Professional Documents
Culture Documents
m
;PcT2Xch E^["8bbdT '(
m
0XaBdaRWPaVT4gcaPXU0__[XRPQ[T
=4F34;78CD4B30H<0A27" !!*?064B !C"
49<:9DD?
4?>1D5D?
@=31B5C
! F9F139DI
fffSPX[h_X^]TTaR^\
3ZUd`_W`cR^a]V4`gZUXVRc 1L]DPXGGLQDFRURQD
*RYWURSHVLQGRPHVWLFJOREDOSOD\HUVIRUYHQWLODWRUVPDVNV33( KRWVSRW"VXVSHFWV
0A270=09H>C8Q =4F34;78 achieve this goal. As a result,
eleven domestic producers of
2cVRT`cU`_VU`WW
W ith coronavirus cases
surging by each passing
PPE coveralls have qualified so
far and orders for 21 lakh have
RWeVcaV`a]VhY`
day, the Government has roped
in domestic and global manu-
been placed on them.
“Currently they are sup- e``\aRceZ_[R^RRe
facturers to manufacture ven-
tilators, masks and personal
plying 6-7,000 kits per day
and this is expected to go up to dY`hdj^ae`^d
protective equipment (PPE) 15,000 per day within the next
among other essential medical week. One more manufactur- B74:70AB8=67Q =4F34;78
items needed to combat the er has qualified on Monday,
viral infection. and an order of 5 lakh cover- n area near a mosque in
Bharat Electronics Ltd has
been asked to manufacture
alls has been placed with him,”
said Agarwal.
A Southeast Delhi’s
Nizamuddin was cordoned off
30,000 ventilators in the next Similarly, he said, to ensure on Monday after around 200
two months in collaboration that sufficient medical items are people developed coronavirus
with local manufacturers. available whenever required, symptoms in the last two days.
Automobile giants like Maruti, orders for 10 lakh PPE kits have Police said these people ?T^_[TfW^bW^fTSR^a^]PeXadbbh\_c^\bQTX]VcPZT]c^ePaX^dbW^b_XcP[bUa^\
too, will be making ventilators been placed through the have been shifted to various =XiP\dSSX]PaTPX]=Tf3T[WX^]<^]SPh ?C8
which are in high demand to Ministry of External Affairs hospitals by authorities.
provide supporting aid to with a Singapore-based plat- Meanwhile, teams of Union back to the area and now they police served notice to them for
Covid-19 patients. Similarly, form and supplies are to com- Health Ministry and World cited the lockdown being the violating prohibitory orders
Agva Healthcare, Noida, has mence soon. While another Health Organization’s Delhi reason for not going back,” said and restrictions imposed owing
been given an order to manu- supplier based in Korea, which office reached Nizamuddin a source. to lockdown.
facture 10,000 ventilators with- has tie- up with production and surveyed the area. Drones Devesh Srivastva, Joint “Police teams are making
in a month, and DRDO will companies in Vietnam and have been deployed in the area Commissioner of Police, announcements through pub-
begin manufacturing 20,000 Turkey has been identified to ensure strict implementation Southern Range, said, “Police is lic address systems, asking
N-99 masks per day within the with daily production capaci- 0bTRdaXchVdPaSfTPaX]V_a^cTRcXeTVTPaXbbTT]PcA<;7^b_XcP[PbP_aTRPdcX^]X]fPZT^UR^a^]PeXadb_P]ST\XRSdaX]VcWT of lockdown orders. assisting the Health people to stay indoors. People
next week. ty of over 1 lakh PPE kits. ]PcX^]fXST[^RZS^f]X]=Tf3T[WX^]<^]SPh ?C8 Authorities suspect that Department in taking out peo- have been informed regarding
Till now PPE, which are Also, he said, 10,000 PPE the residents of the area might ple for check-ups.” the orders and further told that
used by medical personnel coveralls donated by Red Cross placed with ordinance factories, for patients of COVID19 as Giving details on the avail- have been exposed to conron- He said such religious gath- if violated they will face legal
working in isolation areas and have been received and are said the official. they tend to develop acute res- ability of masks, the official said avirus as on March 10 several erings keep happening and action,” he said.
intensive care units to protect being distributed. As of now, Regarding availability of piratory disease syndrome. that DRDO will begin manu- visitors from Malaysia, Saudi foreigners come here and stay. Joint Secretary in the
them from acquiring infec- 3.34 lakh PPE are available in ventilators, Agarwal said, PSU Presently, less than 20 covid-19 facturing 20,000 N-99 masks Arabia, Kyrgyzstan and “Around 300 to 400 people Ministr y of Health Lav
tions, were not being manu- various hospitals across the BEL has been asked to manu- patients are on ventilator sup- per day within the next week. Indonesia had gathered at were part of the religious gath- Agarwal said police can initi-
factured in the countr y. country. About 60,000 PPE facture 30,000 ventilators in the port at this moment. Over Continued on Page 2 Nizamuddin Markaz mosque ering. We were approached by ate action as per the protocol
However, now focus is on kits have already been procured next two months in collabora- 14,000 ventilators have been located in thickly populated the Health Department after whereever larger number of
Made in India as well in the
wake of global shortage.
and supplied by the
Government while Indian Red
tion with local manufacturers.
Noida-based Agva
identified in various hospitals
across the country for treat-
µ&RQJUHVVNL area at an event organised by
Tableeghi Jamaat.
they suspected them of having
some symptoms related to
cases are reported.
“Be it in Nizamuddion or
Sharing details with the
reporters at a routine presser,
Cross Society has arranged
10,000 PPE from China which
Healthcare has been given an
order to manufacture 10,000
ment of Covid-19 patients
while orders have been placed 5DVRL¶LQ'HOKL “Several of them were told
to go back to their native places
coronviarus,” said the Joint CP.
“In the last two days,
any part of the country, our
teams go and take action as
Lav Agarwal, Joint Secretary in have also been received and are ventilators within a month. on international companies New Delhi: Delhi Congress and were subsequently around 200 people are taken part of the containment strat-
the Union Health Ministry, being distributed. Another 3 Similarly, automobile manu- like Hamilton, Mindray and has launched “Congress ki dropped at Indira Gandhi out by the Health Department egy,” he said, adding the
said that the Textile Ministry lakh donated PPE coveralls facturers too have been asked Draeger besides a few domes- Rasoi” in Delhi to provide International (IGI) airport. for quarantine and necessary Government is focusing on
along with the Health Ministry are to arrive by April 4. An to manufacture ventilators. tic firms and a PSU to supply cooked food to thousands of Most of them managed to checks up,” he said. hotpsots.
are working in tandem to order for 3 lakh PPE has been Ventilators are required ventilators, said Agarwal. needy during the lockdown dodge police and returned A senior police official said Continued on Page 2
20?BD;4
C>:H>>;H<?82BC>
>?4=>=9D;H!"!! 9LMD\DQUDLVHVERR]HUV¶VSLULWV J`XZgZdZed?`ZURd]R^dRU^Z_
C^Zh^) CWTC^Zh^>[h\_XRbfX[[
QTVX]^]9d[h!"]TgchTPa
^aVP]XbTabbPXS^]<^]SPhPUcTa
:>2TcZeZTZdVd liquor have downed their shut-
ters since last Wednesday fol-
W`c]`T\U`h_]RadVd`fded5>
cWTR^a^]PeXadbU^aRTScWT
WXbc^aXRSTRXbX^]c^_^bc_^]TcWT
4>¶ddfXXVdeZ`_ lowing the nation-wide lock-
down announced by Prime ?=BQ ;D2:=>F=>830
6P\Tbd]cX[!! :D<0A274;;0??0=Q :>278 Minister against the backdrop
of coronavirus. he District Magistrate of
<0A:4CB4GC4=3;>BB4B
0B2>E83 (20B4BB?8:4 C hief Minister Pinarayi
Vijayan has kicked off a
There were reports that
the State was mulling plans to
T Gautam Buddh Nagar,
Brijesh Narain Sgiingh, was on
<d\QPX) CWT1B4BT]bTg controversy by directing the make liquor available through Monday transferred for failing
RaPbWTS^eTa "&$_^X]cb^] State Excise Department to on line platforms. S to implement the lockdown
<^]SPh_aTbbdaTSQhWTPeh provide liquor to those carry- Ananthakrishnan, Excise clamped to stem the growth of
bT[[X]VX]QP]ZX]VUX]P]RTP]S ing medical prescriptions in Commissioner, in a note to the coronavirus.
Pdc^R^d]cTabPbbT]cX\T]c view of suicide cases reported Government has suggested that The Uttar Pradesh
aT\PX]TSVaX\P\XSPbcTPSh from various parts of Kerala persons with strong withdrawal Government’s order came after 3PX[hfPVTabP]SW^\T[Tbbcahc^b]PcRWU^^S_PRZTcbUa^\Pe^[d]cTTaSdaX]VcWT
aXbTX]R^a^]PeXadbRPbTb after liquor sales were stopped symptoms can produce a doc- Chief Minister Yogi Adityanath ]PcX^]fXST[^RZS^f]P\XSR^a^]PeXadb^dcQaTPZX]=^XSP^]<^]SPh ?C8
during the ongoing “lockdown”. tor’s prescription at the Excise visited Noida, the hotspot of
?0:CA>>?B4=60648= Taking strong exception, Office. “The prescription to the deadly infection in the Suhas LY has been posted as that he wrote a leave applica-
58A8=6B74;;8=60C;^2 the Indian Medical Association allot liquor should be from a State. With seven more cases on the new District Magistrate of tion and leaked it to the media,
9P\\d) ?PZXbcP]Xca^^_b said scientific treatment should tion to provide a prescription the wake of reports of suicides Government doctor. After Monday, the Covid-19 positive Gautam Buddh Nagar, the which amounts to indiscipline.
T]VPVTSX]UXaX]VP]S\^acPa be given to those who have for alcohol. Writing a liquor by alcoholics. Till Monday, the obtaining clearance from the cases reached 38 in the district. Chief Secretary said, adding Earlier, the DM had written
bWT[[X]VP[^]VcWT;X]T^U alcohol withdrawal symptoms. prescription can result in the State has reported seven sui- Excise Office, it can be pro- Announcing Singh’s trans- that “he has left for Noida to a letter to the chief secretary of
2^]ca^[;^2X]?^^]RWSXbcaXRc “It can be treated at home cancellation of the right to cides by persons suffering from duced at the Beverages fer, Uttar Pradesh Chief take over charge”. the Uttar Pradesh Government
^U9P\\d:PbW\Xa^] or in hospitals with medicines. treatment,” the IMA said in a alcohol withdrawal symptoms. Corporation Outlet to get Secretary RK Tiwari said a Singh has been removed saying he does not want to con-
<^]SPhX]eX^[PcX^]^UcWT It is not scientifically acceptable statement on Monday. Kerala State Beverages liquor,” said a senior official of departmental enquiry has also for his failure in carrying out tinue on the post due to “per-
RTPbTUXaT^UUXRXP[bbPXS to offer alcohol to them. Vijayan’s directive to the Corporation, the State-owned the Excise Department. been initiated against him. work to control the spread of sonal reasons”.
Doctors have no legal obliga- Excise Department comes in wholesale and retail traders of Continued on Page 2 Special Secretary, Planning, coronavirus, he said, adding Continued on Page 2
=4F34;78kCD4B30H k<0A27" !! ]PcX^]!
>fd]Z^U`_ReVdC&=dRgVU 2T]caTTgcT]Sb!8]cTaTbcBdQeT]cX^]c^QP]Zb
"?a^\_cAT_Ph\T]c8]RT]cXeTc^P[[UPa\Tab
=XiP\dSSX]P
R^a^]PW^cb_^c.
gious preacher and a foreign-
er who were at the event had
been tested positive of coron-
!bdb_TRcb
W`c9R[[e`CDD]Z_\VUS`Uj
avirus and had died recently.
“The preacher died in
?=BQ =4F34;78 loans upto the extended peri- per cent per annum. The Srinagar last week and he too
od at 4 per cent per annum objective of the scheme is to had a travel history visiting to
?=BQ =4F34;78 the tough time the country is said. n view of several restric- interest without attracting any make available at ground level, From Page 1 Deoband seminary in Uttar
0LJUDQWV¶ZRHVRQ
coronavirus pandemic. tion Sewa Bharati for the poor cer, is presently serving as an to May 31, 2020 for all crop ing difficulties in repayment of worsened due to untimely
Khalida Begum, 87, who and the needy in Jammu and adviser to the Jammu and loans up to C3 lakh. their short term crop loans rains and hailstorms in some
saved C5 lakh for Hajj, was Kashmir. She had saved this Kashmir Lieutenant Governor. The decision will allow falling due during this period,” parts of the country, impairing
forced to defer her plans for the amount for performing Hajj, Meanwhile, since the lock- farmers to repay such loans up officials added. their repayment capacity. “
6SUD\JLYHVWKHP
pilgrimage due to the lock- plans for which she deferred down was announced, Sewa to the extended period at 4 per The Centre is currently The complete lockdown has
down. due to the present situation, Bharati volunteers across the cent annual interest without providing concessional crop disrupted agriculture opera-
Hajj is the annual Islamic Anand said. country have been providing attracting any penalty. loans to farmers through tions due to unavailability of
VPDUWLQJH\HV
pilgrimage to Mecca in Saudi "Khalida Begum ji was food and other essential items Officials of Agriculture banks. Under the scheme, an labourers and other resources,
Arabia, the holiest city of among the first few women in to the needy. The Sangh-affil- Ministry said that the extension additional 2 per cent interest leaving standing crops unat-
Muslims. Jammu and Kashmir who got iate''s volunteers were seen on of IS and PRI benefit upto May subvention is provided to tended, halting harvesting, and
"Khalida Begum ji was educated in a convent. She is Saturday managing crowd and 31, 2020 on the short term crop farmers repaying loans impeding farmers' access to
impressed with the welfare the daughter-in-law of Colonel providing food to them at the loans upto Rs.3 lakh which are promptly. For such farmers, the transportation, warehousing,
work done by the Sewa Bharati Peer Mohd Khan, who was Anand Vihar bus terminal in due upto May, 31 2020, will effective rate of short-term marketing and export”, the From Page 1 Slamming the Uttar
in Jammu and Kashmir during president of the Jana Sangh," he Delhi. help the farmers to repay such crop loans works out to be 4 letter read. The National Commission Pradesh Government for such
for Protection of Child Rights insensitivity, former State Chief
has asked the Bareilly District Minister Akhilesh Yadav said,
APYh^VX]X3PSX
3aTP\bfPXcPbfTSSX]VbVTcRP]RT[[TS^a_^bc_^]TS
Magistrate to submit a report “The spraying of chemicals on
in the matter within three days. migrants to sanitise them has
7aXSPh<^WX]X “NCPCR has expressed serious
view on this inhuman act. In
raised some questions. Has the
World Health Organisation
]Tf2WXTU^U ?C8Q =4F=4F34;78 truncated function inevitable and pushed her that can run into several lakhs founder of Cosmic Light
view of the above incident, you
are requested to get the matter
given any direction in this
regard? How do you treat the
²1aPW\P:d\PaXb o band, no baaja and cer-
with close family mem-
bers only," Khurana, a PR
wedding from April to
November-December.
and even crores of rupees.
"The business has taken a
Entertainment, a popular
wedding planning company.
inquired into urgently and
issue necessary directions for
burning sensation caused by
the chemicals? What arrange-
?=BQ <C01D
N tainly no baraat. Dreams
of a big fat Indian wedding
professional, told PTI.
But that would be minus
"All of us felt it's better to
be safe than sorry, and so
serious hit due to the spread
of the coronavirus.
"In fact, the few func-
tions we organised in March
immediate action thereby;
ensuring adequate arrange-
ments are there for people to
change out of wet clothes?
have faded into the far dis- extended family, no cousins decided to postpone the wed- I have lost count of the saw such low turnout that we ments of basic essentials to the What alternatives are being
n a decision taken by man- tance for many a couple who and possibly not even grand- ding date. We have to call up calls we have received for had to advise people to not go family members viz. provision provided for the food that gets
I agement commitee of the
Brahma Kumaris, Rajyogini
have had to cancel, postpone
or downsize their celebra-
parents, and what is a wedding
without them.
all our guests and inform
them about the postpone-
postponing and cancelling
bookings. For April, we had
ahead with their weddings,”
she said.
of food, shelter and safety and
wellbeing of these children of
wet due to the spraying?
On Sunday, a police sub-
Dadi Hriday Mohini has been tions to the barest minimum. "You know I also joined a ment date, which is both 20-25 bookings, almost one a Salons and parlours, migrant workers during lock- inspector decided to “shame” a
declared Chief of the organi- Like for 26-year-old Delhi gym to get in shape for the embarrassing and exhaustive. day, and there is a big ques- which in normal times, would down period,” according to migrant labourer by scribbling
sation from Monday. boy Harshad Khurana who special day, but it was all for "We have made advance tion mark on whether those have seen brides and brides- the letter issued by the NCPCR. on his forehead - “I have vio-
Hriday Mohini succeeds its was all set for the wedding he nothing," he said dejectedly. payments to so many pre- will happen or not’, said maids making a beeline for The body also demanded lated lockdown, stay away from
former Chief, Rajyogini Dadi had always dreamed of on Khurana is not alone. wedding planners and are Anmol Bummi, manager at their bridal packages — even appropriate disciplinary and me”. Following public outrage,
Janki who expired last Friday at April 8 and now doesn't know The entire D-Day drill – not sure if the money will get the Golden Gates banquet in at exorbitant price – are also penal action against the offi- the authorities have decided to
the age of 104 years. what to do. The venue was with months spent on zero- refunded,” said the 26-year- west Delhi in Mayapuri. bearing the brunt. cials who carried out the sani- initiate action against the sub-
Dadi Hriday Mohini (94), fixed, theme decided, the ing-in on the menu, haggling old IT professional. Several wedding planners Until a few weeks ago, tising exercise. inspector.
also known as Dadi Gulzar, cards distributed and his suit over the price of the venue, COVID-19 alarm bells and catering units, like Neeti Chopra, owner of the
J`XZgZdZed?`ZURd]R^d
who was Addl.Global Chief till stitched too. The threat of preparing guest lists, white- have drowned out the sound Cosmic Lights Entertainment Unwind salon in Saket, was
date, also served Delhi Zonal COVID-19 started as a little washing the whole house, of wedding bells and also the and Kitchen Kraft Luxury busy booking appointments
Head of the organisation. blip before blowing up into a picking the right jewellery clink of the cash registers for Catering, said the business for April.
RU^Z_W`c]`T\U`h_
huge cloud of dread and a and clothes has come to businesses dependent on the will take a long time to recov- “From the very beginning
nationwide lockdown from naught. wedding industry -- wedding er. of the COVID-19 outbreak,
3TPS\P]b March 24, ending his hopes Vipul Verma, 38, was set planners, banquet owners, “March-April have always our salons were following all
]RadVd`fded5>
for a grand once-in-a-life- to get married on April 12. bands, florists, photogra- been good for the wedding kinds of precautions, includ-
bP\_[TcTbcb
time celebration. The compulsion of a limited phers and salons. India's wed- business and there were a lot ing using gloves and hand
After a day's ‘Janta curfew' gathering and that too with- ding market, pegged at $50 of bookings this year too. But sanitisers. We thought things
on March 22, Prime Minister out his brother who can't billion by a recent KPMG everything changed after would become normal soon.
R^a^]PeT*<? Narendra Modi on March 24
announced a three-week lock-
leave Australia due to travel
restrictions has led to Verma
report, has been badly dis-
rupted due to the spread of
coronavirus burst into the
picture.
But then one day the adviso-
ry was issued that all parlours
From Page 1
“Hence, relieve me from
Adityanath reprimanded the
officers for not taking tough
c^[[aTPRWTb" down."Who had expected
this? There is very little that
cancelling his wedding – at
least for now.
the novel coronavirus, said
industry insiders. In the
Be it a destination wed-
ding or routine functions here
had to shut,” she said.
The number of novel
the post of district magistrate
and grant me three months
action against a private com-
pany which, the health depart-
we can say or do now... Hope Particular about 'auspi- Indian way of things, families, in the capital, all have been coronavirus cases in India earned leave and since in the ment suspects, has directly or
?C8Q 8=3>A4 everything becomes normal cious dates', Priya Malik has poor and rich, save up for a either cancelled or post- rose to 1,071 on Monday. present situation due to indirectly infected nearly two
soon. Our last resort will be a eventually accepted the lifetime to spend on weddings poned," said Raina Kapoor, This includes 29 deaths. COVID-19 outbreak it is essen- dozen people so far.
Sdaysamples of a 38-year-old man tial that no administrative lax- “Ye bakwas band karo
03JRYWPDNLQJDOOHIIRUWVWR 9LMD\DQUDLVHV
who Died in Ujjain three ity takes place, please appoint apna… bakwas kar-kar ke aap
ago came out positive for some other officer as the dis- logon ne poora mahaul kharab
coronavirus on Monday, an trict magistrate of Gautam ho gaya hai yahan pe..
official said. Buddh Nagar,” Singh wrote in Zimmedariyon ka nirvahan
ILJKWFRURQDYLUXV&KRXKDQ
With this, the death toll the letter, a copy of which was karne ke bajaay ek doosre pe
due to coronavirus has gone up circulated in media. wo (dosh) daalna.. (Stop talk-
to three in Madhya Pradesh. From Page 1 ence of alcohol is a time con- Earlier in the day, ing nonsense. You all have
Earlier, a 65-year-old man While Government doc- suming one. The best thing is Adityanath pulled up officials spoilt the situation here with all
from Indore and a woman ?C8Q 17>?0; day complete lockdown is tancing strictly by staying tors in Kerala are tight lipped to make him reduce the alco- in Gautam Buddh Nagar for this nonsense. Instead of ful-
from Ujjain died of coron- being enforced," Chouhan said. inside their homes. over the issue because of the hol intake in stages and not at not being able to contain the filling your responsibilities you
avirus here. adhya Pradesh Chief He urged people to follow "I also urge people to fol- gag order from the State one stroke. A person addict- spread of coronavirus in the are passing the buck). We had
"We got a report from a lab
of Indore-based Government
M Minister Shivraj Singh
Chouhan on Monday said his
the lockdown for their own
safety.
low the 'Lakshman Rekha', as
advised by Prime Minister
Government not to discuss
anything regarding corona
ed to alcohol is likely to end up
as a medical wreck up if he is
district, which has recorded 38
COVID-19 cases so far, high-
issued orders two months ago,
the order was for the entire
Mahatma Gandhi Memorial government is taking all steps He was speaking to PTI Narendra Modi, to win the virus or related issues with the denied the stuff at one go,” said est in the state. State,” Adityanath told the offi-
Medical College on Monday to deal with coronavirus in the after interacting with a Bhopal- fight against coronavirus," he media, the IMA issued a release Dr Krishnaswamy who heads While reviewing the dis- cers sternly, directing them to
morning that the 38-year-old state, specially in Indore where based girls' hostel inmates who said. questioning the move to intro- the department of diabetology trict’s preparedness to deal work more efficiently and con-
man had coronavirus infec- 27 COVID-19 cases have been were stranded here after the Chouhan also said he vis- duce the prescription for alco- and research, Dr Prema with the virus outbreak, tain the spread of the virus.
tion," Ujjain's Chief Medical reported so far. lockdown. He went there to ited the state's control and hol arrangement. Medical And Diabetes
and Health Officer Dr In an interview to PTI, know their well-being and command centre where But Dr CV Krishnaswamy, Research Centre, Chennai,
³=^R^\\d]Xchb_aTPS
Anusuiya Gawli told PTI. Chouhan assured that the sit- assured them that he will take arrangements have been made former professor of clinical But a senior Government
The man died on March 27 uation in Indore, the industri- care of all their needs. for providing telemedicine medicine, Stanley Medical physician in Kerala, on condi-
night. He was admitted to al hub which has been ranking "The awareness level of facility to people. College at Chennai told The tion of anonymity chose to dis-
Madhav Nagar Hospital of no. 1 in cleanliness since three people of Indore is very high Doctors are deployed there Pioneer that there is nothing agree with Dr Krishnaswami.
Ujjain in a critical condition consecutive terms, would be and they have proved it by get- and they are answering people's wrong in medical doctors issu- “We have not studied in
and died after an hour of brought under control ting the cleanliness award in calls, prescribing medicines ing prescriptions for alcohol to our medical course that a dis- From Page 1 passed Maharashtra as the
undergoing treatment. soon. the country for three times in and making arrangements for patients suffering from with- ease could be cured with alco- As a part of the State with the highest number
"According to doctors, the man So far, 47 coronavirus cases a row...I assure them that they providing it also, he said. drawal symptoms. hol. There is no mention in our Government’s preparedness to of COVID-19 positive cases in
had high blood pressure and have been reported from the will not face much difficulty "After that also if people Dr Krishnaswamy is the treatment protocol that alco- fight the spread of the novel the country. Kerala reported
complained of chest pain and state. Of these, the maximum but the three-day lockdown is have symptoms, then we have Editor (Indian sub-continent) hols or drugs could be pre- coronavirus (COVID-19), the 234 cases while with 32 new
discomfort during admission to 27 cases have been reported necessary and therefore it is a made arrangements for their , Journal of the Science of scribed to patients,” said the Ministry of Skill Development addition whereas Maharashtra
the hospital. At first glance, he from Indore. Besides, eight total lockdown for three days, treatment in Bhopal, Indore, Healing Outcomes, an inter- doctor. and Entrepreneurship (MSDE) has 220 cases.
looked like a heart patient," cases have been reported in he said. Gwalior and Jabalpur and also national medical journal pub- Corona virus has added yet will make available all its Meanwhile, to help coun-
Gawli said. Jabalpur, five in Ujjain, three in "I have full faith that we in Rewa, Shahdol lishing peer reviewed research another controversy to Kerala National Skill Training tries manage the surge in
The deceased was a resi- Bhopal and two each in will fully control the situation and Sagar, the chief minister paper. society where social drinking is Institutes (NSTIs) and hostels COVID19 cases while main-
dent of Amber Colony in Shivpuri and Gwalior. in Indore soon. I appeal to peo- said. “I understand there are catching up like a wild fire. across the country for con- taining essential services, the
Ujjain, the state public relations The state has also report- ple to follow the lockdown for Chouhan said his suicides reported from Kerala There were reports of school version into quarantine/ iso- World Health Organisation
department said in a release. ed four deaths- two each from themselves, their children, Government has also made because of the unavailability of students frequenting bars for lation facilities. (WHO) has published a
His blood and swab sam- Indore and Ujjain. friends, for Indore and for the arrangements for providing alcohol. The question is gulping a few drinks during The ICMR has maintained detailed, practical manual on
ples were sent for testing as he "We are ensuring that peo- entire state. The state govern- food to poor people and whether we should leave the interval hours. One of the pop- that there is no need of ran- how to set up and manage
had virus-like symptoms. ple follow isolation, social dis- ment and the local adminis- labourers, and farmers are also patients to their fate and allow ular folk songs in Kerala is dom sampling as those done treatment centres for the virus
He visited the state's tancing and remain in their tration is totally with them," being told not to worry about them to take their lives. There “Kallolam Nalloru Vasthu earlier were found to be neg- that has taken toll on 38,000
Neemuch district, located close houses only, and for that a 21 Chouhan said. their crops. is nothing wrong in a medical Bhoolokathinkal illa penne”, ative. people.
to border adjoining Rajasthan, -day lockdown was announced. Chouhan said his govern- "I will take care of it soon, doctor issuing prescription for Malayalam for “there is noth- “We started with random Even though we’re in
five days before he fell ill. He We will soon control the situ- ment is ensuring that people he said. spirits. The process of making ing in this world better than samples but no sample tested midst of crisis, essential health
came in contact with some ation in Indore, where a three- follow isolation and social dis- a person free from the influ- liquor” positive. So the next day we services must continue. Babies
people of Rajasthan at a party changed testing guidelines as are still being born, vaccines
0\XS[^RZS^f]R^_fP[Zb!W^dabc^Y^X]SdchX]<?
there. After his return to Ujjain, a precaution. Also, survel- must still be delivered and
he was down with fever, cold lience is not required as of people still need life-saving
and cough, the release said. now,” said a scientist from the treatment for a range of other
A survey was underway in ICMR at the Press briefing. diseases, said TA Ghebreyesus,
Amber locality to check the Kerala on Monday sur- Director-General of the WHO.
spread of the viral infection, it ?C8Q 17>?0; on foot. CWTAPYVPaW_^[XRT[PdSTS foot from Etawah on March 25 duty soon," said the constable,
added.
Earlier in the morning, the nfazed by the nationwide
Talking to PTI on Monday,
Sharma said he was on leave
R^]bcPQ[T3XVeXYPhBWPa\Pb morning. I walked for nearly 20
hours during my journey in
who joined the Madhya
Pradesh Police force on June 1, %LGVRQIRU distributed during last two days
authorities confirmed eight
new coronavirus cases in the
U lockdown, a 22-year-police
constable walked for nearly 20
from March 16 to 23 to appear
for his BA (Bachelor of Arts)
R^\\Xc\T]cc^fPaSbf^aZ
P]SPSeXbTSWX\aTbcU^aP
which I took lifts from people
on motorbikes and reached
2018.
Rajgarh Superintendent of DPSOH&RYLG
and 1.40 lakhs being distributed
on Monday.
state, taking the total number hours during the 450-km jour- exams at Etawah in Uttar UTfSPhbPbWXb[TVbV^cb^aT Rajgarh on Saturday night. I Police (SP) Pradeep Sharma "Ten lakh masks would be
to 47. So far, Indore has report- ney from his hometown in Pradesh. But, the exams got \dbR[TbPUcTacaPeT[[X]V[^]V subsequently informed my boss said he gave the constable a let- From Page 1 part of the PPE kits being sourced
ed the maximum 27 cases, fol- Uttar Pradesh to Rajgarh in postponed due to the shut W^dab^]U^^c about my arrival," he said. ter lauding his commitment "Two domestic manufac- from Singapore," Agarwal added.
lowed by Jabalpur- eight, Madhya Pradesh to join duty. down. Sharma said during the and dedication towards work turers are producing 50,000 N95 The official also shared that
Ujjain-five, Bhopal-three, and The Rajgarh police lauded "I contacted my boss - ity available," he said. journey he did not get anything during such challenging times. masks per day and are ramping all drug companies have assured
Shivpuri and Gwalior- two constable Digvijay Sharma's Pachor police station inspector Sharma's family also to eat for a day, but later some "I am going to write to the up capacities to go up to 1 lakh that there will not be any short-
each. commitment towards work - and told him that I want to advised him to stay at home, social organisations provided state Director General of Police, per day within next week. age of drugs during this crisis
As of now, 44 active cases and advised him rest for a few join duty during these testing but he could not hold himself him food. requesting him to give the Presently hospitals in India have while medical personnel are
are being treated in different days as his legs got sore mus- times. He advised me against it back. "My boss asked me to rest constable a letter of apprecia- 11.95 lakh N95 masks in stock being trained for any emergen-
districts. cles after travelling long hours as there was no transport facil- "I started my journey on as I have sore legs. I will join tion," the SP added. while additional five lakhs were cies.
$OWKRXJKHYHU\SRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHO\IRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULW\RIRUELQGLQJLQDQ\ZD\RQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQ\UHVSRQVLELOLW\IRUDQ\
GDPDJHRUORVVWRDQ\SHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQ\DFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO\5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULI\DQGVHHNDSSURSULDWHDGYLFHWRVDWLVI\WKHPVHOYHVDERXWWKHYHUDFLW\RIDQ\NLQGRIDGYHUWLVHPHQWEHIRUH
UHVSRQGLQJWRDQ\FRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQ\HPSOR\HHRIWKH3LRQHHU*URXS·VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQ\NLQGRIFODLPPDGHE\WKHDGYHUWLVHUVRIWKHSURGXFWV VHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQ\NLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV
=?;A83AR_eY`daZeR]d¶U`Tde`XVe&deRcRTT`^^`UReZ`_
BC055A4?>AC4AQ =4F34;78 been made to quarantine these accommodation at Hotel Lalit our duty to ensure a suitable The administration is
doctors. The Delhi and the payment of the same and safe arrangement for them. ensuring free food to nearly 4
he doctors treating coron- Government will bear all the shall be borne by the Delhi This is a quarantine facility so lakh people daily and is pro-
T avirus patients at LNJP and
GBP hospitals will be accom-
cost of accommodations.
Delhi Health Minister
Government."
The district magistrate of
that the family members do not
come in contact with the doc-
viding free ration to 71 lakh
people in the wake of the
modated at a private hotel here Satyendar Jain said every doc- New Delhi would make neces- tors. Each of them will get one Covid-19 crisis.
on Delhi Government's tor would be given a separate sary arrangements to make separate room and the doctors More than 800 centres for
expense, said an order from the room. This is a precautionary 100 rooms available at the will work in shifts," said Jain. food and over 1,000 shops for
Delhi Health Department. measure to keep these doctors hotel on Barakhamba Road. The Delhi has come with a ration have been made opera-
Delhi Chief Minister away from their families so that The LNJP Hospital, GBP 14-day shift, 14-day quarantine tional. 234-night shelters across
Arvind Kejriwal said the doc- there is no chance of spreading Hospital and other few hospi- plan for health workers and Delhi are open to accommo-
tors are on the frontlines of of the virus if anyone is tals are among the facilities medical professionals who are date needy people and those hit
the battle against coronavirus. infected. where doctors are deployed on coronavirus duty in hospi- by the lockdown.
All doctors, serving in Delhi The order issued by the round-the-clock for attending tals. The plan will keep the “The administration is also
Government's Lok Nayak Health Department noted, "It positive or suspected cases of spread of coronavirus in check. working toward converting
Hospital and GB Pant has been decided that doctors COVID-19. Meanwhile, the Delhi schools into shelters to
Hospital on COVID-19 duty, working on COVID-19 duty at "The doctors are working Government has taken sever- accommodate migrant workers
will now be housed in Hotel LNJP Hospital and GB Pant 24*7 to treat the COVID-19 al measures to fight the and daily wage labourers,” a
Lalit. This arrangement has Hospital would be provided positive patient, therefore, it is coronavirus. Government official said.
SHRSOHGHWDLQHG
State borders. set up near IMT Manesar on the tested positive, a 29-year-old Monday.
According to the directions Delhi-Jaipur national highway. woman who had returned from According to Deputy Chief
by the CM, the migrants should Food will be provided to the Malaysia and Indonesia on Minister Manish Sisodia, it is
be stopped at their respective occupants. February 22, as well as a couple BC055A4?>AC4AQ =4F34;78 required to engage students as
places and no one should be Other three are at the com- from Nirvana Country, where schools are shut.
allowed to move from the cur- munity centre on Gurugram- the man had recently returned he Delhi Police registered 145 cases and 3,750 people were Taking care of education of
rent locations.
The CM ordered the offi-
Sohna road near Bhondsi village
(150 people), at Bhim Nagar (40
from London.
The other two are a 22-year-
T detained for violating government orders during the coro-
navirus lockdown. According to the data shared by the police,
students in continuation of
lockdown span with recent
cers concerned to set up shelter people), and at Kadipur village old studying in London who 145 cases were registered under section 188 (for disobedience riot incidents in Delhi vicini-
or relief camps and ensure that (50 people). had returned home on March to order duly promulgated by public servant) of the Indian Penal ty, Sisodia said that the
proper food, boarding and lodg- “Since a lot of people work 14, as well as her 16-year-old Code till 5pm. Government has prepared its
ing arrangements were made for in IMT Manesar, the capacity of brother. A total of 3,750 people have been detained under section 65 action plans to engage students
the migrant labourers staying in this shelter home is bigger than Also, In the last 5 days, (persons bound to comply with reasonable directions of police in learning activities via mod-
such camps and if anyone still the others. I appeal to people however, no new cases have officers) and 557 vehicles have been impounded under section ern day —virtual classes with
opposes, strict action should be from other states who reside in emerged, according to officials 66 of the Delhi Police Act, they stated. A total of 2143 move- the help World Wide Web.
taken against them. Gurugram to come to the shel- from the health department. ment passes have been issued. Addressing Delhi through
APX[fPhbd]X]cTaad_cTSUaTXVWcbTaeXRTbU^aTbbT]cXP[R^\\^SXcXTb
tackle coronavirus. Notably, available right at the gate. The
Union Government and Delhi health of all children and youth
Government issued several living here will be given prior-
guidelines and precautions ity. The measures have been
which must be taken to pre- taken in the light of their
BC055A4?>AC4AQ =4F34;78 which 442 rakes and 24412 wagons officials are in constant touch with vent the transmission of coro- health,” said Gautam
were loaded with essential com- State Governments to sort out oper- navirus There are currently 29
hile the country is completely modities (One wagon contains 58-60 ational issues to ensure smooth han- Gautam ordered an imme- youth in the Observation
W locked down due to the pan-
demic of coronavirus, Indian Railways
ton consignment). “This includes 54
rakes and 2,405 wagons of food
dling at terminal.
In its continuous effort to fight
diate ban on the visiting of fam-
ily members in the juvenile
Homes at Delhi Gate with a
capacity of 75 people, out of
continues to work round the clock to grains, three rakes and 126 wagons of against COVID – 19, the northern homes. The residents will be which 6 were released on bail.
ensure availability of essential com- sugar, one rake and 42 wagons of salt, railway workshops have been geared able to contact their families Similarly, the Observation
modities through its uninterrupted one rake and 50 wagons of edible oil, up to manufacture 700 liters sanitiz- twice a week by phone, which Home, with a capacity of 100
freight services. 356 rakes and 20,519 wagons of coal, er per day, 700 face masks per day. At earlier used to happen only youth, has 103 residents, of
The Indian Railway loaded 684 27 rakes and 1270 wagons of petro- least1600 face masks have already once. whom 24 are released on bail
rakes and 35,319 wagons on Sunday leum products,” the Railways said in been manufactured in northern rail- Special instructions were and 2 will be released by
out of which 437 rakes and 24,202 a statement. way. given to the authorities that evening.
wagons were full of essential com- It may be noted that Ministry of In order to ensure availability of there should be minimum vis- There are 65 youths in the
modities. Home Affairs has allowed movement essential items to different parts of itors in the home and proper 50-capacity Place for Safety
A senior railway official said that of goods across the country to ensure India and to mitigate the effect of lock- hygiene and cleanliness should Majnu Ka Tila, of which 9 were
40 rakes and 1727 wagons were wagons of salt, one rake and 42 wag- wagons of petroleum products. that supply chain keeps fully opera- down during COVID -19, Northern be the topmost priority. granted bail. SPYM located at
loaded with food grains, five rakes and ons of edible oil, 363 rakes and 20,904 Similarly, on Saturday, 695 rakes tional. railway has decided to run six parcel “The only way to avoid Sewa Kutir where there are 40
210 wagons of sugar, one rake and 42 wagons of coal, 27 rakes and 1277 and 35,942 wagons were loaded out of Ministry of Railways and MHA special trains across India. corona is to preventing its youths with 10 released on bail.
00?<;0bSXbcaXQdcTU^^Sc^SPX[hfPVTab\XVaP]cb
BC055A4?>AC4AQ their area. The lockdown has severe- tion centres can be opened. The AAP MLA Mr Raghav Chadha said,
=4F34;78 ly affected the lives of many poor Delhi government has made neces- "At this tough time, Delhi Chief
people, daily-wagers and labourers. sary arrangements as per the require- Minister Arvind Kejriwal has made
he Aam Aadmi Party (AAP) Therefore, the Delhi government has ments raised by the MLA,” it said. sure that no one goes to sleep hun-
T MLAs have started distributing
food to the daily wage workers and
not only started free food distribu-
tion through night shelters but has
Another Aam Aadmi Party
(AAP) MLA Praveen Kumar from
gry. Today, at Rajendar Nagar
Legislative Assembly, I have dis-
migrants in their constituency. The also set up food distribution centres,” Jungpura said that his team is feed- tributed free food at eight places. We
party MLAs has also created a the party said in a statement. ing almost 5000 people daily. “We are are ensuring social distancing while
WhatsApp groups in their respective AAP MLA from Uttam Nagar distributing food in 18 police stations distributing food,”
Assembly consisting of social organ- Naresh Baliyan distributed dry food areas, 2000 packets two times a day. “We are working round the
isations and NGOs to facilitate the packets and almost 10,000 packets Apart from this we have identified clock to ensure sanitizers, food and
entire process. of 5 kg flour and 10,000 packets of several locations where we are dis- water for the poor people of the area.
The party MLAs had submitted 1 kg rice to the poor people in his tributing food through our volunteer There is no need to worry, we are all
a list of locations where new night constituency. He has also set up 200 teams. Our team is also involved in together working for the relief,"
shelters and food distribution cen- WhatsApp groups in Uttam Nagar facilitating distribution of ration,” he said AAP MLA from Timarpur
tres can be established for the needy. Assembly consisting of social organ- added. Dilip Pandey.
Based on the input from the MLAs, isations and NGOs to facilitate the Kuldeep Kumar, MLA from "The Delhi Government is pro-
the Delhi Government has now entire process. Kondli said, "Many people who viding 1.5 times extra ration to the
established new shelters and food “All these organisations are were leaving Delhi, have returned ration card holder residents of
distribution centres. working with the MLA to ensure no after listening to the appeal made by Delhi. Today I ensured that in my
“The party MLAs and workers one stays hungry in the area. Mr Delhi CM Arvind Kejriwal. We area all the ration cardholders get
are working tirelessly on ground to Balayan had also submitted a list of have made adequate arrangements this benefit and the initiative was
ensure food distribution to poor locations where new night shelters for their stay and food" successful," said MLA from Burari
people affected by lockdown in can be built and new food distribu- National Spokesperson and Sanjeev Jha.
=4F34;78kCD4B30H k<0A27" !! ]PcX^]#
2>E83 (>DC1A40:
A>Y`]UdgZUV`T`_WVcV_TVhZeYYVRUd`W>ZddZ`_d
<^SX[PdSbb^RXP[^aVP]XbPcX^]b´ ?<bWPaTbWXb³UXc]Tbb\P]caP´
a^[TbX]UXVWcX]VR^a^]PeXadb cWa^dVW"3P]X\PcTSeXST^b
?=BQ =4F34;78 Nation Mahatma Gandhi's have been effective in con-
words that serving the poor trolling the spread of the
ontinuing his interactions and downtrodden is the best virus. They pledged support
C with various key repre-
sentatives of the society for a
way to serve the nation. The
Prime Minister praised the
to the PM-CARES fund and
said their workforce will be
?=BQ =4F34;78 evacuate Indians stranded unified fight against the coro- dedication and commitment dedicated completely to the
abroad in some of the epicen- navirus spread in India, Prime of organisations participating cause of serving the nation in
ith the objective of shar- tres of the crisis. He also Minister Narendra Modi on in the video conference, this time of crisis. The organ-
W ing details about global
efforts to fight coronavirus
exhorted them to take steps on
five specific counts.
Monday said social organisa-
tions have a big role to play in
towards serving humanity.
He observed that these
isations spoke about their
work to meet the COVID-19
pandemic and India’s ongoing The steps included endur- countering superstitions, organisations have three dis- challenge through awareness
measures, Prime Minister ing their own health and safe- wrong beliefs and misinfor- tinct specialties: a humane campaigns digital means, dis-
Narendra Modi on Monday ty, and that of their teams and mation even as he maintained approach, massive reach and tribution of essentials, food
held a video conference with families besides attending to that the entire nation is dis- connect with people and a packets, sanitisers, medicines
the heads of all of Indian Indians who remain in various playing immense resilience, service mindset. He said, due and provision of medical help
embassies worldwide — the foreign countries, given the grit and patience in facing the to these distinctions, such to those in need.
first such event for Indian uncertainty of continuing inter- challenge. organisations are trusted The Prime Minister reit-
Missions worldwide. national travel restrictions. He The Prime Minister was implicitly. erated the importance of
The Prime Minister said called on Heads of Indian interacting with representa- Modi said that the nation spreading awareness, help-
extraordinary times require Missions to help boost the tives of organisations working is facing an unprecedented ing the poor and needy
extraordinary solutions and morale of such compatriots for social welfare via video crisis and needs the service of through arranging for basic
therefore most of the world had abroad, address issues arising conference. these bodies and their necessities, provision of med-
quarantined itself even in this from their unplanned stay He appealed to them to resources like never before. ical facilities and dedicating ?=BQ =4F34;78 legs, hands and back for relax- post the "Yoga with Modi"
globalised era. Incidentally, abroad, with their host gov- spread awareness about the He suggested that they could the volunteers to the cause of ing the body. The exercises videos.
this conference was like mak- ernments, and other problems COVID-19 outbreak. Modi play a huge role in arranging serving those impacted by rime Minister Narendra ,Prime Minister suggested "But do remember, that I
ing assertion about taking
unprecedented decisions
Indians might face abroad,
including arranging shelter,
said that people were seen
gathered in places and flout-
for basic necessities for the
poor. They could also dedi-
COVID-19. He stressed on
the importance of giving
P Modi on Monday shared
3D animated videos of him
would keep people physically
and mentally fit while remain-
am not a fitness expert, I am
also not a yoga teacher. I am
including lockdown. Modi fur- where necessary and feasible. ing social distancing norms in cate their medical facilities medical and scientific advice performing yoga on Twitter to ing indoors during the three- merely a practitioner," he had
ther said this was an unavoid- He asked them to stay the name of belief. He said, it and volunteers to serving and countering misinforma- show how he remains fit. week lockdown period. said.
able step taken to fight this alert and identify in their is necessary to highlight the patients and the needy. Modi tion. Prime Minister also "During yesterday's The release of video was "...some yoga asanaas have
pandemic, but it was also huge- countries of accreditation best importance of maintaining said, the nation needs both underlined the need to keep #MannKiBaat, someone asked meant to all those who are greatly benefitted me. It is pos-
ly consequential, as the closure practices, innovations, scien- social distancing during this short-term measures and a working together to face the me about my fitness routine feeling tense while feeling sible that some of these tips
of the globalised system has tific breakthroughs and time. long-term vision to overcome challenge of the pandemic. during this time. Hence, inactive and stranded durng might help you too during the
had an extensive and far-reach- sources to procure medical Those with whom Modi the challenge. Over the last few days, thought of sharing these Yoga the period of “social distanc- lockdown," Modi said on
ing impact upon the interna- equipment, for India’s fight interacted included RSS The representatives of the Modi has been conducting a videos," he tweeted. ing”. Sunday.
tional transport system, finan- against COVID-19. He also leader Bhaiyyaji Joshi, social welfare organisations series of interactions via video "I hope you also begin Responding to a question In the run-up to
cial markets and the global advised Heads of Mission to Dawoodi Bohra head Qaq praised the leadership of the conferencing with represen- practising Yoga regularly," he in his monthly radio address International Yoga Day in
economy. suitably publicise the newly- Djoher Syedna, Yoga Guru Prime Minister in guiding the tatives of different sectors wrote. "Mann ki Baat" on Sunday on June last year, the Prime
Outlining the measures established PM-CARES Fund Baba Ramdev, spiritual leader country during the major cri- including electronic and print The video shows Modi how he is keeping fit during Minister had shared similar
taken by India, he said the to mobilise donations from Sri Sri Ravi Shankar and Raj sis. media and medical fraterni- doing some simple Yoga exer- the lockdown, the Prime videos to encourage people to
country had taken unprece- abroad. Yogini Brahmkumaris sister They praised the pro- ty besides Chief Ministers of cises involving stretching of Minister had said he would practise yoga
dented and early steps in Since this crisis also Jayanti. active measures of the gov- all the States and heads of
response to this pandemic from impacts upon the economy, He recalled Father of the ernment which, they said, States of SAARC nations. devices, technologies, research Heads of Mission underlined work.
mid-January this year, to Modi further advised the and other measures which measures to assist the nation- Modi emphasised that
reduce the risk of importing the envoys to also focus on ensur- to pay close attention to the Rome, Berlin, Kathmandu, measures taken by India to might help in India’s own al responses of those countries, India’s Missions abroad may
infection, and thereafter to ing that commerce in essential evolving international political Abu Dhabi, Kabul, Male, and combat this pandemic. national effort to fight this using the special fund created well be far from home, but
prevent a large outbreak. This supplies, logistics chains, and economic situation, espe- Seoul offered their perspec- Heads of Missions out- pandemic. at India’s initiative for SAARC they remain full participants in
included the world’s largest remittances and so on are cially in the context of the tives to the Prime Minister and lined their efforts to help They also reported lessons countries to combat COVID- India’s fight against COVID-
quarantine and lockdown, unaffected, through their COVID-19 pandemic. the rest of the audience. They Indians stranded abroad, in learned in other countries, 19. The Heads of Mission also 19. He emphasised that the
implemented by India. coordination with foreign In response, 10 Heads of shared feedback regarding particular, students and work- and their best practices, in the expressed gratitude for the unity and alertness of all
Modi complimented Heads partners. Lastly, he urged the Mission, in B eijing, appreciation in their countries ers. They also reported efforts global fight against COVID- guidance and inspiration from Indians would help safeguard
of Missions for their efforts to heads of missions to continue Washington DC, Tehran, of accreditation of the resolute to identify medicine, medical 19. In our neighbourhood, the Prime Minister for their the nation’s future.
2^]VeXST^R^]UTaT]RX]Vc^PbbTbbR^a^]PbXcdPcX^] 2^]V<?APY\^WP]D]]XcWP]\^eTbB2
3^]PcTPc[TPbcC TPRWc^?<20A4B bTTZb^_T]X]V^U:´cPZPQ^aSTafXcW:TaP[P
5d]S19?_aTbXST]cdaVTb_Pachf^aZTab New Delhi: The Congress MP
from Kerala’s Kasaragod,
Rajmohan Unnithan, has
the State of Kerala leading to
shortage supply of food and
medical supplies,” his plea
Karnataka.“The people of
Kasaragod in Kerala rely entire-
ly upon the medical facilities of
the State of Karnataka to the
State of Kerala,” he said in his
PIL.His plea sought directions
?=BQ =4F34;78 to 20 crore members. Fund as part of his moved the Supreme Court said.Unnithan said the “ill- Mangalore District in the State to the Karnataka Government
"I appeal to all of you to Government's efforts to com- seeking direction to the planned and dangerous block- of Karnataka and its adjacent to open the borders with Kerala
enior Congress leaders make your contribution to bat the coronavirus and asked Karnataka Government to ade” has claimed the life of a 70 areas.“As a result of this block- and in particular Kasargod-
Smeeting
have convened a high-level
on Thursday through
PM Cares Fund. Our small
support can make a huge
people to contribute gener-
ously to it.
open its border with his State
for smooth movement of
year old woman who was
denied entry into Karnataka for
ade two persons have already
died as they were denied entry
Mangalore border at Talappadi
and allowing the movement of
video conferencing to dis- contribution. I request every Earlier, the BJP decided ambulances and other emer- urgent medical treatment only into Karnataka even for urgent Ambulances and other emer-
cuss the implications due to BJP worker to contribute at that one crore of its affluent gency vehicles during the lock- available at Mangalore.“This is medical treatment at a hospi- gency vehicles through the
the 21-day countrywide lock- least C100 to PM Care Fund workers would arrange food down. a clear case of violation of the tal in Mangalore,” his plea said. borders.
down to check the coron- ?=BQ =4F34;78 and inspire 10 others to con- for at least five poor persons In his plea, Unnithan said right to life with dignity by the He added that Kerala being The petition also sought
avirus menace. tribute as well," Nadda said in under the ‘Mahabhojan’ pro- that such a blockade is a clear state as citizens are made to die a consumer state, grocery items direction to Karnataka to allow
The party which has aying this is the need of a message. gramme. While the party has violation of Articles 21 and on the roads because of the and vegetables come from the movement of trucks and
simultaneously been criticis-
ing certain measures of the
SNadda
the hour, BJP chief JP
on Monday appealed
This is the need of the
hour and BJP workers with
directed all its 386 MPs from
the Lok Sabha and Rajya
19(d) of the Constitution at a
time when supply of com-
action of the State which is in
total disregard to Article 21,” he
Karnataka through roads and
Highways connecting the
other vehicles carrying essen-
tial and non-essential items to
Modi Government and also to party workers to donate at their small donations can Sabha to release C1 crore modities is itself hit hard and said. Kasaragod and the Mangalore the state of Kerala.
extending its support to the least C100 each to the PM make a big contribution, he each from their respective the entire country is fighting a The Congress MP said that his “Now all the roads including The plea sought a direction
Centre in its effort to combat CARES Fund and inspire 10 added. MPLADS fund for tackling medical emergency.“This home constituency Kasaragod the National Highways to Karnataka to register an FIR
COVID 19 on Monday con- others to contribute as well. Prime Minister Narendra the Covid-19 pandemic, it blockade has also resulted in is the northern most district of leading to the Karnataka state and constitute a Special
stituted a control room at The BJP, which claims to be Modi has launched the PM''s has also asked all its MPs to cutting off the essential lifeline Kerala, which shares most of its side are closed by the officials Investigation Team (SIT) under
party headquarters. A couple the largest political party in Citizen Assistance and Relief donate a month’s salary to the of National Highways and State boundary with Karnataka and of the Karnataka State in the the supervision of the court to
of days ago, party chief Sonia the world, is said to have close in Emergency Situations PM’s fund. Highways and major district the Panvel-Kochi- wake of the nation-wide lock- enquire against the authorities
Gandhi had also constituted roads leading to the State of Kanyakumari National down against the Covid 19 concerned including the police
a task force to tackle the 0\TTcX]V^UcWT down. control room on a daily basis Kerala, which has resulted in Highway (NH-66) is passing pandemic which has resulted in officials whose action led to the
spread of Corona menace. 2^]VaTbbF^aZX]V Congress also set up a 24- on the actual ground situation the shortage of supply of essen- through the district, connect- stoppage of supply of goods death of two citizens.
AICC General Secretary 2^\\XccTTfX[[QT hour central control room to with regards to the spread of tial and non-essential items to ing it with Mangalore, and other essential items from Agencies
K C Venugopal said the CWC WT[S^]CWdabSPh coordinate with States on the virus, medical prepared-
C3d_XUQb]YWbQ^dg_b[UbcµYcceUcd_TQi
will discuss the future strate- 0_aX[! steps being taken to extend ness of respective govern-
gy. help to people in distress due ments as also the relief work
"A meeting of the to the lockdown imposed to being undertaken by the party
C ongress Working labourers, the poor and the check the spread of coron- and state agencies.
Committee will be held on marginalised. avirus. The party two days ago NEW DELHI: The Supreme Rao today heard the petition, said that it will deal with every- davit while replying to the peti-
Thursday, April, 2. The meet- The par ty has also The central control room had constituted a task force to Court on Monday slated for filed by advocate Alakh Alok thing, but not with what the tion.The CJI said that we are not
ing will be conducted through accused the Government of at AICC will be monitored by intensify efforts of party- tomorrow the hearing on a Srivastava, through video con- Central Government is already going to add to the confusion by
video-conferencing," not taking adequate steps to Venugopal comprising Rajiv ruled States to deal with the petition seeking directions to ferencing and slated the matter doing and added that it will first issuing any kind of direction,
Venugopal said. mitigate the plight of the Satav, Devendra Yadav (ex- situation due to COVID-19 provide amenities like food and for Tuesday. Srivastava, during go through the Centre's affi- which is already being taken
The Congress has been migrant labour force. MLA), Manish Chatrath and help mitigate the suffer- shelter to migrant workers amid the hearing today, cited many davit. Solicitor General, Tushar care of by the Government.
critical of the Government''s Sonia Gandhi and for- (Secretary, AICC) as mem- ings of people. the lockdown imposed in the news stories about migrant Mehta, told the court that the The petition sought directions
handling of the situation aris- mer Congress chief Rahul bers for the purpose of The task force includes wake of coronavirus. A two- labourers walking out of urban Union of India and all State to provide food, water, shelter
ing out of the COVID-19 Gandhi have suggested a coordinating all COVID-2019 former Union Ministers P judge bench headed by Chief centres. Seeing thousands of Governments are taking all and urgent indulgences to the
lockdown, saying it has halt- nuanced approach to tackle related matters. Chidambaram, Jairam Justice of India (CJI) Sharad people on the road every day, it kinds of necessary steps to mit- migrant workers and their fam-
ed all economic activity and the coronavirus outbreak It also said that state party Ramesh, M Veerappa Moily Arvind Bobde and also com- is a very sad situation, he told igate the situation and submit- ilies.
is causing problems to the rather than the total lock- units will update the central and Tamradhwaj Sahu. prising Justice L Nageshwar the apex court.The top court ted that he wanted to file an affi- Agencies
2^eXS (\PhRaTPcTUPcP[RPaSX^ePbRd[Pa^aaTb_XaPc^ah_a^Q[T\b
0A270=09H>C8Q =4F34;78 coronary syndromes, arrhyth- those that reported respira- died of both causes, and 5 include fever, cough, and
mias, and the development of, tory failure, septic shock, died from undetermined shortness of breath.
ovid-19 can have fatal con- or exacerbation of, heart fail- and/or multiple organ dys- causes.64 Patients who died Other less common
C sequences for people even
without underlying cardiovas-
ure.
In a clinical bulletin
function or failure that result-
ed in death.
had higher levels of troponin,
myoglobin, C-reactive pro-
symptoms are muscle pain,
sore throat, nasal congestion,
cular disease or respiratory issued by the American The authors also analysed tein, serum ferritin, and inter- and headache. Symptoms can
problems, according to a study College of Cardiology, it was another small retrospective leukin-6. This study is further appear as soon as two days
published on Monday. revealed that the case fatality study of 150 patients with lab- suggestive of a high inflam- after exposure to the virus to
"It is likely that even in the rate of COVID-19 for patients oratory-confirmed COVID- matory burden in COVID-19 up to14 days after.
absence of previous heart dis- with cardiovascular disease 19 that evaluated the factors and a possible rise in The co-authors of the
ease, the heart muscle can be was 10.5%. Data also points to associated with mortality. It myocarditis-related cardiac study "Potential Effects of
affected by coronavirus dis- a greater likelihood that indi- was found that cardiovascu- events.” C oronavir uses on the
ease," said Mohammad Madjid, viduals over the age of 65 with lar disease was more prevalent The novel virus that caus- Cardiovascular System"
MD, MS, the study's lead coronary heart disease or in patients who died (13 of es COVID-19 originated in include Payam Safavi-Naeini,
author and an assistant profes- muscle can happen in any effects of COVID-19 on the published in JAMA hypertension can contract the 68) than patients who sur- Wuhan, China, and by March MD, of the Texas Heart
sor of cardiology at McGovern patient with or without heart cardiovascular system is essen- Cardiology explained that illness, as well experience vived (0 of 82). 11, 2020, the WHO had Institute and Scott Solomon,
Medical School at The disease, but the risk is higher in tial for providing comprehen- research from previous coro- more severe symptoms that “Among the 68 fatal cases, declared it a global pandem- MD, of Harvard Medical
University of Texas Health those who already have heart sive medical care for cardiac navirus and influenza epi- will require critical care. 36 died of respiratory failure, ic. School; and Orly Vardeny,
Science Center at Houston. disease,” said the authors cau- patients.. demics suggest that viral According to the study 5 died of myocardial damage The three most common PharmD, of the University of
"Overall, injury to heart tioning that understanding the The authors in the study, infections can cause acute authors, critical cases are and circulatory failure, 22 symptoms of COVID-19 Minnesota.
=4F34;78kCD4B30H k<0A27" !!
2>E83 (>DC1A40:
]PcX^]$
CVefc_Z_X^ZXcR_edRTYR]]V_XVW`c3ZYRc 9:6^ec]^cXUXTb
80=B Q ?0C=0 up along the Bihar-UP border.
By Monday, we are expecting
are being registered at the dis-
aster border relief camps. Their
panchayats and sarpanches
have been asked to monitor the
WT[_[X]T]d\QTabU^a
bcaP]STS\XVaP]cb
he migrant labourers 1.30 lakh people to reach the health is being checked. After situation and follow quarantine
T returning to Bihar has
posed a big challenge to the
borders. We are looking to
provide them food and make
food and rest, they are being
provided buses by the
and social distancing norms,"
Kumar said.
State Government–to keep arrangements for their stay Transport Department in the Those who had returned
them in 14-day isolation to during the quarantine period." district headquarters. from abroad after March 10
contain coronavirus spread. The state government, he Arrangements have been made were being investigated. The 80=B Q 90<<D contact for help the following:
Over 45,000 people had said was taking all precaution- to send them, " said another government has a list of 1,790 Zameer Ahmad, Assistant
reached the UP towns border- ary measures even before official. such people. he Jammu & Kashmir Labour Commissioner,
ing Bihar and more than
100,000 were expected by
Prime Minister Narendra Modi
announced the 21-day lock-
The process could contin-
ue for two-three days, he
The Chief Minister after
high-level meetings have
T Government on Monday
notified the helpline numbers
9797172356 (for Kashmir
Division) and Sanjay Kumar,
evening, said a Bihar Disaster down on March 24. After added. ordered one-month's ration for migrant labourers from the Labour Officer, 9419424281
Management Department offi- emergence of Covid-19 cases in Principal Secretary Deepak free to 1.68 crore cardholders Union Territory who are (for Jammu Division).
cial, here on Monday. the state, the government had Kumar said arrangements were and payment of three months' stranded in various parts of the These officials have been
Pratyam Amrit, Principal made arrangements even in the But the influx of workers has expressed displeasure at the being made to send Biharis pension to all pensioners. countr y due to asked to liaise authorities con-
Secretary of the Disaster rural areas to provide food and from Delhi has created serious migrant workers being sent coming from outside to their A control room has also the 21-day nationwide lock- cerned to assist/help
Management Department, shelter and screen villagers for problem the state government. back to Bihar. villages. "All the Block been set up at Bihar Bhawan in down. stranded migrant
said, "Six camps have been set infection, he added. Chief Minister Nitish Kumar "People from other states Development Officers, Head of Delhi to help people. The migrants were asked to labourers
ad[Tb)1BH
one week or so will also pass Lucknow: BJP legislators are now involving "I have sent two quintals of gram and two
B0D60AB4=6D?C0Q :>;:0C0 of by the grace of Marangburu themselves in providing relief to the common quintals of wheat to a local saint along with Rs
(the tribal god)” said another people during the ongoing Covid-19 crisis and 50,000. I am doing my bit in this crisis," he said.
bunch of semi-literate, person adding they will only the ensuing nationwide lockdown. BJP General Secretary Bansal on Monday 80=BQ 14=60;DAD
A half-clad people from
tribal boondocks of Bengal
descend from the trees and go
to their village after the doc-
Uttar Pradesh Chief Minister Yogi
Adityanath and BJP General Secretary Sunil
asked all party workers to provide food to at least
five to 10 families every day at the booth level
Panaji: With Panaji reeling
under severe food and gro-
accused of diverting and
hoarding essential goods, n a stern warning to viola-
have displayed the kind of
grasp of corona consciousness
tor give us permission.
Cut to Kolkata: The num-
Bansal have asked all party legislators and work-
ers to extend all possible help to the people dur-
and send a report to the party headquarters.
Every party worker has also been asked to
ceries shortage amid the ongo-
ing lockdown like other parts
releasing them
ly to party workers and other
on IMinister
tors, Karnataka Chief
BS Yediyurappa on
that hundreds of their well- ber of corona deaths increased ing the lockdown. contribute a minimum of Rs 100 each into the of Goa, former Chief Minister favourites. Monday put the onus of lock-
heeled fellow citizens have to two with a middle-aged UP Minister Brijesh Pathak has turned his PM-CARES fund. late Manohar Parrikar's son Former Panaji MLA and down ending on the people fol-
failed to exhibit. About 10 woman from Kalimpong --- residential phone number into a helpline and has Majority of the legislators in UP have Utpal on Monday, participat- BJP leader Sidharth lowing the Government's
migrant workers from Bhamri who was admitted to the asked people to contact him if they require any already announced contribution form their MLA ed in a drive to deliver essen- Kuncalienkar has also alleged guidelines strictly and staying
village in interior part of the North Bengal Medical College help for food. He claims that his control room funds for fighting the Covid-19 crisis. tial groceries to 500 people liv- a scam in the diversion of at home.
tribal Purulia district have in Siliguri on Sunday --- suc- works round the clock for people who are in However, some of them are clearly hesitant ing in the late Defence essential goods in the home "Ending of the 3-week
been living on tree tops as a cumbing to the dreaded dis- need. to go out among the people and supervise the Minister's home delivery mechanism devised lockdown depends on strict-
measure of isolating them- ease in the wee hours of Banda BJP MLA Prakash Dwiwedi said that relief work. constituency. by the city corporation which ness with which the people fol-
selves from the rest of the vil- Monday, Health Department he has provided food to at least 5,000 workers, These MLAs are posting their videos on the "Many people who live is controlled by the BJP. low the curfew and maintain
lagers, sources said. sources said. The earlier casu- labourers and homeless people. social media in which they can be seen doing day to day cannot afford to Utpal Parrikar said that he social distance. In this hour of
The workers had returned alty was from Kolkata where He has also set up a control room to facil- yoga, playing with their children, watching tele- buy large amounts of grocery himself faced a lot of issues crisis, it is not good to come out
from Chennai and unlike in a 65-year-old man passed itate relief work, which includes home delivery vision and exercising within the confines of their at a time. They have to sur- related to sourcing of mater- of house and violate the cur-
many villages were not imme- away last week. of food packets. homes. Naraini BJP MLA, Raj Karan Kabir, has vive. It is easy to say 'stay at ial for the outreach pro- few," Yediyurappa said in a
diately pushed outside by the A third person too died at Dwiwedi claimed in a press release that he isolated himself in his farmhouse and has home', but many people are gramme, on behalf of the statement here.
locals for the fear of infection. NRS Medical College hours is also providing food to monkeys. stopped taking calls. IANS facing hunger. Ground reali- Mahalaxmi temple trust. He appealed to the people
“We came straight to our vil- after his admission with ty is it is difficult to get sup- Mahalaxmi is the city deity of to help the state government in
lage by hiring a vehicle, saw Corona-like symptoms but plies. I do not know if it is Panaji, a constituency repre- preventing the spread of the
local medic who advised
home quarantine. But as our
houses are small with no
the reason of his death could
not be ascertained as reports
of his pathological samples
B^dcWTa]APX[fPhbQTVX]b hoarded by people," Utpal
Parrikar told IANS on
Monday.
sented by Manohar Parrikar
since 1994.
"I am just giving it on
virus.
"People of Karnataka are
known for tolerance and
chance of isolation without
coming in close physical con-
tact of others we decided to
were still awaited, sources
said. Meanwhile, the count of
corona infection increased to
f^aZ^]Xb^[PcX^]fPaSb The outreach by Utpal,
who is a member of the state
executive committee of the
behalf of the Mahalaxmi trust
as a social cause to a few needy
people so that they can stay at
patience. They are law-abiding
citizens. The lockdown is a test-
ing time for them. It has come
stay on tree top,” said Bijoy 22 in Bengal with three more Chennai: Three production units belonging to Indian style toilets into a bathing room with Goa Bharatiya Janata Party, home for a few days. We are to test the patience of our peo-
Singh Loya. persons --- one from Southern Railways have been assigned the task hand shower, bucket, mug, soap and liquid dis- comes at a time when the trying to reach 500 families ple," Yediyurappa said.
They made their own Seoraphuli in Hooghly dis- of converting one train coach as an isolation penser. Chief Minister Pramod which are in need," Utpal Citing Prime Minister
abode up on mango trees trict, a trader from Burra ward for coronavirus patients, said an official. All the middle berths in the coaches and the Sawant-led administration is said. Narendra Modi's apology for
using bamboo sticks to fabri- Bazar in Kolkata and a third According to the official, Perambur Loco ladders to climb on to middle and upper berths facing accusations of ineffi- "I was doing it silently for the lockdown amid the pan-
cate planks some three feet by person from Baranagar in Works, Perambur Carriage Works both locat- would be removed for easier movement. ciency vis a vis ensuring avail- the past two three days. I was demic, the Chief Minister said
six feet each. “We have spread North 24 Parganaas were ed here and the Golden Rock Workshop in The official said there will be extra bottle ability of food supplies and facing a lot of issues getting everyone should realise the
out bed sheets and using mos- admitted to various hospitals, Trichy will be converting one coach each as pro- holder and there will be 230V sockets in each basic essentials to hundreds of the material. We will try to predicament of Modi who cares
quito curtains too,” said anoth- sources said. Even as the num- totype for Coronavirus ward. cabin.There will be plastic curtain for each cabin thousands of Goans across the repeat it next week, so that for the well-being of the coun-
er fellow migrant,” adding the ber of Corona infection went Further plans for converting coaches as as a measure of isolation. state who are in a state of these people can stay inside. try and its people.
villagers are kind enough to up Chief Minister Mamata medical ward will be taken based on the The partition on the end side next to main panic due to grocery stores That is the next goal," he "Modi's precautionary
provide them with rice and Banerjee on Monday upped instructions from the Indian Railway Board, an doorway will be removed on each end. running out of stock. The said, adding that people who measures are yielding results
vegetables. “They bring both the insurance amount for the official not wanting to be quoted told IANS. According to an official, Indian Railways home delivery system initiat- live on day-to-day finances when the performance of the
steaming and puffed rice medical and other govern- According to the official, the work has begun have already coaches with fully equipped oper- ed by the government, with find it difficult to buy large developed countries is miser-
beneath the tree and we pull ment staff involved in fighting and is expected to be completed by Thursday. ation theatre which are used to treat the injured the help of volunteers from volumes of groceries to last able in handling Covid out-
the utensils with rope. This is the endemic to C10 lakh. The modifications include converting the in train accidents. IANS political parties, has also been several days. IANS break," he said.
:TaP[PeTRPbTbRa^bb!P\XS\XVaP]cf^aZTab´d]aTbc 7RWDOSRVLWLYHFDVHVPRXQWWRLQ- .
:D<0A274;;0??0=Q :>278 arrangements to travel back to CWT\XVaP]cb\PX][hUa^\ hour shift. The owners of the <>78C:0=370A8Q 90<<D number of 10 news development, the district
their native places in the back- 1T]VP[P]S0bbP\c^^Zc^ factories and mills make huge cases tested posi- authorities in Jammu Monday
s the number of corona drop of the 21-day shut down. profit but they refuse to pay the doctor working in the itve in Jammu and intensified lockdown in certain
A virus affected persons
crossed the 200 mark by
“The workers, mostly from
Bangladesh masquerading as
cWTbcaTTcbST\P]SX]V
X\\TSXPcTPaaP]VT\T]cbc^
workers at least half of their
wages in this time,”
A microbiology laboratory
of Government Medical
Kashmir
Monday. He said,
on pockets of Jammu and blocked
all the entry and exit routes to
Monday morning, making it they are from Bengal and caPeT[QPRZc^cWTXa]PcXeT Subramanian Sasidharan, a College (GMC) hospital in 11644 persons are contain movement of local res-
the State with the second high- Assam are upset that they are _[PRTb timber mill owner , told The Jammu Monday tested positive under observation idents.
est number of afflicted patients, out of work. Being daily wage Pioneer. He also disclosed that for Covid-19 along with nine and 722 samples The decision was taken
Kerala is faced with a major earners, they are not in a posi- moments on Monday as local 90 per cent of the workforce is others in Jammu & Kashmir. tested so far, 659 by the local authorities after
issue which has been brewing tion to find ways to get two officials reached a labor camp from Bangladesh. “They work The total number of posi- tested negative and reports claimed some of these
up for days. It is feared that square meals a day,” said Siby housing migrant workers. sincerely and with dedication. tive cases stood at 48, with reports of 15 sam- positive cases may have come
migrant workers across the Abraham, member, Paippadu Because of the nationwide lock The local youth are reluctant to seven new cases reported from ples were awaited. in contact with large number of
State may take to the streets Panchayath in Kottayam dis- down , all plywood companies, do manual jobs,” said Kashmir and three from He said, seven people in the area and needed
demanding better living con- trict. He said there are more which employ nearly 1,00,000 Sasidharan, Jammu region till last reports clock. more cases detected positive in strict measures to isolate them.
ditions or for transportation than 10,000 migrant workers in migrant workers, had laid off Sunday’s showdown in came in. According to official Kashmir, two from Shopian Deputy Commissioner
back to their villages. Paippadu Panchayth and most the workforce. Paippadu has upset the author- As a safety measure, sam- sources, the doctor was imme- and three from Srinagar, one Jammu, Sushma Chauhan
An aggressive posture by of them are in possession of at Most of the owners of these ities as Chief Minister Pinarayi ples of other staff diately shifted to the dedicated each from Bandipore and issued a statement which said,
thousands of migrant laborers least a dozen identity cards. plywood factories, money Vijayan himself came out with members/technicians and con- covid-19 ward in the GMC Budgam. He added, all positive "in order to strengthen COVID
in Paippadu Grama Panchayat This is not a problem faced spinners in normal time, a statement on Monday. He sultants working in the GMC where seven other patients, cases were contacts of previous containment in some areas of
in Kottayam district on Sunday by Kottayam district alone. refused to pay the workers cit- said some vested interests were laboratory were taken and all of tested positive between March positive cases. In Jammu divi- PS Trikuta nagar (from where
took the State administration Neighboring district of ing the layoff. “There are instigating the migrant work- them were immediately quar- 25-29, were already admitted. sion, he said three new positive recent +VE cases traced), we
by surprise. The migrants, Ernakulam, the El Dorado of 1,50,000 migrant laborers in ers. Officials in State police said antined. Three cases from Udhampur cases were reported". Out of have intensified lockdown in
mainly from Bengal and Assam migrant workers, is like a vol- Perumbavoor who are they suspect the role of a 24X7 Senior doctors in the GMC were also admitted in the GMC these three, one case was Bhatindi and neighbouring
(though the local officials term cano which may burst anytime. employed in plywood compa- news channel owned by a reli- were frequently raising the ward in Jammu. detected in Udhampur, while areas. Further included today
them as workers from Perumbavoor, a small town nies, timber mills and eateries. gious group for fomenting issue of inadequate safety kits According to Rohit Kansal, two others from Janipur and are Bhawani Nagar of Janipur
Bangaldesh) took to the streets with nearly 500 registered ply- They get anything between troubles at Payippadu on for doctors and other staff spokesman of the Jammu and Gujjar Basti area of Jammu. PS as well. This is in interest of
demanding immediate wood companies faced tense C800 to C1,000 per day for a 12 Sunday. members working round the Kashmir government, " a total In another important public at large".
QHZFDVHVWDNH 0DKDPRUHGHDWKVSRVLWLYHFDVHVPD\FURVV
5DMWDOO\WR C=A067D=0C70Q <D<108
%
gggTQY\i`Y_^UUbS_]
UPRTQ^^ZR^\SPX[h_X^]TTak /CWT3PX[h?X^]TTak X]bcPVaP\R^\SPX[h_X^]TTa
3ROLWLFVLQ&RURQDH[RGXV
A2A6CH:E9A2DD:@?
:_UZR_d`]feZ`_d
+RPHJURZQWHVWNLWVDQGJHRIHQFLQJRI&29,'
VXVSHFWVVKRZZK\ZHQHHGWRSULRULWLVHWKHVFLHQFHV5 '
, CWTaTeTabT\XVaPcX^]^USPX[hfPVTabWPb\PSTP\^RZTah^UcWT?aX\T<X]XbcTa³b
ILQGHHGDV3ODWRIDPRXVO\VDLG´1HFHVVLW\
LV WKH PRWKHU RI LQYHQWLRQµ WKHQ WKH
&RURQDYLUXVSDQGHPLFKDVFHUWDLQO\EURXJKW
RXW,QGLDQLQQRYDWLRQDWLWVEHVW7REHJLQZLWK RP[[U^aP! SPh[^RZS^f]FWPc_a^\_cTScWXbWd\P]XcPaXP]RaXbXb.
DWHDPDW,,7%RPED\DQGSURIHVVLRQDODQG
H[SHULHQFHG PHPEHUV DPRQJ WKH DOXPQL
UHFHQWO\GHYHORSHGDQDSSIRUPRELOHVFDOOHG
¶&RURQWLQH·ZKLFKZRXOGKHOSWKHDXWKRULWLHV
NHHSWUDFNRISRWHQWLDORUVXVSHFWHGDV\PS
WRPDWLFFDUULHUVRI&29,'LIWKH\ZHUHWR
OHDYHWKHLUTXDUDQWLQH]RQH7KLVKDVEHHQGRQH
E\FUHDWLQJZKDWWKHWHFKLHVDUHFDOOLQJD´JHR
C1>48I1 908=
IHQFHµWRNHHSWDEVRQSHRSOHZKRKDGWUDYHOOHGDEURDGVLQFH)HEUXDU\HQGDQG
KDGEHHQDGYLVHGKRPHTXDUDQWLQHIRUDPLQLPXPRIGD\VWRVHHLIWKH\GHYHO here is a strange coincidence, if
RSV\PSWRPV7KHVHOITXDUDQWLQHZDVQRWMXVWIRUWKRVHZKRWUDYHOOHGDEURDG
EXWDOVRIRUWKHSHRSOHWKH\FDPHLQFRQWDFWZLWKDIWHUUHWXUQLQJLQFOXGLQJIULHQGV
DQGUHODWLYHV$V\PSWRPDWLFFDUULHUVRI&29,'KDYHEHHQDFDXVHRIFRQ
FHUQIRUWKHPHGLFDOFRPPXQLW\JOREDOO\DQGLQ,QGLDWRR3DUWLFXODUO\DVWKHUH
KDYHEHHQVHYHUDOFDVHVLQWKHFRXQWU\ZKHUHSHRSOHHVFDSHGTXDUDQWLQHDQG
T not synergy, between some
Twitter handles calling for the
national Government to deal
with the Coronavirus health
crisis, even though the Union Government
enjoys a staggering majority, and the sud-
den exodus of thousands of casual labour
PLQJOHGZLWKWKHPDVVHVLUUHVSRQVLEO\LQFUHDVLQJWKHSRWHQWLDOULVNRIFRPPX from jhuggi clusters across Delhi on
QLW\WUDQVPLVVLRQRIWKHFRQWDJLRQ7KHQWKHUHZDV0LQDO%KRVDOHDYLURORJLVW Saturday, March 28. This made a mockery
IURP3XQHZKRZLWKWKHKHOSRIKHUWHDPFUHDWHGWKHILUVW,QGLDQWHVWLQJNLWIRU of the 21-day national lockdown
announced by Prime Minister Narendra
WKHYLUXVMXVWDGD\EHIRUHVKHJDYHELUWKWRDEDE\JLUO7KHWHVWZDVGHOLYHUHG Modi on March 24 and potentially exposed
LQDUHFRUGWLPHRIMXVWVL[ZHHNVDQGWKHILUVWEDWFKKDVQRZKLWWKHPDUNHWV these fleeing families and those they
PDNLQJIRUDTXLFNDQGDIIRUGDEOHRSWLRQ7KHHQJLQHHULQJWHDPVEDVHGDWWKH would meet at the end of their journey to
the virus, should any among them be silent
DXWRPDNHU0DKLQGUDDQG0DKLQGUD·V0XPEDLDQG1DVKLNPDQXIDFWXULQJSODQWV carriers of the deadly disease.
GHYHORSHGDQ$PEXEDJYHQWLODWRULQKRXUVWKDWZLOOFRVWMXVWC7KLV Delhi Chief Minister Arvind Kejriwal
LQGLJHQRXVO\GHYHORSHGEDJYDOYHPDVNLVDVHOILQIODWLQJGHYLFHWKDWLVW\SLFDO could have used the Disaster Management
Act, 2005 to rein in migrants from the
O\XVHGWRKHOSSDWLHQWVZLWKEUHDWKLQJSUREOHPVDQGZLOOEHDQDQVZHUWR,QGLD·V beginning. The Lt Governor and collectors
ZRUU\RYHUWKHVKRUWDJHRIYHQWLODWRUVIRU&RURQDYLUXVSDWLHQWV1RZWKH'HIHQFH of the capital’s 11 districts are also culpa-
5HVHDUFKDQG'HYHORSPHQW2UJDQLVDWLRQ'5'2LVWU\LQJWRGHYHORS´PXOWLSDWLHQW ble for not realising the developments
YHQWLODWRUVµZKHUHLQVHYHUDOSDWLHQWVFDQEHVXSSRUWHGE\DVLQJOHYHQWLODWRUWR brewing under their watch and total inac-
tion when exodus began from their respec-
PHHWWKHKXJHGHPDQGLIWKH&RYLGRXWEUHDNJRHVRXWRIFRQWURODV,QGLDKDV tive areas. A new Lt Governor will revive
RQO\YHQWLODWRUVDVRIQRZ confidence in the city’s shaken populace.
7KLVJRHVWRVKRZWKDWZKHQSXVKFRPHVWRDVKRYHLQWLPHVRIFULVLVWKH The Prime Minister, however, took
control of the situation with Sunday morn-
,QGLDQVSLULWDQGPLQGNLFNLQWRRYHUGULYHWRILQGDQVZHUVWRTXHVWLRQVZKLFK ing’s Mann ki Baat, where he warned that
SX]]OHWKHZRUOGHYHQWRGD\$OODURXQGWKHZRUOG,QGLDQPLQGVDUHUHYHUHGDQG those violating the lockdown are “playing Minister Yogi Adityanath by Uttar Pradesh. From there, offices and construction activ-
DUHRIWHQHYHQIRXQGDWKLJKUDQNLQJSRVLWLRQVLQWKHILHOGVRIVFLHQFHDQGGLV with their own lives” and that a complete surprise. they got a ride on a tractor trol- ities going as soon as possible
lockdown was the only solution in the glob- However, he had to order ley, ate at a gurdwara and will give the economy a jolt
FRYHU\DWWKHPRVWSUHVWLJLRXVLQVWLWXWLRQV7KLVDOVRSRLQWVRXWWRWKHODFNRI al pandemic. He regretted the discrimina- 1,000 buses to pick up the hoped to get Government from which it would struggle to
UHVHDUFKDQGLQQRYDWLRQIDFLOLWLHVDQGLQFHQWLYHVDWKRPH7KHPRVWEULOOLDQWRI
,QGLDQPLQGVXVXDOO\IORXULVKWKHPRVWRQFHWKH\KDYHEHHQUHFRJQLVHGE\IRU
tion against medical personnel, who are
risking their lives to save others at this crit-
homeward-bound and ordered
a 14-day quarantine of about 508;DA4C> transport to reach their village.
Hundreds more have been
recover. It is pertinent that the
Centre had announced a slew
HLJQLQVWLWXWLRQVZKLFKYDOXHWKHLULGHDVPRUHWKDQWKH,QGLDQRQHV,WLVQRP\V
ical time and applauded all those provid-
ing essential services.
one lakh people who had
entered the State in the last
A4BD<442>=><82 spotted walking towards
Ghaziabad and Gautam
of incentives for the small and
medium manufacturing sector,
WHU\WKDWWKH,QGLDQHGXFDWLRQV\VWHPGRHVQRWOHDYHPXFKEUHDWKLQJURRPIRU Simultaneously, the National Executive three days. This means some 02C8E8CH0=364C Buddha Nagar, adjoining Delhi. just prior to the lockdown. This
LQQRYDWLRQDQGFULWLFDOWKLQNLQJ7KHHGXFDWLRQV\VWHPQHHGVWREHRYHUKDXOHG Committee of the Disaster Management
Act, 2005, under Section 10(2)(1) direct-
began coming from Thursday.
All district magistrates
502C>A84BB7>?B The Chief Ministers of
Bihar and Uttar Pradesh have
sector is a large source of
employment and needs to get
WRSURPRWHFULWLFDOWKLQNLQJDQGLQQRYDWLRQLQYDULRXVILHOGVLQVWHDGRIWKHEDVLF ed all State and Union Territor y were given details (names, >55824B0=3 expressed anger at the Delhi on its feet fast.
OHYHORIHGXFDWLRQDQGNQRZOHGJHZKLFKLVIRUFHGXSRQVWXGHQWV,QWKHDEVHQFH Governments to keep migrants, who left addresses and phone numbers) 2>=BCAD2C8>= Government for facilitating Can there be any other rea-
RIDKLJKHUHGXFDWLRQV\VWHPWKDWLVDSSOLFDWLRQEDVHGDQGZKLFKHQFRXUDJHV their current domiciles to return to their of the new arrivals and 60,000 this huge movement of people son for nudging labour from
EUHDNWKURXJKYHQWXUHVZHZLOODOZD\VUHPDLQSODJXHGE\PHGLRFULW\7KHRQVHW
home towns, in mandatory quarantine at panchayats were asked to share 02C8E8C84B6>8=6 across the country in defiance Uttar Pradesh and Bihar to quit
RIWKH&RURQDYLUXVLVVRPHWKLQJZKLFKEURXJKWRXWWKHEHVWLQRXUVFLHQWLVWV
the nearest shelter for 14 days as per stan-
dard health protocol. It asked landlords not
responsibility for the quaran-
tine. Uttar Pradesh has also sent
0BB>>=0B of the nationwide lockdown
and without any warning to the
the capital? It is difficult to say
but some have observed that in
DQGLQQRYDWRUVDWKRPH:LWKRQHRIWKH\RXQJHVWSRSXODWLRQVRIWKHZRUOGLI to press for rents for a month. It was later nodal officers to 12 States to ?>BB81;4F8;; respective States. Clearly, at all the turmoil, the alleged ille-
QXUWXUHGFRUUHFWO\DQGHIIHFWLYHO\ZHXQGHUVWDQGDEO\KDYHWKHSRWHQWLDOWREHFRPH that Kejriwal appealed to all migrant
labourers to remain in their current domi-
help people from Uttar
Pradesh, who have business or 68E4C7442>=><H this time, there is no need for
competitive activism or politics
gal migrants from Bangladesh
— both Bangladeshis and
DVXSHUSRZHUEXWWKHQHHGRIWKHKRXULVLQQRYDWLRQLQWKHILHOGRIVFLHQFH7KH ciles and not risk catching the infection or employment there. 09>;C5A>< but a coordination between Rohingyas — stayed put. They
*RYHUQPHQWQHHGVWREDFNWKHVFLHQFHVWRHQFRXUDJHFULWLFDOWKLQNLQJDQGSUR spreading it further. He promised to In Delhi, the national and
F78278CF>D;3 States to save lives. did not express anxiety about
PRWHUHVHDUFKDVYHU\IHZRIRXUSUHPLHUHGXFDWLRQDOLQVWLWXWLRQVWDNHSDUWRU ensure rations and began thermal temper- international media had a field The first objective would jobs or food and shelter during
DUHTXRWHGLQJOREDOVWXGLHV$VWKHUHFHQWFULVLVKDVVKRZQZKDWZHFRQVLJQ
ature checks at the bus stand but Bharatiya day; usual suspects interviewed BCAD66;4C> be to disrupt the Bihar admin- the crisis; nor did they have an
DVVRFLDOVHFWRUVLQQDWLRQDOEXGJHWVQDPHO\KHDOWKDQGHGXFDWLRQQHHGWREH
Janata Party (BJP) leader Kapil Mishra said
the buses must stop plying and people must
poor and hungry people walk-
ing home in the absence of A42>E4A8C8B istration with an abrupt inva-
sion of thousands of families,
urge to go home. Some
kind Samaritans were taking
DFFRUGHGDPXFKKLJKHUSULRULW\$WWKHVDPHWLPHDPLGDOOWDONRILPPXQLW\ be given rations at home.
Such mass movement of people from
transport, taking care not to ask
why they were moving around
?4AC8=4=CC70C who would immediately need
food, shelter and Coronavirus
care of them.
Whatever the reasons for
RXU$\XUYHGLFVFLHQFHVFDQEHUHYLYHGWRLQFXOFDWHDKROLVWLFKHDOWKFXOWXUH,QGLD all parts of the city requires meticulous during a nationwide lockdown. C7424=CA4703 screening, even quarantine. the reverse migration, it has
KDVRYHUFRPHSUREOHPVEHIRUHDQGLWVXUHO\ZLOOGRVRDJDLQZKHQHYHU\RQH planning and execution. The Centre must
fix responsibility for the DTC ferrying peo-
Al Jazeera spoke with painter
Ram Bhajan Nisar, who set off
0==>D=243 Lack of preparedness on this
score would embarrass the
increased the urgency for the
National Population Register
ZRUNVWRJHWKHUDQGSXWVKXPDQOLIHDERYHHYHU\WKLQJHOVH,QWKHHQGWKHEDW 8=24=C8E4B5>A
ple all over the city when the service is on foot with his wife, two chil- Nitish Kumar Government in (NPR) in order to track migra-
WOHLVRXUVWRILJKWQRERG\HOVHZLOOGRLWIRUXV restricted to staff of essential services at
fixed hours in the morning and evening.
dren and 11 others from Delhi
to Gorakhpur village on the
C74B<0;;0=3 an election year.
If we destroy the efficacy of
tion and job opportunities
across the country, which is
<438D<B42C>AB
=``\Z_XW`ca`dZeZgVd
By the time thousands of people had col- Nepal border, 650 km away. He the 21-day lockdown, the vital for future economic
lected at the Anand Vihar bus stand, it was admitted that an overnight bus Prime Minister would have no planning.
too late to send them back to their clusters. took the family from the bor- choice but to extend it further. (The author is a senior
Many had already been dumped at the der overpass area on Saturday Failure to resume economic journalist. Views expressed are
0D\EH,QGLDVKRXOGORRNDWWKLVSHULRGDVDQ Uttar Pradesh border, catching Chief up to Shahjahanpur district, activity and get factories, shops, personal.)
HQIRUFHGGHDGGLFWLRQWLPH
B>D=318C4
:
KLOH.HUDODPLJKWKDYHWKHPRVWQXP
EHU RI FRQILUPHG FDVHV RI WKH 4eTah^]T]TTSbc^QT <h[XUTfPbb^\TbbTSd_8 8P__aTRXPcTcWTX]XcXPcXeT8]SXP 8P\_PX]TSP]SbW^RZTS
aTPShU^acWTX\_PRc^UcWT fPbfXcWRTacPX]ch_T^U_T^ WPbcPZT]c^bTcd_P]T\Ta bTTX]VeXST^b^UP[[TVTS
6$56&R9YLUXVVWUDLQWKDWKDVSXW _[TUa^\fW^\^][hSTPcW VT]RhUd]SP]SP]T[TRca^]XR
2^a^]PeXadb^dcQaTPZ^] X]RXST]cb^UPccPRZP]SaPRXP[
WKH HQWLUH QDWLRQ XQGHU D ORFNGRZQ PRGH cWTR^d]cah³bTR^]^\hPb R^d[SWPeTbPeTS\T0[[^U _[PcU^a\c^TgRWP]VTX]U^a\P SXbRaX\X]PcX^]^]cWT_T^_[T
WKHUHKDVRQO\EHHQRQHFRQILUPHGGHDWKGXH QdbX]TbbPRcXeXcXTbWPeT cWXbWP__T]TSPccWTcX\T cX^]Z]^f[TSVTP]STg_TacXbT ^UcWT=^acWTPbc?<<^SX
R^\Tc^PbcP]SbcX[[ fWT]8fPb^][hPcTT]PVTa c^cPRZ[TcWTb_aTPS^U2^eXS ( \dbccPZTX\\TSXPcTPRcX^]
WRUHVSLUDWRU\LOOQHVVDVVRFLDWHGZLWKWKHYLUXV
DWWKHWLPHRIZULWLQJ+RZHYHUDFFRUGLQJWR =2?RWXTU 0Rc^a B_XaXcdP[[TPSTa <Xi^aP\2<
DQHZVVWRU\HYHUVLQFHWKHORFNGRZQFDPH ¯BWPaPS?PfPa ¯:P]VP]PAP]Pdc ¯3P[PX;P\P ¯I^aP\cWP]VP
LQWRHIIHFWVHYHQSHRSOHKDYHUHSRUWHGO\FRP
PLWWHGVXLFLGHGXHWRWKHQRQDYDLODELOLW\RI
DOFRKROLQWKLV6WDWH7KLVOHGWR.HUDOD&KLHI ;4CC4AB C>C74438C>A
0LQLVWHU3LQDUD\L9LMD\DQDOORZLQJWKHVDOHRI
Many of these labourers may
4U`\_idXU]Y\YdQbi
OLPLWHGDOFRKROWRWKRVHSHRSOHKDYLQJZLWKGUDZDOV\QGURPHWKRXJKWKH\PXVW
SURYLGHDGRFWRU·VSUHVFULSWLRQ2QHZRQGHUVKRZWKRVHZKRZDQWOLTXRULQ
3Q^9^TYQ]Q[UQTYVVUbU^SU/ turn out to be “super spreaders”
of the virus much like South
WKH6WDWHZLOOILQGWKHGRFWRUVWRLVVXHWKHPSUHVFULSWLRQVZKHQWKHPHGLFDO PaaXVWc1aPiX[XP]?aTbXST]c9PXa1^[b^]Pa^fPbcWTRWXTU
5
Sir — The Government has made Korea’s “Patient 31,” who unknow-
it clear that it has no plans to VdTbcU^acWXbhTPa³bAT_dQ[XRSPhUd]RcX^]B^^]PUcTa ingly caused the rapid rise in cases.
IUDWHUQLW\LWVHOILVRYHUZKHOPHGWUHDWLQJ&RURQDYLUXVSDWLHQWV0RUHRYHULWLV extend the 21-day lockdown to P]TgRXcTS?aTbXST]c^U0\TaXRP3^]P[SCad\_eXb There’s a possibility that these
TXHVWLRQDEOHLIDPHGLFDOSUDFWLWLRQHULVDOORZHGWRSUHVFULEHDOFRKRODVDPHG slow the spread of Coronavirus. XcTS8]SXPc^VaTTccWTRWTTaX]VRa^fSbX]cWTR^\_P]h workers may have taken the infec-
LFLQHWRWUHDWGHDGGLFWLRQ,WLVQRWMXVW.HUDODDOFRKROVKRSVDUHVKXWGRZQ But the fact remains that in spite ^U ?aX\T <X]XbcTa =PaT]SaP <^SX <TP]fWX[T AXVWc tion to rural India. Chain reaction
of the national lockdown, the fX]VTabX]8]SXPR[P__TSU^acWTT[TRc^aP[eXRc^ah^U1^aXb may trigger the spread of the virus
DFURVVWKHFRXQWU\ZLWKRQO\VRPHSHRSOHOXFN\HQRXJKWRKDYHVWRFNHGXS number of COVID-19 cases in 9^W]b^]X]1aXcPX]P]SRT[TQaPcTScWTUP[[^UcWT;PQ^da to the community stage, which
EHIRUHWKHQDWLRQZHQWLQWRFRPSOHWHORFNGRZQ7KHVLWXDWLRQLVVLPLODUHOVH the country is going up on a daily [TPSTa9TaT\h2^aQh]8cfPbR[TPacWPcaXRW]PcX^]bfTaT will be perilous for India. To
ZKHUHWRRZLWKSDDQDQGFLJDUHWWHVKRSVVKXWLQPRVWSODFHV2QFHDIORXU basis. The numbers may yet be X] cWT UXa\ VaX_ ^U cWT AXVWcfX]V FWT] cWT =^eT[ ensure its prevention, the migrants
tiny compared with those in the 2^a^]PeXadbfPbb_aTPSX]VaP_XS[hX]FdWP]P]S7dQTX should be thoroughly screened at
LVKLQJWUDGHIRUUHFUHDWLRQDOSXUSRVHVWKHVDOHRIDGGLFWLYHGUXJVLVDOVRLQ US, Italy and Spain but health _a^eX]RTbX]2WX]PcWTSaTPSTS_P]ST\XRfPbSXb\XbbTS the places of arrival and put to
ORFNGRZQZLWKRWKHUYLFHWUDGHVHTXDOO\EDGO\KLW%XWQRWJHWWLQJ\RXUGDLO\ experts have warned that India, Pb cWPc R^d]cah³b _a^Q[T\ P]S eXTfTS Pb Xcb ]T\TbXb _T^_[T[XeX]VX]cWTbT]PcX^]b quarantine in public hospitals at
GRVHRIZKDWHYHU\RXUYLFHLVVKRXOGQRWEHDQRSSRUWXQLW\WRPRSHRUPRDQ the world’s second most populous 1^[b^]Pa^SXb\XbbTSXcPb\TSXP°WhbcTaXP±P]SRP[[TScWT FXcWcWTX]bT]cXT]cP_^bc[Tb^UR^fdaX]TPbcWTcWTa their native place by the State
nation, faces a tidal wave of X[[]Tbb°P[Xcc[TU[d±4eT]fWT]2>E83 (RPbTbP__TPaTS P_hc^UXVWccWTSaTPSTSeXadb8]SXPc^^fPbX]cWTSP] Governments.
:KHWKHULWLVQRWKDYLQJ\RXUGDLO\SDFNRIVPRNHVRUWZRSHJVRIZKLVN\ infections if tough steps are not c^QTbdaVX]VWTQaPiT][haT\PaZTS°8³\b^aahb^\T_T^ VTa^UT\QaPRX]VcWTRP[P\Xch8cXbc^cWTRaTSXc^U?aX\T Umang Srivastava
PD\EHSHRSOHZLWKDQDGGLFWLRQVKRXOGXVHWKHFRPLQJFRXSOHRIZHHNVFRQ taken. In the light of this, it is _[TfX[[SXTcWThfX[[SXTcWPc³b[XUT±P]S°h^dRP]³cbc^_ <X]XbcTa<^SXcWPcWTRW^bTc^fP[ZPfPhUa^\bcd_XScP[Zb Agra
VWUXFWLYHO\DQGWU\DQGZHDQWKHPVHOYHVRIIWKHP2QHZRXOGQRWPDNHDQ essential that the lockdown be PRPaUPRc^ahQTRPdbT^UcaPUUXRSTPcWb±4gWXQXcX]VRaPbb P]SP]]^d]RTSP]PcX^]P[[^RZS^f]CWTUX]P]RXP[_PRZ
enforced with military precision X]bT]bXcXeXchP]S[PRZ^U°QPbXRWd\P]T\_PcWh±Cad\_ PVTcWPcU^[[^fTSfPbcX\T[hP]S]TTSTS<^SXWPb]^f
DUJXPHQWWRTXLWEXWDWWHPSWVPXVWEHPDGHWRUHGXFHFRQVXPSWLRQ,WVKRXOG to prevent the pandemic from aTb_^]STSfah[h°CPZTcWT[XeTb^UcWT^[SP]ScWTfTPZ) bW^f] fX[[X]V]Tbb c^ f^aZ fXcW ^cWTa BcPcTb Pb fT[[ 8U\`dXUg_b[Ubc
QRWEHFRPHWKHFDVHWKDWWKHGD\WKHORFNGRZQHQGVHYHU\ERG\UXVKHVWR entering Stage-III. 8fP]ccWT\^]Th±2>E83 (WPbQTR^\TP]XVWc\PaT 7^fTeTa[Xcc[TXbZ]^f]PQ^dccWT_aT_PaTS]TbbX]cWTR^f
WKHOLTXRUVWRUHWRJHWWKHPVHOYHVVRPHEHHU In a bid to stop the commu- X]cWTDBfXcW\^aTcWP]^]T[PZWX]UTRcTSP]ScW^dbP]Sb QT[cCWTfPaPVPX]bc2^a^]PXbbcX[[]^cf^]QdccWTR^d] Sir — Despite the Prime
7KLVQHZVSDSHUXQGHUVWDQGVWKDWVRPHLQGLYLGXDOVZRXOGKDYHEXLOWXSD nity transmission of the virus, the STPSCWTD:6^eTa]\T]c\PSTP]X]RaTSXQ[TP]]^d]RT cahP]SXcb "QX[[X^]_^_d[PcX^]RP]X[[PUU^aSc^[^bTXc Minister’s appeal to the business
Government has ordered the \T]ccWPcXcf^d[S]^cT]R^daPVTb^RXP[SXbcP]RX]VP]S 7PaXSPbP]APYP] community to not retrench
SK\VLFDODGGLFWLRQWRGUXJVRUDOFRKRO6XFKSHRSOHPXVWEHKHOSHGLQVXFK sealing of all State and district f^d[S]^cX\_^bT[^RZS^f]FTRP]^][h_aPhU^acWT :^iWXZ^ST employees, many labourers have
WLPHVEXWWKHV\VWHPMXVWOLNHWKDWIRUEHLQJRXWLQSXEOLFPXVWQRWEHDEXVHG borders in an attempt to prevent been left in the lurch. Their
$QGWKDWLVIRUWKHDGGLFWLYHVXEVWDQFHVDYDLODEOHOHJDOO\WKHLOOHJDOGUXJVPXVW the exodus of migrant workers plight calls for urgent comprehen-
from the cities to the villages. This and shelter, the task ahead for Central and State levels, cannot sive action. It’s the Government’s
EHIOXVKHGRXWRI,QGLD1RZZLWKWKHERUGHUVFORVHGDQGIOLJKWVHIIHFWLYHO\EDQQHG is welcome but this move should them is not easy. Lakhs and lakhs 6\YWXd_V\QR_eb be ignored. If the relief measures duty to mitigate their sufferings.
WKHLQIORZRIVXFKKDUPIXOVXEVWDQFHVKDVFRPHWRDQHQG2IFRXUVHWKLV have come immediately after the of workers will have to be quar- announced now were on display Juhi Singh
ZLOOQRWVWD\WKHFDVHIRUHYHU7KHPRPHQWWKLQJVRSHQXSSHRSOHZLOOJREDFN declaration of the lockdown. antined. The paramilitary forces Sir — The migration of workers at the time of the lockdown, Via email
Now that the State Governments and the Army must be deployed. from big cities to the villages was labourers may have stayed put.
WRWKHLUROGZD\V%XWHYHQWKHQFRQVXPLQJDELWOHVVPD\QRWEHDEDGWKLQJ have started acting by reaching MC Joshi unexpected. The tragic failure of That a humanitarian crisis could BT]Shh^daUUTTSQPRZcc^)
IRUDOOLQYROYHG,ISHRSOHFDQWDNHWKLVWLPHWRTXLWDOOWKHEHWWHU out to the workers with food, aid Lucknow the administration, both at the unfold isn’t a distant possibility. [TccTabc^_X^]TTa/V\PX[R^\
P]P[hbXb
=4F34;78kCD4B30H k<0A27" !!
gggTQY\i`Y_^UUbS_] &
58ABC2>;D<=
7__Td_Rebi @?9>D2>D=C4A@?9>D
dXUXQdSXUd 8A4@D4BC24;41A8C84BC>BC>?1><10A38=6DBF8C7
F>A:>DCE834>BH>D0A4?A8E8;46431DCF470E4
<09>A2>=24A=B3DA8=6C78B?0=34<82
4G4A28B8=6=>C?DCC8=6D?E834>B8B<>A401>DC
7>FH>D544;8CA40;;H:44?BA0=E44A0=3<4
6>8=60CC78BC8<48C64CBDBC7A>D67C7430H
0]TfQTVX]]X]VbTT\bc^WPeTQTT]\PSTfXcW
°27>A4>6A0?74A °02C>A
cWTR^]SXcX^]P[aT[TPbT^U1TVd\IXPQhcWT
50A07:70= 344?8:0?03D:>=4
1P]V[PSTbWX6^ecSdTc^cWT2>E83 (^dcQaTPZ
'HVSHUDWLRQDQGGHSULYDWLRQ
:?I55D1 170CC0270A944
$PLGWKHSUHYDLOLQJORFNGRZQWKHDIIOLFWLRQVRIPLJUDQWODERXUHUVDUHEHLQJFRPSRXQGHG
7
KH&29,'RXWEUHDNKDVEURXJKWQHDUO\WKHZKROHZRUOGWR
DVWDQGVWLOODQGLWVLPSDFWRQJHRSROLWLFVKDVJUDEEHGZRUOG
ZLGHDWWHQWLRQ+RZHYHUYHU\OLWWOHFRQVLGHUDWLRQKDVEHHQJLYHQ
GXULQJWKHLUORQJWUHNKRPHDQGVRPHDUHEHLQJEHDWHQXSDQGWRUWXUHGE\SROLFH
WRWKHLPSDFWRIWKHSDQGHPLFRQDFRXQWU\·VLQWHUQDOSROLWLFV$PLG
DOOWKHJORRPDQGGRRP%DQJODGHVKLVWKHILUVWFRXQWU\LQ6RXWK
$VLDRUSHUKDSVWKHZRUOGZKHUHWKHVSUHDGRIWKHSDQGHPLFKDV
KDGDSRVLWLYHLPSDFWRQWKHQDWLRQ·VSROLWLFV
7KH ULYDOU\ EHWZHHQ WKH WZR PDMRU SROLWLFDO SDUWLHV RI
%DQJODGHVKLVOHJHQGDU\DQGWKHIDFWWKDWWKHUXOLQJ$ZDPL/HDJXH
$/DQGWKH2SSRVLWLRQ%DQJODGHVK1DWLRQDOLVW3DUW\%13KDYH
QRORYHORVWIRUHDFKRWKHURUHYHQDFRPPRQPHHWLQJJURXQGLV
QRVHFUHW+RZHYHUDIHZGD\VDJRNHHSLQJDVLGHSROLWLFDOULYDOU\
WKHUXOLQJ$/*RYHUQPHQWUHOHDVHGWKHDLOLQJ%HJXP.KDOHGD=LD
FKDLUSHUVRQRIWKH%13DQGWZRWLPHIRUPHU3ULPH0LQLVWHUIURP C9=9 21<G1>D 1B:E>
SULVRQRQKXPDQLWDULDQJURXQGV7KHOHDGHUZDVIUHHGIRUVL[PRQWKV <47C0 <47C0 :D<0A
WRDOORZKHUWRXQGHUJRXUJHQWPHGLFDOWUHDWPHQW f the pitiful sight of a father walking with his ten-
=LDZDVVHUYLQJDILYH\HDUSULVRQWHUPIROORZLQJKHUFRQYLF
WLRQLQDFDVHRIILQDQFLDOPLVDSSURSULDWLRQUHODWHGWRDFKDULWDEOH
RUJDQLVDWLRQQDPHGDIWHUKHUKXVEDQGDQGIRUPHUPLOLWDU\GLFWDWRU
I month-old infant on his shoulders, for over 100
km in this heat to reach his hometown, does not
shake us, then it raises serious doubts about human-
*HQHUDO=LDXU5DKPDQ7KHUHOHDVHRI%HJXP=LDZDVZHOFRPHG ity and its future. If the death of a 38-year-old work-
E\WKHSHRSOHRIWKHFRXQWU\DQGUDLVHGQHZKRSHVIRUDWUDQVIRU er after walking for 200 km and the predicament of
PDWLRQRIWKHFRXQWU\·VELFNHULQJSROLWLFVIURPRQHWKDWLVPRUHLVVXH tens of thousands of jobless, shelterless, hungry, thirsty
EDVHG%HJXP=LDLV\HDUVROGDQGLVVXIIHULQJIURPPXOWLSOHFKURQ and helpless migrant workers yearning to return to
LFDLOPHQWVOLNHGLDEHWHVDQGDUWKULWLV7KH%13KDGEHHQFODLPLQJ their villages amid the rapidly proliferating
WKDWKHUKHDOWKZDVGHWHULRUDWLQJDQGKDGEHHQVWUHVVLQJRQWKHXUJHQF\ Coronavirus outbreak and the resultant countrywide
lockdown, does not receive our empathy, then
IRUKHUUHOHDVHIRUWUHDWPHQW(DUOLHUKHUEDLOSHWLWLRQZDVGHQLHGDQG humanity’s opportunism is well-established.
WKH%13·VSOHDWRWKH*RYHUQPHQWIRUKHUUHOHDVHZDVDOVRRYHU Amid the prevailing threat of the contagion, the
ORRNHG1RZSUHVXPDEO\WKHVSUHDGRIWKH&RURQDYLUXVKDVVLJ afflictions of the voiceless poor are being compound-
QLILFDQWO\FKDQJHGWKH$/*RYHUQPHQW·VDSSURDFKRQWKHLVVXHDQG ed and some are being beaten up, tortured, made to
%HJXP=LDZDVUHOHDVHGDIWHUFRPSOHWLQJKDOIRIKHUVHQWHQFHLH do sit-ups, locked up in overcrowded makeshift pris-
WZRDQGDKDOI\HDUV ons, while others are being punished through other
$QDO\VLQJWKH*RYHUQPHQW·VPRWLYHEHKLQGWKHGHFLVLRQWRIUHH “innovative” ideas of violence, by those who are sup-
WKHLQFDUFHUDWHGOHDGHUSROLWLFDOREVHUYHUVRIWKHFRXQWU\RSLQHWKDW posed to protect the people, the police.
FRQVLGHULQJKHUDGYDQFHGDJH%HJXP=LDEHORQJHGWRWKHPRVWYXO If the authorities have become thankless to the
QHUDEOHJURXSRISHRSOHZKRFRXOGEHDIIHFWHGE\WKH&RURQDYLUXV extent that they have forgotten the contribution of
informal workers towards the growth of the econ-
DQGWKH*RYHUQPHQWZDQWHGWRDYRLGDQ\XQSOHDVDQWVLWXDWLRQFRQ omy, here are some insights: India’s labour market
FHUQLQJKHU/LNHRWKHUFRXQWULHVWKH&RURQDYLUXVKDVVSUHDGLQ is dominated by informal employment and consti-
%DQJODGHVKWRR7KHUHKDYHEHHQFRQILUPHGFDVHVDQGILYHSHR tutes 90 per cent of the total workers involved. Out
SOHKDYHDOUHDG\GLHG7KHKXJHLQIOX[RIH[SDWULDWHVIURPYDULRXV of the total 47.1 crore workers in 2017-18, the num- 8=;867C>5C74
QDWLRQVKDVLQFUHDVHGWKHULVNIDFWRUIRUWKHFRXQWU\KHQFHWKH ber of informal workers stood at 42.4 crore. They con- F>AB4=8=6 that led to the generation of such an idea the shutting down of their sources of ponent of Shelter for Urban Homeless
*RYHUQPHQW·VFRQFHUQ+RZHYHUWKHUHDUHFRQGLWLRQVDWWDFKHGWR tributed almost 50 per cent to the national income B8CD0C8>=3D4 is further amplified by hiring big private employment, seem to have been forgotten. (SUH) to meet the decent space and shel-
%HJXP=LD·VUHOHDVHDQGUHVWULFWLRQKDVEHHQSXWRQKHUWUDYHODEURDG as per a Confederation of Indian Industries’ report.
C>2>E83 ( consultants as project monitoring units, As the country is bracing for an eco- ter requirements along with catering to the
*LYHQWKHVWULFWERUGHUFRQWUROVSXWLQSODFHE\PRVWQDWLRQVDIWHU The rise in urbanisation is a consequence of having a “corporate-style target achieve- nomic bloodbath with loss of millions of shelter needs of women, children, the
demographic explosion and poverty-induced rural- 8=5>A<0C8>= ment attitude.” Further, the inconsiderate jobs and scramble for food and water for elderly, persons with disabilities; commu-
WKHRXWEUHDNRIWKHSDQGHPLFDQGEDQQLQJRIIRUHLJQHUV·HQWU\LQD 0=3
GHVSHUDWHELGWROLPLWWKHVSUHDGRIWKH&RURQDYLUXVVXFKUHVWULF urban migration. As per the estimates of the approach of the authorities during times survival and the impending scorching nity kitchens; medical help; in-kind assis-
Economic Survey, 2017, the magnitude of inter-State 2><<D=820C8>= of economic slowdown, when the migrant summer, these migrant workers would be tance through public distribution systems,
WLRQVE\'KDNDKDUGO\PDNHDQ\PDMRUGLIIHUHQFH migration in India was 90 lakh annually between C427=>;>6H workers are the hardest hit, is evident from the hardest hit once the infection starts to water and toilets. This must be developed
%HJXP=LDZLOOEHFRQILQHGWRKHUUHVLGHQFHLQ'KDNDDQGZLOO 2011 to 2016, while total internal migration was about 0=3A4B40A27 the meagre increase in the budgetary allo- spread among them. The poverty and suf- with service-level benchmarking standards
EHWUHDWHGE\%DQJODGHVKLGRFWRUV*LYHQWKDWVRFLDOGLVWDQFLQJLV 13.9 core. If this trend continues, the total number 0=330C0 cation for DAY-NULM vis-à-vis the flag- fering of all those dependent upon them to combat pandemics like COVID-19. This
EHLQJFRQVLGHUHGDVWKHPRVWRSWLPDOSUHYHQWLYHPHDVXUHDJDLQVW of migrants would be around 21.1 crore by 2020-end. 0=0;HC82B<DBC ship schemes of the Ministry of Housing will increase due to the lack of a source of is not a daunting task and only requires
WKHVSUHDGRIWKHFRQWDJLRQKHUSUHVHQFHLQWKHFRXQWU\LVQRFDXVH Uttar Pradesh (UP) and Bihar are the two biggest 1470A=4BB43 and Urban Affairs (MoHUA). It was income. Plus, home isolation will be dif- passion and keenness of the authorities.
IRUZRUU\IRUWKH$/*RYHUQPHQWDVKHUSDUW\DQGVXSSRUWHUVFDQ source States, closely followed by Madhya Pradesh, 8C <DBC 14<034 C750 crore (in 2019-20) and was raised by ficult to attain as large families live in small, In light of the worsening situation due
QRWGHULYHDQ\PLOHDJHRXWRILWLQWKHVHWLPHVRIORFNGRZQV Punjab, Rajasthan, Uttarakhand, West Bengal and only six per cent to C795 crore in 2020-21. closely-packed houses in areas of high pop- to COVID-19, information and commu-
C>F>A:8=
7KHUHOHDVHRI%HJXP=LDKRZHYHUUDLVHGVRPHVFHSWLFLVP the Union Territory of Jammu and Kashmir. On the
C0=34<F8C7
The deep-seated contentions in DAY- ulation density. This will add to the bur- nication technology (ICT) and research
DERXWKHUSDUW\·VDVWXWHQHVVLQOHYHUDJLQJWKHVLWXDWLRQWRULVHDJDLQ other hand, the main destination States are Delhi, NULM do not stop here. Several private den of the already inept public healthcare and data analytics must be harnessed and
Maharashtra, Tamil Nadu, Gujarat, Andhra Pradesh C74 players and NGOs have been roped in to system and ultimately impact the private made to work in tandem with the
SROLWLFDOO\0RVW%DQJODGHVKLVDUHKRSLQJWKDWDPLGWKHFXUUHQWVLW 6>E4A=<4=C>=
and Kerala. carry out different implementation func- and the public sector and hit their bottom- Government on a war footing to ensure
XDWLRQDQGLWVFULWLFDOLW\JOREDOO\DQGQDWLRQDOO\WKHSROLWLFDOSDUWLHV Most workers had migrated in search of liveli- 0F0A5>>C8=6 tions for which they have tendered huge lines and profits. that comprehensive efforts being under-
RIWKHFRXQWU\ZLOOQRWSUHFLSLWDWHDQ\SROLWLFDOFULVLVRUXQUHVWDQG hood and were involved in low-paying informal work C>4=BDA4 sums of money. The irony is that these Some of the immediate steps for con- taken to test, trace, treat and combat the
DFWUHVSRQVLEO\$Q\HIIRUWE\WKH%13WRFDSLWDOLVHRQWKHVLWXDWLRQ in urban destinations in sectors such as construc- 2><?A474=B8E4 agencies are bearing the brunt of corrup- taining the spread of Coronavirus and sav- pandemic reach all sections of society,
ZLOO EH FORVHO\ ZDWFKHG E\ WKH FRPPRQ PDQ DV ZHOO DV WKH tion, hospitality, textiles, manufacturing, trans- 455>ACB148=6 tion in the bureaucratic system leading to ing the lives of informal workers are as fol- including the vulnerable and poor migrant
*RYHUQPHQWWRSUHYHQWDQ\XQWRZDUGVLWXDWLRQLQWKHVHFULWLFDOWLPHV portation, services and domestic work. Lacking any D=34AC0:4=C> deferred payments for months and years lows. The administration must work with workers. This approach will go a long way
$SDUWIURPKHOSLQJLQWKH*RYHUQPHQW·VFRQFHUWHGILJKWDJDLQVW social or income security, they are not only exploit- C4BCCA024 even after fulfilling their work assignments various State Governments to arrange dis- in ushering in BR Ambedkar’s egalitarian
WKHSDQGHPLFSROLWLFDOVWDELOLW\ZLOODOVRFRQWULEXWHLQVWUHQJWKHQLQJ ed, ignored and disrespected by their employers but CA40C0=3 punctually. The complacency in the trict-wise special sanitised trains and ethos in the country, upon which the
WKHFRXQWU\·VUHODWLRQVKLSZLWKLWVQHLJKERXUVHVSHFLDOO\,QGLDZLWK also by the political class, as they hardly translate into
2><10CC74
approach of the various projects sanctioned buses to send the workers to their respec- Constitution of India rests.
ZKLFKLWVKDUHVWZRWKLUGVRILWVERUGHU0RUHRIWHQWKDQQRWWKH votes. With their livelihood threatened by the lock- under DDU-NULM has remained with- tive homes. These means of transport must To conclude, as the predictability of life
down and future uncertainties, no wonder they are ?0=34<82A4027 out any independent third-party monitor- be equipped with non-perishable food is increasingly being compromised, the vir-
ELODWHUDOUHODWLRQVEHWZHHQ1HZ'HOKLDQG'KDNDKDYHEHHQDYLF 0;;B42C8>=B>5
forced to tread the long road to their hometowns and ing and evaluation. items and water for the passengers. tuous unity of a decisive leadership, mass
WLPRIWKHULYDOU\EHWZHHQWKHWZRSROLWLFDOSDUWLHV,WKDVEHHQXVHG villages on foot. C74B>284CH Given that the Government did its best A pre-boarding health check-up must cooperation and mutual trust will win the
E\WKHWZRSROLWLFDOSDUWLHVWRFULWLFLVHHDFKRWKHU1RUPDOO\,QGR At this moment of crisis, coupled with their 8=2;D38=6C74 to arrange special flights across the globe be done and those showing any COVID- fight against the Coronavirus and flatten
%DQJODWLHVDUHSHUFHLYHGWREHDWWKHLUEHVWGXULQJWKH$/·VUXOHQHY enforced alienation from the cities, they might not ED;=4A01;40=3 to bring back well-heeled citizens, it is 19 symptoms must be prohibited from the curve in India. It is high time that edu-
HUWKHOHVV,QGLDKDVDOZD\VPDLQWDLQHGDFRUGLDOZRUNLQJUHODWLRQ even know if they are also Coronavirus vectors. It ?>>A<86A0=C unfortunate that it has turned a blind eye travelling and referred to the nearest cated Indians, those at the helm of the
VKLSZLWKWKH%13UHJLPHWRR%XWLWLVDOZD\VDWLJKWURSHZDONIRU can only be hoped that amid the thousands walk- F>A:4AB to the plight of the migrant workers. This Government hospital. Government, the private sector and civil
WKHPDQGDULQVLQWKH0LQLVWU\RI([WHUQDO$IIDLUV3ROLWLFDOVWDELOLW\LQ ing alone or with families, children or lining up at only represents the deep-rooted systemic If the transport cannot be organised, society organisations show some sensitiv-
%DQJODGHVKLVDOVRDFKHULVKHGGUHDPRI,QGLDDVLWHQKDQFHVWKH shelters and bus stations, with no practical scope for contempt and neglect of the vulnerable and decent accommodation with food, water ity and generosity and arrange for a safe
ZHOOEHLQJRIWKHSHRSOHRIWKHFRXQWU\DVWKLVDGGVWRWKHUHJLRQ social distancing, there is no one in the crowd who the poor. and sanitation must be arranged. The transit and compulsory 14-day quarantine
DOSURVSHULW\DQGVHFXULW\ is infected. If it is otherwise, India would become the Though a delayed announcement, hotels, guest houses, stadiums, expo cen- of migrant labourers in their respective
+XPDQLW\LVSDVVLQJWKURXJKWKHELJJHVWFKDOOHQJHRIWKHFHQ new epicentre of the outbreak in no time at all, thanks there is no denying that the nationwide tres and so on must be made available. At States. Testing times like these and the
to our inept healthcare system and infrastructure. lockdown is the need of the hour. However, present, nobody is using them anyways. brewing humanitarian crisis will either
WXU\DQGWKHILJKWDJDLQVW&29,'GHPDQGVFRRSHUDWLRQRIDOO+RSH
Add to this forced exodus the fact that the Deen the decision should have been accompa- Devise and implement an immediate solidify the trust of the people in the
WKHSROLWLFDOSDUWLHVLQ%DQJODGHVKZLOOMRLQKDQGVLQILJKWLQJWKLVFUL Dayal Antyodaya Yojana-(DAY-NULM), which nied with a well-crafted draft strategy for monetary compensation plan through cash Government or establish the narrative that
VLVDQGFUHDWHDQHZKLVWRU\WKDWZLOOFRQWULEXWHLQHQKDQFLQJWKH could come to the rescue of these workers, suffers each and every section of this diverse coun- and direct incentives for the circular and the latter exists not for them but just to use
VDIHW\ DQG SURVSHULW\ RI WKHLU QDWLRQ 7KLV ZLOO DOVR HQKDQFH from several inherent challenges. For instance, for try. Unfortunately, as time unfolded, there seasonal migrant workers who have lost them.
%DQJODGHVK·VJOREDOLPDJHDVWKHZRUOGKDVVWDUWHGWDNLQJQRWLFH the last 18 months the Government has been mulling was no such strategy. However, while their jobs. This must be done on an urgent (Simi Mehta is CEO and Editorial
RILWGXHWRLWVLPSURYHGDQGJURZLQJHFRQRP\ over the idea of outsourcing the upkeep of the liveli- ordering everyone to stay at home during basis by at least tripling the budgetary allo- Director, Balwant Mehta is Co-Founder and
7KHZULWHULV6HQLRU)HOORZDWWKH2EVHUYHU5HVHDUFK)RXQGDWLRQ hood mission to corporates and philanthropic the lockdown period, the homeless and cation of DDU-NULM and immediate Visiting Senior Fellow and Arjun Kumar is
9LHZVH[SUHVVHGDUHSHUVRQDO institutions. This implicit failure of the Government those who would be rendered homeless by transfers. Expand the DDU-NULM com- Director, IMPRI)
(PSOR\KLJKWHFKIRUFOLPDWHFKDQJHDGDSWDWLRQ
:UIUSHGZZNKOSVGIZULMRUHGR]GXSOTMOZOY\OZGRZUOSVXU\KOTTU\GZOUTOTVXU\OJOTMY[VVUXZLUXTK]ZKINTURUMOKYOTZNK]GZKXYKIZUXOTJK\OYOTM
OTTU\GZO\KOTYZX[SKTZYLUXKTNGTIOTMMXU[TJ]GZKXYZUXGMKGTJKTY[XOTMGIZO\KVGXZOIOVGZOUTUL\GXOU[YYZGQKNURJKXYOTIR[JOTMZNKVXO\GZKYKIZUX
snowfall during winters. Each of States showing a decrease in annual is 240 m3 in the Sabarmati basin in always a sustainable option. In that for the adaptation to climate change strong impetus, which has the poten-
these phenomena influences the rainfall are Uttar Pradesh (UP), western India. case, enhancing the groundwater impacts. The entire spectrum of tial to provide sustainable water
water resources on Earth. Maharashtra, Madhya Pradesh and The impact of climate change on storage should be a viable option. adaptation technologies in the water sources at the local level. This tech-
Glaciers form an integral part of Karnataka, while West Bengal, India’s water resources presents a Interestingly, technologies play a sector in India needs to focus on nology also saves groundwater
India’s water resource system. Over Gujarat and Bihar are showing an major challenge for the success of significant role in minimising water these “three Rs”. To reduce the resources. Also, for the success of
9,000 glaciers are the sources of major increasing trend in annual rainfall. Government schemes like Jal Jeevan variability to climate change impacts. wastage of water, the efficiency of programmes like Jal Jeevan Mission,
Indian rivers like the Indus, the UP, the most populous State of Mission and achievement of the The UN recognises that technologies water usage needs to be improved — the focus should be on conservation
Ganga and the Brahmaputra and India, is now receiving reduced rain- United Nation’s (UN’s) Sustainable for adaptation could be either in the especially in the agriculture sector and utilisation of “green water”,
thousands of their tributaries. fall in all seasons while Bihar and Development Goals of ensuring uni- “hard” form, involving materials or (water use efficiency in this sector is which is the precipitation that is
Meltwater from glaciers sustains West Bengal, two of the most versal access to safe drinking water. equipment, or in the “soft” form, like about 38 per cent), which is the absorbed by soil and plants and sub-
CI1=1< C8B5CD8 river flows during the summer and densely-populated States of the coun- Changes in precipitation will have a diverse forms of knowledge, new biggest consumer of water. Changes sequently returned to the atmosphere
B0A:0A C0H0; ensures year-round water availabil- try are receiving increased rainfall in significant influence on the design of insurance schemes or crop rotation in cropping patterns, crop rotation as through plant transpiration.
ity in these river basins. With increas- almost all the seasons. hydrological structures, flood and patterns. well as efficient drip and sprinkler For climate change adaptations,
he disastrous effects of human- ing temperature, enhanced melting Although India has 1.91 drought management and urban Also, for efficient adaptation to technologies, need to be adopted on it is essential to improve innovation
8=@32=4@C@?2G:CFD562E9E@==$&<
C@19>µC8?C@9D1<C1D2B51;9>7@?9>DEC39D95C2B135
8C0;H ¯ &&(STPcWbP]S 05?0?Q ?0A8B<03A83 flags were lowered in a day of people around the world have 11,000. In a situation unimag- navirus causes mild or moder-
(&%'(RPbTb mourning Monday as Spain become infected and over inable only a month ago, Italian ate symptoms, such as fever
ore than 7,27,080 cases of raced to build field hospitals to 35,000 have died, according to officials were cheered when and cough. But for others,
B?08=¯&"#STPcWb^dc^U
'$ ($RPbTb M infection and 35,000
deaths have been recorded in
treat an onslaught of coron-
avirus patients.
a running count kept by Johns
Hopkins University. The US
they reported only 756 deaths
in one day. The country said
especially older adults and
people with existing health
278=0¯""#STPcWbP]S
' #&RPbTb 183 countries and territories In the US, the reported over 1,40,000 infec- the number of deaths has problems, the virus can cause
since the coronavirus epidem- Government’s top infectious- tions and more than 2,500 dropped about 10 per cent a severe symptoms like pneu-
DB ¯!% %STPcWbP]S #$$" ic started in China in disease expert warned that deaths, with New York City the day since Friday. “We are sav- monia. More than 1,50,000
8A0= ¯!&$&STPcWbP]S December, according to an smaller cities are about to see worst hot spot. ing lives by staying at home, by people have recovered, accord-
# #($RPbTb AFP tally compiled on Monday cases “take off ” the way they Spain overtook China in maintaining social distance, ing to Johns Hopkins.
5A0=24 ¯!%%STPcWbP]S based on official sources. have in New York City. reported coronavirus infections by traveling less and by closing In Italy, coronavirus patient
# &#RPbTb As bells tolled in Madrid’s A US Navy hospital ship as the outbreak stretched scores schools,” said Dr Luca Richeldi, Andrea Napoli, 33, said he did-
deserted central square and with 1,000 beds arrived in New of Spanish hospitals to their a lung specialist. n’t remotely expect that he
York to help relieve the crisis breaking point. With a popu- At least six of Spain’s 17 would be hospitalized, strug-
gripping the city. The USNS lation of 47 million people to regions were at their limit of gling for his life, since he was
Comfort — also sent to New China’s 1.4 billion, Spain saw its intensive care unit beds, and young and fit. But what he saw
York City after 9/11 — will be official tally of infections climb three more were close to it, shocked him. While he was
used to treat non-coronavirus past 85,000. It also reported authorities said. Crews of work- being treated in Rome, three
patients while packed hospitals over 800 new deaths, for an ers were frantically building patients died in his ward. He saw
deal with those with COVID-19. overall toll of more than 7,300. more field hospitals. doctors stressed and exhausted
In Japan, officials Experts say those figures — Nearly 15 per cent of all from the long hours, out of
announced a new date for the and those in every other coun- those infected in Spain, almost breath from pushing equipment
2020 Tokyo Olympics — the try — are much lower than the 13,000 people, are healthcare around, dressed in protective
summer of 2021 — as a spike true numbers, because of lim- workers, hurting hospitals’ masks, suits and gloves.
in reported infections fueled ited testing, counting irregu- efforts to help the tsunami of “What I saw was a lot, a lot
suspicions that the larities and mild cases that people gasping for breath. of pain. It was very hard,’’
Government was understating have been missed. Many coro- In hard-hit Madrid, flags Anthony Fauci, director of the “sort of percolating” now. Napoli said. “I heard s
the extent of the country’s out- navirus deaths in Spain and were lowered to half-staff for an National Institute of Allergy “What we’ve learned from creams from the other rooms,
break in recent weeks while it Italy that happen at home or at official mourning period. and Infectious Diseases, said up painful experience with this constant coughing from the
was still hoping to salvage the nursing homes are not even During a minute of silence for to 2,00,000 Americans could outbreak is that it goes along other rooms.’’
Summer Games. counted. the dead, Madrid’s Puerta del Sol die and millions become infect- almost on a straight line, then China on Monday reported
Moscow locked down its Spain and Italy make up square was empty as bells tolled. ed if lockdowns and social a little acceleration, accelera- 31 new COVID-19 cases, among
12 million people as Russia more than half the world’s In the US on Sunday, as distancing did not continue. tion, then it goes way up,” he them just one domestic infection.
braced for sweeping nation- death toll from the virus that deaths in New York state sur- On Monday, Fauci said on said, adding: “We’re going to At the peak of China’s restric-
wide restrictions. has upended the lives of billions passed 1,000, the majority of ABC’s “Good Morning have all of these little mini-out- tions, some 700 million people
And in Britain, Prince and devastated world them in New York City, America” that cities like New breaks throughout various were ordered to stay home, but
Charles, the heir to the throne economies. Their hospitals President Donald Trump Orleans and Detroit are ripe for cities in our country.” those rules are being eased.
who tested positive for the have been buckling under the extended stay-at-home recom- the kind of acceleration that has Lockeddown Moscow Japanese automaker Toyota
virus, ended his period of iso- weight of caring for so many mendations for a month in an occurred in New York City. But accounted for more than 1,200 halted production at its auto
lation and is in good health, his desperately ill patients at once. abrupt turnaround from his he said he is also concerned of the country’s 1,800 or so plants in Europe, but all of its
office said. Italy has by far the most previous stance. about other, smaller cities across coronavirus cases. factories in China resumed
Three-quarters of a million reported deaths, at nearly The move came after Dr the country that are merely For most people, the coro- work on Monday.
$URXQGWKH
:eR]jdVVdd]`hU`h_Z_cReV`W_VhgZcfdTRdVd
0?Q A><4 the last day, bringing Italy’s toll
to 11,591 and maintaining its
real number of Italy’s caseload,
however, is as much as five to
*OREDOORFNGRZQZLGHQV *OREH
05?Q ?0A8B “While the isolation mea-
O CWT]d\QTa^USTR[PaTS
^a^]PeXadbX]UTRcX^]bX]8aP]
c^__TS#^]<^]SPhPb
Iratetaly is seeing
continued slowdown in the
a
,VUDHOL30HQWHUV
<^]SPhbRaP\Q[TSc^_aT_PaT
4ZejReTV_ecV`W that has so far killed at least
35,000 people, infected more
many people scrabbling to sur-
vive on a day-by-day basis.
U^a[^RZS^f]X]bdQBPWPaP]
0UaXRP³bQXVVTbcRXch;PV^bP]S
4YZ_R¶dgZcfd than 700,000 and left two- Africa’s biggest city, Lagos, cWTRP_XcP[0QdYPPbcWT
WHVWHGYHIRU&RYLG
O 6T^aVXPfX[[X\_^bTPVT]TaP[
XcRUfR]]jcVgZgVd US military hospital ship in
New York, to the empty streets
Muhammadu Buhari order-
ing a two-week lockdown for `dPaP]cX]TP]SP]XVWccX\T
RdaUTfc^UXVWccWTR^a^]PeXadb
of European capitals and fears its 20 million people. The mea-
_P]ST\XRcWT1[PRZBTP
0?Q FD70= of a new wave of COVID-19 in sures, in force from 2200 GMT,
]PcX^]³b_aX\T\X]XbcTa
?C8Q 94ADB0;4< Africa, the virus has changed also apply to the capital Abuja.
P]]^d]RTS^]<^]SPh°CWT
hopkeepers in the city at the the face of the world in a few Zimbabwe on Monday also
S centre of the virus outbreak
in China were reopening Ihissraeli Prime Minister
Benjamin Netanyahu and
short weeks.
The march of the coron- 0eXTf^UT\_ch_PaZX]V[^cbX]Ua^]c^UP\P[[X]<^bR^f^]<^]SPh 0?
began enforcing a three-week
lockdown in the impoverished
Sh]P\XRb^UcWTVa^fcWX]]Tf
RPbTb^UcWT2>E83 (SXbTPbT
XbP[Pa\X]V±?aX\T<X]XbcTa
Monday but customers were close advisers have been avirus has also transformed the southern African country. 6X^aVX6PZWPaXPc^[SP]Tfb
scarce after authorities lifted placed under quarantine after sporting and cultural measures... Very seriously and there passing 25,000 on Experts in Germany, R^]UTaT]RT°FTPaTSTR[PaX]VP
more of the anti-virus controls an aide on Parliament affairs calender, with the postponed completely responsibly,” Putin Monday, according to an AFP Europe’s economic power- VT]TaP[`dPaP]cX]TPb^U'P\
that kept tens of millions of tested positive for coronavirus, Tokyo 2020 Olympic Games said after regional authorities tally. Spain, which has the house, said the virus would #6<C±^]CdTbSPh
people at home for two his office said on Monday. announcing that it will open on clamped down because many world’s second biggest death shrink output there this year by SdaX]VfWXRW_T^_[TfX[[^][hQT
months. The step was a precaution July 23 next year. Muscovites were failing to heed toll from the disease after Italy, up to 5.4 percent. _Ta\XccTSc^[TPeTW^\TbU^a
“I’m so excited, I want to and is being taken even before In Russia, President warnings to self-isolate. announced another 812 virus The crisis is also testing the TbbT]cXP[bW^__X]VWTbPXS
cry,” said a woman on the the epidemiological investiga- Vladimir Putin on Monday Red Square in the heart of deaths in 24 hours, although it balance between civil liberties
Chuhe Hanjie pedestrian mall tion has been concluded, urged residents of Moscow to Moscow was eerily empty, was the first decline since on and the need for restrictions to O ?^_d[Pa9P_P]TbTR^\TSXP]
who would give only the according to a statement issued fortnight. The epidemiological respect the lockdown that has while the streets were quiet Thursday. curb the disease. :T]BWX\daPfW^SaTf
English name Kat. She said she by the Prime Minister’s Office. investigation is ongoing,” it seen the closure of all non- even though traffic could still Spain has also joined the Hungary’s parliament on X]b_XaPcX^]Ua^\cWT0\TaXRP]
was a teacher in the eastern city “Even before the epidemi- stressed. essential shops, including be seen on the roads. United States and Italy in sur- Monday endorsed a contro- R^\TSXRXR^]9Taah;TfXbWPb
of Nanjing visiting her family ological investigation is over The statement had also restaurants and cafes, in Coronavirus continues to passing the number of cases in versial bill giving nationalist SXTSUa^\cWTR^a^]PeXadb
in Wuhan when the govern- and to remove all doubt, the emphasised that the prime min- Europe’s largest city. tighten its grip in Europe, China, where the disease first Prime Minister Viktor Orban QTR^\X]V9P_P]³bUXabcZ]^f]
ment locked down the city in Prime Minister has decided ister and those around him have “I ask you to take these which remains the epicentre of emerged in December in the sweeping new powers he says RT[TQaXcheXRcX\^UcWTSXbTPbT
late January to stem the spread that he and his close staff will been strictly adhering to the forced but absolutely necessary the disease with the death toll city of Wuhan. he needs to fight coronavirus. 7TfPb&BWX\daPfW^
of the coronavirus. remain in isolation until the Health Ministry guidelines dur- PccaPRcTSUP]b^UP[[VT]TaPcX^]b
Some 70 per cent to 80 per epidemiological investigation is ing the past few weeks, under the fXcWWXbb[P_bcXRZR^\TShP]S
cent of shops were open
Monday but many imposed
completed,” the statement said.
“In accordance with the
watch of his personal physician,
and that most discussions
GZVe_R^8`gefdVd Ud]]hUPRTbWPSQTT]caTPcTSPc
PC^Zh^W^b_XcP[P]SSXTS^]
limits on how many people findings, the Health Ministry Netanyahu holds are via video- EZ\E`\W`c4@G:5"* Bd]SPhPRR^aSX]Vc^WXb
PVT]Rh8iPfP>UUXRT
could enter. Shopkeepers set up and the personal physician of link from his residence.
dispensers for hand sanitizer the Prime Minister will set a Hebrew language media, Z_W`c^ReZ`_ O 0 #hTPa^[SQ^hfW^
and checked customers for day to end the isolation,” it however, contradicted these P[[TVTS[hR^dVWTS^]Va^RTaXTb
signs of fever. added. Earlier, his office said claims, saying Netanyahu had 80=BQ 70=>8 PbP_aP]ZPcPbc^aTX]cWTDB
Wuhan’s bus and subway “the move was unnecessary” as in fact met with Paluch, along bcPcT^UCTgPbP\XSbccWT
service has resumed, easing the Premier had not been in the with a reported confirmation ietnam’s Ministry of Health R^a^]PeXadbbRPaTWPbQTT]
curbs that cut most access to
the city of 11 million people on
same room as the concerned
adviser, Rivka Paluch, during
from his office.
Paluch, Netanyahu’s advis-
V has launched a TikTok
account in a bid to raise pub-
RWPaVTSfXcWcP\_TaX]VfXcW
R^]bd\Ta_a^SdRcb^UUXRXP[b
Jan. 23 as China fought the the last two weeks. er on ultra-Orthodox affairs, lic awareness about preventive bPXSCWTVa^RTaX]]^acWfTbc
coronavirus. “The initial assessment is tested positive hours after her measures against the coron- 7PaaXbR^d]chRP[[TS( P]S
The train station reopened that there is no need for the husband was hospitalised with avirus pandemic, it was report- aT_^acTSPSXbcdaQP]RT
Saturday, bringing thousands of Prime Minister to be in quar- COVID-19. ed on Monday. U^[[^fX]VfWXRWcWTST_dcXTb
people to what is the manu- antine since he was not in close She met with several law- The move also aims to call PaaXeTScWTbc^aTcWThbPXS
facturing and transportation contact with the patient and did makers on Thursday amid people to follow health rec- O B^dcW:^aTP³b^][X]TU^^SbP[T
hub of central China. not meet with her,” the PMO negotiations with Blue and ommendations and regularly P[\^bcS^dQ[TS[Pbc\^]cWPb
Travel controls on most of earlier said. White leader, Benny Gantz, update related information for R^]bd\TabaTUaPX]TSUa^\
Hubei province, where “Likewise, from an initial over the formation of a coali- TikTok users, Xinhua news \^eX]V^dcbXSTcWTXaW^\TbSdT
Wuhan is located, were lifted check, the two were not togeth- tion Government, according to agency reported citing local c^cWTR^a^]PeXadb_P]ST\XRP
on March 23. er in the same room for the past Channel 12. media as saying. V^eTa]\T]caT_^acaTeTP[TS^]
<^]SPhATeT]dTQh\PY^a
^][X]TaTcPX[TabYd\_TS"#"_Ta
WRKHOSVSHHGYDFFLQHV dYRcVgZcfdZ_W`c^ReZ`_
0f^\P]fTPabPUPRT\PbZc^_a^cTRcPVPX]bcR^a^]PeXadb_PbbTbX]Ua^]c^UVaPUUXcX_PX]cTS^]cWTbWdccTa^UPR[^bTS
aTbcPdaP]cSdaX]VP[^RZS^f]^aSTaQhcWT6aTTZ6^eTa]\T]cc^R^]ca^[cWTb_aTPS^UcWTeXadbX]0cWT]b^]<^]SPh 0?
^UCaPST8]SdbcahP]S4]TaVh
aT_^acPbbPXS
8\aP]^aSTab^_T]X]V^UP[[WXVWfPhbU^aV^^Sbbd__[h
0? Q C>:H> Favipiravir with several other Paris: The United Nations sci- made us aware of the impor-
countries. entific agency UNESCO held a tance of science for both
apan’s Prime Minister Shinzo Japan’s Foreign Ministry virtual meeting with science research and international
J Abe urged the head of the
World Health Organization
says Tedros pledged
WHO’s leadership in the devel-
ministers from 73 countries to
discuss international coopera-
cooperation. This crisis also
shows us the urgency of better
Islamabad: Pakistan Prime
Minister Imran Khan has
committee at the Prime Minister
House on Sunday, Khan reiter-
medical practitioners, including
doctors and paramedical staff
(WHO) to help accelerate opment of medicine, vaccines tion around COVID-19. knowledge sharing.” ordered opening of all nation- ated his commitment to provid- currently performing their duty
development of medicine and and diagnostics. Open science is an issue The meeting, which includ- al highways to ensure smooth ing ration at the doorsteps of the in different hospitals, and inten-
vaccines for the coronavirus by Abe asked Tedros to make UNESCO has been pushing for ed representatives from the and adequate supply of food poor and daily wage earners sive care units (ICUs) and quar-
promoting information use of Japan’s USD 46 million months. The agency’s leader- United States and Israel, items from farms/factories to through a force of young volun- antines had been established
sharing and cooperation contribution to the WHO to ship believes the global pan- addressed reducing the “knowl- markets amid “panic buying” teers he is going to formally form across the country for coron-
among countries. effectively provide technical demic has highlighted the need edge deficit” between coun- due the coronavirus pandem- on Monday, reprts Dawn news. avirus patients. In case of death
Abe told Director-General assistance for health workers in to better share information to tries, strengthening the link ic, it was reported on Monday. The meeting was informed of any of the medical practi-
Tedros Adhanom in a phone developing countries where save lives. UNESCO Director- between science and political While presiding over a that the government had start- tioners during duty, he/she
call that Japan is pursuing clin- COVID-19 cases are sharply on General Audrey Azoulay says decisions and allowing free meeting of the ruling Pakistan ed providing personal protec- would be given a ‘Shuhada’
ical research on flu drug the rise. “the COVID-19 pandemic has access to scientific data. AP Tehreek-i-Insaf ’s (PTI) core tion equipment (PPE) to all (martyr) package. IANS
=4F34;78kCD4B30H k<0A27" !!
2>E83 (>DC1A40:
f^a[S(
AfeZ_e`µac`SRS]jRd\¶W`cdR_TeZ`_d]ZWeZ_X+Ecf^a
05?Q F0B78=6C>= he had put sanctions on Russia not specify which countries he where Washington, supported and argued that US sanctions Crimea in Ukraine and what
but adding, “They don’t like was talking about but Russia is by dozens of other countries, on a Rosneft subsidiary — US investigators say was a con-
resident Donald Trump that. Frankly we should be being hit hard by the econom- has been trying unsuccessful- imposed as part of certed attempt to interfere in
P said on Monday he expects
his Russian counterpart
able to get along.” The two were
due to talk “shortly,” he said.
ic fallout from coronavirus
and a parallel price war with
ly to promote the toppling of
leftist strongman Nicholas
Washington’s attempt to crip-
ple the Maduro Government’s
the 2016 presidential election
won by Trump.
Vladimir Putin to request the Last Thursday, Putin told Saudi Arabia on the oil market. Maduro. Russia is one of the revenue sources — should now Trump has resisted pun-
lifting of US sanctions during G20 leaders during a confer- Trump said he would be few countries propping up his be lifted. ishing Moscow, which denies
an upcoming phone call. ence call that he wanted a discussing the collapse in oil government. However, Russia remains a meddling in US politics, but his
“Yeah, he’ll probably ask for moratorium on sanctions as a prices, which he said is “really “We may discuss that too,” key partner to Caracas. The hand was forced by his own
that,” Trump told Fox News. “matter of life and death” dur- hurting” the US energy indus- Trump said. Russian state oil bulk of US sanctions against Republican party in Congress,
Trump did not say what his ing the global coronavirus out- try. Another point of con- company Rosneft said Saturday Russia were imposed over which sees the Putin govern-
response would be, noting that break. In the comments he did tention could be Venezuela, it is pulling out of Venezuela Moscow’s annexation of ment as hostile.
DRfUZ]VUT`R]ZeZ`_RZcdecZ\Vd DBR[TPa[hS^Tb]´cfP]c=cP[Zb)=:^aTP
YZecVSV]YV]UJV^V_TRaZeR] 0?Q B4>D;
QdbX]Tbb
>Rc\VedVieV_U]`ddVd *OREDORLOSULFHVSOXQJHWR\UORZ
RdgZcfdTRdVddaZ\V 1DC?4CA>;384B4;A0C4BD=270=6438=8=380 ?C8Q =4F34;78
21>;9>769>1>35CD?3;C<51461<< BPdSXc^aPXbT^X[Tg_^acbc^aTR^aS[TeT[bPb_aXRTfPaaPVTb
?C8Q <D<108 cent), Nestle (4.49 per cent), 2009. “As expected, the markets
Ilownternational oil prices on
Monday plunged to a 17-year
but retail petrol and diesel 05?Q A8H037 increase for April, said it will as OPEC+ which included the global economy hard. In an
Axis Bank (2.50 per cent) and have set aside the stimulus prices in India remained on add additional supplies to the Russia. effort to grab market share,
he BSE Sensex crashed over HUL (2.19 per cent). measures announced by the freeze as oil companies con- audi Arabia on Monday global market, deepening a Its Gulf neighbour UAE Saudi Arabia immediately
T 1,375 points on Monday,
pressured by heavy selling in
“Indian markets started
the week on a negative note
RBI and the government, and
focused on the rising virus
tinued to set off gains against
the excise duty hiked by the
Sexports
said it will raise its oil
to a record 10.6 million
glut. “The kingdom plans to
raise its petroleum exports by
has also pledged to pump at
least one million bpd more
announced a substantial
increase in its production to
banking, finance and auto tracking volatile global cues in infections and its impact on the Government. barrels per day starting from 600,000 bpd from May, so from next month. 12.3 million bpd and exports
counters, as sentiment Asian markets as coronavirus- Indian economy. Brent crude futures May, escalating a price war total exports will increase to Riyadh said earlier this to 10 million bpd at the begin-
remained grim amid a steady fuelled volatility gripped glob- “With a global recession dropped to around USD 23 per with Russia. 10.6 million bpd,” said an offi- month it was raising exports to ning of April.
rise in coronavirus cases. al equities and other financial already declared by the IMF, barrel — the lowest since Oil prices are languishing cial at the energy ministry, 10 million bpd in April after a The energy ministry said
The number of Covid-19 markets, with oil prices seen the recessionary forces and the November 2002, while US at 17-year lows as the coron- cited by the state-run SPA production cut agreement it will secure the increase from
cases in India shot past the plunging,” said Narendra general uncertainty are forcing crude briefly dipped below avirus pandemic threatens a agency. among top producers flopped two sources, by using natural
1,000-mark on Monday, with Solanki, Head- Equity Research investors, especially the FIIs, to USD 20 as coronavirus lock- global recession that will send Saudi Arabia had been in early March. gas in the domestic market to
the death toll rising to 29. (Fundamental), Anand Rathi. redeem their investments. CPI downs dried up demand while demand plummeting. exporting around 7.0 million OPEC+ failed to reach an free up oil for export and also
Investors dumped risky Fitch Solutions slashed its for Industrial workers is due the crude surplus ballooned. Saudi Arabia, the world’s bpd under an output reduction agreement on further produc- as domestic consumption
assets after multiple ratings estimate for India’s GDP tomorrow, although it is unlike- Petrol and diesel prices in top oil exporter, which already agreement among a 24-mem- tion cuts to shore up sagging drops because of the coron-
agencies cut India’s growth growth in the fiscal starting ly to have an effect in the cur- India, however, remained on announced a sharp production ber producers’ alliance known prices as the coronavirus hit avirus.
outlook, traders said. April 1 to 4.6 per cent due to rent market scenario,” said freeze for the 14th day in a row.
After plunging over 1,500 weaker private consumption Vinod Nair, Head of Research Rates were last revised on increase. Instead, they kept litre. The BJP-led Government C2 per litre in July 2019. Globally, 100 million bar-
points during the day, the 30- and contraction in investment at Geojit Financial Services. March 16 and since then oil adjusting it against the fall in had between November 2014 The Saudi-Russia oil price rels of oil is normally con-
share BSE barometer ended amid the coronavirus outbreak, BSE realty, finance, bankex, firms continue to adjust the fall international crude prices. and January 2016 raised excise war, combined with the destruc- sumed daily, but forecasters
1,375.27 points or 4.61 per cent costing economies around the auto and telecom indices tum- against the C3 per litre hike in Soon after the excise duty duty on petrol and diesel on tion of demand by the coron- predict as much as a quarter of
lower at 28,440.32. globe. India Ratings and bled up to 7.01 per cent, while excise duty on two fuels done hike, the Government took nine occasions to take away avirus pandemic, has led to the that has disappeared in just a
Similarly, the NSE Nifty fell Research too revised its FY21 healthcare and FMCG ended by the Government. authorisation from Parliament gains arising from plummeting slump in international rates. few weeks.
379.15 points, or 4.38 per cent, GDP growth forecast down to with gains. Broader BSE mid- In Delhi, petrol is priced at to raise excise duty on petrol global oil prices.
to close at 8,281.10. 3.6 per cent from 5.5 per cent. cap and smallcap indices fell up C69.59 per litre while in and diesel by C8 per litre each In all, duty on petrol rate
Bajaj Finance was the top
laggard in the Sensex pack,
The International Monetary
Fund (IMF) had on Friday said
to 2.13 per cent.
Global equities notched
Mumbai it comes for C75.30.
Diesel is priced at C62.29 per
in future.
After the March 14
was hiked by C11.77 per litre and
that on diesel by 13.47 a litre in
Cad\_bPhbc^cP[ZfXcW
tanking nearly 12 per cent, fol-
lowed by HDFC, Tata Steel,
the world has entered a reces-
sion as bad or worse than in
up losses as investors assessed
the economic damage from
litre in Delhi and C65.21 in
Mumbai. The excise duty hike,
increase in taxes, the total inci-
dence of excise duty on petrol
those 15 months that helped the
Government’s excise mop-up ?dcX]^][^f^X[_aXRTb
HDFC Bank, ICICI bank, the virus pandemic. which would give the govern- has risen to C22.98 per litre and more than double to C2,42,000 Washington: President Donald Trump on Monday said he will
ment C39,000 crore additional that on diesel to C18.83. crore in 2016-17 from C99,000
CdVee]Vd(!a
Kotak Mahindra Bank and Bourses in Shanghai, Hong shortly be talking with his Russian counterpart Vladimir Putin
Maruti, which shed up to 10.92 Kong, Tokyo and Seoul ended revenue, could have led to an The tax on petrol was C9.48 crore in 2014-15. It cut excise about plunging oil prices and the impact on US producers.
per cent. Only six Sensex con- in the red. Benchmarks in increase in retail prices by per litre when the Modi duty by C2 in October 2017 and “One of the subjects we’re going to be talking about is ener-
stituents ended in the green, led
by Tech Mahindra (4.94 per
]`hVcRe(&&* Europe were also trading on a
negative note.
C3 per litre each, but the oil
companies did not pass on the
Government took office in 2014
and that on diesel was C3.56 a
by C1.50 a year later.
But, it raised excise duty by
gy,” Trump told Fox News in an interview. He said the phone
call would be “very soon.” The global market is experiencing
RXRZ_de a crude glut as a result of the ongoing price war between Saudi
Arabia and Russia. In the US, “people in the oil and gas busi-
Mumbai: The rupee settled
70 paise lower at 75.59 (pro- 6HELHDVHVSURFHVVLQJ 6Y^=Y^Qc[cRQ^[cd_U^cebU ness are really hurting,” Trump said. AFP
aR_UV^ZTdfcXVd
expected disbursement in Jan demand of people. PTI
1A845B
Bangkok: World markets started the week with
fresh losses as countries reported surging num- <4CA>A?5F>A:8=6C>?A4E4=C0=H8=2834=C
bers of infections from the coronavirus that are
forcing shutdowns of travel and business in
many regions.
Shares fell in London, Paris and Tokyo but
surged 7 per cent in Australia after the govern-
ment promised more recession-fighting stimu-
lus. “We want to keep the engine of our econo-
my running through this crisis,” Prime Minister
Scott Morrison told reporters in Canberra. His
unprecedented $130 billion package includes
wage subsidies of up to USD 1,500 per two weeks
to businesses to keep workers on the job.
US futures yoyo’d throughout Asia’s day but
turned lower. The future for the S&P 500 fell 0.6
per cent while that for the Dow industrials lost
0.8 per cent. Oil prices were lower. :^[ZPcP)<Tca^A?5WPbQTT]f^aZX]VcXaT[Tbb[hc^_aTeT]cP]h
Hopes that a USD 2 trillion US relief bill d]c^fPaSX]RXST]cSdaX]VcWT]PcX^]fXST[^RZS^f]A?5_Tab^]]T[PaT
would ease the economic havoc brought by the ^]WXVWP[Tacc^STP[fXcWP]hT\TaVT]RhP]SP[b^c^TgcT]SWT[_X]V
pandemic did little to alleviate the gloom pre- WP]Sbc^P]hRXcXiT]SdTc^cWXb2>E83 (_P]ST\XR<TSXRP[
vailing in many markets. On Monday, Germany’s 3T_Pac\T]cWPbQTT]^aVP]XbX]V0fPaT]Tbb2P\_PXV]bU^aA?5
DAX was flat at 9,634.00 while the CAC 40 in _Tab^]]T[c^cTPRWcWT\fWccWThbW^d[SS^fWX[TSXbRWPaVX]VcWTXa
Paris lost 1.1 per cent to 4,304.63. Britain’s FTSE SdcXTbPc<Tca^bcPcX^]b7^b_XcP[<Tca^2^[^]XTbPbfT[[Pb2PabWTSb
100 declined 1.7 per cent to 5,415.26. PTI P]S^cWTa^UUXRTbaTVd[Pa[h
=4F34;78kCD4B30H k<0A27" !! eXePRXch
1277+(
SHow do you think podcasts,
films, books around such sensi-
tive topic would help people to
understand the community bet-
27+(5
ter?
3X[YXcc^S^]PcTC! Fida: Until and unless you
know the truth, how will you react
[PZWc^?<20A4B to it? Through this podcast, we
want to convey who transgenders
BX]VTaPRc^a38;98C3>B0=97 actually are. There are too many
WPb_[TSVTSc^S^]PcTC![PZWc^ misconceptions and myths in
[T]Sbd__^acc^cWT^]V^X]VQPcc[T people’s mind. The initiative is to
PVPX]bccWT2^a^]PeXadb_P]ST\ show them the right thing and
XR 4PRWT_Xb^ST^U3TCPP[X°;XUT^UP remove those myths.
Recently, I was on The Kapil
3X[YXcc^^Zc^CfXccTac^\T]
cX^]cWPcWXb_aX^aXchXbc^WT[_cWT CaP]bVT]STaW^bcTSQh5830:70= Sharma Show, its video went viral
on YouTube. I saw somebody’s
R^d]cah
°8\R^\\XccTSc^S^]PcX]V
RdaPcTSP]S_a^SdRTSQhB70<44A comment there — “Here she is
talking so nicely. You should see
C![PZWc^cWT?<20A4B5d]S C0=3>=d]aPeT[bP]STSdRPcTbcWT the way they behave on a train.”
This is the exact mindset that we
>da_aX^aXch]^fbW^d[SQTc^
WT[_^daR^d]cahVTc [XbcT]TabPQ^dcSXUUTaT]cUPRTcb^UcWT want to change through the pod-
cast so that people know about the
cWa^dVWcWXbc^dVWcX\T
C^VTcWTaFT2P]±WT
[XeTb^UcaP]bVT]STabCWXbXbS^]T challenges we face just because we
have a different gender. We are
cfTTcTS cWa^dVWR^]eTabPcX^]bfXcWVdTbcbUa^\ born the same, we feel the same
pain, we are humans too!
°?T^_[TUa^\P[[
fP[Zb^U[XUTTg_aTbbTS ePaXTSQPRZVa^d]SbX]R[dSX]V\TSXRX]T Shameer: This podcast deals
with the details of life of transgen-
cWTXaSTbXaTc^S^]PcT
c^8]SXPbfPaPVPX]bc
[XcTaPcdaTcWTcaP]bVT]STaR^\\d]Xch der, especially in the Indian cul-
tural context. We are hoping that
2>E83 ( P]S\^aT1h0HDB78 B70A<0 there might be a paradigm shift in
ATb_TRcX]VcWPcb_Xa the mindset of people, who will
XccWT?aX\T listen to it as they will understand
their way of life. When they get
<X]XbcTab2XcXiT] disowned by their own families,
0bbXbcP]RTP]SAT[XTU their basic thought process says,
X]4\TaVT]Rh e breathe the same air, idea as it is a medium where one ing that the society can’t provide about the other two genders? “if my family didn’t accept me,
BXcdPcX^]b5d]SWPb
QTT]R^]bcXcdcTSCWXb
fX[[RaTPcTPWTP[cWXTa
W eat the same food and
feel the same way. You
might say we are all equal, right?
can put out one’s thoughts with-
out worrying about what one
wants to actually say because it’s
them. I feel, asking for a shelter is
not a very major thing to do. It’s
been five years and still we have
Childhood is a great time, with-
out doubt to develop their values
and habits, which can define
how will the society?” In the ini-
tial years, we faced a lot of diffi-
culty in gaining their trust. Fida
Unfortunately, that’s far from the more of a conversational format. got nothing. If decriminalisation them for the rest of their lives. If very well pointed that — inko
8]SXP±?<<^SX truth. There are many communi- That’s how it was conceived. The would have made a difference, we proper values are taught to chil- cheezein maangne se hi milti hai.
cfTTcTS^] ties that are treated differently, first season is already out with five would have been successful in get- dren, they will surely be able to But our idea was to give them
BPcdaSPh unequally, and at times even episodes. Another five are on ting something as basic as an apply them when they grow up. legitimacy through a platform
harshly. One such community is their way. ashram. More stories surrounding trans- for singing, speaking and doing all
that of transgenders, the world’s ³2WX[SW^^SXbP genders can be added in their of that. So it took time but now we
³8c´bP\PccTa^U third gender. While some progress SDo you think the decriminal-
VaTPccX\Tc^
SThe podcast seems to talk books. Won’t they learn better and are absolutely aligned and in
has been made to improve their isation of homosexuality has about various aspects of the life keep it in their minds forever? We sync.
VaTPc_aXSTU^a social situation, there are many opened the doors for several STeT[^_cWTXa of trans people. One being that would certainly face lesser ques- When anybody asks me what
P]hPRc^afWT] real-world truths and stories we changes to be introduced like there are not enough opportuni- tions. It would eventually lead to was the biggest challenge in bring-
are unaware of. Stories of what the marriage, medical, adoption and eP[dTbfWXRWRP] ties for them when it comes to a better world that would live and ing this piece together? It was def-
WXbWTaf^aZ
bcaXZTbPRW^aS
community faces every day and inheritance laws for the STUX]TcWT\U^a healthcare, education or other grow with us, knowing that we are initely winning their faith! When
realities that many of us can’t relate LGBTQ+ community? skill-based tasks. Lack of accu- also a part of humankind. a community has faced centuries
fXcWcWTUP]b8c to. Fida Khan: Decriminalisation cWTaTbc^UcWTXa rate representation in Indian of oppression and suppression,
aTPbbdaTbcWPc8
To increase awareness around
the community of transgenders,
happened on September 6, 2018
and it is only on papers till now.
[XeTb<^aTbc^aXTb pop culture and stereotypical
portrayal exist even today. What
SJudicial reform is one thing but
social realities don’t shift in an
then things don’t change within a
click or get better overnight. It
P\WTPSTSS^f]cWT Spotify has launched a new orig- Zameeni haqiqat se inka koi vaas- bdaa^d]SX]V do you think is the way forward? instant. How do you think peo- takes time. We met approximate-
aXVWc_PcW8fX[[ inal podcast for India that high-
lights the unexplored lives of the
ta nahi hai (It has nothing to do
with the on-ground reality). I
caP]bVT]STabRP] Fida: We don’t have to do
much. Gradually, the government
ple are ready to take this change
ahead?
ly 200 trans people about five
years ago. Out of them, we picked
R^]cX]dTc^RW^^bT country’s third gender. Each know this because I belong to that QTPSSTSX]cWTXa is actually catering to things that Fida: While many people up beautiful stories of six of them.
RWPaPRcTabP]SS^a^[Tb episode of De Taali — Life of a community. I can still recall the
Q^^ZbF^]´ccWTh we as a community require. treat transgenders as lesser than
Transgender, hosted by Fida Khan, fight we started five years ago. Like However, everything exists only humans, there are some people SIn the time of global crisis like
cWPcPaTSPd]cX]VP]S curated and produced by Shameer there are ashrams for women, old [TPa]QTccTaP]S on papers and not in reality. I who are brave enough to fight for this, how do you think podcast
_dbW\T^dc^U\h Tandon, unravels and educates the age groups and orphans, we asked
ZTT_XcX]cWTXa believe that even if they start their rights day and night. There will work the best for the audi-
listeners about different aspects of the government for the same for working today on the ground are some trans people too, who ence?
R^\U^aci^]T8]cWXb the lives of transgenders through transgenders like me. They suffer \X]SbU^aTeTa.8c level, everything can just be fine. have made their way into the Shameer: When people are
hTPaXcbT[U8WPeTb^\T conversations with guests from more than anybody in the world. The change might actually come mainstream, achieved their goals homebound, they resort to digi-
f^d[STeT]cdP[[h
VaTPcUX[\bfWXRWWPeT varied backgrounds, including Being disowned by their own only if the things on paper are also and proved that we are as capable tal options. With the announce-
QTT]VaTPc[TPa]X]V
medicine, literature, the transgen- families and harsh treatment from [TPSc^PQTccTa done in reality. Gender-sensitisa- and deserving as any other Indian. ment of lockdown amid the pan-
der community, and more. the society leads to their so called tion should work in parallel with Fighting for issues like lack of legal demic of Covid-19, I think it’s a
Tg_TaXT]RTbU^a\T´ Excerpts of the interview: ‘bad’ behaviour. Lack of access to f^a[ScWPcf^d[S legal reform. Also, people still protection, poverty, harassment great option for people to just lis-
°AXRWP2WPSWP basic rights often forces them to [XeTP]SVa^ffXcW believe in stereotypes and refuse and stigma, anti-transgender vio- ten to such positive stories, which
SHow was the podcast first con- beg and engage in paid sex work. to give jobs to trans people. A lence, identity documents (a bar- normally they wouldn't have time
ceptualised? It takes a lot of courage for trans dbZ]^fX]VcWPc well-educated transgender Indian rier to healthcare for people for.
0Rc^aB0=90H3DCC Shameer Tandon: After the people to come to terms with who fTPaTP[b^P_Pac is as capable and deserving to take belonging to trans-community) is
WPbR^\T^dcX]bd__^ac success of Pioneer Six Pack, a they are. up significant jobs as any other my fearless grandmother, Salma SCan you share some anecdotes?
^UcWT]PcX^]fXST[^RZ musical band, which we created a In our country, people usual- ^UWd\P]ZX]S´ cisgender Indian. You have to fight Khan. She is the first trans- Fida: I just want people to
couple of years ago, we realised ly mock and harass them which for your rights because nobody woman in the three-member know that we have seen and done
S^f]daVX]VWXbUP]b that the natural extension would makes their life hell. It happens else is going to do it for you. panel of Mumbai’s District a lot in our lives. But it never real-
]^cc^eT]cdaT^dcSda be to do a lot of live events across because of a deep rooted patriar- When I was hosting this pod- Suburban Legal Ser vices ly made a difference to my life. I
X]VcWXb_TaX^ScWa^dVW the world. Then we thought that chal mindset of people. There is cast, an idea popped up in my Authority. Ours is a backward want to point out to the jobs we
PeXST^^]8]bcPVaP\ we should do something on main- a stigma attached to it. All this mind. You know how a child society which is devoid of its basic have and that we shouldn’t be
stream media to reach out to a explains the level of discrimina- learns ABCD... as he grows and he rights. But I am glad that people neglected as we are transgenders.
°>daR^d]cahXbV^X]VcWa^dVW larger audience. We had to stay tion prevailing in this society. All remembers that until he dies... so like Laxmi Narayan Tripathi, We shouldn’t be judged on the
PeTahSXUUXRd[cbXcdPcX^]CWPcb ahead of the curve, so we thought that they lack are some basic why don't teach them about trans Joyita Mondal, Gauri Sawant, are basis of our gender but rather, on
fWhfTP[[WPeTc^QTd]XcTSc^ that a podcast would be a great human rights. They desire noth- people just like they are taught constantly trying to break the our capability.
STP[fXcWcWXbFTWPeTc^TaPSX
BUc`USdQ\\YTTePb 5a^\cWTPaRWXeTb
RPcT2^a^]PeXadbU^aTeTa8P\ day ago, I read a report by
aT`dTbcX]Vh^dP[[fXcWU^[STS
WP]SbcWPc_[TPbTU^[[^fcWT
A London-based professors
Andrew Cunningham and Kate
X]bcadRcX^]b^UcWTV^eTa]\T]c Jones. The report clearly depicted 1*0$FHOHEUDWHVLWV\HDUV
how human beings have played a
P]SS^]cbcT_^dc^Uh^daW^\Tb huge role in landing the world in the ZLWKDYLVXDOWRXUWKDWVKRZFDVHV
?[TPbTbcT_^dc^][hXUXcXbeTah
daVT]c?[TPbTbcPhPcW^\TP]S
present crisis, including how other
viruses could also be spread even after
7d\P]b]TTSc^_PhWTTSc^P]RXT]c8]SXP]_WX[^b^_Whc^T\TaVT^dc^U WKHKLGGHQWUHDVXUHVRILWV
b_T]S`dP[XchcX\TfXcWh^daUP\ the present disaster has ended. cWT_aTbT]cf^a[SRaXbXbbPhb14=>H 147; UHSRVLWRULHV%\7($0 9,9$
However, besides dealing with the
X[h>]RTPVPX]8P\cT[[X]Vh^d ongoing situation, I thought it is time It is such a delightful and joyous crea- he National Gallery of Modern Art celebrates
_[TPbT[XbcT]c^cWTV^eTa]\T]c
BcPhbPUT±WTbPXSX]cWTeXST^
to introspect and to understand how
we can plan for a healthy and happy
ture with the qualities of an elephant,
cow, deer and even a horse.
T 66 years amid the COVID-19 lockdown with
a virtual tour that reflects its archives as dynam-
tomorrow. Then comes the Stupa II, Sanchi ic and progressive. The tour has plenty to explore
The report showcased how from 100 BCE. In today’s time, the and ponder over.
0]VT[X]P\PX]cPX]b humans are responsible by, first, message from Indian art and philos- Director General Adwaita Gadanayak, who
SXbcP]RTfXcW1aPS destroying the habitats of bats and
other animals, as well as keeping
ophy about oneness of all beings is
that it is time to stop being cruel to
completed three years and got a three-year
extension of his tenure at the gallery, feels that it
0Rc^a0=64;8=09>;84XbbT[UXb^ them in conditions of extreme stress bats, chicken and all kinds of animals, is important to have exhibitions that showcase the
and misery. Animals which can fly trees and eventually, nature, which we strength of the gallery.
[PcX]VP[^]VfXcWWTaRWX[SaT]P]S and roam free are often found use to fulfill our necessities. If we go by the exhibitions in these three years,
\PX]cPX]X]VSXbcP]RTUa^\TeTah trapped in terrible circumstances — This is one of the most difficult these are indeed an insight into a vision that wants
^]TX]R[dSX]VWTaU^a\TaWdbQP]S sometimes in cages, piled one on top times the world is going through. to keep an eye on the past as well as bring for-
P]SPRc^a1aPS?Xcc of another. Some animals like chick- However, we do have a choice by ward the importance of India’s sculptural sensi-
en often spend their entire life cooped looking at it through a different bilities.
0RR^aSX]Vc^Pb^daRT9^[XT up in a crowded space and are not prism. We can use it to look at our- Gadanayak, who recently designed the
°ZTT_X]VcWTRWX[SaT]fXcWWTa± allowed to sleep so that they can soon selves, rethink our lives, take care of National Police Memorial, has a significant place
aPcWTacWP][TccX]VcWT\QTfXcW become an appropriate size to be con- all that is around us and reshape a in sculptural traditions and contemporary move-
?XccP\XScWTR^a^] sumed by humans. better future for this planet. We ments.
PeXadb_P]ST\XR Such circumstances are terrifying would have achieved something pos- “The sculptures, paintings and prints in the
for animals and make them extreme- itive and learnt a very important les- visual tour showcase the hidden treasures of the
CWT<P[TUXRT]c ly stressed. Consequently, their resis- son even in the midst of such a cri- collection. It all began with the exhibition titled,
bcPaWPbSTRXSTScWPc tance and response to diseases is sis. We are very fortunate to have a Itihaas, which was NGMA’s celebration of 63 years.
SdaX]VcWT2>E83 greatly impaired. This all eventually rich heritage of philosophy, which has It’s the first exhibition that was held after I took
(WTP[cWRaXbXbcWT turns into a breeding ground for always taught us universal love and charge as the DG. This creative and wonderful
RWX[SaT]¯?Pg viruses, which one day jump on to the interconnection of all creation, journey of representing the treasures has contin-
human beings as we can see today. including us, animals, the trees and ued with several such exhibitions. And this vir-
%IPWPaP $ This is a time when one should rivers and even the sun, the moon tual tour is one such exhibition which I believe will
BWX[^W "P]S recall how in ancient Indian philos- and the stars. The early Upanishads, take this journey to greater heights. I present it as
hTPa^[ScfX]b ophy, all the living beings of the world which were penned in the eighth- a tribute to our modern masters and firmly believe
:]^gP]S have been regarded as being deeply ninth centuries BCE, presented a that this would generate greater interest among
EXeXT]]T¯ united. There is no separate compart- marvellous vision of the intercon- people towards the legacy of sculptures, paintings
ment for animals or birds. They are nectedness of all that is around us. and prints as a creative medi-
bW^d[SQTfXcWWTa all jeeva (living beings). The concept Foreign visitors to ancient India um,” says Gadanayak.
CWTXaT[STbc can also be understood with the constantly wrote about vegetarianism
RWX[S 'hTPa^[S example of our own previous births which they found here. They found
<PSS^gP[b^U[Tf in the form of different animals. Even it remarkable and said it was based
S^f]Ua^\B^dcW the Buddha is seen in many avatars upon the Indian belief in ahimsa, or
in his previous births — as a buffa- non-violence to all living creatures.
:^aTPfWTaTWT lo, monkey, boar, elephant and so In any case, cruelty to animals is
XbbcdShX]VPc many other animals. We are indeed wholly unnecessary and the world
H^]bTX taught to respect the dignity and should take a leaf out of the
D]XeTabXchX] emotions of all the animals and ry painting, Gautama Buddha is mind. In fact, one can see a smile on Upanishads, to shape a vision for a
birds around us since we were also seen in his previous birth as a buffa- the face of the Mahisha. It is such a better tomorrow.
BT^d[ one of them at some point of time. lo. The pesky monkey troubles him composite creature. The depiction (The writer is a culture historian,
In Mahisha Jataka, a fifth centu- but the kindly Bodhi Sattva does not displays the oneness of all life forms. filmmaker and photographer.)
SLRQHHU C74?8>=44A
=4F34;78kCD4B30H k<0A27" !!
?^bXcXeT3QcU
0bh\_c^\PcXR2>E83 (_PcXT]cbPaTPb
eXad[T]cP]SX]UTRcXeTPbbh\_c^\PcXR
^]TbP]ScW^bTWPeX]V]^R[X]XRP[
bh\_c^\bQdccTbcTS_^bXcXeTU^a]Tf
R^a^]PeXadbRP]X]UTRcbTeTaP[WTP[cWh
_T^_[TPRR^aSX]Vc^]TfbcdSXTbCWT
X]UTRcXeXch^UPbh\_c^\PcXR_PcXT]cbR^d[S
QT]TPa[hcWTbP\TPbR^]UXa\TSRPbTb
9R_eRgZcfdecfeY
3>2H0A3 WHAT YOUR
3AA0:4B7270F;0 FEVER MEANS?
any believe that most fevers cannot be dif-
6HQLRU&RQVXOWDQW M ferentiated clinically. However, it is not true.
5HVSLUDWRU\0HGLFLQH Here are few tips to identify different types of
fevers and their causes.
B0A>9BD?4AB?4280;8CH7>B?8C0;
FWT]cWTf^a[SXbbcX[[UXVWcX]VfXcWR^a^]PeXadb_P]ST\XRP]TfeXadb
Y Fever with cough and cold: think of flu
=4F34;78 Y Fever with retroorbital eye pain: think of
dengue
X]2WX]PWPbR[PX\TSP[XUT3A=0E=44C B>>3cT[[bh^d\^aT Y Fever with joints pain which improves on
bending: think of Chikungunya
Y Fever with lymphocytosis: think of viral fever
Y Fever with lymphopenia: think of Covid 19,
acute hepatitis, HIV
Y Fever with jaundice: rules out viral hepati-
tis
Y Fever subsides capillary leakage appears in
dengue
Y Low grade evening rise fever: think of TB
Y Fever with chills and rigors: think of malar-
ia, filaria, UTI, sepsis
Y Fever with cough and breathlessness: think
of COVID like illness
Y Fever with ESR > 100: painful thyroiditis,
sepsis
Y Fever with SGOT > SGPT: dengue
Y Fever with angry looking throat with no
cough think of streptococcal sore throat
Y Fever with red eyes: Zika illness
Y Fever with eschar: scrub typhus
;UU`ceWQb
Y Fever with single chills: pneumonia
Y Fever with involvement of skin, joint and or
kidney rule out auto immune disease
Y Fever with TLC > 15000 is sepsis
Y Fever with positive thump sign on liver rule
\UfU\cY^SXUS[
out liver abscess
CWTfaXcTaXb3a::0VVPafP[?aTbXST]c2<00>7258P]S
5^a\Ta=PcX^]P[?aTbXST]c2<00>
:44?38BC0=24
While the geriatric population may have other co-morbidi- he world is already in the (1951-1953), In year 1978 in South Virus can be transmitted through breast
ties like asthma, wheezing or any
other respiratory ailments, dia-
?PcXT]cbfW^WPeT betes and hypertension along
T grip of Corona pandemic;
more than 170 countries
are affected, even powerful coun- he sigh of relief is Hantavirus As COVID-19 is changing
Korean Hemerologic fever was iso-
lated from small infected field
rodent near Hantan River, and the
milk
The only report of testing found no virus in
the maternal milk of six patients. However,
3XPQTcTbRP]WPeT with a diminished immunity,
makes them more vulnerable to
tries are witnessing tough time
with best healthcare systems as
T is rare and can only infect peo-
ple who have close contact with
people's lifestyle all around the
world, it can be expected that the
virus was named after Hantan
river. Later in 1981 it was termed
droplet transmission could occur through close
contact during breastfeeding. Thus, mothers
P]X]RaTPbTSaXbZ infections. But this doesn’t make death toll is still at rise due to rodent’s urine, saliva or excretion spread of this virus will be con- as hantavirus. with confirmed COVID-19 or symptomatic
them the only victims to the COVID-19. Time when even our where this virus comes from, at trolled in the wake of COIVD-19 Symptoms: First of all infect- mothers with suspected COVID-19 should take
^UcPZX]V\^aT virus, but people of all age and entire country is locked down as the same time it rarely transmits and lessons it has taught to the ed mouse can cause this infection precautions to prevent transmission to the infant
cX\Tc^WTP[P]S gender are equally vulnerable. safety measure, news reports about from one human being to anoth- human race. At the same time this to anybody around. A person during breastfeeding (including assiduous hand
As we age, our immune the outbreak of Hanta virus, which er. Although it has caused one life is not the first time world is fight- may start feeling ill after getting for hygiene and use of a facemask).
VTcPbTR^]SPah system also depletes gradually fuelled more fear among the peo- according to news reports still as ing against virus pandemic. Black one to five weeks around an Alternatively, to minimise direct contact, the
X]UTRcX^]8UcWTh and likely for this reason any ple. Even it was on trend on social the time suggests COVID-19 is death, SARS, plague are also infected rat or any other rodent, infant can be fed expressed breastmilk by
elderly catching coronavirus is media including twitter and face- the bigger problem world is fac- some of the examples from the and this chance is also rare. Initial another caregiver until the mother has recov-
WPeTP]h^UcWT more vulnerable to sail through book and other platforms, hash ing and Hantavirus is not as dan- history which gave tougher time symptoms may include:- ered, provided that the other caregiver is
bh\_c^\bbdRWPb the ill-effects of the virus. While
the body’s fighting capacity
tags of Hantavirus started running,
people from around the world had
gerous as it is, yes precautions can
be taken, basic cleanliness and not
to human time and again. We
only need to learn, take precau-
Q Fever
Q Fatigue
healthy and follows hygiene precautions.
Women who choose not to breastfeed must
R^dVWWXVW would have reduced by this age, different opinions and fears asso- coming in the contact of such rats tions and not to repeat same mis- Q Serious muscle ache take similar precautions to prevent transmission
cT\_TaPcdaTP]S in addition to the existing co-
morbidities, old people are more
ciated with this new Hanta virus
term, which only made people
can prevent even this risk as well. takes.
CH?4B)
through close contact when formula is used.
Two tests are required to declare recovery
UTT[X]VbW^ac^U likely to die of corona virus more furious and tensed. It all Q New World Hanta Virus: It is Ideally four. Factors include resolution of
QaTPcWcWTh]TTS be extra People with diabetes should
careful about their
started few days back when Global
Times reported about a man trav-
required to be well informed
rather than getting flown away
tion of rodents like rats, squirrels
which cause Hanta virus diseases
basically found in US which caus-
es Pulmonary Syndrome, it can
clinical signs and symptoms and negative
results of reverse-transcription polymerase
c^\^]Xc^acWTXa health. They should maintain elling in Yunnan province in with a mere news report. Keep and HPS (Hanta Virus Pulmonary cause severe cough and shortness chain reaction (RT-PCR) testing for severe acute
Q[^^SbdVPa good glycaemic control (blood
sugar level which helps in reduc-
China, who died while travelling
in a bus, he was found to be infect-
yourselves well informed with the
authentic sources as rumours are
Syndrome). Now it may have
scared the people but it's not a new
in breathing and severe pulmonary
problems.
respiratory syndrome coronavirus 2 (SARS-
CoV-2) on two sequential paired nasopharyn-
R[^bT[h ing the risk of infection and also ed from Hantavirus, and the fel- also rife about COVID-19. The virus in the list of viruses. Even Q Old World Hanta Virus: It is geal and throat specimens (four specimens total,
the severity of complications. low passengers were also tested for sudden outbreak of Hanta Virus Chinese media has reported that found in Asia and Europe which each handled separately), with each pair collect-
In case a person with the same. Here before we get into may have made scared people but it is not a new virus and has been causes Haemorrhagic Fever with ed 24 hours apart.
Diabetes gets Covid-19, the details about this news report it is not as dangerous as COVID- infecting human race already since Renel Syndrome (HFRS), it caus- COVID-19 can’t be diagnosed without
advisory suggests authorities should be notified immediately. and Hantavirus we all must 19 which is already world is fight- many years. es vascular leakage, low blood tests
Patients who have Diabetes can have an increased risk of tak- observe it as our social responsi- ing with. There is already a history pressure and kidney failure. In some cases, testing for COVID-19 may
ing more time to heal and get a secondary infection. In such a bility to not spread panic. According to CDC (Centre for available on the same as to bring CWTfaXcTaXb_d[\^]^[^VhR^]bd[cP]cPc not be accessible, particularly for individuals who
case people if people have any of the symptoms such as cough, Considering this sensitive time Disease Control) the origin of this new fear down. It goes back 3WPaP\bWX[P=PaPhP]PBd_Tab_TRXP[Xch have a compatible but mild illness that does not
high temperature and feeling short of breath, they need to mon- entire world facing, it is highly Hanta virus is in urine and excre- in the history, after Korean War 7^b_XcP[ warrant hospitalisation.
itor their blood sugar closely.
85B2CD?B5C3E5
Here are a few tips how diabetics can prevent Covid-19.
Q Maintain good glycaemic control, which may help in reduc-
ing risk of infection and severity. It may also lessen chances of 'DGL.D.HKQD
secondary bacterial pneumonia. Doctors say it is important to
Q Pay attention to nutrition and have adequate protein. Any defi-
ciency of minerals and vitamins should be addressed immedi- boost one’s immunity so that
the body has the capacity to
'53$57$3&+$8+$1WHOOV\RXKRZWRWDNHWKH$\XUYHGD
ately.
If a Diabetic has Covid-19 fight COVID-19. There are
Q Most can be treated at home. Water level should be maintained
along with symptomatic treatment.
Q Patient with type-1 Diabetes should measure blood glucose
ingredients in our kitchen that
can help ensure one is healthy,
URXWHDQGNHHSKHDOWK\GXULQJWKHVSUHDGRI&29,'
and urinary ketone frequently in case of fever. trong immunity is necessary to fight any
Q Hospitalised patients with severe infection should be given
insulin to control hyperglycaemia in them.
says ROSHNI DEVI
here are several mes- decoction has all the goodness
SCoronavirus
kind of foreign body or disease.
primarily affects the lungs
E`\j`@]j^aZTdWc`^;f]j#$#!#"
05? Q C>:H>
,2$DVN16)V
he Tokyo Olympics will WRVWDUWSODQQLQJ
F^a[SPcW[TcXRbR´bWX_\^eX]Vc^!!!
T begin on July 23 next
year, organisers said on
Monday, after the coronavirus
=4F 34;78) Indian Olympic
Association (IOA) on
05?Q ;>=3>=
>[h\_XRb_^bc_^]T\T]c
from athletes and sports feder- (National Sports Federations) The announcement came with the Commonwealth
ations as the global outbreak are requested to please start immediately after Olympics Games Federation, the organ-
worsened. their draft planning structure organisers said the 2020 Tokyo isers of the Commonwealth
“The Olympics will be held for preparation for Tokyo Games will now take place on Games that are currently
from July 23 to August 8, 2021.
The Paralympics will be held
from August 24 to September 5,”
2021 and for Paris 2024,”
IOA president Narinder Batra
said in a release.
July 23-August 8, 2021.
That means the world ath-
letics championships that were
scheduled to be held In the
English city of Birmingham on
July 27-August 7, 2022.
aTZX]S[Tb3X_P³bW^_Tb
Tokyo 2020 chief Yoshiro Mori Soon after the new dates scheduled to take place in The athletics federation ?C8Q =4F34;78 So it gives me more time to
told reporters. were announced, IOA secre- Eugene on August 6-15, 2021, said it was also talking to the recover and prepare for the two
Only hours earlier, Mori had tary general Rajeev Mehta can no longer be held on organisers of the 2022 he postponement of Tokyo events,” she added.
said he expected a decision
from the International Olympic
C^Zh^>[h\_XR?aTbXST]cH^bWXa^<^aXaXVWccP[ZbfXcW7^]^aPah?aTbXST]c5dYX^
<XcPaPXd_^]WXbPaaXeP[PcC^Zh^!!4gTRdcXeT1^PaS<TTcX]V^]<^]SPh 0?
said, “Indian Olympic
Association along with the
those dates.
“We support the new 2021
European Athletics
Championships, which are
T Olympics has come as a ray
of hope for injury-ravaged
Karmakar hoped the extra
time to get back to form will
Committee (IOC) during the preparations, selection and qual- to the international sports cal- NSFs welcome and support dates for the Tokyo 2020 due to take place in Munich Indian gymnast Dipa come in handy for her.
course of the week. ification of athletes,” he added. endar, the body said. the new dates for the Tokyo Olympic Games announced on August 11-21. Karmakar, who is preparing for “I will give my best to
But on Monday evening, he In a statement, the IOC said There was some specula- 2020 Olympic Games, which today by the Japanese organ- There has been no deci- another shot at qualification return to form and hopefully I
said an emergency teleconfer- the new dates would give health tion that Japanese organisers will be held from 23 July to 8 isers and the IOC,” World sion yet whether to postpone after a niggling knee problem can do well and qualify,” said
ence had been held with the IOC authorities and organisers “the could take advantage of the August, 2021.” PTI Athletics said in a statement. this year’s European champi- hampered her earlier bid to the 26-year-old, the first Indian
and the date finalised. maximum time to deal with the blank canvas to shift the Games “This gives our athletes onships, slated for Paris make the cut. female gymnast to compete in
“We agreed that the timing constantly changing landscape to spring, avoiding the heat of marathon has been moved to the time they need to get between August 26-30. Karmakar, who finished the Olympics.
of the event will be in summer and the disruption caused by the the Tokyo summer that had Sapporo, a city some 800 kilo- back into training and compe- Track and field is the tra- fourth at the 2016 Rio Karmakar’s long-time
as originally planned, consider- COVID-19 pandemic.” been their main concern before metres to the north of Tokyo tition. ditional centrepiece of the Olympics, has been struggling coach Bishweshwar Nandi also
ing the coronavirus... and a cer- The decision would also coronavirus struck. where the weather is cooler “Everyone needs to be Olympic Games and the with injuries ever since she said this postponement has
tain amount of time needed for cause “minimum” disruption Due to the heat, the even at the height of summer. flexible and compromise and Commonwealth Games. underwent a surgery to treat an renewed Karmakar’s hopes.
Anterior Cruciate ligament “She is fit now. She has
(ACL) injury in 2017. ACL is completely recovered from the
3TRXbX^]^]FX\Q[TS^]cWXbfTTZ
;>=3>=) The vice-president of president Bernard Giudicelli for
0B802D?C!AD;43>DC
80=BQ =4F34;78 of the year in Australia.
a key ligament that stabilises
the knee joints.
Her comeback in 2018 was
short-lived as the knee troubled
injury but in gymnastics, you
have to slowly start the process
of training and Dipa had start-
ed her basic practice late last
the German tennis federation his handling of the rescheduling “Though it doesn’t seem right to be talking her again at the Artistic month when this coronavirus
has predicted that Wimbledon of Roland Garros, the claycourt he coronavirus outbreak has not only about cricket schedules as of now, we can safe- Gymnastics World Cup in outbreak happened,” the
will be cancelled on Wednesday
and slammed the French Tennis
Grand Slam.
“What president Bernard
T brought the world to a standstill, it has also
created a scenario where the fate of sporting
ly assume that Asia Cup isn’t a possibility.
“The sports organisation are hit deeply and
Baku last year. She was forced
to withdraw from the Doha
Dronacharya awardee said.
“She will be back to her
Federation for moving the Giudicelli did is a disgrace, for ten- activities in the next six months hangs in bal- there will be some tough measures once some World Cup as well and failed to best in 3-4 months and since
French Open to the autumn. nis and for France,” Hordorff said. ance. While the 2020 Olympic has already been semblance of normalcy returns. There are lia- recover in time for the World there are still two events left, we
Dirk Hordorff told French The controversial switch postponed and the start of IPL-13 suspended, bilities and difficulties that the Board faces and Artistic Gymnastics can take another shot at the
sports daily L’Equipe that he organisers have already post- leaves the French Open starting the 2020 Asia Cup is also likely to be given a skip it will be a new kind of a challenge to deal with Championship in October, Olympics. See, in gymnastics,
expects Wimbledon, scheduled poned their tournament and a week after the US Open finish- this year. them,” the official said. 2019. injuries happen a lot but I’m
for June 29-July 12, to be moved it to start on September es, if that event retains its orig- Speaking to IANS, a BCCI official said that Host association Pakistan Cricket Board also “There were eight World hopeful that she will take it as
scrapped due to the coron- 20, instead of May 24. inal slot in New York. gauging from how things stand at present, it is confirmed that there isn’t much information to cups but now there are only a challenge.
avirus pandemic. “You could reorganise “The way they did it, tennis almost safe to say that this edition of the Asia be given with regards to the status of the tour- two left, which were supposed “She will need two Silver or
“This is not a rumour, they Roland Garros for September or would be dead if we all behaved Cup might not see the light of day. In fact, the nament which was to be played in September. to happen in March but got one Gold and a Silver in the
will announce that they are October, but not Wimbledon, like that. I’m sure it was a polit- tournament had greater significance this year as “We cannot throw light on when the next postponed to June due to coro- two tournaments. We will not
cancelling Wimbledon,” he said. the grass would be too damp,” ical move with elections coming it would be the perfect training ground for the Asian Cricket Council meeting will take place navirus outbreak,” Karmakar leave any stone unturned and
In a move that surprised the Hordorff said. up (in December). He’s pan- Asian team going into the World T20 which is and on decisions around the Asia Cup and its said. “Given the situation they I hope she will be able to per-
tennis world, French Open Hordorff hit out at FFT icked.” AFP still scheduled to be played as per plan at the end fate,” the PCB official said. perhaps will happen next year. form.”
CXQVQ\Y^UUTcd_e` EV_Uf]\RchRdR_R]]T`_UZeZ`_SRed^R_+HRc_V
dXUWQ]UcQiUh`Ubdc
?C8Q <4;1>DA=4 conditions, it is a real toss-up While Lara played 131 Tests and Australia scoring 10927 runs, includ-
between Tendulkar and Lara, but I scored 11,953 runs with an average ing 32 centuries & 50 fifties.
pin great Shane Warne on would just choose Tendulkar.” of 52.88. In 299 ODIs he accumulat- About his team, Warne said: “I