You are on page 1of 44

BULLET PROOF DOORS, WINDOWS

AND OTHER SYSTEM


FIRE RATED
EMBOSSED PANEL DOORS

HURRICANE RESISTANCE
TRADITIONAL DESIGNS STANDARD
PRODUCT
AVAILABLE
OPTIONS
FEATURES

HIGH DEFINITION
TRADITIONAL DESIGNS STANDARD
PRODUCT
AVAILABLE
OPTIONS
5HSXEOLF·VFRPSOHWHOLQHRIFRPPHUFLDOKROORZPHWDOHPERVVHGSDQHOGRRUV
SURYLGHDZLGHUDQJHRIGHVLJQÁH[LELOLW\2XUGRRUVPHHWDQGH[FHHGDOORI\RXU
FEATURES JDJHFORVHUUHLQIRUFHPHQW
SULPDU\RSWLRQ
DUFKLWHFWXUDOSURMHFWQHHGV µGHVLJQUDWHGIRUOLJKWWRH[WUD
5HSXEOLF·VWUDGLWLRQDOHPERVVHGGHVLJQVLQFOXGHDQGSDQHOOD\RXWV KHDY\GXW\XVH JDJHFORVHUUHLQIRUFHPHQW
:HDOVRRIIHU· QRPLQDO WDOORQWKHSDQHOGHVLJQZLWKHORQJDWHGSDQHOV VHFRQGDU\RSWLRQ
SDQHODUFKWRSDQG&URVVEXFNGHVLJQ 6L]HVDYDLODEOH0LQLPXP·µ[·µ
6HYHUDORIRXUGHVLJQVDUHDYDLODEOHZLWKSURYLVLRQ V IRUOLWHLQVHUWV2XUGRRUV 0D[LPXP·µ[·µ JDJH &RQWLQXRXVO\ZHOGHGVHDPOHVV
DUHDYDLODEOHLQDQGJDJHGHSHQGLQJXSRQGHVLJQ(PERVVHGGRRUVDUH DYDLODEOHLQRUVPDOOHURQO\  GHVLJQRUÀOOHGVHDPOHVVGHVLJQ
VWDQGDUG$JDOYDQQHDOZLWKSRO\VW\UHQHFRUH&RQWDFWDFXVWRPHUVHUYLFHUHSIRU 1RWDYDLODEOHRQJDJH
FRPSOHWHGHWDLOVRQDYDLODELOLW\ +LQJHFKDQQHOLVQRQEHYHOHGDQG
UHLQIRUFHGZLWKDIXOOKHLJKWJDJH /RFNHGJHEHYHOHGµLQµ
VWHHOFKDQQHOSURMHFWLRQZHOGHGDW
9LVLRQ/LJKWLQVHUWV
DPD[LPXPRIµRQFHQWHUZLWKDQ
DGGLWLRQDOJDJHUHLQIRUFHPHQWSODWH
)LQLVKSDLQW 5HSXEOLFVWDQGDUGDQG
DWHDFKKLQJHORFDWLRQSURYLGLQJRYHU custom colors)
µWRWDOUHLQIRUFHPHQW
67&UDWHG SDQHORQO\
JDJHIOXVKWRSDQGLQYHUWHGERWWRP
FKDQQHOVSURMHFWLRQZHOGHGWRERWK µ7KLFN
VNLQVHYHU\µRQFHQWHU
4 PANEL 6 PANEL 8 PANEL HALF CROSS SUN
GLASS BUCK BURST /RFNHGJHLVQRQEHYHOHGDQG
UHLQIRUFHGZLWKDFRQWLQXRXVJDJH
FKDQQHOPRUWLVHDQGF\OLQGULFDOORFN
UHLQIRUFHPHQWVDUHLQWHJUDOJDJH

HIGH DEFINITION UHLQIRUFHPHQWV

:KHWKHU\RXVHOHFWRXUWUDGLWLRQDO 'RRUVDUHWKRURXJKO\FOHDQHG
GHVLJQRURXUQHZ+'VWHHOGRRU SKRVSKDWL]HGDQGSULPHGZLWKDFRDW
\RX·OOEHDGGLQJDEHDXWLIXOGXUDEOH RIIRUFHFXUHGUXVWLQKLELWLQJSULPHU
HQWUDQFHWRDQ\DUFKLWHFWXUDORSHQLQJ WKDWPHHWVDQGRUH[FHHGVWKH
ZLWKULFKDQGGLVWLQFWLYHSDQHO
UHTXLUHPHQWVRI$16,$ 
HPERVVPHQWV
2XUQHZDQGSDQHODUFKWRS KRXUFRQWLQXRXVVDOWVSUD\WHVWSHU
1 PANEL 2 PANEL 2 PANEL
DUHDYDLODEOHZLWKKLJKGHÀQLWLRQVW\OH $670%DQGKRXUFRQWLQXRXV
ARCHTOP RSWLRQ KXPLGLW\WHVWSHU$670'

www.republicdoor.com 155 REPUBLIC DRIVE | McKENZIE, TN 38201 | 1.800.733.3667 | FAX 1.800.723.6677 | www.republicdoor.com
FIRE RATED
*HWXSWRKRXUVRIÀUHSURWHFWLRQZLWK5HSXEOLF·VHPERVVHG
SDQHOGRRUV5HSXEOLFHPERVVHGSDQHOGRRUVKDYHEHHQÀUH
WHVWHGLQDFFRUGDQFHZLWK8/%8/&8%&DQG$670
EMBOSSED PANEL DOORS
(DQGDUHDOOPDQXIDFWXUHGXQGHU8QGHUZULWHUV/DERUDWRULHV
DQG:DUQRFN+HUVH\,76IDFWRU\LQVSHFWLRQDQGODEHOLQJVHUYLFH
SURJUDP)LUHUDWLQJFDSDELOLWLHVRQWKHVHSURGXFWVLQFOXGHWKHXVH
RIJODVVDQGVSHFLDOFRPSRXQGV

HURRICANE RESISTANCE
7KH8QLWHG6DWHVKDVH[SHULHQFHGQXPHURXVKXUULFDQHVWKDW
KDYHLQÁLFWHGORVVRIOLIHDQGH[WHQVLYHSURSHUW\GDPDJH,Q
UHVSRQVHPDQ\FRDVWDOUHJLRQVDUHQRZDGRSWLQJVWULFWEXLOGLQJ
FRGHSURYLVLRQVLQWHQGHGWRHQKDQFHWKHVWUXFWXUDOLQWHJULW\RI
FRPPHUFLDOEXLOGLQJV
5HSXEOLFPHHWVDQGH[FHHGVWKHFXUUHQW+XUULFDQH:LQGVWRUP
FRGHUHTXLUHPHQWV2XUDQGSDQHOHPERVVHGGRRUVKROG
DSUHVVXUHUDWLQJRISVIIRUERWKLQVZLQJDQGRXWVZLQJ
DSSOLFDWLRQV5HSXEOLFGRRUVDUHDSSURYHGIRU)ORULGD%XLOGLQJ
&RGH )%& 0LDPL'DGH 12$ DQG7H[DV'HSDUWPHQWRI,QVXUDQFH
7', 7KHVHGRRUVDUHDSSURYHGIRUFRDVWDODUHDVVXEMHFWWR
KXUULFDQHZLQGVWRUPIRUFHZLQGVDQGGHEULV

155 REPUBLIC DRIVE | McKENZIE, TN 38201 | 1.800.733.3667 | FAX 1.800.723.6677 | www.republicdoor.com www.republicdoor.com

FEMA 320 & 361 TORNADO SYSTEMS
When a tornado threatens, individuals need to have a safe place to go and time to
get there. Lives are saved when individuals receive and understand the warning,
know what to do, and know the safest place to go.
Doors and Fr ames
Close Focus Research Page 1 of 2 Ballistic Test Report
Ballistic Testing Services Report Number: BTR-03-09-2022-Sample 1a
Phone: 800-513-4291 Email: techsupport@CloseFocusResearch.com CloseFocusResearch.com
Name: Rollc for Trading Company Report Date: March 9, 2022
Address: Riyadh, Saudi Arabia Contact: Azzam Asfour
Phone: Phone: +966-553331850 Email: talaforsafety@yahoo.com

Ballistic Results
Project Summary International Ballistic Standards / Specifications Testing
Type of Products to be tested: Steel Frames and Panels ASTM Canadian FRA NIJ CFR Pass All
Test Specimen Sample size(s): Various Sizes Australian EN1063 Germ DIN State Dept CFR SYA
Number of test specimens: 3 Samples / 6 Tests British EN1522/23 MIL-SAMIT UL 752 Other
Weight of all samples: 81.4 lbs Test Standard: European EN1522 / EN1523 [No Splinters]
Are Materials a Health Hazard: No Particular Test: EN FB4 [NS] Part 1 (.357 Mag. 158 gr FSJCSC)
Need the Tests performed by: within 7 to 10 days Velocity Range: 1,378 to 1,444 ft/s
Need products shipped back: No Shots: 3 shots
Purchase Order Number: Not Applicable Shot Pattern: 4.7 inch triangle

Test Results
Test Sample: Sample 1a
Test / Part Number: 1 / Panel B4 10.40 inch
Sample ID: Panel B4 (264.2 mm)
Description: Steel Panel
Sample Size: 10.40 x 7.80 inch (264.2 x 198.1 mm)
Thickness: 9.80 inch (248.9 mm)
Weight: 45.60 lbs (20.68 kg)
Weapon Type: .357 Magnum
Cartridge / Projectile Type: .357 Magnum 158 gr FSJ Coned Soft Core
Projectile Weight: 158 grains
Target Distance: 16.4 feet
7.80 inch (198.1 mm)
Number of Shots: 3 shots
Shot Sequence: Shot 1 Shot 2 Shot 3
Impact Velocity (ft/sec) *: 1,414 1,416 1,409
Impact Energy (ft-lbs): 701 703 696
Impact Momentum (lb-sec.): 0.99 0.99 0.99
Impact Angle (degrees): 0º 0º 0º
Sample Penetration: NP NP NP
Witness Plate Penetration: NP NP NP
Impact Spacing (inches) **: 4.80 4.46 4.36
Impact Spacing / Pattern: 4.54 inch (average)
Witness plate material: 0.0008 in. thick Type 1100 Aluminum foil
Spall catch box: 17.32 x 17.32 in.
Witness / Box Distance: 19.7 inches NP = No Penetration
Spall Occurrence: No spall occurred PP = Partial Penetration
Test Temperature: 64 º F CP = Complete Penetration
Test Date: March 09, 2022 N/A = Not Applicable
Pass / Fail Results: Passed the Test
Comments:
Footnotes
* Velocity measurements were taken at a distance of 8.2 feet from muzzle.
** Impact Spacing is the distance between shots (shot 1= 3 to 1, shot 2 = 1 to 2, shot 3 = 2 to 3)

Test and Report Engineers


Tested and Reported by: Sam Raheb Signature: Date: March 9, 2022

Form: BTR22P-12 © 2/06 Close Focus Research


Close Focus Research Page 2 of 2 Ballistic Test Report
Ballistic Testing Services Report Number: BTR-03-09-2022-Sample 1b
Phone: 800-513-4291 Email: techsupport@CloseFocusResearch.com CloseFocusResearch.com

Name: Rollc for Trading Company Report Date: March 9, 2022


Ballistic Test Results and Photographs

Ballistic Test Results:


Test Sample 1b passed the European EN1522 / EN1523 [No Splinters] EN FB4 [NS] Part 2 (.44 Mag. 240 gr FCJFNSC) Ballistic test. There
was no complete penetration of the test sample from any of the .44 Magnum FCJ Flat Nose Soft Core caliber projectiles.

Witness Plate and Spall Effects:


No spall occurred or damage to the 0.0008 in. thick Type 1100 Aluminum foil witness plate was observed.

Photographs
The following photographs show both the pre and post-test sample. Additional larger sized photographs are included with this report.

Test and Report Engineers


Tested and Reported by: Sam Raheb Signature: Date: March 9, 2022

Form: BTR22P-12 © 2/06 Close Focus Research


Close Focus Research Page 1 of 2 Ballistic Test Report
Ballistic Testing Services Report Number: BTR-03-09-2022-Sample 1b
Phone: 800-513-4291 Email: techsupport@CloseFocusResearch.com CloseFocusResearch.com
Name: Rollc for Trading Company Report Date: March 9, 2022
Address: Riyadh, Saudi Arabia Contact: Azzam Asfour
Phone: Phone: +966-553331850 Email: talaforsafety@yahoo.com

Ballistic Results
Project Summary International Ballistic Standards / Specifications Testing
Type of Products to be tested: Steel Frames and Panels ASTM Canadian FRA NIJ CFR Pass All
Test Specimen Sample size(s): Various Sizes Australian EN1063 Germ DIN State Dept CFR SYA
Number of test specimens: 3 Samples / 6 Tests British EN1522/23 MIL-SAMIT UL 752 Other
Weight of all samples: 81.4 lbs Test Standard: European EN1522 / EN1523 [No Splinters]
Are Materials a Health Hazard: No Particular Test: EN FB4 [NS] Part 2 (.44 Mag. 240 gr FCJFNSC)
Need the Tests performed by: within 7 to 10 days Velocity Range: 1,411 to 1,476 ft/s
Need products shipped back: No Shots: 3 shots
Purchase Order Number: Not Applicable Shot Pattern: 4.7 inch triangle

Test Results
Test Sample: Sample 1b
Test / Part Number: 2 / Panel B4 10.40 inch
Sample ID: Panel B4 (264.2 mm)
Description: Steel Panel
Sample Size: 10.40 x 7.80 inch (264.2 x 198.1 mm)
Thickness: 9.80 inch (248.9 mm)
Weight: 45.60 lbs (20.68 kg)
Weapon Type: .44 Magnum
Cartridge / Projectile Type: .44 Magnum FCJ Flat Nose Soft Core
Projectile Weight: 240 grains
Target Distance: 16.4 feet
7.80 inch (198.1 mm)
Number of Shots: 3 shots
Shot Sequence: Shot 1 Shot 2 Shot 3
Impact Velocity (ft/sec) *: 1,447 1,442 1,445
Impact Energy (ft-lbs): 1,116 1,108 1,113
Impact Momentum (lb-sec.): 1.54 1.54 1.54
Impact Angle (degrees): 0º 0º 0º
Sample Penetration: NP NP NP
Witness Plate Penetration: NP NP NP
Impact Spacing (inches) **: 4.15 4.36 4.36
Impact Spacing / Pattern: 4.29 inch (average)
Witness plate material: 0.0008 in. thick Type 1100 Aluminum foil
Spall catch box: 17.32 x 17.32 in.
Witness / Box Distance: 19.7 inches NP = No Penetration
Spall Occurrence: No spall occurred PP = Partial Penetration
Test Temperature: 64 º F CP = Complete Penetration
Test Date: March 09, 2022 N/A = Not Applicable
Pass / Fail Results: Passed the Test
Comments:
Footnotes
* Velocity measurements were taken at a distance of 8.2 feet from muzzle.
** Impact Spacing is the distance between shots (shot 1= 3 to 1, shot 2 = 1 to 2, shot 3 = 2 to 3)

Test and Report Engineers


Tested and Reported by: Sam Raheb Signature: Date: March 9, 2022

Form: BTR22P-12 © 2/06 Close Focus Research


Close Focus Research Page 2 of 2 Ballistic Test Report
Ballistic Testing Services Report Number: BTR-03-09-2022-Sample 1c
Phone: 800-513-4291 Email: techsupport@CloseFocusResearch.com CloseFocusResearch.com

Name: Rollc for Trading Company Report Date: March 9, 2022


Ballistic Test Results and Photographs

Ballistic Test Results:


Test Sample 1c passed the European EN1522 / EN1523 [No Splinters] EN FB7 [NS] (7.62 x 51 NATO 150 gr FCJSHC AP) Ballistic test.
There was no complete penetration of the test sample from any of the 7.62 x 51 NATO FCJ steel hard core AP caliber projectiles.

Witness Plate and Spall Effects:


No spall occurred or damage to the 0.0008 in. thick Type 1100 Aluminum foil witness plate was observed.

Photographs
The following photographs show both the pre and post-test sample. Additional larger sized photographs are included with this report.

Test and Report Engineers


Tested and Reported by: Sam Raheb Signature: Date: March 9, 2022

Form: BTR22P-12 © 2/06 Close Focus Research


Close Focus Research Page 1 of 2 Ballistic Test Report
Ballistic Testing Services Report Number: BTR-03-09-2022-Sample 1c
Phone: 800-513-4291 Email: techsupport@CloseFocusResearch.com CloseFocusResearch.com
Name: Rollc for Trading Company Report Date: March 9, 2022
Address: Riyadh, Saudi Arabia Contact: Azzam Asfour
Phone: Phone: +966-553331850 Email: talaforsafety@yahoo.com

Ballistic Results
Project Summary International Ballistic Standards / Specifications Testing
Type of Products to be tested: Steel Frames and Panels ASTM Canadian FRA NIJ CFR Pass All
Test Specimen Sample size(s): Various Sizes Australian EN1063 Germ DIN State Dept CFR SYA
Number of test specimens: 3 Samples / 6 Tests British EN1522/23 MIL-SAMIT UL 752 Other
Weight of all samples: 81.4 lbs Test Standard: European EN1522 / EN1523 [No Splinters]
Are Materials a Health Hazard: No Particular Test: EN FB7 [NS] (7.62 x 51 NATO 150 gr FCJSHC AP)
Need the Tests performed by: within 7 to 10 days Velocity Range: 2,657 to 2,723 ft/s
Need products shipped back: No Shots: 3 shots
Purchase Order Number: Not Applicable Shot Pattern: 4.7 inch triangle

Test Results
Test Sample: Sample 1c
Test / Part Number: 3 / Panel B7 10.40 inch
Sample ID: Panel B7 (264.2 mm)
Description: Steel Panel
Sample Size: 10.40 x 7.80 inch (264.2 x 198.1 mm)
Thickness: 9.80 inch (248.9 mm)
Weight: 45.60 lbs (20.68 kg)
Weapon Type: 7.62 NATO
Cartridge / Projectile Type: 7.62 x 51 NATO FCJ steel hard core AP
Projectile Weight: 150 grains
Target Distance: 32.8 feet
7.80 inch (198.1 mm)
Number of Shots: 3 shots
Shot Sequence: Shot 1 Shot 2 Shot 3
Impact Velocity (ft/sec) *: 2,696 2,688 2,697
Impact Energy (ft-lbs): 2,420 2,406 2,422 PP = Partial Penetration - A situation when the projectile
Impact Momentum (lb-sec.): 1.80 1.79 1.80 completely penetrates a test specimen, but projectile
Impact Angle (degrees): 0º 0º 0º itself did not exit the specimen. The projectile is lodged
Sample Penetration: PP PP PP and protruding out the rear surface of the specimen as
Witness Plate Penetration: NP NP NP shown in the images on page 2.
Impact Spacing (inches) **: 4.92 4.31 3.73
Impact Spacing / Pattern: 4.32 inch (average)
Witness plate material: 0.0008 in. thick Type 1100 Aluminum foil
Spall catch box: 17.32 x 17.32 in.
Witness / Box Distance: 19.7 inches NP = No Penetration
Spall Occurrence: No spall occurred PP = Partial Penetration
Test Temperature: 64 º F CP = Complete Penetration
Test Date: March 09, 2022 N/A = Not Applicable
Pass / Fail Results: Passed the Test
Comments:
Footnotes
* Velocity measurements were taken at a distance of 8.2 feet from muzzle.
** Impact Spacing is the distance between shots (shot 1= 3 to 1, shot 2 = 1 to 2, shot 3 = 2 to 3)

Test and Report Engineers


Tested and Reported by: Sam Raheb Signature: Date: March 9, 2022

Form: BTR22P-12 © 2/06 Close Focus Research


Close Focus Research Page 2 of 2 Ballistic Test Report
Ballistic Testing Services Report Number: BTR-03-09-2022-Sample 1a
Phone: 800-513-4291 Email: techsupport@CloseFocusResearch.com CloseFocusResearch.com

Name: Rollc for Trading Company Report Date: March 9, 2022


Ballistic Test Results and Photographs

Ballistic Test Results:


Test Sample 1a passed the European EN1522 / EN1523 [No Splinters] EN FB4 [NS] Part 1 (.357 Mag. 158 gr FSJCSC) Ballistic test. There
was no complete penetration of the test sample from any of the .357 Magnum 158 gr FSJ Coned Soft Core caliber projectiles.

Witness Plate and Spall Effects:


No spall occurred or damage to the 0.0008 in. thick Type 1100 Aluminum foil witness plate was observed.

Photographs
The following photographs show both the pre and post-test sample. Additional larger sized photographs are included with this report.

Test and Report Engineers


Tested and Reported by: Sam Raheb Signature: Date: March 9, 2022

Form: BTR22P-12 © 2/06 Close Focus Research


Close Focus Research Page 1 of 2 Ballistic Test Report
Ballistic Testing Services Report Number: BTR-03-09-2022-Sample 2a
Phone: 800-513-4291 Email: techsupport@CloseFocusResearch.com CloseFocusResearch.com
Name: Rollc for Trading Company Report Date: March 9, 2022
Address: Riyadh, Saudi Arabia Contact: Azzam Asfour
Phone: Phone: +966-553331850 Email: talaforsafety@yahoo.com

Ballistic Results
Project Summary International Ballistic Standards / Specifications Testing
Type of Products to be tested: Steel Frames and Panels ASTM Canadian FRA NIJ CFR Pass All
Test Specimen Sample size(s): Various Sizes Australian EN1063 Germ DIN State Dept CFR SYA
Number of test specimens: 3 Samples / 6 Tests British EN1522/23 MIL-SAMIT UL 752 Other
Weight of all samples: 81.4 lbs Test Standard: European EN1522 / EN1523 [No Splinters]
Are Materials a Health Hazard: No Particular Test: EN FB4 [NS] Part 1 (.357 Mag. 158 gr FSJCSC)
Need the Tests performed by: within 7 to 10 days Velocity Range: 1,378 to 1,444 ft/s
Need products shipped back: No Shots: 3 shots
Purchase Order Number: Not Applicable Shot Pattern: 4.7 inch triangle

Test Results
Test Sample: Sample 2a
Test / Part Number: 4 / B4 11.85 inch
Sample ID: B4 (301.0 mm)
Description: Steel Frame Section
Sample Size: 11.85 x 11.85 inch (301.0 x 301.0 mm)
Thickness: 2.267 inch (57.58 mm)
Weight: 11.40 lbs (5.17 kg)
Weapon Type: .357 Magnum
Cartridge / Projectile Type: .357 Magnum 158 gr FSJ Coned Soft Core
Projectile Weight: 158 grains
Target Distance: 16.4 feet
11.85 inch (301.0 mm)
Number of Shots: 3 shots
Shot Sequence: Shot 1 Shot 2 Shot 3
Impact Velocity (ft/sec) *: 1,402 1,411 1,408
Impact Energy (ft-lbs): 689 698 695
Impact Momentum (lb-sec.): 0.98 0.99 0.99
Impact Angle (degrees): 0º 0º 0º
Sample Penetration: NP NP NP
Witness Plate Penetration: NP NP NP
Impact Spacing (inches) **: N/A N/A N/A
Impact Spacing / Pattern: N/A
Witness plate material: 0.0008 in. thick Type 1100 Aluminum foil
Spall catch box: 17.32 x 17.32 in.
Witness / Box Distance: 19.7 inches NP = No Penetration
Spall Occurrence: No spall occurred PP = Partial Penetration
Test Temperature: 64 º F CP = Complete Penetration
Test Date: March 09, 2022 N/A = Not Applicable
Pass / Fail Results: Passed the Test
Comments:
Footnotes
* Velocity measurements were taken at a distance of 8.2 feet from muzzle.
** Impact Spacing is the distance between shots (shot 1= 3 to 1, shot 2 = 1 to 2, shot 3 = 2 to 3)

Test and Report Engineers


Tested and Reported by: Sam Raheb Signature: Date: March 9, 2022

Form: BTR22P-12 © 2/06 Close Focus Research


Close Focus Research Page 2 of 2 Ballistic Test Report
Ballistic Testing Services Report Number: BTR-03-09-2022-Sample 2a
Phone: 800-513-4291 Email: techsupport@CloseFocusResearch.com CloseFocusResearch.com

Name: Rollc for Trading Company Report Date: March 9, 2022


Ballistic Test Results and Photographs

Ballistic Test Results:


Test Sample 2a passed the European EN1522 / EN1523 [No Splinters] EN FB4 [NS] Part 1 (.357 Mag. 158 gr FSJCSC) Ballistic test. There
was no complete penetration of the test sample from any of the .357 Magnum 158 gr FSJ Coned Soft Core caliber projectiles.

Witness Plate and Spall Effects:


No spall occurred or damage to the 0.0008 in. thick Type 1100 Aluminum foil witness plate was observed.

Photographs
The following photographs show both the pre and post-test sample. Additional larger sized photographs are included with this report.

Test and Report Engineers


Tested and Reported by: Sam Raheb Signature: Date: March 9, 2022

Form: BTR22P-12 © 2/06 Close Focus Research


Close Focus Research Page 1 of 2 Ballistic Test Report
Ballistic Testing Services Report Number: BTR-03-09-2022-Sample 2b
Phone: 800-513-4291 Email: techsupport@CloseFocusResearch.com CloseFocusResearch.com
Name: Rollc for Trading Company Report Date: March 9, 2022
Address: Riyadh, Saudi Arabia Contact: Azzam Asfour
Phone: Phone: +966-553331850 Email: talaforsafety@yahoo.com

Ballistic Results
Project Summary International Ballistic Standards / Specifications Testing
Type of Products to be tested: Steel Frames and Panels ASTM Canadian FRA NIJ CFR Pass All
Test Specimen Sample size(s): Various Sizes Australian EN1063 Germ DIN State Dept CFR SYA
Number of test specimens: 3 Samples / 6 Tests British EN1522/23 MIL-SAMIT UL 752 Other
Weight of all samples: 81.4 lbs Test Standard: European EN1522 / EN1523 [No Splinters]
Are Materials a Health Hazard: No Particular Test: EN FB4 [NS] Part 2 (.44 Mag. 240 gr FCJFNSC)
Need the Tests performed by: within 7 to 10 days Velocity Range: 1,411 to 1,476 ft/s
Need products shipped back: No Shots: 3 shots
Purchase Order Number: Not Applicable Shot Pattern: 4.7 inch triangle

Test Results
Test Sample: Sample 2b
Test / Part Number: 5 / B4 11.85 inch
Sample ID: B4 (301.0 mm)
Description: Steel Frame Section
Sample Size: 11.85 x 11.85 inch (301.0 x 301.0 mm)
Thickness: 2.267 inch (57.58 mm)
Weight: 11.40 lbs (5.17 kg)
Weapon Type: .44 Magnum
Cartridge / Projectile Type: .44 Magnum FCJ Flat Nose Soft Core
Projectile Weight: 240 grains
Target Distance: 16.4 feet
11.85 inch (301.0 mm)
Number of Shots: 3 shots
Shot Sequence: Shot 1 Shot 2 Shot 3
Impact Velocity (ft/sec) *: 1,446 1,434 1,441
Impact Energy (ft-lbs): 1,114 1,096 1,106
Impact Momentum (lb-sec.): 1.54 1.53 1.54
Impact Angle (degrees): 0º 0º 0º
Sample Penetration: NP NP NP
Witness Plate Penetration: NP NP NP
Impact Spacing (inches) **: N/A N/A N/A
Impact Spacing / Pattern: N/A
Witness plate material: 0.0008 in. thick Type 1100 Aluminum foil
Spall catch box: 17.32 x 17.32 in.
Witness / Box Distance: 19.7 inches NP = No Penetration
Spall Occurrence: No spall occurred PP = Partial Penetration
Test Temperature: 64 º F CP = Complete Penetration
Test Date: March 09, 2022 N/A = Not Applicable
Pass / Fail Results: Passed the Test
Comments:
Footnotes
* Velocity measurements were taken at a distance of 8.2 feet from muzzle.
** Impact Spacing is the distance between shots (shot 1= 3 to 1, shot 2 = 1 to 2, shot 3 = 2 to 3)

Test and Report Engineers


Tested and Reported by: Sam Raheb Signature: Date: March 9, 2022

Form: BTR22P-12 © 2/06 Close Focus Research


Close Focus Research Page 2 of 2 Ballistic Test Report
Ballistic Testing Services Report Number: BTR-03-09-2022-Sample 2b
Phone: 800-513-4291 Email: techsupport@CloseFocusResearch.com CloseFocusResearch.com

Name: Rollc for Trading Company Report Date: March 9, 2022


Ballistic Test Results and Photographs

Ballistic Test Results:


Test Sample 2b passed the European EN1522 / EN1523 [No Splinters] EN FB4 [NS] Part 2 (.44 Mag. 240 gr FCJFNSC) Ballistic test. There
was no complete penetration of the test sample from any of the .44 Magnum FCJ Flat Nose Soft Core caliber projectiles.

Witness Plate and Spall Effects:


No spall occurred or damage to the 0.0008 in. thick Type 1100 Aluminum foil witness plate was observed.

Photographs
The following photographs show both the pre and post-test sample. Additional larger sized photographs are included with this report.

Test and Report Engineers


Tested and Reported by: Sam Raheb Signature: Date: March 9, 2022

Form: BTR22P-12 © 2/06 Close Focus Research


Close Focus Research Page 1 of 2 Ballistic Test Report
Ballistic Testing Services Report Number: BTR-03-09-2022-Sample 3
Phone: 800-513-4291 Email: techsupport@CloseFocusResearch.com CloseFocusResearch.com
Name: Rollc for Trading Company Report Date: March 9, 2022
Address: Riyadh, Saudi Arabia Contact: Azzam Asfour
Phone: Phone: +966-553331850 Email: talaforsafety@yahoo.com

Ballistic Results
Project Summary International Ballistic Standards / Specifications Testing
Type of Products to be tested: Steel Frames and Panels ASTM Canadian FRA NIJ CFR Pass All
Test Specimen Sample size(s): Various Sizes Australian EN1063 Germ DIN State Dept CFR SYA
Number of test specimens: 3 Samples / 6 Tests British EN1522/23 MIL-SAMIT UL 752 Other
Weight of all samples: 81.4 lbs Test Standard: European EN1522 / EN1523 [No Splinters]
Are Materials a Health Hazard: No Particular Test: EN FB7 [NS] (7.62 x 51 NATO 150 gr FCJSHC AP)
Need the Tests performed by: within 7 to 10 days Velocity Range: 2,657 to 2,723 ft/s
Need products shipped back: No Shots: 3 shots
Purchase Order Number: Not Applicable Shot Pattern: 4.7 inch triangle

Test Results
Test Sample: Sample 3
Test / Part Number: 6 / B7 11.00 inch
Sample ID: B7 (279.4 mm)
Description: Steel Frame Section
Sample Size: 11.00 x 11.05 inch (279.4 x 280.7 mm)
Thickness: 4.905 inch (124.59 mm)
Weight: 24.40 lbs (11.07 kg)
Weapon Type: 7.62 NATO
Cartridge / Projectile Type: 7.62 x 51 NATO FCJ steel hard core AP
Projectile Weight: 150 grains
Target Distance: 32.8 feet
11.05 inch (280.7 mm)
Number of Shots: 3 shots
Shot Sequence: Shot 1 Shot 2 Shot 3
Impact Velocity (ft/sec) *: 2,683 2,695 2,690
Impact Energy (ft-lbs): 2,397 2,419 2,410
Impact Momentum (lb-sec.): 1.79 1.79 1.79
Impact Angle (degrees): 0º 0º 0º
Sample Penetration: NP NP NP
Witness Plate Penetration: NP NP NP
Impact Spacing (inches) **: N/A N/A N/A
Impact Spacing / Pattern: N/A
Witness plate material: 0.0008 in. thick Type 1100 Aluminum foil
Spall catch box: 17.32 x 17.32 in.
Witness / Box Distance: 19.7 inches NP = No Penetration
Spall Occurrence: No spall occurred PP = Partial Penetration
Test Temperature: 64 º F CP = Complete Penetration
Test Date: March 09, 2022 N/A = Not Applicable
Pass / Fail Results: Passed the Test
Comments:
Footnotes
* Velocity measurements were taken at a distance of 8.2 feet from muzzle.
** Impact Spacing is the distance between shots (shot 1= 3 to 1, shot 2 = 1 to 2, shot 3 = 2 to 3)

Test and Report Engineers


Tested and Reported by: Sam Raheb Signature: Date: March 9, 2022

Form: BTR22P-12 © 2/06 Close Focus Research


Close Focus Research Page 2 of 2 Ballistic Test Report
Ballistic Testing Services Report Number: BTR-03-09-2022-Sample 3
Phone: 800-513-4291 Email: techsupport@CloseFocusResearch.com CloseFocusResearch.com

Name: Rollc for Trading Company Report Date: March 9, 2022


Ballistic Test Results and Photographs

Ballistic Test Results:


Test Sample 3 passed the European EN1522 / EN1523 [No Splinters] EN FB7 [NS] (7.62 x 51 NATO 150 gr FCJSHC AP) Ballistic test.
There was no complete penetration of the test sample from any of the 7.62 x 51 NATO FCJ steel hard core AP caliber projectiles.

Witness Plate and Spall Effects:


No spall occurred or damage to the 0.0008 in. thick Type 1100 Aluminum foil witness plate was observed.

Photographs
The following photographs show both the pre and post-test sample. Additional larger sized photographs are included with this report.

Test and Report Engineers


Tested and Reported by: Sam Raheb Signature: Date: March 9, 2022

Form: BTR22P-12 © 2/06 Close Focus Research


Close Focus Research (CFR)
Ballistic Testing and Engineering Design Services
661-645-9791 CloseFocusResearch.com

Azzam Asfour
Rollc for Trading Company
Riyadh, Saudi Arabia
Phone: +966-553331850
Email: talaforsafety@yahoo.com

Date: March 31, 2022


Subject: Project 1 Ballistic Testing Results from Close Focus Research (CFR)

Dear Azzam Asfour:

Rollc for Trading Company Ballistic Test Project 1

The following outlines the Ballistic Testing performed on March 9, 2022 for the European EN 1522 / 1523 Ballistic
Standards Levels FB4 and FB7 Ballistic Standards. All the test samples have passed the tests.

Project 1 Test Samples


Sample 1a: Test 1 - Panel B4 - EN FB4 [NS] Part 1 (.357 Mag.) - Report Number: BTR-03-09-2022-Sample 1a
Sample 1b: Test 2 - Panel B4 - EN FB4 [NS] Part 2 (.44 Mag.) - Report Number: BTR-03-09-2022-Sample 1b
Sample 1c: Test 3 - Panel B7 - EN FB7 [NS] (7.62 x 51 AP) - Report Number: BTR-03-09-2022-Sample 1c
Sample 2a: Test 4 - B4 - EN FB4 [NS] Part 1 (.357 Mag.) - Report Number: BTR-03-09-2022-Sample 2a
Sample 2b: Test 5 - B4 - EN FB4 [NS] Part 2 (.44 Mag.) - Report Number: BTR-03-09-2022-Sample 2b
Sample 3: Test 6 - B7 - EN FB7 [NS] (7.62 x 51 AP) - Report Number: BTR-03-09-2022-Sample 3

Note:
In addition to the FB4 and FB7 tests performed by CFR, based on the performance results of the test samples, we
can attest the these test samples would have also passed the following tests:

The test samples that have passed the European EN 1522 / 1523 Ballistic Standard Level FB4 would also pass the
UL752 Level 1 (9 mm), Level 2 (.357 magnum), and Level 3 (.44 magnum) test standards.

The test samples that have passed the European EN 1522 / 1523 Ballistic Standard Level FB7 would also pass the
UL752 Level 6 (9 mm high velocity), Level 7 (.223 5.56 NATO), Level 8 (7.62 NATO), and the National Institute of
Justice NIJ 0108.01 Level III (7.62 NATO) test standards.

Thank you for your business,

Sam Raheb, CEO


Close Focus Research (CFR)
Phone: 661-645-9791
sam@closefocusresearch.com
http://www.closefocusresearch.com
Close Focus Research Page 1 of 2 Ballistic Test Report
Ballistic Testing Services Report Number: BTR-03-29-2022-Rollc-Sample 1
Phone: 800-513-4291 Email: techsupport@CloseFocusResearch.com CloseFocusResearch.com
Name: Rollc for Trading Company Report Date: March 29, 2022
Address: Riyadh, Saudi Arabia Contact: Azzam Asfour
Phone: Phone: +966-553331850 Email: talaforsafety@yahoo.com

Ballistic Results
Project Summary International Ballistic Standards / Specifications Testing
Type of Products to be tested: Bullet Proof Glazings ASTM Canadian FRA NIJ CFR Pass All
Test Specimen Sample size(s): 270 x 230 x 80 mm Australian EN1063 Germ DIN State Dept CFR SYA
Number of test specimens: 4 Samples British EN1522/23 MIL-SAMIT UL 752 Other
Weight of all samples: 111.2 lbs Test Standard: European EN1063 [No Splinters]
Are Materials a Health Hazard: No Particular Test: EN BR7 [NS] (7.62 x 51 NATO 150 gr FCJ SHC AP)
Need the Tests performed by: within 7 to 10 days Velocity Range: 2,657 to 2,723 ft/s
Need products shipped back: No Shots: 3 shots
Purchase Order Number: N/A Shot Pattern: 4.3 to 5.1 inch triangle

Test Results
Test Sample: Sample 1
Shot 1
Item / Part Number.: 1/1 9.8 inch
Sample ID: ROLLC-1 (250 mm)
Sample Type: Bullet Resistant Glazing
Sample Size: 9.8 x 9.8 inch (250 x 250 mm)
Thickness: 3.235 inch (82.2 mm)
Weight: 27.8 lbs (12.6 kg) Shot 3 Shot 2
Weapon Type: 7.62 NATO
Cartridge / Projectile Type: 7.62 x 51 NATO FCJ steel hard core AP
Projectile Weight: 150 grains
Target Distance: 32.8 feet
9.8 inch (250 mm)
Number of Shots: 3 shots
Shot Sequence: Shot 1 Shot 2 Shot 3
Impact Velocity (ft/sec) *: 2,702 2,718 2,695
Impact Energy (ft-lbs): 2,431 2,460 2,419
Impact Momentum (lb-sec.): 1.80 1.81 1.79
Impact Angle (degrees): 0º 0º 0º
Sample Penetration: NP NP NP
Witness Plate Penetration: NP NP NP
Impact Spacing (inches) **: 5.40 4.40 5.00
Impact Spacing / Pattern: 4.93 inch (average)
Witness plate material: 0.0008 in. thick Type 1100 Aluminum foil
Spall catch box: 17.32 x 17.32 in.
Witness / Box Distance: 19.7 inches NP = No Penetration
Spall Occurrence: No spall occurred PP = Partial Penetration
Test Temperature: 68 º F CP = Complete Penetration
Test Date: March 29, 2022 N/A = Not Applicable
Pass / Fail Results: Passed the Test
Comments: EN BR7 [NS] Test Sample 1 of 4
Footnotes
* Velocity measurements were taken at a distance of 8.2 feet from muzzle.
** Impact Spacing is the distance between shots (shot 1= 3 to 1, shot 2 = 1 to 2, shot 3 = 2 to 3)

Test and Report Engineers


Tested and Reported by: Sam Raheb Signature: Date: March 29, 2022

Form: BTR9P-12 © 2/06 Close Focus Research


Close Focus Research Page 2 of 2 Ballistic Test Report
Ballistic Testing Services Report Number: BTR-03-29-2022-Rollc-Sample 1
Phone: 800-513-4291 Email: techsupport@CloseFocusResearch.com CloseFocusResearch.com

Name: Rollc for Trading Company Report Date: March 29, 2022
Ballistic Test Results and Photographs

Ballistic Test Results:


Test Sample 1 passed the European EN1063 [No Splinters] EN BR7 [NS] (7.62 x 51 NATO 150 gr FCJ steel hard core AP) Ballistic test.
There was no complete penetration of the test sample from any of the 7.62 x 51 NATO FCJ steel hard core AP caliber projectiles. This test
sample is assigned the EN1063 [NS] No Splinters Rating.

Witness Plate and Spall Effects:


No spall occurred or damage to the 0.0008 in. thick Type 1100 Aluminum foil witness plate was observed.

Photographs
The following photographs show both the pre and post-test sample. Additional larger sized photographs are included with this report.

Test and Report Engineers


Tested and Reported by: Sam Raheb Signature: Date: March 29, 2022

Form: BTR9P-12 © 2/06 Close Focus Research


Close Focus Research Page 1 of 2 Ballistic Test Report
Ballistic Testing Services Report Number: BTR-03-15-2022-Rollc-Sample 1A
Phone: 800-513-4291 Email: techsupport@CloseFocusResearch.com CloseFocusResearch.com
Name: Rollc for Trading Company Report Date: March 15, 2022
Address: Riyadh, Saudi Arabia Contact: Azzam Asfour
Phone: Phone: +966-553331850 Email: talaforsafety@yahoo.com

Ballistic Results
Project Summary International Ballistic Standards / Specifications Testing
Type of Products to be tested: Steel Talk Thru Barrier ASTM Canadian FRA NIJ CFR Pass All
Test Specimen Sample size(s): 250 x 245 x 55 mm Australian EN1063 Germ DIN State Dept CFR SYA
Number of test specimens: 1 Sample British EN1522/23 MIL-SAMIT UL 752 Other
Weight of all samples: 22.8 lbs Test Standard: European EN1522 / EN1523
Are Materials a Health Hazard: No Particular Test: EN FB4 Part 1 (.357 Magnum 158 gr FSJ Coned Soft Core)
Need the Tests performed by: within 7 to 10 days Velocity Range: 1,378 to 1,444 ft/s
Need products shipped back: No Shots: 3 shots
Purchase Order Number: N/A Shot Pattern: 4.7 inch triangle

Test Results
Test Sample: Sample 1A
Shot 1
Item / Part Number: 1A / ROLLC-THB 9.8 inch
Sample ID: ROLLC-THB-BR4 (250 mm)
Description: Steel Talk Thru Barrier
Sample Size: 9.8 x 9.7 inch (250 x 245 mm)
Thickness: 2.2 inch (55 mm)
Weight: 22.8 lbs (10.3 kg)
Shot 3 Shot 2
Weapon Type: .357 Magnum
Cartridge / Projectile Type: .357 Magnum 158 gr FSJ Coned Soft Core
Projectile Weight: 158 grains
Target Distance: 16.4 feet
9.7 inch (245 mm)
Number of Shots: 3 shots
Shot Sequence: Shot 1 Shot 2 Shot 3 0.85 inch (21.6 mm)
Impact Velocity (ft/sec) *: 1,420 1,408 1,414
Impact Energy (ft-lbs): 707 695 701
Impact Momentum (lb-sec.): 1.00 0.99 0.99
Impact Angle (degrees): 0º 0º 0º Impact Side
Sample Penetration: NP NP NP
2.2 inch (55 mm)
Witness Plate Penetration: NP NP NP
Impact Spacing (inches) **: 2.40 2.40 1.90
Impact Spacing / Pattern: 2.23 inch (average)
Witness plate material: 0.0008 in. thick Type 1100 Aluminum foil
Spall catch box: 17.32 x 17.32 in.
Witness / Box Distance: 19.7 inches NP = No Penetration
Spall Occurrence: No spall occurred PP = Partial Penetration
Test Temperature: 70 º F CP = Complete Penetration
Test Date: March 15, 2022 N/A = Not Applicable
Pass / Fail Results: Passed the Test
Comments: European Standard EN 1522 / 1523 FB4 Part 1
Footnotes
* Velocity measurements were taken at a distance of 8.2 feet from muzzle.
** Impact Spacing is the distance between shots (shot 1= 3 to 1, shot 2 = 1 to 2, shot 3 = 2 to 3)

Test and Report Engineers


Tested and Reported by: Sam Raheb Signature: Date: March 15, 2022

Form: BTR20P-12 © 2/06 Close Focus Research


Close Focus Research Page 2 of 2 Ballistic Test Report
Ballistic Testing Services Report Number: BTR-03-15-2022-Rollc-Sample 1A
Phone: 800-513-4291 Email: techsupport@CloseFocusResearch.com CloseFocusResearch.com

Name: Rollc for Trading Company Report Date: March 15, 2022
Ballistic Test Results and Photographs

Ballistic Test Results:


Test Sample 1A passed the European EN1522 / EN1523 EN FB4 Part 1 (.357 Magnum 158 gr FSJ Coned Soft Core) Ballistic test. There was
no complete penetration of the test sample from any of the .357 Magnum 158 gr FSJ Coned Soft Core caliber projectiles.

Witness Plate and Spall Effects:


No spall occurred or damage to the 0.0008 in. thick Type 1100 Aluminum foil witness plate was observed.

Photographs
The following photographs show both the pre and post-test sample. Additional larger sized photographs are included with this report.

Shot 1

Shot 3 Shot 2

Test and Report Engineers


Tested and Reported by: Sam Raheb Signature: Date: March 15, 2022

Form: BTR20P-12 © 2/06 Close Focus Research


Close Focus Research Page 1 of 2 Ballistic Test Report
Ballistic Testing Services Report Number: BTR-03-15-2022-Rollc-Sample 1B
Phone: 800-513-4291 Email: techsupport@CloseFocusResearch.com CloseFocusResearch.com
Name: Rollc for Trading Company Report Date: March 15, 2022
Address: Riyadh, Saudi Arabia Contact: Azzam Asfour
Phone: Phone: +966-553331850 Email: talaforsafety@yahoo.com

Ballistic Results
Project Summary International Ballistic Standards / Specifications Testing
Type of Products to be tested: Steel Talk Thru Barrier ASTM Canadian FRA NIJ CFR Pass All
Test Specimen Sample size(s): 250 x 245 x 55 mm Australian EN1063 Germ DIN State Dept CFR SYA
Number of test specimens: 1 Sample British EN1522/23 MIL-SAMIT UL 752 Other
Weight of all samples: 22.8 lbs Test Standard: European EN1522 / EN1523
Are Materials a Health Hazard: No Particular Test: EN FB4 Part 2 (.44 Magnum 240 gr FCJ Flat Nose Soft Core)
Need the Tests performed by: within 7 to 10 days Velocity Range: 1,411 to 1,476 ft/s
Need products shipped back: No Shots: 3 shots
Purchase Order Number: N/A Shot Pattern: 4.7 inch triangle

Test Results
Test Sample: Sample 1B
Shot 1
Item / Part Number: 1B / ROLLC-THB 9.8 inch
Sample ID: ROLLC-THB-BR4 (250 mm)
Description: Steel Talk Thru Barrier
Sample Size: 9.8 x 9.7 inch (250 x 245 mm)
Thickness: 2.2 inch (55 mm)
Weight: 22.8 lbs (10.3 kg)
Shot 3 Shot 2
Weapon Type: .44 Magnum
Cartridge / Projectile Type: .44 Magnum FCJ Flat Nose Soft Core
Projectile Weight: 240 grains
Target Distance: 16.4 feet
9.7 inch (245 mm)
Number of Shots: 3 shots
Shot Sequence: Shot 1 Shot 2 Shot 3 0.85 inch (21.6 mm)
Impact Velocity (ft/sec) *: 1,446 1,437 1,441
Impact Energy (ft-lbs): 1,114 1,100 1,106
Impact Momentum (lb-sec.): 1.54 1.53 1.54
Impact Angle (degrees): 0º 0º 0º Impact Side
Sample Penetration: NP NP NP
2.2 inch (55 mm)
Witness Plate Penetration: NP NP NP
Impact Spacing (inches) **: 1.50 1.35 2.80
Impact Spacing / Pattern: 1.88 inch (average)
Witness plate material: 0.0008 in. thick Type 1100 Aluminum foil
Spall catch box: 17.32 x 17.32 in.
Witness / Box Distance: 19.7 inches NP = No Penetration
Spall Occurrence: No spall occurred PP = Partial Penetration
Test Temperature: 70 º F CP = Complete Penetration
Test Date: March 15, 2022 N/A = Not Applicable
Pass / Fail Results: Passed the Test
Comments: European Standard EN 1522 / 1523 FB4 Part 2
Footnotes
* Velocity measurements were taken at a distance of 8.2 feet from muzzle.
** Impact Spacing is the distance between shots (shot 1= 3 to 1, shot 2 = 1 to 2, shot 3 = 2 to 3)

Test and Report Engineers


Tested and Reported by: Sam Raheb Signature: Date: March 15, 2022

Form: BTR20P-12 © 2/06 Close Focus Research


Close Focus Research Page 2 of 2 Ballistic Test Report
Ballistic Testing Services Report Number: BTR-03-15-2022-Rollc-Sample 1B
Phone: 800-513-4291 Email: techsupport@CloseFocusResearch.com CloseFocusResearch.com

Name: Rollc for Trading Company Report Date: March 15, 2022
Ballistic Test Results and Photographs

Ballistic Test Results:


Test Sample 1B passed the European EN1522 / EN1523 EN FB4 Part 2 (.44 Magnum 240 gr FCJ Flat Nose Soft Core) Ballistic test. There
was no complete penetration of the test sample from any of the .44 Magnum FCJ Flat Nose Soft Core caliber projectiles.

Witness Plate and Spall Effects:


No spall occurred or damage to the 0.0008 in. thick Type 1100 Aluminum foil witness plate was observed.
ose Soft Core)
Photographs
The following photographs show both the pre and post-test sample. Additional larger sized photographs are included with this report.

Shot 1

Shot 3 Shot 2

Test and Report Engineers


Tested and Reported by: Sam Raheb Signature: Date: March 15, 2022

Form: BTR20P-12 © 2/06 Close Focus Research


www.cert-assure.com
CERTIFICATE OF REGISTRATION
This is to certify that the Occupational Health & Safety Management System of

Rollc for Trading Co.


PO Box 63975, Riyadh 11526
Kingdom of Saudi Arabia

has been assessed and registered by Certification Assurance International


as conforming to the requirements of

ISO 45001:2018
The Occupational Health & Safety Management System is applicable to:
Design, Manufacturing & Supply of Blast Proof, Bullet Proof, X-Ray, Detention, Acoustical and Fire
Rated Steel Doors & Windows. Blast Proof Valves, Normal Steel Doors & Fire Rated Steel Portions,
Louvers, Roof Hatch, Stainless Steel Works and Atex Components. Manufacturing of Automatic
Rolling Shutter Doors, Fire Rated Rolling Shutter Doors, Acoustic Rolling Doors, Fast Action Doors,
Road Blocker, Air Craft Hangar Doors, Security Systems, Membrane Structure, High Security
Bollard, Steel Canopy, Dock Leveler, Sectional Doors and Blow Out Panels.

Certificate No:
KSA-H-450256

Initial Approval: Certification Issuance: Certificate Expiry: Re-Certification:


27-03-2022 30-03-2022 29-03-2023 29-03-2025

Authorized Signatory
Certification Assurance International

Certification Assurance International is Accredited by ASIB


(Accred Services International Board (Europe) Limited)
Kemp House, 160 City Road, London, United Kingdom.

This certificate remains valid while the holder maintains the management system in accordance with the standard(s) above, which shall be periodically
audited by Certification Assurance International.
This certificate remains the property of Certification Assurance International and must be returned on request. In the issuance of this certificate,
Certification Assurance International assumes no liability to any party other than to the client, and then only in accordance with the agreed upon
certification agreement. Validity of this certificate may be confirmed at www.cert-assure.com or directly through QR code by using any device with
correct information or email to certification@cert-assure.com.
Managing Offices: 1330 Avenue of the Americas, 23rd Floor, New York, United States - Office No. 33, Commercial Building No. 114, Manama, Bahrain
21st Floor, Khobar Gate Tower, King Fahad Road, Al Khobar, Saudi Arabia
EXAMPLES

BULLET PROOF GATE PROTECTION LEVEL BR7


ACCORDING TO EN1063

BULLET PROOF DOOR LEVEL UL8

BULLET PROOF DOOR LEVEL UL3

You might also like