUHHVRUODZQVLQKDUGWRUHDFKSODFHVHJIRUVKUXEV
RUEXVKHVRUDVDQLGHDOKHOSHUIRUFXWWLQJWKHJDUGHQSRQG
WRWDOOHQJWKDSSUR[FPFXWWLQJEODGHPDGHRI6.VWHHO
KDUGHQHGDQGQRQVWLFNFRDWHGORZHUEODGHPDGHRIFDUERQ
VWHHOFKURPLXPSODWHGDQRGLVHGDOXPLQLXPWXEHZLWKQ\ORQ
handles

No.: PU EAN Placement Clip Stripe Article

B44348 6 SP. - -
4 004722 637106

Hand grass shears


'LSFRDWHGZLWKORFNLQJGHYLFH

No.: PU EAN Placement Clip Stripe Article

B44350 30 M42 - -
4 004722 596991

09.2016 Subjects to change without notice 321


Garden accessories

Boxwood cutter
)RUGRLQJWRSLDU\ZRUNRQEHHFKWUHHVDOVRIRUSUXQLQJ
JUDVVIORZHUVIORZHUVDQGWKLQEUDQFKHV
XSWR¡PPKDQG\VOLSUHVLVWDQW
FRPSRQHQWKDQGOHZLWKVDIHW\ORFNZLWKKHDUWVKDSHG
VSULQJE\SDVVFXWWLQJV\VWHPFDUERQVWHHOWRWDOOHQJWK
330 mm

No.: PU EAN Placement Clip Stripe Article

FLORP10781 6 M45. X X
4 035300 907328

Folding saw
Folding saw with sharp teeth
DSSUR[PPHUJRQRPLFFRPSRQHQWKDQGOHZLWK
safety hook

No.: PU EAN Placement Clip Stripe Article

B44425 12 M20 X X
4 004722 624663

322 Subjects to change without notice 09.2016


Garden accessories

Grass shears with handle


7KHOHQJWKFDQEHDGDSWHGWRWKHERG\VL]HKDQGKHOGIRU
DQXSULJKWEDFNIULHQGO\ERG\VXSSRUWZLWKDFXWHGJHFXW
FDUERQEODGHVZLWKQRQVWLFNFRDWLQJPOHQJWKZLWKDQ
adjustable angle of inclination of the grip form handle for
HDV\JXLGLQJRQHKDQGZLWKUXQQLQJZKHHOV

No.: PU EAN Placement Clip Stripe Article

FLORP44349 12 SP. X -
4 035300 904334

Garden knife
%ODGHVRIVWDLQOHVVVWHHOEODGHOHQJWKDSSUR[PP
EODGHWKLFNQHVVPPWRWDOOHQJWKDSSUR[PP
HUJRQRPLFDOO\VKDSHGVOLSSURRIFRPSRQHQWKDQGOHORZ
ZHLJKWRIRQO\JLQFOXGLQJNQLIHVKHDWKZLWKEHOWORRS

No.: PU EAN Placement Clip Stripe Article

B40550 12 D19 - -
4 004722 632590

09.2016 Subjects to change without notice 323


Garden accessories

Herb scissors
EODGHVPDGHRIVWDLQOHVVVWHHOWKHUHIRUHLWLVSRVVLEOHWR
JULQGILYHWLPHVPRUHKHUEVDWRQFHWKDQXVXDOIRUFKLYHV
EDVLOSDUVOH\HWFLQFOXGLQJUXEEHUFOHDQVHUVWRUHPRYHWKH
herbs between the blade 2-component handle 215 mm long

No.: PU EAN Placement Clip Stripe Article

FLORP44430 12 D12. X X
4 035300 904327

Spiral plant stake


0DGHIURPJDOYDQL]HGURXQGVWHHOPPIRUWRPDWRHV
FOLPELQJVWUDZEHUULHVDQGVLPLODUQRW\LQJWRSODQWVUHTXLUHG

No.: PU EAN Placement Clip Stripe Article

B43700 20 SP - -
4 004722 561135

324 Subjects to change without notice 09.2016


Garden accessories

Multifunction grill brush


:LUHEUXVKZLWKEUDVVEULVWOHVFRDUVHFOHDQLQJSDGVFUDSHU

No.: PU EAN Placement Clip Stripe Article

B46250 12 K30 - -
4 004722 622959

Wooden mousetrap
SFVZRRGHQURFNHUZLWKEDLWKROGHUVWURQJVSULQJVWDEOH
VWULNHUEDUPDGHRIRDN

No.: PU EAN Placement Clip Stripe Article

B46505 25 M44 X X
4 004722 618259

Wood rat trap


:RRGHQURFNHUZLWKEDLWKROGHUVWURQJVSULQJVWDEOHVWULNHU
EDUPDGHRIRDN

No.: PU EAN Placement Clip Stripe Article

B46600 25 M27 X X
4 004722 618266

09.2016 Subjects to change without notice 325


Garden accessories

Flower sprayer
POFRORXUDVVRUWPHQW

No.: PU EAN Placement Clip Stripe Article

B45025 80 SP - -
4 004722 618242

Pressurised garden sprayer


OLWUHZLWKVWDEOHSUHVVXUHWDQNVYHU\VPRRWKSRZHUIXO
SXPSDGMXVWDEOHEUDVVQR]]OHZLWKSUHVVXUHUHOLHIYDOYH

No.: PU EAN Placement Clip Stripe Article

B45041 15 SP - -
4 004722 624540

Pressurised garden sprayer


OLWUHVWDEOHSUHVVXUHWDQNVPDGHRIKLJKTXDOLW\SODVWLF
VPRRWKSXPSKRVHOHQJWKDERXWFPLQMHFWLRQ
PRXOGHGSODVWLFWXEHDERXWFPDGMXVWDEOHQR]]OH
ORFNDEOHGLVSHQVHUEXWWRQDGMXVWDEOHVKRXOGHUVWUDSIRU
SODQWSURWHFWLRQSURGXFWVSHVWLFLGHVDQGOLTXLGIHUWLOLVHUV

No.: PU EAN Placement Clip Stripe Article

B45045 6 SP - -
4 004722 624557

326 Subjects to change without notice 09.2016


Garden accessories

Automatic plant irrigation


SFVIRUDXWRPDWLFZDWHULQJRISODQWVDWKROLGD\WLPHVWKH
KRVHLVLPPHUVHGLQDYHVVHORIZDWHUWKHSODQWGUDZVZDWHU
LWVHOIRYHUWKHFRXUVHRIWKHGD\QRRYHUZDWHULQJ

No.: PU EAN Placement Clip Stripe Article

B45560 12 M30 X X
4 004722 627671

Rain meter
:LWKPLOOLPHWUHLQIRUPDWLRQPP UDLQIDOOLQOLWUHVSHU
VTXDUHPHWHU SODVWLFZLWKLQVHUWLRQVOHHYH

No.: PU EAN Placement Clip Stripe Article

B45600 24 M43 X X
4 004722 620634

Garden shower with tripod


2QHVSUD\W\SHDGMXVWDEOHZDWHUIORZIURPDILQHVSUD\XS
WRDIXOOMHWDOXPLQLXPWXEHDGMXVWDEOHKHLJKWIURPFP
FP$%6SODVWLFVKRZHUKHDGZLWKWULSRGDQGVSLNHIRUD
ILUPVWDQGIRUDOOFRPPRQFOLFNFRQQHFWLRQV

No.: PU EAN Placement Clip Stripe Article

B45103 12 SP. - -
4 004722 636710

09.2016 Subjects to change without notice 327


Garden accessories

Watering extension arm


)RUJHQWOHZDWHULQJRISODQWVDQGSODQWURZVFRQQHFWLRQ
OHQJWKDERXWFPZLWKRQRIIURWDU\VZLWFKRQWKHKDQGOH
normal stream

No.: PU EAN Placement Clip Stripe Article

FLOR89955 6 SP - -
4 035300 500963

Multifunctional watering extension arm


3ODVWLFPHWDO³FRQQHFWRUOHQJWKFPZLWKRQRII
WRJJOHVZLWFKRQWKHKDQGOHVSUD\PRGHV IODWVRDNHU
PLVWVKRZHUMHWFRQH ZLWKVRIWKDQGOHZLWKDELOLW\WRKDQJ
for space-saving storage

No.: PU EAN Placement Clip Stripe Article

FLOR89956 6 SP - -
4 035300 500970

Cast sprayer
6XUIDFHQLFNHOSODWHGRUDQJHKDQGOHPDGHRI735VSUD\
W\SHVIXOO\DGMXVWDEOHZDWHUIORZZLWKIDVWHQLQJFOLSIRUSHU-
manent flow adjustable head 180 °
total length approx. 61 cm

No.: PU EAN Placement Clip Stripe Article

FLORP45220 6 M65. X -
4 035300 900374

328 Subjects to change without notice 09.2016


Garden accessories

Garden sprayer
6XUIDFHQLFNHOSODWHGRUDQJHKDQGOHPDGHRI735
VSUD\W\SHVIXOO\DGMXVWDEOHZDWHUIORZZLWKIDVWHQLQJFOLS
for permanent flow

No.: PU EAN Placement Clip Stripe Article

FLORP45350 12 D44 - -
4 035300 900367

Basic equipment, 4 pieces


6SUD\QR]]OHZLWKYDULDEOHIORZFRQWUROYDULDEOHVSUD\
SDWWHUQV³³WDSDGDSWHU³KRVHFRQQHFWRU
³ZDWHUVWRSSODVWLFIRUVLPSOHDQGFRQYHQLHQWZDWHULQJ
of flowerbeds

No.: PU EAN Placement Clip Stripe Article

B45655 15 K57 X X
4 004722 620665

Spray gun set, 4 pieces


6SUD\SLVWROZLWKGLIIHUHQWVSUD\SDWWHUQV
HUJRQRPLFDOO\VKDSHGFRPSRQHQWKDQGOH³³
KRVHSLHFH³ZDWHUVWRS³

No.: PU EAN Placement Clip Stripe Article

B45660 12 M60 X X
4 004722 624809

09.2016 Subjects to change without notice 329


Garden accessories

Water hose connection set, 3 pieces


&RQWHQWVKRVHFRQQHFWRUZDWHUVWRSFRQQHFWRUWDS
FRQQHFWRUFRPSDWLEOHZLWKDOOVWDQGDUGFRQQHFWRU
systems the connection can be detached by easy pulling

No.: PU EAN Placement Clip Stripe Article

B45657 10 K20. X X
4 004722 637632

Flowers sprinkler
:DWHULQJUDGLXVPYDULDEOHFLUFOHDUFVHWWLQJVƒWRƒ
IXOO\DGMXVWDEOHZDWHUIORZOHQJWKDSSUR[FPOHQJWK
VSLNHDSSUR[FPGLDPHWHUIORZHUDSSUR[FP
with second hose connection
DVVRUWHGFRORXUVLQGLVSOD\[\HOORZ[RUDQJH[SXUSOH

No.: PU EAN Placement Clip Stripe Article

B45050 12 D30 - -
4 035300 900077

Hose clamps
PPSFVZLWKZLQJQXWV

No.: PU EAN Placement Clip Stripe Article

B45740 10 K10 X X
4 004722 623833

330 Subjects to change without notice 09.2016


Garden accessories

Hose clamps
PPSFVZLWKZLQJQXWV

No.: PU EAN Placement Clip Stripe Article

B45745 10 K10 X X
4 004722 623840

Endless hose binder


3 m x 8 mm
UXVWIUHHFXWWROHQJWKLQFOXGLQJWHUPLQDOFORVXUHV

No.: PU EAN Placement Clip Stripe Article

B34089 15 K22 X X
4 035300 717668

09.2016 Subjects to change without notice 331


Garden accessories

Garden hose
P´PPZLWKFDQYDVLQFOXGLQJKRVH
FRQQHFWLQJVHW QR]]OHKRVH´ZDWHUVWRS´WDS
VHFWLRQ´[´,* WRILWDOONQRZQTXLFNFRQQHFWLRQ
V\VWHPVSUHVVXUHUHVLVWDQWWZLVWSURWHFWLRQDOJDHIUHH
89UHVLVWDQWDEUDVLRQUHVLVWDQWIOH[LEOHDWORZWHPSHUDWXUHV
IURPWRƒ&EXUVWSUHVVXUHEDUDWƒ&
28 pcs. supplies in 1/2 pallet box ‘Gras’ on half Euro pallet

No.: PU EAN Placement Clip Stripe Article

B45940 28 SP - -
4 004722 624588

Flexible stretch hose


Expands up to three times the size when water pressure
DQGVKULQNVEDFNDVVRRQDVWKHSUHVVXUHLVRIIOLJKWKDQG\
VSDFHVDYLQJQRWZLVWLQJNLQNLQJDQGNQRWWLQJWZROD\HU
ODWH[WXEHFRORXUEOXHPLQPPD[PLQFOXGHV³
connections 1/2“+ 3/4“ tap and shower with 7 different jet
IXQFWLRQVUHFRPPSUHVVXUHEDU

No.: PU EAN Placement Size Content Clip Stripe Article

B45725 10 G90 - 8m 1 -
4 004722 635959

B45726 10 G90 - 16 m 1 -
4 004722 635966

332 Subjects to change without notice 09.2016


Garden accessories

Hose bracket
:LWKFDUU\LQJKDQGOHDQGKDQJHUSODVWLFLGHDOIRU
transporting and storing hoses and cables
HJKRVH³[P

No.: PU EAN Placement Clip Stripe Article

B45755 24 SP - -
4 004722 624526

Trimmer line
For garden trimmers or brushcutters

Clip Stripe
No.: PU EAN Placement Size Content
Article

CMB321225 10 K15 X PP[P 1 X


5 400391 908032

Trimmer line
For garden trimmers or brushcutters

Clip Stripe
No.: PU EAN Placement Size Content
Article

CMB321625 10 K15 X PP[P 1 X


5 400391 810045

09.2016 Subjects to change without notice 333


Garden accessories

Trimmer line
For garden trimmers or brushcutters

Clip Stripe
No.: PU EAN Placement Size Content
Article

CMB322025 10 K15 X PP[P 1 X


5 400391 810076

Trimmer line
For garden trimmers or brushcutters

Clip Stripe
No.: PU EAN Placement Size Content
Article

CMB322425 10 K15 X PP[P 1 X


5 400391 810106

Hassock
35 x 30 x 3 cm
WRSURWHFWDJDLQVWKDUGFROGDQGPRLVWJURXQGZDVKDEOH
PDGHRISRO\HWK\OHQHIRDPDYDLODEOHLQFRORXUVJUHHQ
RUDQJHSLQNEOXH

No.: PU EAN Placement Clip Stripe Article

B46425 48 SP - -
4 004722 627657

334 Subjects to change without notice 09.2016


Garden accessories

Hassock
NHHSVGU\DQGZDUP[[FP

No.: PU EAN Placement Clip Stripe Article

B46426 20 G40 - -
4 004722 636727

Carrying strap for buckets and pots


)RUHDV\DQGFRQYHQLHQWWUDQVSRUWDWLRQLGHDOIRUFDUU\LQJ
KHDY\RUEXON\WXEVDQGSRWVZLWKKDQGVWUDSV
PD[NJORDGLQJFDSDFLW\DGMXVWDEOHZLGWKVXLWDEOHIRU
SRWVXSWRDERXWFPLQGLDPHWHUHDVHRIXVHE\FODPSLQJ
ORFNPDWHULDO33ZLGWKFP

No.: PU EAN Placement Clip Stripe Article

B46026 10 K15. X X
4 035300 900053

09.2016 Subjects to change without notice 335


Garden accessories

Roof gutter caterpillar


6XLWDEOHIRUFRPPHUFLDOJXWWHUV\VWHPVDOVRIRUFRSSHU
JXWWHUVWKHFDQNHUZRUPFDQEHSODFHGLQWKHUDLQSLSHWKH
EULVWOHVJXDUDQWHHVDQXQREVWUXFWHGZDWHUZD\SUHYHQWV
FRQWDPLQDWLRQIURPOHDYHVEUDQFKHVRUGLUWDGGLWLRQDO
protection against marten and other small animal
DQLPDOVFDQµWZDONWKURXJKWKHEUXVKHVVRWKH\FDQµWJHW
LQWRWKHKRXVH FPORQJ¡FP]LQFZLUHZLWKSODVWLF
FRDWHGJOXHGHQGV89UHVLVWDQWSODVWLFEULVWOHVPP89
VWDEOHSODVWLFPPGHOLYHU\LQVDOHVGLVSOD\

No.: PU EAN Placement Clip Stripe Article

B46149 100 SP - -
4 004722 636666

Leaf protection net 5 x 4 m


protection from leaves and dirt in ponds or large water
YHVVHOVZLWKQHWKROGHUIRUIL[LQJPDGHRISODVWLFPHVK
VL]H[PP89UHVLVWDQWSRO\HWK\OHQH

No.: PU EAN Placement Clip Stripe Article

B46475 20 M80 X X
4 035300 900060

336 Subjects to change without notice 09.2016


Garden accessories

Leaf grids for gutters with holders


)OH[LEOHSODVWLFJULGFP[PZLWKKROGHUVHDFK
FP FDQEHLQGLYLGXDOO\VKRUWHQHG IRUSURWHFWLRQRIURRI
gutters from leaves

No.: PU EAN Placement Clip Stripe Article

B46480 24 SP - -
4 004722 624717

Gritter lorry
OLWUHFDSDFLW\VSUHDGLQJZLGWKDSSUR[FPOHYHUIRU
OHYHOOLQJUHJXODWLRQDOXPLQLXPKDQGOHDSSUR[FPODUJH
VWDEOHSODVWLFZKHHOVVWDQGIHHWIRUVSUHDGLQJVHHG
IHUWLOLVHUJULWDQGVDQG

No.: PU EAN Placement Clip Stripe Article

B46860 4 SP - -
4 004722 624748

Scattering container
OLWUHZLWKOLWUHVFDOHSODVWLFWRVSUHDGVHHGVGXQJRU
salt

No.: PU EAN Placement Clip Stripe Article

B46850 12 G50. X -
4 004722 624533

09.2016 Subjects to change without notice 337


Garden accessories

Spiral rubbish bag


([WUHPHO\VWURQJIRLOIDEULFJPðVHOIUHLQIRUFHGZLWKD
PHWDOVSLUDOVSDFHVDYLQJIROGDEOHKDQGOHV

No.: PU EAN Placement Size Content Clip Stripe Article

B47049 12 SP - 62 l 1 -
4 004722 627633

B47050 12 SP - 160 l 1 -
4 004722 624755

Garden waste bag 245 litres


VTXDUHVWXUG\ULSVWRSIDEULFIRLO3(VSDFHVDYLQJIROGDEOH
easy to use with two handles and two tilt loops in the floor
area

No.: PU EAN Placement Clip Stripe Article

B47055 20 SP - -
4 004722 627626

Bar table cover


)RUWDEOHKHLJKWDSSUR[FPDQGWDEOHGLDPHWHU
DSSUR[¡FPPDWHULDOSRO\HVWHUHODVWDQH
FRORXUZKLWHFDUHLQVWUXFWLRQVZDVKDEOHDWƒ&
89UHVLVWDQWLGHDOIRUUHFHSWLRQVRUFHOHEUDWLRQVRIDOONLQGV
IURPELUWKGD\VZHGGLQJVFKULVWHQLQJVMXELOHHVFOXESDUWLHV
to large events

No.: PU EAN Placement Clip Stripe Article

B46351 10 M20. X X
4 004722 637564

338 Subjects to change without notice 09.2016


Garden accessories

Cover 20 m²
+'3(P\[PH[WUHPHO\GXUDEOHDQGSURWHFWVDJDLQVW
GXVWSDLQWZDWHUDQGGLUWIURPZRUNLQJLQGRRUV
manufactured with recyclable polyethylene

No.: PU EAN Placement Clip Stripe Article

B47131 20 M42 - -
4 004034 604018

Professional cover 20 m²
+'3(P\[PH[WUHPHO\GXUDEOHDQGSURWHFWV
DJDLQVWGXVWSDLQWZDWHUDQGGLUWIURPZRUNLQJLQGRRUV
manufactured with recyclable polyethylene

No.: PU EAN Placement Clip Stripe Article

B47136 20 M35 - -
4 004034 605060

09.2016 Subjects to change without notice 339


Taps

Washbasin mixer tap PICCOLO


• Made from brass according to current DIN
‡)OH[LEOHFRQQHFWLQJKRVHVOHQJWKPP
tested according to current drinking water standard KTW-A
• Easily replaceable durable cartridge with ceramic
sealing discs
• Aerator M24 x 1
• Drain fitting 1 1/4“
• Installation accessories
• Chrome-plated

Packed in a box

No.: PU EAN

SA840 10
4 035300 000470

Bath mixer tap PICCOLO


• Made from brass according to current DIN
• Shower fitting outlet 1/2“
• Without hose-connected sprayer fitting set
• Easily replaceable durable cartridge with ceramic
sealing discs
• Aerator M24 x 1
• Installation accessories
• Chrome-plated

Packed in a box

No.: PU EAN

SA841 6
4 035300 000487

342 Subjects to change without notice 09.2016


Taps

Shower mixer tap PICCOLO


• Made from brass according to current DIN
• Shower fitting outlet 1/2“
• Easily replaceable durable cartridge with ceramic
sealing discs
• Installation accessories
• Chrome-plated

Packed in a box

No.: PU EAN

SA842 6
4 035300 000494

Bidet mixer tap PICCOLO


• Made from brass according to current DIN
‡)OH[LEOHFRQQHFWLQJKRVHVOHQJWKPP
tested according to current drinking water standard KTW-A
• Easily replaceable durable cartridge with ceramic
sealing discs
• Swivel-joint shower head with aerator M24 x 1
• Drain fitting 1 1/4“
• Installation accessories
• Chrome-plated

Packed in a box

No.: PU EAN

SA844 1
4 035300 000517

09.2016 Subjects to change without notice 343


Taps

Sink mixer tap PICCOLO


• Made from brass according to current DIN
‡)OH[LEOHFRQQHFWLQJKRVHVOHQJWKPP
tested according to current drinking water standard KTW-A
• Easily replaceable durable cartridge with ceramic
sealing discs
• Swivel-joint shower head with aerator M24 x 1
• Drain fitting 1 1/4“
• Installation accessories
• Chrome-plated

Packed in a box

No.: PU EAN

SA843 10
4 035300 000500

Washbasin mixer tap LEON


• Made from brass according to current DIN
‡)OH[LEOHFRQQHFWLQJKRVHVOHQJWKPP
tested according to current drinking water standard KTW-A
• Easily replaceable durable cartridge with ceramic
sealing discs
• Aerator M24 x 1
• Drain fitting 1 1/4“
• Installation accessories
• Chrome-plated

Packed in a box

No.: PU EAN

SA850 10
4 004722 590340

344 Subjects to change without notice 09.2016


Taps

Bath mixer tap LEON


• Made from brass according to current DIN
• Shower fitting outlet 1/2“
• Without hose-connected sprayer fitting set
• Easily replaceable durable cartridge with ceramic
sealing discs
• Aerator M24 x 1
• Installation accessories
• Chrome-plated

Packed in a box

No.: PU EAN

SA851 6
4 004722 590357

Shower mixer tap LEON


• Made from brass according to current DIN
• Shower fitting outlet 1/2“
• Easily replaceable durable cartridge with ceramic
sealing discs
• Installation accessories
• Chrome-plated

Packed in a box

No.: PU EAN

SA852 6
4 004722 590364

09.2016 Subjects to change without notice 345


Taps

Sink mixer tap LEON


• Made from brass according to current DIN
‡)OH[LEOHFRQQHFWLQJKRVHVOHQJWKPP
tested according to current drinking water standard KTW-A
• Easily replaceable durable cartridge with ceramic
sealing discs
• With swivel outlet
• Aerator M24 x 1
• Installation accessories
• Chrome-plated

Packed in a box

No.: PU EAN

SA853 10
4 004722 590371

Sink mixer tap LEON


• Made from brass according to current DIN
‡)OH[LEOHFRQQHFWLQJKRVHVOHQJWKPP
tested according to current drinking water standard KTW-A
• Easily replaceable durable cartridge with ceramic
sealing discs
• With swivel outlet
• Removable hand-held shower head 1/2“ incl.
connection thread length 1200 cm
• Aerator M24 x 1
• Installation accessories
• Chrome-plated

Packed in a box

No.: PU EAN

SA855 10
4 004722 590388

346 Subjects to change without notice 09.2016


Taps

Washbasin/sink low pressure dual lever fitting LINA


• Made from brass according to current DIN
‡)OH[LEOHFRQQHFWLQJKRVHVPPORQJ
tested according to current drinking water standard KTW-A
‡(DVLO\UHSODFHDEOHLQQHUXSSHUVHFWLRQ
ƒDQJOHRIURWDWLRQFHUDPLFVHDO
• With swivelling pipe outlet
• For low-pressure electric storage water heater
• Aerator M22 x 1
• With chain eyelet
• Outlet valve not included in delivery
• Incl. Installation accessories
• Chrome-plated

No.: PU EAN

SAH1131 1
4 004722 545760

Thermostatic shower mixer LAO


• Made from brass according to current DIN
• Shower outlet 1/2“
• Temperature selection handle with safety stop at 38° C
• Easily replaceable thermo element
• Incl. Installation accessories
• Chrome-plated

Packed in a box

No.: PU EAN

SA326 1
4 004722 589870

09.2016 Subjects to change without notice 347


Taps

Thermostatic bath mixer LAO


• Made from brass according to current DIN
• Shower outlet 1/2“
• Without hose-connected sprayer fitting set
• Temperature selection handle with safety stop at 38° C
• Easily replaceable thermo element
• Aerator M24 x 1
• Incl. Installation accessories
• Chrome-plated

Packed in cardboard

No.: PU EAN

SA327 1
4 004722 589887

348 Subjects to change without notice 09.2016


Showers

CARBALLO shower system round


• Round
Wall mounted riser
• Length: 970 mm
• Slider
Hand-held shower
• ø 85mm
• 5 types of jet
• With an anti-calc function
Showerhead
• ø 200 mm
• 1 type of jet
• With an anti-calc function
Shower hose
• 1/2“ x 150 cm
Shower hose
• 1/2“ x 50 cm
• For connection to a shower fitting 1/2“
Diverter 1/2“

Chrome-plated

• Packed in a box

No.: PU EAN Placement Clip Stripe Article

SA330100 5 - - -
4 035300 905454

09.2016 Subjects to change without notice 349


Showers

CARBALLO shower system corner


• Corner
Wall mounted riser
• Length: 970 mm
• Slider
Hand-held shower
• 75 x 75 mm
• 1 types of jet
• With an anti-calc function
Showerhead
• 200 x 200 mm
• 1 type of jet
• With an anti-calc function
Shower hose
• 1/2“ x 150 cm
Shower hose
• 1/2“ x 50 cm
• For connection to a shower fitting
Diverter 1/2“

Chrome-plated

Packed in a box

No.: PU EAN Placement Clip Stripe Article

SA330101 5 - - -
4 035300 905461

350 Subjects to change without notice 09.2016


Showers

CARBALLO shower fitting


Hand-held shower
• 5 types of jet
• ø 95 mm
• With an anti-calc function
• 1/2“ connection thread
Shower hose
• Metal
• 1/2“ x 150 cm
Wall mounted riser
• Length: 60 cm
• ø 18 mm
• With slider

Chrome-plated

Packed in a blister

No.: PU EAN Placement Clip Stripe Article

SA330693 5 - X X
4 035300 633975

09.2016 Subjects to change without notice 351


Showers

CARBALLO shower fitting


Hand-held shower
• 5 types of jet
• ø 110 mm
• With an anti-calc function
• 1/2“ connection thread
Shower hose
• Metal
• 1/2“ x 150 cm
Wall mounted riser
• Length: 60 cm
• ø 18 mm
• With slider

• Chrome-plated/white

Packed in a blister

No.: PU EAN Placement Clip Stripe Article

SA330893 5 - X X
4 035300 905584

352 Subjects to change without notice 09.2016


Showers

CARBALLO shower fitting


Hand-held shower
• 5 types of jet
• ø 100 mm
• With an anti-calc function
• 1/2“ connection thread
Shower hose
• Metal
• 1/2“ x 150 cm
Wall mounted riser
• Length: 60 cm
• ø 18 mm
• With slider

Chrome-plated

Packed in a blister

No.: PU EAN Placement Clip Stripe Article

SA330793 5 - X X
4 035300 905553

09.2016 Subjects to change without notice 353


Showers

CARBALLO shower set


Hand-held shower
• 8 types of jet
• ø 85 mm
• With an anti-calc function
• 1/2“ connection thread
Shower hose
• Metal
• 1/2“ x 150 cm
Wall mounted riser

Chrome-plated

Blister-packed

No.: PU EAN Placement Clip Stripe Article

SA330695 10 - X X
4 035300 633982

354 Subjects to change without notice 09.2016


Showers

CARBALLO shower set


Hand-held shower
• 5 types of jet
• ø 110 mm
• With an anti-calc function
• 1/2“ connection thread
Shower hose
• Metal
• 1/2“ x 150 cm

Chrome-plated/white

Packed in a blister

No.: PU EAN Placement Clip Stripe Article

SA330895 5 - X X
4 035300 905614

09.2016 Subjects to change without notice 355


Showers

CARBALLO shower set


Hand-held shower
• 5 types of jet
• ø 100 mm
• With an anti-calc function
• 1/2“ connection thread
Shower hose
• Metal
• 1/2“ x 150 cm

Chrome-plated

Packed in a blister

No.: PU EAN Placement Clip Stripe Article

SA330795 5 - X X
4 035300 905577

356 Subjects to change without notice 09.2016


Showers

CARBALLO hand-held shower


• 1 type of jet
• ø 40 mm
• With an anti-calc function
• 1/2“ connection thread
• Chrome-plated

Packed in a blister

No.: PU EAN Placement Clip Stripe Article

SA330990 5 - X X
4 035300 905621

CARBALLO hand-held shower


• 3 types of jet
• ø 70 mm
• With an anti-calc function
• 1/2“ connection thread
• Chrome-plated

Packed in a blister

No.: PU EAN Placement Clip Stripe Article

SA330694 10 - X X
4 035300 633999

09.2016 Subjects to change without notice 357


Showers

CARBALLO hand-held shower


• 5 types of jet
• ø 120 mm
• With an anti-calc function
• 1/2“ connection thread
• Chrome-plated

Packed in a blister

No.: PU EAN Placement Clip Stripe Article

SA330991 5 - X X
4 035300 905638

358 Subjects to change without notice 09.2016


Showers

CARBALLO hand-held shower


• 5 types of jet
• ø 110 mm
• With an anti-calc function
• 1/2“ connection thread
• Chrome-plated/white

Packed in a blister

No.: PU EAN Placement Clip Stripe Article

SA330894 5 - X X
4 035300 905607

09.2016 Subjects to change without notice 359


Showers

CARBALLO hand-held shower


• 5 types of jet
• ø 100 mm
• With an anti-calc function
• 1/2“ connection thread
• Chrome-plated

Packed in a blister

No.: PU EAN Placement Clip Stripe Article

SA330794 5 - X X
4 035300 905560

360 Subjects to change without notice 09.2016


Showers

CARBALLO metal shower hose


• 1/2“ con x 1/2“ union nut
• Inner diameter: 8 mm
• Length: 150 cm
• Bursting pressure: 5 bar/50 °C
• Tensile strength: 50 kg
• Stainless steel

Packed in a blister

No.: PU EAN Placement Clip Stripe Article

SA330696 20 - X X
4 035300 634002

Shower hose, plastic


• 1/2“ cone x 1/2“ cone
• Length: 150 cm
• Inner diameter: 8 mm
• Bursting pressure: 3 bar / 50°C
• Tensile strength: 50 kg
• Grey
• Made in Germany

Packed in a bag with sticker

No.: PU EAN Placement Clip Stripe Article

TB3012 10 - - -
4 035300 878109

09.2016 Subjects to change without notice 361


Showers

Shower hose, plastic


• 1/2“ cone x 1/2“ cone
• Length: 150 cm
• Inner diameter: 8 mm
• Bursting pressure: 5 bar / 50°C
• Tensile strength: 25 kg
• Transparent/chrome
• Made in Germany

Packed in a bag with sticker

No.: PU EAN Placement Clip Stripe Article

TB3010 10 - - -
4 035300 878086

Shower hose, plastic


• 1/2“ cone x 1/2“ cone
• Length: 150 cm
• Inner diameter: 8 mm
• Bursting pressure: 3 bar / 50°C
• Tensile strength: 25 kg
• White
• Made in Germany

Packed in a bag with sticker

No.: PU EAN Placement Clip Stripe Article

TB3011 10 - - -
4 035300 878093

362 Subjects to change without notice 09.2016


Bath accessories

Shower extractor
• With wall holder (including fixing material)
• Strip-free lustre without lime stains
• Stainless steel/metal chrome-plated

Packed in a box

No.: PU EAN Placement Clip Stripe Article

SA119 4 - X X
4 035300 755158

Designer towel holder


• Practical storage for up to 8 towels
• For hanging on the shower cubicle up to 8 mm
glass thickness
• Also suitable for wall mounting
• 2 hooks for used towels
• Stylish stainless steel shelf
• Material: Glass / brass chrome-plated
• Lightweight installation

• Height: 60 cm
• Glass width: 8 cm
• Shelf width: 18 cm

Packed in a box with eurotab

No.: PU EAN Placement Clip Stripe Article

T319649 2 - X X
4 035300 923663

09.2016 Subjects to change without notice 363


Bath accessories

Designer washbasin plug


• For eccentric pop-up waste fittings
• Adjustable height (60 - 70 mm)
• Diameter: 39.5 mm
‡&RORXUIDVWGHVLJQHOHPHQWUHVLVWDQWDJDLQVW
standard household cleaners
(do not use lime-dissolving/acidic cleaning agents
and abrasive agents)

• Material: Chrome-plated brass surface


• Design element finished with a
high-gloss artificial resin

• Packaged with tab

No.: PU EAN Motif

SA1001 4 Goldi
4 035300 889228

SA1002 4 Kuh.
4 035300 889235

SA1003 4 Pirsch.
4 035300 889242

SA1004 4 Leuchtturm.
4 035300 889259

SA1005 4 Anker.
4 035300 889266

SA1006 4 Muschel.
4 035300 889273

SA1007 4 White Flower


4 035300 889280

SA1008 4 Flora
4 035300 889297

364 Subjects to change without notice 09.2016


Bath accessories

SA1009 4 Herz.
4 035300 889303

SA1010 4 Wasch Dich.


4 035300 889310

SA1011 4 Moin Moin.


4 035300 889327

SA1012 4 Flecki.
4 035300 889334

SA1014 4 Yeti.
4 035300 889358

SA1015 4 Eule.
4 035300 889365

SA1016 4 Haltestelle.
4 035300 889372

SA1017 4 Raus.
4 035300 889389

SA1018 4 Born to lose.


4 035300 889396

SA1019 4 D-Mark.
4 035300 889402

SA1020 4 Euro.
4 035300 889419

SA1021 4 Help.
4 035300 889426

SA1022 4 Earth.
4 035300 889433

09.2016 Subjects to change without notice 365


Bath accessories

SA1023 4 Gulli.
4 035300 889440

SA1024 4 Eye.
4 035300 889457

SA1025 4 Lolly.
4 035300 889464

SA1026 4 Dart.
4 035300 889471

SA1027 4 Twist.
4 035300 889488

SA1028 4 Piano black


4 035300 889495

SA1029 4 Vanilla Cream


4 035300 889501

SA1030 4 Water Lily


4 035300 889518

SA1031 4 Deutschland.
4 035300 899388

366 Subjects to change without notice 09.2016


Bath accessories

Designer XL washbasin plug


You can cover the whole drainage area very easily with the
XL version!
• For eccentric pop-up waste fittings
• Adjustable height (70.0 – 85.0 mm)
• Diameter: 66.0 mm
‡&RORXUIDVWGHVLJQHOHPHQWUHVLVWDQWDJDLQVW
standard household cleaners
(do not use lime-dissolving/acidic cleaning agents
and abrasive agents)

• Material: Chrome-plated brass surface


• Design element finished with a high-gloss artificial resin

Packaged loose with tab

No.: PU EAN Motif

SA1101 4 Union Jack.


4 035300 000531

SA1102 4 6WDUV 6WULSHV


4 035300 000548

SA1104 4 Chief
4 035300 000562

SA1105 4 Fire Engine.


4 035300 000579

SA1106 4 Yin Yang.


4 035300 000586

SA1107 4 Sweet Home.


4 035300 000593

SA1108 4 Piano black


4 035300 000609

SA1109 4 Vanilla Cream


4 035300 000616

09.2016 Subjects to change without notice 367


Bath accessories

SA1110 4 Water Lily


4 035300 000623

SA1111 4 V.I.P
4 035300 000630

SA1112 4 Muschel.
4 035300 000647

SA1113 4 Bottle.
4 035300 000654

SA1114 4 Goldi
4 035300 000661

SA1115 4 Affe.
4 035300 000678

SA1116 4 Spinne.
4 035300 000685

SA1117 4 Gulli.
4 035300 000692

SA1118 4 Herz.
4 035300 000708

368 Subjects to change without notice 09.2016


Bath accessories

Universal plugs 36 mm - 58 mm
• Plastic
• The universal plug replaces existing plugs with a
ø of 36 to 58 mm
• Consists of a basic body and 3 matching rings in
between each other
• Adhesive due to suction effect on all smooth surfaces
‡$SSOLFDEOHIRUVLQNZDVKEDVLQDQGEDWKWXEV

Packed in a blister

No.: PU EAN Placement Clip Stripe Article

SA168 10 - X X
3 375537 144594

Hair sieve
• Plastic
• For wastes
• Chrome-plated

No.: PU EAN Placement Clip Stripe Article

SA318624 36 - X X
4 035300 762316

09.2016 Subjects to change without notice 369


Aerator

Aerator
• Brass
• With internal thread
• With seal
• Not suitable for unpressurised devices

No.: PU EAN Placement Clip Stripe Article

SA307897 12 - X X
4 035300 698240

Aerator
• Brass
• With external thread
• With seal
• Not suitable for unpressurised devices

No.: PU EAN Placement Clip Stripe Article

SA307898 12 - X X
4 035300 698233

Aerator
• Brass
• With external thread
• With seal
• Not suitable for unpressurised devices

No.: PU EAN Placement Clip Stripe Article

SA307899 12 - X X
4 035300 698226

370 Subjects to change without notice 09.2016


Aerator

CON: P Economical aerator set


• 7 pieces
• Brass
Contents:
• 2 pcs. M22x 1 internal thread
• 2 pcs. M24x 1 external thread
• Including 4 matching seals
• 2 pcs. water-saving internal set
• 1 pcs. water-saving internal set
• Not suitable for low-pressure fixtures

Packed in a box

No.: PU EAN Placement Clip Stripe Article

SA145 10 - X X
4 035300 721054

CON: P WATERPAR Economical aerator


• Made of brass/plastic
• Reduces the flow rate up to 50%
• With ball joint
• Economic without any loss of comfort - also comes
with different pressure ratios
• With adapter piece M24 x 1 / M22 x 1
• With seal
• Not suitable for low pressure
• Chrome-plated/black

Packed in a blister

No.: PU EAN Placement Clip Stripe Article

SA130 12 - X X
4 035300 632183

09.2016 Subjects to change without notice 371


Aerator

CON: P Kitchen and washbasin tap


• Plastic/brass
• With ball joint out of plastic
• With threaded transition piece out of plastic
M24 x 1 AG and M22 x 1 AG
• Including seals
• Changeable from spray to jet spurt
• Not suitable for unpressurised devices

No.: PU EAN Placement Clip Stripe Article

SA140 12 - X X
4 035300 632190

372 Subjects to change without notice 09.2016


Toilet-seats

Toilet seat TAROX


• Thermoset
• Plastic hinges
• Soft close
• Weight incl. hinges 2.0 kg
• Replacement set: KSE90
• White

Packed in a box

No.: PU EAN Placement Clip Stripe Article

KSTASC00 12 - - -
4 035300 836635

Child toilet seat


• Thermoplastic
• Suitable for all common toilet seats
• Assorted colours

Each 5 pieces
ZKLWHUHGEOXHYLROHW

Seat will be delivered


in a box of 20 pieces.

Packed with tab

No.: PU EAN Placement Clip Stripe Article

SA760 20 - X X
4 004722 566437

09.2016 Subjects to change without notice 373


Cleaning agents

Cleaning sponge
• Highly effective - reliably removes any dirt
‡,GHDOIRUFOHDQLQJEDWKURRPNLWFKHQUHIULJHUDWRUV
VWDLQOHVVVWHHOULQVHVSDUTXHWODPLQDWHWLOHVJDUGHQ
IXUQLWXUHDOXPLQLXPULPVFDULQWHULRUOHDWKHUFRYHULQJV
sports shoes and much more.
• Not recommended for cleaning
YDUQLVKHGSROLVKHGRUGDUNVXUIDFHVFDUYDUQLVK
• Use only on smooth surfaces
• Available with and without cleaning agents!
• Contents: 3 pieces

Delivery in a sales display

No.: PU EAN Placement Clip Stripe Article

SA101 200 - X X
4 260108 620029

Toilet seat cover


• Perfect hygienic protection when travelling
• the ideal travel companion
• Contents: 10 pcs.

Packed in a resealable film pack


with Euro-perforation

No.: PU EAN Placement Clip Stripe Article

SA103 20 - X X
4 035300 740598

374 Subjects to change without notice 09.2016


Cleaning agents

Travel set, 2 pieces


Contents:
‡7RLOHWVHDWFRYHUSFV
• Hand disinfection spray (approx. 190 applications)
• Perfect hygienic protection
• When travelling--the ideal travel companion

Packed in a slider with bag

No.: PU EAN Placement Clip Stripe Article

SA108 20 - X X
4 035300 751327

09.2016 Subjects to change without notice 375


Installation

Washstand fixing
• With 2 screws M 10 x 140 mm
• 2 dowels 14 mm
• 2 noise-insulating bushings
• 2 metal washers
• 2 nuts M10

No.: PU EAN Placement Clip Stripe Article

SA319899 12 - X X
4 035300 656745

Odour trap for sink unit pipes


• Plastic
• With flexible wall connection hose
• With drain connection for washing machine
or dishwasher
• Universally adjustable

No.: PU EAN Placement Clip Stripe Article

SA353304 10 - - -
4 035300 688814

376 Subjects to change without notice 09.2016


Installation

Sheet holes
• For hole diameter: 35 mm
• Made of high-quality stainless steel
• Suitable for punching stainless steel sinks up to a
thickness of 2 mm

Packed in a blister

No.: PU EAN Placement Clip Stripe Article

SA185 4 - X X
4 035300 749034

Hose clamp set, 12 pieces


• Band and housing stainless steel
• Screw galvanized
Contents:
• 2 pieces. ø 12 - ø 20 mm
• 4 pieces ø 16 - ø 25 mm
• 4 pieces ø 20 - ø 32 mm
• 2 pieces ø 25 - ø 40 mm

Packed in a blister

No.: PU EAN Placement Clip Stripe Article

SA166 12 - X X
4 035300 747740

09.2016 Subjects to change without notice 377


Sealants

Household gasket set, 45 pieces


45 pieces consisting of:
• Fever seals 1/2“ and 3/4“
• Rubber gaskets M22 x 1 for aerators
• Rubber gaskets M24 x 1 for aerators
• Rubber gaskets M28 x 1 gaskets for aerator
• Rubber washers with hole 1/2“ and 3/4“
• Rubber O-rings 3/8“ and 1/2“

Packed in a box with eurotab

No.: PU EAN Placement Clip Stripe Article

SA147 15 - X X
4 035300 739653

Seal kit, 87 pieces


87 pieces consisting of:
• Rubber gaskets
• Rubber O-rings
• Rubber faucets
• Rubber siphon gaskets
• Fever ring
• Threaded gasket (only for water )
• Radiator Venting Wrench

Packed in assortment box

No.: PU EAN Placement Clip Stripe Article

T380299 10 - - -
4 035300 466412

378 Subjects to change without notice 09.2016


Sealants

seal for wall taps


• Self-adhesive
• Prevents penetration of water behind the tiles at wall
connections
• 2 pieces

Packed in a bag

No.: PU EAN Placement Clip Stripe Article

T321030 12 - X X
4 035300 771677

Thread sealing tape for cold water


P.T.F.E

‡WKLFNPPZLGH
• 12 m roll
• Contents: 5 pieces
• Only suitable for cold water up to +25°C

Packed in a bag with a tab

No.: PU EAN Placement Clip Stripe Article

SA260 20 - X X
4 004722 567755

09.2016 Subjects to change without notice 379


Sealants

Repair tape
• Even-welding polyisobutylene tape

Application ranges:
• Vehicle range
• In the domestic home
‡+REE\
• Electrical and sanitary area

Characteristics:
• Universal tape
• Welded within 10 minutes
• Temperature resistance - 40°C - 100°C
• Insulating and sealing tape
• Resistant to plasticiser
• Residue-free removable
• Salt water and UV-resistant
• Puncture strength: 20 kV
• Elongation: 600 %
• Water resistance: 0.40 %
• Paintable with acrylic lacquer
• Length: 5 m

Application:
7KHXQLYHUVDOWDSHLVQRWVHOIDGKHVLYHLW
ZHOGVZKHQLQULQJVKDSHGRUVSLUDOILQQHGZUDSSHG
Pull under tension at 3-fold length (approx. 300%)
and wrap overlapping spiral-finned.

Important:
Pull at 3 fold length and wrap
overlapping spiral-finned

No.: PU EAN Placement Clip Stripe Article

SA270 10 - X X
4 035300 454327

380 Subjects to change without notice 09.2016


Sealants

Sealing tape
‡)RUSHUPDQHQWVHDOLQJRIEDWKWXEVVKRZHUVVLQNV
etc.
‡+LJKO\DGKHVLYHUHVLVWDQWWRDJHLQJ
• Resistant to conventional cleaning agents
• PVC-free
• Contents: 1 roll (W 28 mm x L 3.2 m)

Packed in a blister

No.: PU EAN Placement Clip Stripe Article

SA131 24 - X X
4 035300 774593

09.2016 Subjects to change without notice 381


Sound insulation

Anti-vibration device
• Vibration-insulating / non-slip
• For washing machine
• Plastic
• Content: 4 pieces

Packed in bag with eurotab

No.: PU EAN Placement Clip Stripe Article

T357401 4 - X X
4 035300 679607

Insulation boards
• Environmentally friendly recycling product
• Almost unlimited deterioration stability
• Chemical resistant
• Vibration retardant
• Skid-proof
• Decades of permanent elasticity
• 100 x 100 x 15 mm

Packed in a box with eurotab

No.: PU EAN Placement Clip Stripe Article

SA310 6 - X X
4 035300 685998

382 Subjects to change without notice 09.2016


Pipe cleaning

Pipe cleaner
• Cleans clogged pipes
• ø 50 mm - ø 150 mm
• Fits into any 1/2“ or 3/4“ hose

Packed in a blister

No.: PU EAN Placement Clip Stripe Article

SA100 6 - X X
5 013556 123838

Outlet cleaner
• With handle

1RWSDFNHGLQFOVWLFNHU

No.: PU EAN Placement Size Clip Stripe Article

T595600 5 - - Ø 110 mm -
4 035300 287079

T595605 5 - - Ø 140 mm -
4 035300 287086

09.2016 Subjects to change without notice 383


Pipe cleaning

Overflow silencer®
• Seals the overflow at the washbasin for optimal
pump results
• No more overflows
‡8QLYHUVDOVL]HVXLWDEOHIRUDOOFRPPRQRYHUIORZ
forms and sizes
• Material: Plastic

Packed in a box

No.: PU EAN Placement Clip Stripe Article

SA240 12 - X X
4 035300 875245

Plumbing set - The perfect duo for a free drain


Contents:
Overflowing-line
‡&RPSHQVDWHVUHOLDEO\IRURSWLPDOSXPSLQJUHVXOWV
‡8QLYHUVDOVL]HVXLWDEOHIRUDOOFRPPRQRYHUIORZ)RUPV
and sizes

Spout Cleaner
• With handle
• ø 140 mm

Packed in a box

No.: PU EAN Placement Clip Stripe Article

SA250 10 - X X
4 035300 893775

384 Subjects to change without notice 09.2016


Pipe cleaning

Outlet cleaner
• With vacuum suction pump
• ø 115 mm

Loose with sticke

No.: PU EAN Placement Clip Stripe Article

AGRV 4 - - -
4 004722 445220

Compressed air pipe cleaning gun


‡)RUVLQNVZDVKEDVLQVELGHWV
EDWKWXEVVKRZHUV:&VDQGPXFKPRUH
• Environmentally-friendly pipe cleaning without the use of
chemicals - purely mechanical
‡6LPSOHVDIHDQGFRQYHQLHQW
‡,QFOXGHVSOXJKROHDWWDFKPHQWV
• 1 special WC attachment and a user manual
‡7h9*6=$

Packed in cardboard box

No.: PU EAN Placement Clip Stripe Article

SA220 8 - X X
4 035300 824953

09.2016 Subjects to change without notice 385


Pipe cleaning

Instant cleaner without cap for drainage


• Cleans clogged drains such as in e.g.
ZDVKEDVLQVLQNEDWKWXEHWF
• Without addition of acids or alkalis
• Does not damage sound pipes
• The gas pressure dissolves the blockages within seconds
• Up to 15 1-second-applications
• With lemon fragrance
• Easy to use

Packed with sticker

No.: PU EAN Placement Clip Stripe Article

T595700 4 - - -
4 035300 754625

Instant cleaner with cap for drainage


• Cleans clogged drains such as in e.g.
ZDVKEDVLQVLQNWRLOHWEDWKWXEHWF
• Without addition of acids or alkalis
• Does not damage sound pipes
• The gas pressure dissolves the blockages within seconds
• Up to 15 1-second-applications
• With lemon fragrance
• Easy to use

Packed with banderole

No.: PU EAN Placement Clip Stripe Article

T595701 4 - - -
4 035300 754632

386 Subjects to change without notice 09.2016


Pipe cleaning

Waste pipe cleaning strips


• Set of 2 pieces
• Material: bio-plastic from cornstarch
• The most environmentally-friendly solution for spout
cleaning
• Spout cleaning without chemistry
• Simple Put the strip in the drain and pull it out again
• Easy disposal together with household waste

7KHVWULSRIELRSODVWLFVLVPDGHIURPFRUQVWDUFKVRWKLVVWULS
is the most environmentally friendly solution for the purificati-
on of spills

Chemical cleaning agents must not be used.

Packed in banderole

No.: PU EAN Placement Clip Stripe Article

SA230 20 - X X
8 711962 053974

Plumber‘s snake
• With crank and claw fastener
‡ &UDQNSODVWLFUHG
‡ 6KDIWVWHHOJDOYDQL]HG

No.: PU EAN Placement Clip Stripe Article

T595500 6 - - -
4 035300 287055

09.2016 Subjects to change without notice 387


Pipe cleaning

Plumber‘s snake
• With crank and claw fastener
‡&UDQNSODVWLFUHG
‡6KDIWVWHHOJDOYDQL]HG

No.: PU EAN Placement Clip Stripe Article

T595505 3 - - -
4 035300 287062

T595510 3 - - -
4 035300 541058

388 Subjects to change without notice 09.2016


Heater

Fully automatic radiator vent


• Saves expensive energy
• No contamination by spray
• No annoying noises
• Max. operating temperature 95° C
• Max. operating pressure 8 bar
• Save up to 20% time and money

Packed in a blister

No.: PU EAN Placement Clip Stripe Article

T593006 10 - X X
4 035300 737574

Radiator venting box


• With collecting container
• Capacity: 60 ml
• Container: Plastic
• Key: Metal
• Height: 100 mm / W: 55 mm / Depth: 29 mm
For fast and clean radiator bleeding

Packed in a box

No.: PU EAN Placement Clip Stripe Article

T593000 24 - X X
4 035300 905782

09.2016 Subjects to change without notice 389


Heater

Room air humidifier


‡:LWKKHDWUHVLVWDQWUXEEHUULQJV
‡6XLWDEOHIRUDOOW\SHVRIUDGLDWRUV
‡¡[PP
• Contents: 2 pieces
‡0DWHULDOVWDLQOHVVVWHHOPDWWEUXVKHG

Packed in a box

No.: PU EAN Placement Clip Stripe Article

SA123 6 - X X
4 035300 771455

390 Subjects to change without notice 09.2016


$Chapter_L1 Index

$ %URRP 
Brush set 83
$FFHVVRULHV  Builders‘ gloves 33

Adapter kit 104 &
$GKHVLYHWDSH 
Adjustable wrench 101 Cabinet and shelf light 109
Adjusting bolts 240 Cable cutter 149
$HUDWRU  Cable lug clamping and stripping pliers 130
Aerator set 370 &DEOHWLHV 
Aerator Set 370 &DEOHWLHVDVVRUWPHQW 
Agitators 80 &DUDFFHVVRULHV 
Allen key set hexagonal 102 Carpenter’s pencil 143
Allen key set on ring 104 Carpenter‘s pencil set 143
Allen key set TX 101 Car rescue knife 42
All-purpose saw 121 Carrying strap 335
Aluminium lantern 109 &DUVHFWRU 
Aluminium light rod 108 Car sponge 41
Aluminium mini handsaw 119 Car trailer lock 35
$OXPLQLXPVQDSKRRNVHW  Cast sprayer 328
Angle 248 &DXONLQJJXQ 
Angle screws set 25 Chain/cables promotion 151
Angle set 249 Chair bracket 248
$QWLVOLSPDW  Chocks 237
Anti-vibration device 382 Circular saw box 120
Apron 314 Clamp fastener 196
$UWLFXODWHGUDWFKHWZUHQFKSLHFHV  &ODPSIDVWHQLQJ 
$VVRUWHGIHOWSDGV  
$VVRUWPHQWER[HV  Clamp fastening set 206
 Clamping sleeve assortment box 278
 Claw 140
 cleaning agents 374
288 Cleaning sponge 374
Automatic water pump pliers 126 &ORWKHVOLQHSODVWLF 
&ORWKHVOLQHV 
% Clotheslines replacement cover 175
&RDUVHWKUHDGVFUHZV 
Bag clips 150 Coarse thread screws assortment box 254
%DJJDJHVWUDS  Combination drill set 28
%DUULHUWDSH  Combination padlock 181
Bar table cover 338 Combination pliers 132
Basic equipment 329 Combination spanner set 101
%DWKDFFHVVRULHV  Connector 151
%DWK¿WWLQJ  &RUGV 
%DWKPL[HUWDS  Cotter pin assortment box 280
%DWKURRP¿WWLQJV  Cotter pins assortment box 281
Bath thermostat 348 Cotton cord 168
Bathtub thermostat 348 Countersunk head wood screws 243
Battery-operated car torch 37 &UDIWDFFHVVRULHV 
Battery tester 52 Craft knife 8
%HOWV  Culture equipment 311
Bicycle baggage strap 192 Cutter 30
Bicycle marking set 36 &XWWLQJZKHHOVVDZV 
%LGHW¿WWLQJ  Cylinder padlock 176
Bidet mixer tap 343
Billiard ball hanger 149 '
Bit holder 26
Bit/key set 102 'HKXPLGL¿HU 
Bit/ratchet screwdriver set 100 Demagnetiser 139
%LWV  Designer magnets 155
%LWVVHW  'HVLJQHUZDVKEDVLQHFFHQWULFSOXJV 
%ODGHV  'HVLJQHUZDVKEDVLQSOXJ 
Bolt cutters 127 'HVLJQHU;/ZDVKEDVLQHFFHQWULFSOXJV 
Boxwood cutter 322 'HVLJQHU;/ZDVKEDVLQSOXJ 
Brackets kit 249 'LDPRQGFXWWLQJEODGH 
Brass padlock set 177 Discus padlock 178
Breakdown truck 138 Double hook 304
Drain cleaner 385

392 Subjects to change without notice 09.2016


Index $Chapter_L1

'UDLQSLSHFOHDQHU  Garden spade 301


Drain plug 369 Garden sprayer 329
'ULOO  Garden waste bag 338
Duct tape 44 *ORYHV 
Duroplast 373 Grass shears 323
Dust door 86 Grease nipples assortment box 277
Dust mask 72 Grill brush 325
Dustpan 310 Gripping shears 321
Grip wrench 131
( Gritter lorry 337
E-clips assortment box 275 Grubber 303
(GJHSURWHFWRU  +
Electrician‘s combination pliers 137
(OHFWULFLDQµVÀDWWDSHUQRVHSOLHUV  Hair sieve 369
Electrician‘s side cutting pliers 136 +DPPHU 
Electrician‘s taper-nose pliers 137 Hand grass shears 321
Endless hose binder 331 Hand sanding block 70
+DQGVKRZHU 
) Handwashing paste 146
Fabric tape 44 +DVVRFN 
)DVWHQLQJHOHPHQWV  Head lamp 114
)DVWHQLQJWRROV  Head lamp set 108
)HOWJOLGHV  Hedge trimmer 321
)HOWJXLGHVDQGDFFHVVRULHV  Herb scissors 324
Files 71 Hexagonal drill set 27
Files set 67 Hexagonal head screws 245
Fireplace screen cleaner 145 Hexagonal head screws set 246
Firewood rack 298 +H[DJRQDOKHDGZRRGVFUHZVVHW 
Firmer chisel 71 High-power tacker 9
Firmer chisel set 71 Hoe 304
Fishing tape 149 Hole and rivet tongs 127
Fitting accessories 370 Hole saw set 117
Fittings 348 Holiday plant waterer 327
Flag 211 Holiday watering 327
)ODWEUXVKVHW  +ROVWHLQVKRYHO 
Flexible hose 332 +RRN 
Flexible magnet 142 Hooks assortment box 264
Flipchart markers 150 +RVH 
Flooring screws 240 Hose bracket 333
Floor repair set 84 +RVHFODPSV 
Flower shears set 316 Hose clamps set 377
Flower sprayer 326 +RVHSLSH 
)ROGLQJUXOH  Hot glue sticks 14
Folding ruler 45 Hot-melt adhesive gun 13
Folding saw 322 +RXVHKROGDVVRUWPHQWER[ 
Folding spade 302 +RXVHKROGVFLVVRUV 
Forstner bit 29 Household seal set 378
Forstner bit set 29 +XPLGLILHU 
Frankfurt shovel 301 ,
Fruit picker 304
Funnel 138 ,FHVFUDSHU 
Funnel set 139 Industrial safety set 74
Furniture carrying belt 153 Installation 377
Furniture carrying strap 153 ,QVWDOODWLRQWRROV 
Furniture transport set 86 Instant drain cleaner 386
Insulating bedding layer 382
* Insulation and noise protection 382
*DUGHQDFFHVVRULHV -
338
Garden hoe 304 Japanese spatula set 75
Gardening gloves 314 Jigsaw 118
Garden knife 323 -RLQWEUXVK 
Garden rake 303 Joint cleaner 308
Garden shears 319
Garden shower 327

09.2016 Subjects to change without notice 393


2
$Chapter_L1 Index

. Mini knife 63
Mini table fan 144
Key accessories set 294 Mitre clamp 14
.H\FKDLQV  Mitre saw 118
Kitchen and wash basin shower 372 Mounting 376
.LWFKHQ¿WWLQJ  0RXQWLQJVHW 
.QLIH  Mousetrap 325
.QLIHVKDUSHQHU  Multifunctional ratchet wrench 105
/ Multifunctional socket spanner set 105
Multifunctional tool set 125
Lag bolts 244 Multifunction grill brush 325
/DJEROWVVHW  Multifunction watering extension arm 328
Lamp set 107 Multi-polishing set 8
Large-diameter washers/spring washers assortment box Multi-purpose knife 65
 Multi-purpose line 167
/DVHUUDQJH¿QGHU  Multi-purpose polypropylene ropes 172
Laser spirit level 48 0XOWLSXUSRVHSRO\SURS\OHQHURSHVRUDQJH 
/DVKLQJDQGOLIWLQJ  0XOWLSXUSRVHVLVDOURSHQDWXUDO 
Leaf grating 337 0XOWLSXUSRVHVLVDOURSHV 
Leaf protection net 336 Multi-sanding set 9
/HDIUDNH  0XOWLWRRO 
LED light with motion detector 110 Multitool/pocket torch set 124
Lever sheet metal shears 131 Multi tools accessories set 116
/LIWLQJEHOW  Multi-use shovel 310
/LJKW/('ZLWKNH\FKDLQ 
Lint roll set 149 1
/RDGVHFXULQJ  Nail plug 232
 1DLOV 
 1DLOVDQGSLQVDVVRUWPHQWER[ 
Load securing set 208 1HRG\PLXPPDJQHW 
Locking rings assortment box 274 1HWZRUN 
Lock nuts assortment box 280 Nuts assortment box 269
/RFNV 
Lubricant 146 2
Luggage arm 192
/XJJDJHEHOW  2I¿FHVXSSOLHVDVVRUWPHQWER[ 
Luggage compartment belt 208 2I¿FHVXSSOLHVVHW 
Luggage compartment holding strap 208 Outlet cleaner 383
Luggage compartment netting 214 2YHUIORZVLOHQFHU 
/XJJDJHVSLGHU  3
Luggage strap set 193
Packaging tape 43
0 3DFNLQJWZLQH 
Machine screws 245 3DGORFN 
Machine screws set 246 3DGORFNV 
Magnetic bit holder 26 Paint mixer 80
Magnetiser 139 Paint scraper 75
0DJQHWV  Parking disc 34
Magnifying glass 141 Pencils 150
Marking template 47 3HQOLJKW/(' 
Marquee holder 159 3KDVLQJWHVWHUFRQWDFWOHVV 
0DVNLQJWDSH  3LFWXUHKRRNVDVVRUWPHQWER[ 
0DVRQµVKDPPHU  Pincers 129
Matt 210 Pipe cleaner 383
0HDVXULQJDQGFXWWLQJ  3LSHFOHDQLQJ 
65 pipe cleaning gun 385
0HDVXULQJDQGZHLJKLQJ  Pipe cleaning trip 387
54 Pipe wrench 128
0HDVXULQJWDSH  Pistol screwdriver 98
0HFKDQLF¶VELWVHW  Plank screws 240
Mechanic’s screwdriver set 93 Planting set 313
0HKU]ZHFNVHLOH3RO\SURS\OHQ  Planting stick 324
Metal saw bow 122 Plant requirements 324
Metal saw bow set 119 Plants clips 313
Metalworking 71 Plasterer set 80
Miniature ratchet screwdriver 98 3ODVWLFGRZHO 

394
3
294 Subjects to change without notice 09.2016
Index $Chapter_L1

Plate joint cleaner 308 Saw horse 117


Plate radiator accessories 389 6DZV 
Pliers for precision mechanics 135 Scattering container 337
3OXPEHUµVVQDNH  6FLVVRUV 
Plumbing set 384 6FUHZELW 
3RFNHWNQLIH  Screw clamp 12
3RFNHWODPS  Screw clamps 14
3RFNHWWRUFK/('  6FUHZGULYHU 
3RFNHWWRUFK/('$OXPLQLXP  100
Pocket torch set 107 Screwdriver bit set 94
Polyester rope 173 Screwdriver set 93
3RO\SURS\OHQHURSH  Screwdriver set VDE 92
3RO\SURS\OHQHWZLQH  Screw extractor set 94
Polypropylenseil 171 Screw hooks assortment box 252
Post connector 297 6HDO 
Post corner 296 6HDODQW 
Post screws 242 6HDOLQJWDSH 
Potting soil 312 Seal Kit 378
3UHFLVLRQVFUHZGULYHUVHW  6HDOV 
Precision screwdrivers set 89 6HFDWHXUV 
Professional tacker 10 Securing ring pliers 129
3URPRWLRQDOLWHPV  Seile 171
 Self-adhesive blackboard foil 145
 Sensor night light/pocket torch 110
 Set of blind rivets with pliers 128
Pruning shears 320 6HWRI¿OHV 
36$  Sharpener 68
PU foam gun 76 6KHDUV 
Sheet holes 377
5 6KHHWPHWDOVFUHZVDVVRUWPHQWER[ 
5DGLRDQGWHOHSKRQHSOLHUV  Shock spatula 79
Rain meter 327 6KRYHO 
Rake 303 Shovel and rake set 312
Ratchet cable 217 Shower extractor 363
Ratchet screwdriver 96 6KRZHU¿WWLQJ 
5DWFKHWVFUHZGULYHUMRLQW  6KRZHUKRVH 
Rat trap 325 6KRZHUPL[HUWDS 
5HGHFRUDWLQJ  6KRZHUV 
87 
5HÀHFWLYHZDUQLQJVWULS  6KRZHUVHW 
Renovation set 85 6KRZHUV\VWHP 
Repair tape 380 Shower thermostat 347
Replacement nozzle cartridge gun 77 Shrink tubing assortment 283
Replacement nozzles 77 Shrink-wrap tubing assortment box 282
Replacement nozzles with holder and cap 78 Side cutting pliers 133
Respiratory assistance mask 72 Signal magnets 155
Reusable cable ties 19 Silicone multifunctional set 78
Reusable cable ties set 18 Sink 376
Reversible ratchet 41 Sink accessories 369
Roof gutter caterpillar 336 6LQNPL[HUWDS 
5RR¿QJKDPPHU  Sink unit hose with joint 372
5RSH  6LQNXQLWSLSHRGRXUWUDSZLWKÀH[LEOHZDOOFRQQHFWLRQSLSH
Round-nose pliers 132 376
5RXQGVOLQJV  6LSKRQ 
Routers 30 Sisal cord 161
Rubbish bag 338 Small brush 308
Ruler 46 Small double hook 309
Small grubber 309
6 Smartphone repair set 95
6QDSRIIEODGHVWULS 
Safety knife 62 Snips 131
Safety vest 73 Snow shovel 39
Sanding sponges 70 6RFNHWVSDQQHUVSDQQHU 
Sandpaper set 69 Socket spanners set 103
Saving aerator with joint 371 Sock liners 87
6DZ  Soft gloves 33
Saw box set 121

09.2016 Subjects to change without notice 395


2
$Chapter_L1 Index

6SDGH  Train level 49


6SDUHFRYHULQJ\HOORZ  Trapezoidal blades 64
6SDWXODVHW  7UDWFKHWVFUHZGULYHUSLHFHV 
Special 373 7UDWFKHWVFUHZGULYHUSLHFHV 
Special screws 240 Travel lock 182
Spiral plant stake 324 Travel set 375
Spiral rubbish bag 338 7ULPPHUOLQH 
6SLULWOHYHO  7URZHO 
Spirit level set 48 TSA padlocks 183
Sponge 374
Spray pistol set 329 8
Spring clamp 12 8QLYHUVDOKROGHUV 
Springs assortment box 276 8QLYHUVDONQLIH 
Spring washers assortment box 273 Universal knife set 61
6SULQNOHU  Universal plugs 369
6SULQNOHUFRQQHFWRUV\VWHP  8QLYHUVDOURSH 
Squares 47 Universal saw 120
Starting aid 29 8QLYHUVDOVFUHZV 
Steel brush set 67 
String set 163 8QLYHUVDOVFUHZVDVVRUWPHQWER[ 
6XUIDFHWUHDWPHQW  
7 9
Tablecloths 338 Velcro assortment 17
Tacker 10 Veneer pins 295
Tacker staples 11 9HQHHUSLQVVRUWHG 
Tap accessories 371 Venting box 389
Tap and die set 146 Vent valve 389
7DSH  9ROWDJHGHWHFWRUPP 
Tape dispenser 43 9ROWDJHGHWHFWRUPP 
7DSHPHDVXUH  Voltage detector set 91
Tapping screws and threaded screws assortment box 271
Tar paper pins 247 :
Tarpaulin 339
Tarpaulin clamp 195 :DOOKRRNVHW 
Tarpaulins 339 Wallpapering set 85
7DUSDXOLQWHQVLRQHU  :DOOSOXJV 
Telescope mirror 141 :DOOVDQGWLOLQJZRUNV 
Telescopic handle 305 Wall tap seal 379
7HOHVFRSLFPDJQHW  :DUQLQJÀDJ 
Telescopic ratchet screwdriver 97 :DUQLQJWDSH 
Tension bands 191 :DUQLQJWDSHEDUULHUWDSH 
Tensioning hooks 195 :DVKEDVLQDQGELGHW 
7HQVLRQUDWFKHW  :DVKEDVLQ¿WWLQJ 
Terminal clamp 11 :DVKEDVLQPL[HUWDS 
Terrace broom 305 :DVKEDVLQVLQNORZSUHVVXUHGXDOOHYHU¿WWLQJ 
Terrace screws 241 Washers assortment box 279
7KUHDGHGVFUHZVDVVRUWPHQWER[  :DVKVWDQG¿[LQJ 
Threading tools 146 Waste trap 376
Thread sealing tape 379 Watering extension arm 328
Thumbscrew set 92 Water pump 140
Tie wire 313 Water pump pliers 135
Tillage 301 :DWHUWHFKQRORJ\ 
7LPEHUFRQQHFWRU  Weeder 311
Toilet sea 373 Whetstone set 28
Toilet seat 373 Windscreen wipers repair set 35
Toilet seat cover 374 Wing nut assortment box 282
7RQJV  Winter broom 306
 Winter gloves 33
Torpedo spirit level 49 Wire brush 70
Torsion bits set 20 Wire brushes 70
Towel rack 363 Wire brush set 66
Tower pincers 130 Wire end sleeve pliers set 126
Tracking device 51 :LUHQDLOV 
Trailer net 215 Wire stripping pliers 134
Trailer winch 218 Wood and material moisture meter 51

396 Subjects to change without notice 09.2016


Index $Chapter_L1

Wood drill bit set 27


Wooden folding rule 53
Wooden mousetrap 325
:RRGSURFHVVLQJ 
Wood rat trap 325
:RRGVFUHZVDVVRUWPHQWER[ 
:RRGVFUHZVGRZHOVDVVRUWPHQWER[ 
Work lamp 24+4 112
Work lamp 24+6 113
Work light 111
Wrapping tape 152

09.2016 Subjects to change without notice 397


$Chapter_L1 Articlenumber

AGRV 385 B21628 85 B26327 143 B30016 234


B20123 66 B22002 72 B26328 143 B30018 246
B20133 66 B22005 72 B26350 46 B30019 246
B20143 67 B22009 87 B26353 47 B30020 244
B20206 67 B22100 73 B26680 47 B30021 244
B20210 125 B22110 73 B26820 48 B30023 248
B20220 68 B22298 83 B26831 49 B30024 233
B20221 68 B22299 84 B26900 49 B30025 232
B20222 69 B22301 43 B26911 48 B30026 232
B20256 101 B22302 43 B26912 49 B30027 232
B20322 57 B22303 44 B26914 50 B30028 232
B20423 126 B22304 33 B26920 50 B30029 227
B20441 15 B22305 33 B27260 80 B30041 223
B20442 16 B22307 33 B27384 75 B30042 223
B20443 16 B22308 33 B27414 13 B30043 223
B20444 16 B22310 33 B27415 13 B30044 223
B20445 16 B22540 78 B27416 14 B30045 223
B20446 17 B22600 140 B27422 77 B30046 223
B20447 17 B23003 104 B27423 77 B30047 229
B20448 17 B23062 26 B27424 77 B30048 230
B20450 15 B23063 26 B27425 78 B30050 247
B20451 18 B23064 26 B27430 76 B30051 247
B20452 19 B23065 94 B27623 79 B30052 247
B20453 19 B23069 26 B27653 79 B30053 248
B20556 88 B23110 120 B27663 80 B30058 247
B20557 88 B23119 115 B27690 76 B30059 247
B20558 89 B23120 115 B27691 84 B30070 237
B20559 89 B23121 115 B28692 57 B30071 237
B20566 43 B23125 115 B28850 64 B30072 237
B20600 90 B23130 116 B28860 65 B30073 238
B20601 91 B23160 70 B28900 65 B30074 238
B20622 127 B23170 116 B29199 34 B30075 238
B20630 101 B23305 27 B29200 34 B30076 238
B20652 91 B23407 27 B29203 35 B30077 238
B20698 139 B23408 28 B29204 35 B30078 238
B20702 92 B23409 28 B29205 36 B30080 221
B20703 92 B23450 117 B29206 145 B30081 221
B20704 92 B23703 8 B29210 36 B30082 221
B20705 93 B23704 9 B29640 143 B30083 221
B20719 93 B23795 28 B29800 51 B30084 221
B20780 101 B23796 94 B29820 51 B30085 221
B20781 102 B23798 29 B29821 52 B30086 225
B20785 102 B23821 9 B29830 107 B30087 225
B20795 103 B23822 10 B29840 107 B30088 225
B20796 103 B23824 10 B29845 124 B30089 225
B20798 104 B23838 11 B29850 108 B30090 225
B20844 139 B24200 75 B29861 108 B30091 225
B20865 58 B24810 141 B29862 109 B30092 225
B20866 59 B24830 141 B29871 109 B30093 225
B20869 59 B24840 141 B29872 110 B30094 225
B20870 60 B24860 142 B29873 110 B30095 225
B20871 8 B24870 142 B29875 111 B30096 225
B20872 61 B25158 11 B29881 111 B30111 223
B20880 63 B25160 11 B29882 112 B30112 223
B20881 64 B25161 11 B29883 112 B30113 223
B20882 64 B25320 118 B29884 113 B30114 223
B20890 63 B25350 119 B29885 37 B30120 247
B20896 8 B25370 119 B29886 113 B30121 247
B20908 25 B25621 12 B29887 114 B30122 239
B20930 140 B25665 12 B29930 86 B30123 239
B21620 81 B25700 69 B29960 144 B30124 239
B21621 81 B25702 69 B30011 236 B30125 239
B21622 82 B25712 70 B30012 233 B30126 239
B21623 82 B26301 45 B30013 235 B30127 239
B21624 83 B26310 45 B30014 236 B30128 239
B21626 85 B26320 46 B30015 234 B30129 228

398 Subjects to change without notice 09.2016


Articlenumber $Chapter_L1

B30130 224 B34001 176 B34165 282 B42480 310


B30131 224 B34002 176 B34170 86 B42560 308
B30132 224 B34003 176 B34171 160 B42571 313
B30133 224 B34006 177 B34172 162 B42666 310
B30135 222 B34007 177 B34173 161 B42667 311
B30136 222 B34012 180 B34174 162 B42668 311
B30137 222 B34013 180 B34175 160 B42669 311
B30138 222 B34014 181 B34176 165 B42727 312
B30139 222 B34020 167 B34177 163 B43030 313
B30140 222 B34025 151 B34178 164 B43130 313
B30146 242 B34026 151 B34179 164 B43700 324
B30147 242 B34027 151 B34180 165 B44021 320
B30155 243 B34028 151 B34181 168 B44022 320
B30156 243 B34030 216 B34182 168 B44200 320
B30157 243 B34040 194 B34183 169 B44213 318
B30160 244 B34041 194 B34184 169 B44214 319
B30161 244 B34042 195 B34185 169 B44348 321
B30162 245 B34050 161 B34217 178 B44350 321
B30163 245 B34051 161 B34218 179 B44361 321
B30165 243 B34054 163 B34219 179 B44425 322
B30166 243 B34060 182 B34403 198 B44500 316
B30167 243 B34061 182 B34405 197 B44650 117
B30173 219 B34062 182 B34407 192 B45025 326
B30174 219 B34063 178 B34408 196 B45041 326
B30175 219 B34066 114 B34410 200 B45045 326
B30176 219 B34067 215 B34412 204 B45050 330
B30177 219 B34068 215 B34413 205 B45103 327
B30178 219 B34069 215 B34414 205 B45560 327
B30179 219 B34073 183 B34415 200 B45600 327
B30192 220 B34075 192 B34416 202 B45655 329
B30193 220 B34076 192 B34417 204 B45657 330
B30194 220 B34077 191 B34418 206 B45660 329
B30195 220 B34078 193 B34419 201 B45725 332
B30196 220 B34081 166 B34420 211 B45726 332
B30197 220 B34082 166 B34421 211 B45740 330
B30198 220 B34083 167 B34422 212 B45745 331
B30250 241 B34085 155 B34423 212 B45755 333
B30251 241 B34089 331 B34424 212 B45940 332
B30260 242 B34090 152 B34425 212 B46026 335
B30261 242 B34097 149 B34440 213 B46030 305
B30265 246 B34098 149 B34441 213 B46060 307
B30266 246 B34103 155 B34442 213 B46061 307
B30268 245 B34120 153 B34443 213 B46062 308
B30270 229 B34121 150 B34444 214 B46149 336
B30271 229 B34122 181 B34445 214 B46160 37
B30272 229 B34123 181 B34461 217 B46161 38
B30273 229 B34124 181 B34463 218 B46162 38
B30274 240 B34125 181 B40450 302 B46163 38
B30275 240 B34128 154 B40550 323 B46164 39
B30276 240 B34130 150 B40605 301 B46165 39
B30277 240 B34132 283 B40610 301 B46166 40
B30278 240 B34134 237 B40611 302 B46167 40
B30279 232 B34137 149 B40650 301 B46250 325
B30280 232 B34140 184 B41201 303 B46300 314
B30304 230 B34150 273 B41202 303 B46305 314
B30305 231 B34151 274 B41203 303 B46351 338
B30306 231 B34152 275 B41204 304 B46356 315
B33310 151 B34153 276 B41205 304 B46357 315
B33382 226 B34154 277 B41475 302 B46358 315
B33383 226 B34155 278 B41525 304 B46419 145
B33384 226 B34157 279 B41900 305 B46425 334
B33385 226 B34158 280 B42460 308 B46426 335
B33387 235 B34159 280 B42463 309 B46475 336
B33388 235 B34160 281 B42464 309 B46480 337
B33389 235 B34161 281 B42465 309 B46505 325
B34000 176 B34162 282 B42475 310 B46600 325

09.2016 Subjects to change without notice 399


$Chapter_L1 Articlenumber

B46726 314 COXB973946 24 DP8500053 256 DY2701491 175


B46850 337 COXB973971 25 DP8500054 257 DY2701581 175
B46860 337 CP180470 127 DP8500055 258 DY2701592 215
B47049 338 CP180630 127 DP8500056 259 DY2701713 171
B47050 338 CP195270 128 DP8500057 260 DY2701761 172
B47055 338 CP232025 128 DP8500058 261 DY2701771 172
B47131 339 CP232040 128 DP8500059 262 DY2701781 173
B47136 339 CP676014 146 DP8500060 263 DY2701791 174
BP302505 29 CP781257 80 DP8500061 264 DY2701851 171
BP305006 30 CP781605 87 DP8500079 283 DY2701854 169
BP305012 30 CP781612 87 DP8500080 284 DY2701855 170
BWW02108 41 CP804160 121 DP8500084 285 DY2701856 170
CMB321225 333 CP804162 120 DP8500085 286 DY2702887 173
CMB321625 333 CP822702 121 DP8500086 287 DY5110001 288
CMB322025 334 CP861175 14 DP8500087 288 DY5110002 289
CMB322425 334 CP880303 78 DY30000 158 DY5110003 289
COX591201 146 CP885552 144 DY31000 158 DY5110004 290
COX610750 31 CP910001 122 DY200700 187 DY5110005 290
COX611750 31 CP937210 70 DY200701 188 DY5110006 291
COX612750 32 CPT100200 129 DY200702 188 DY5110007 291
COX938602 74 CPT110250 130 DY200703 189 DY5110008 292
COXB364001 52 CPT112180 132 DY200704 189 DY5110010 292
COXB364002 105 CPT130160 132 DY200809 185 DY5110011 293
COXB364003 105 CPT137180 133 DY200810 186 DY5110012 293
COXB364004 95 CPT170160 133 DY200811 187 DY5110013 294
COXB364005 126 CPT176160 134 DY250829 159 DY5110015 294
COXB364006 95 CPT178160 134 DY250830 159 DY5110016 295
COXB364011 96 CPT179004 129 DY270554 196 DY5110017 295
COXB364012 96 CPT187081 137 DY270555 197 DY7100001 156
COXB364013 97 CPT187082 136 DY270601 199 DY7100002 156
COXB364015 97 CPT187084 136 DY270603 202 DY7100003 156
COXB364016 98 CPT187087 137 DY270604 199 DY7100004 156
COXB364041 98 CPT188003 135 DY270606 203 DY7100005 156
COXB364060 41 CPT190221 130 DY270608 153 DY7100006 157
COXB364100 138 CPT202240 135 DY270609 152 DY7100007 157
COXB370200 99 CPT243260 131 DY270612 195 DY7100008 157
COXB370250 99 CPT243261 131 DY270613 211 DY7100009 157
COXB370260 100 CPT243262 131 DY270616 193 DY7100010 157
COXB541900 106 CPT251250 131 DY270623 207 DY7100011 157
COXB700312 53 CPT861000 71 DY270624 207 DY7100012 157
COXB702003 53 CPT894200 56 DY270630 198 DY7100013 157
COXB702005 54 CPT966903 71 DY270633 209 FLOR70349 319
COXB816150 118 DK3230002 241 DY270634 209 FLOR70365 317
COXB896900 55 DK3230003 241 DY270635 210 FLOR70366 318
COXB896901 55 DP3213240 240 DY270636 203 FLOR70367 316
COXB896902 56 DP3213250 240 DY270637 209 FLOR70368 317
COXB897909 58 DP3213260 240 DY270638 210 FLOR79098 312
COXB897918 61 DP8500001 250 DY270639 214 FLOR79099 312
COXB897930 62 DP8500002 251 DY270643 206 FLOR89955 328
COXB897932 63 DP8500005 252 DY270644 208 FLOR89956 328
COXB897940 59 DP8500006 265 DY270650 194 FLORP10781 322
COXB897942 60 DP8500010 266 DY270651 190 FLORP44349 323
COXB897950 62 DP8500014 253 DY270652 190 FLORP44430 324
COXB897951 42 DP8500020 267 DY270653 190 FLORP45220 328
COXB897953 138 DP8500030 268 DY270654 190 FLORP45350 329
COXB899015 123 DP8500031 268 DY270655 190 FLORP46031 306
COXB899016 123 DP8500032 269 DY270656 190 FLORP46032 306
COXB973725 20 DP8500033 269 DY270657 190 HV4241 296
COXB973731 21 DP8500034 270 DY270662 191 HV4242 296
COXB973732 23 DP8500035 270 DY270664 201 HV4243 297
COXB973832 22 DP8500036 271 DY270665 208 HV4244 297
COXB973915 21 DP8500037 272 DY2700594 216 HV4245 298
COXB973918 24 DP8500038 272 DY2700595 217 HV4560 249
COXB973925 23 DP8500050 254 DY2701451 174 KSTASC00 373
COXB973932 22 DP8500051 254 DY2701461 174 SA100 383
COXB973943 100 DP8500052 255 DY2701481 175 SA101 374

400 Subjects to change without notice 09.2016


Articlenumber $Chapter_L1

SA103 374 SA1106 367


SA108 375 SA1107 367
SA119 363 SA1108 367
SA123 390 SA1109 367
SA130 371 SA1110 368
SA131 381 SA1111 368
SA140 372 SA1112 368
SA145 371 SA1113 368
SA147 378 SA1114 368
SA166 377 SA1115 368
SA168 369 SA1116 368
SA185 377 SA1117 368
SA220 385 SA1118 368
SA230 387 SA307897 370
SA240 384 SA307898 370
SA250 384 SA307899 370
SA260 379 SA318624 369
SA270 380 SA319899 376
SA310 382 SA330100 349
SA326 347 SA330101 350
SA327 348 SA330693 351
SA760 373 SA330694 357
SA840 342 SA330695 354
SA841 342 SA330696 361
SA842 343 SA330793 353
SA843 344 SA330794 360
SA844 343 SA330795 356
SA850 344 SA330893 352
SA851 345 SA330894 359
SA852 345 SA330895 355
SA853 346 SA330990 357
SA855 346 SA330991 358
SA1001 364 SA353304 376
SA1002 364 SAH1131 347
SA1003 364 T319649 363
SA1004 364 T321030 379
SA1005 364 T357401 382
SA1006 364 T380299 378
SA1007 364 T593000 389
SA1008 364 T593006 389
SA1009 365 T595500 387
SA1010 365 T595505 388
SA1011 365 T595510 388
SA1012 365 T595600 383
SA1014 365 T595605 383
SA1015 365 T595700 386
SA1016 365 T595701 386
SA1017 365 TB3010 362
SA1018 365 TB3011 362
SA1019 365 TB3012 361
SA1020 365
SA1021 365
SA1022 365
SA1023 366
SA1024 366
SA1025 366
SA1026 366
SA1027 366
SA1028 366
SA1029 366
SA1030 366
SA1031 366
SA1101 367
SA1102 367
SA1104 367
SA1105 367

09.2016 Subjects to change without notice 401


$Chapter_L1 Copyright

:HUHVHUYHWKHULJKWRIPRGL¿FDWLRQZKLFKPD\UHVXOWLQGLIIHUHQFHVEHWZHHQLOOXVWUDWLRQVDQGWH[WVDVZHOODVLQPRGHOGHVLJQ
change. This catalogue is copyright. Reprints or any form of duplication of any part of this catalogue or of the catalogue as a
ZKROHRURIDQ\LOOXVWUDWLRQLQSDUWLFXODUDUHVXEMHFWWRRXUDSSURYDO$OORXUTXRWDWLRQVDQGDQ\SXUFKDVHRUGHOLYHU\FRQWUDFW
concluded with us and any other contractual services shall be governed by our General Terms and Conditions of Sale and
Delivery.

402 Subjects to change without notice 09.2016

You might also like