Professional Documents
Culture Documents
Bhopal English Edition 2020 12 16 - 3 PDF
Bhopal English Edition 2020 12 16 - 3 PDF
L-2/BPLON/41/2006-2008
4bcPQ[XbWTS '%#
@A:?:@?' H@C=5) 2G6?F6D"! ?dQ[XbWTS5a^\
A4?40C43 1>:>70A0<2;08<B:83=0??8=6 D?B:8;;8=6 34;78;D2:=>F 17>?0;17D10=4BF0A
508;DA4B >5=864A80BCD34=CB8==>AC7 8B:4H A0=278A08?DA 270=3860A7
347A03D= 7H34A0103E890HF030
m
;PcT2Xch E^[ &8bbdT "#
m
0XaBdaRWPaVT4gcaPXU0__[XRPQ[T
17>?0;F43=4B30H3424<14A %!!*?064B !C $
G5µ<<81F5@<1>C
9>@<1356?B
;?8<9*<1>75B
!"C@?BD
fffSPX[h_X^]TTaR^\
<ZdR_hZ]]eVRTY@aa]Vdd`_+A> %HSRLVHGIRUYDFFLQH¶V
VLGHHIIHFWV6WDWHVWROG
7KRVHVSUHDGLQJFDQDUGVWKDW
IDUPHUVZLOOORVHODQGZLOOEH ?=BQ =4F34;78 2UgVcdVVgV_edW`]]`hZ_XZ^^f_ZdReZ`_
GHIHDWHG0RGLVD\VDVVXUHV RTcZeZTR]RdaVTe+>Z_Zdecje`DeReVFEd
T he Union Ministry of
Health on Tuesday did not
QHZODZVZLOOEHQHILWNLVDQ rule out possibility of an
adverse event following immu-
nisation whenever Covid-19
?=BQ =4F34;78 traders”. vaccination programme is
“Does any one take away launched and has asked the
7Rc^VcdYRcUV_
said is free from any remove all their doubts…”, said and women and those vacci- Around 29,000 cold chain appropriate behaviour.
Government control, the Prime
Minister said Government
likewise “does not intend to
the Prime Minister saying his
Government has been working
to increase farmers’ agriculture
F our Punjab farmers return-
ing from protest sites near
Delhi borders were killed in
4`gZU"* BC0C4B
<PWPaPbWcaP
C>C0;20B4B340C7BA42>E4A43
''%'& #'""( &%%
:?:?5:2
deR_TVe`S]`T\
interfere in the agriculture produce and the income. two separate road accidents on :Pa]PcPZP ("#!$ (%$'&$&(%
related business.” “Those spreading lies will Tuesday while one died of
Modi, thereafter, went on
to attack the Opposition which
be defeated by farmers and
taught a lesson,” said Modi.
heart attack. According to
Sanyukt Kisan Morcha, at least C>C0; 0]SWaP?aPSTbW
CP\X[=PSd
'&%""%
' %
&%#'%#% !
( (&&(!(
PUcTaCadSTPd´baT\PaZb
?=BQ =4F34;78 organised by Canadian Foreign
set to intensify as farmers hard-
ened stance and said they are
determined to win this fight no
matter what.
“A Homage Day
(Shraddhanjali Diwas) for all
the farmers who lost their lives
and became martyrs in the
The farmers were returning to
Patiala after participating in the
protest against the farm
laws.
3Xbcb C^cP[2PbTb 5aTbW2PbTb
1W^_P["%!($ '$
8]S^aT#($ '# (
1XWPa
6dYPaPc
!##!#$
!!(( "
<PSWhP?aPSTbW !!$&(
"!( !"&((%
# ("! !("(
"#!$!(&%'
6fP[X^a $"''#"
Minister Francois-Philippe Addressing a Press confer- ongoing protest will be organ-
I n an apparent rebuff, India Champagne to formulate ence at Singhu border, farmers’ ised across the country in vil-
on Tuesday did not take part
in a high-level bilateral dia-
logue at the diplomatic-level
strategies to combat the glob-
al pandemic. “Scheduling
issues” were cited as the reason
leaders said the fight has
reached a stage where we are
determined to win no matter
lages and tehsil headquarters
on December 20 from 11 am to
1pm,” said another farmer
8`geTR]]d`WWHZ_eVcDVddZ`_`gVc4`gZU
with Canada claiming that the
date was inconvenient. This
for Jaishankar for not taking
part in the meet. Incidentally,
what. “We are sure that we will
make the Government repeal
leader.
Meanwhile, following the
,W¶VµGHFLPDWLRQRI Opposition party Congress.
The Opposition questioned
complete” and asked if election
campaigning can be done amid
came days after Prime Minister he had attended the last meet- these laws. We are not running protest, the Delhi Traffic Police GHPRFUDF\¶ZKHQ the motive behind not calling the pandemic then why can’t
Justin Trudeau backed the
protesting farmers in
ing in November.
As regards the latest devel-
away from negotiation, but the
Government has to pay heed to
took it on to Twitter and
informed commuters regarding SROOVUDOOLHVDOORZHG the Session when elections and
huge public rallies were allowed
the session be held. Senior
Congress leader and party’s
India. opment, the diplomatic-evel our demands and come for- the traffic closed. DOOHJHV&RQJUHVV and even schools and colleges chief whip in the Rajya Sabha
India had termed the talks were to be held between ward with concrete proposals,” Police said Singhu, have been permitted to be Jairam Ramesh said Leader of
remarks by Trudeau as “unwar- Riva Ganguly Das, Secretary said Jagjeet Dallewal, a farmer Auchandi, Piau Maniyari, ?=BQ opened. the Opposition in the Rajya
ranted” and conveyed its dis- (East) and Canadian counter- leader. Sabholi and Manges borders =4F34;78 In a letter to leader of Sabha Ghulam Nabi Azad was
pleasure while issuing a part. Several other farmer lead- were closed, and commuters Congress in Lok Sabha Adhir not consulted on the
demarche after summoning
Canadian High Commissioner
to New Delhi. External Affairs
Foreign Minister S
Jaishankar had last week
skipped the Ministerial
ers also addressed the Press
conference and said they will
completely block the Chilla
have been advised to take alter-
native routes via Lampur,
Safiabad and Singhu school toll
T he Centre on Tuesday said
the Winter Session of
Parliament will not be held this
Ranjan Chowdhur y,
Parliamentary Affairs Minister
Prahlad Joshi said, “Winter
a Covid vaccine is expected
very soon.”
matter.
Joshi in his communication
to Chowdhury said he had
Minister S Jaishankar last week Coordination Group of Covid- Border between Delhi and tax borders while traffic has year in view of the Covid-19 months are very crucial for Slamming the Government informally contacted floor lead-
also pulled out of a Canadian- 19 organised by Canadian Noida on Wednesday to press been diverted from Mukarba pandemic and that it will be managing the pandemic for its decision to not hold ers of various political parties
led initiative to fight coron- Foreign Minister Francois- for their demands. and GTK road. appropriate to convene the because of recent spurt in cases Parliament’s Winter Session in and “they have expressed their
avirus pandemic. Philippe Champagne to for- The farmers’ leaders also Outer Ring Road, GTK Budget Session in January. during this period, particular- view of Covid-19, the Congress concerns about the ongoing
Jaishankar did not attend mulate strategies on the coro- called upon people to pay trib- road and NH-44 can be avoid- This has invited sharp reac- ly in Delhi. At present, we are said the “decimation of pandemic and opined of doing
the December 7 meeting navirus pandemic. utes on December 20 to those ed, they said. tions from the main in the middle of December and Parliamentary democracy is away with winter session”.
W`c>?4[`S ?=BQ
=4F34;78
Avirtual meeting of the
Cabinet held on Tuesday
of intent in place of the date of
contract. If the contract is not
executed even after having
344?0::D<0A970Q
=4F34;78 B ritish Prime Minister Boris
Johnson will be the chief
guest at the Republic Day next
under the chairmanship of
Chief Minister Shivraj Singh
Chouhan. The Cabinet grant-
obtained all the statutory per-
missions by a tenderer of the
sand group, then the security =Tf3T[WX)CWT3T[WX
X]cTa]PcX^]P[PXa_^acXbVTPaTSd_
Launched with much fanfare
by the Narendra Modi
Government, the lateral entry
year. Making this announce-
ment here on Tuesday, visiting
British Foreign Secretary
ed approval to extend the oper-
ation of Dial 100 scheme with
the pre-contracted firm at the
deposit which deposited by
him as penalty will be seized.
For the approval of miner-
c^T]bdaTbPUTU[XVWc^_TaPcX^]b
P\XSX]RaTPbX]VU^VX]cWTRXch
scheme for senior-level officers Dominic Raab said Johnson approved rates of tender in the al storage license a radius of 5 ^_TaPc^a380;bPXS^]CdTbSPh
drawn from various professions has accepted India’s very “gen- contract period for six months km from the mine has been CWTPXa_^acdcX[XbTbP]0Xa_^ac
and expertise suffered a setback CTPRWTabfW^fTaTbT[TRcTSQhcWT<PSWhP?aPSTbW6^eTa]\T]cSdaX]VcWTaTRadXc\T]cSaXeTX]! 'bcPVTPST\^]bcaPcX^] erous” invitation to honour i.e. from 1st April to September restricted. After this, the con- 2^[[PQ^aPcXeT3TRXbX^]<PZX]V
when one of the nine Joint ST\P]SX]VP__^X]c\T]cX]cWTBcPcT6^eTa]\T]cbTaeXRTX]1W^_P[^]CdTbSPh ?X^]TTa?W^c^ the occasion. 30, 2020 and again for six tractor of sand mineral group 023<RT[[¯fWXRWWPb
Secretaries appointed about a months i.e. October 01, 2020 to and the contractor of sand aT_aTbT]cPcXeTb^US^\TbcXR
&ROGZDYHJULSV'HOKLPLQGURSVWRR&
year ago called it a day and March 31, 2021. mineral authorized by the gov- PXa[X]TbPXacaPUUXRR^]ca^[P]S
chose to get back to an MNC The Cabinet granted ernment can be granted min- cWT3T[WX8]cTa]PcX^]P[0Xa_^ac
abroad. approval to amend the Madhya eral storage license outside the ;X\XcTS380;¯U^aQTccTa
Appointed as a Joint Pradesh Sand (Mining, 5 km limit and within 8 km R^^aSX]PcX^]fWT]eXbXQX[Xch
Secretary in the Ministry of Transportation, Storage and radius from the approved mine aTSdRTbSdTc^U^VXc
Commerce last year, Arun Goel BC055A4?>AC4AQ =4F34;78 es below normal, said , the Trading) Rules 2019. The in their favour. Government \T]cX^]TS
has resigned from Government India Meteorological amendments will ensure unin- departments can be granted
³00?F8;;2>=C4BCD?
of India, DoPT sources
said.
While sources close to Goel
T he national Capital on
Tuesday witnessed cold
conditions with the icy winds
Department (IMD).
At 4.1 degrees Celsius, the
minimum temperature at
terrupted supply of sand min-
erals in the state. This will
speed up construction work
permission for extraction of
sand mineral from the mines of
the sand mineral groups are
0BB4<1;H?>;;B8=!!!´
=Tf3T[WX) CWT0P\0PS\X
said the private executive- blowing from snow-covered Safdarjung Observatory, which and create employment oppor- vacant in order to ensure sup- ?PachfX[[R^]cTbccWTDccPa
turned bureaucrat left the pow- western Himalayas bringing provides representative data tunities for workers. It will ply of sand minerals in the ?aPSTbW0bbT\Q[h_^[[bX]
erful job after having served for the minimum temperature for the city, was five notches also have an impact on the rev- works. !!!Xcb]PcX^]P[R^]eT]TaP]S
about a year due too much of down to 4.1 degrees Celsius, below normal on Tuesday enue income of the state gov- The Cabinet has approved 3T[WX2WXTU<X]XbcTa0aeX]S
“bureaucratic grind” in the the lowest in the city this sea- morning. At Jafarpur, the mer- ernment. a scheme for recovery of min- :TYaXfP[P]]^d]RTS^]CdTbSPh
system, said the Government son so far. cury dipped to 3.6 degrees According to the amend- eral revenue pending under the PbWTPRRdbTS_^[XcXRP[_PacXTbX]
sources, adding that he chose The maximum tempera- Celsius. The Ayanagar and ment, the period of sand min- Department of Mineral cWTBcPcT^US^X]V]^cWX]VQdc
to go back to private sector for ture also dipped to 18.5 degrees Lodhi Road minimum ing in the sand mines approved Resources. bcPQQX]V_T^_[TX]cWTQPRZ
a “fat package”. Celsius, more than four notch- dropped to 4.2 degrees Celsius. in the state will be calculated Continued on Page 3
17>?0; kF43=4B30H k3424<14A %!! RP_XcP[!
4Y`fYR_RUUcVddVd4RSZ_VegZcefR]]j
6D\V0LQVVKRXOGVWHSXSDFWLYLWLHVRIFRUSRUDWLRQVERDUGVDWWDFKHGWRWKHLUGHSDUWPHQWV
from Mantralaya. Before the
Cabinet meeting, Chief
&0WR0LQV Vidisha. In the remaining dis-
tricts, ministers will take part
Minister Chouhan told the PCWTh\dbcf^aZWPaSSPh X\_a^eX]VcWTTR^]^\XR in these programmes. The
ministers to hold discussions P]S]XVWcc^Ud[UX[cWTV^P[^U R^]SXcX^]^UUPa\TabbW^d[S Chief Minister’s Office and the
about the benefits of the new 0c\P]XaQWPa<PSWhP P[b^QT\PSTPePX[PQ[Tc^cWT Agriculture Minister are decid-
agricultural laws during their ?aPSTbW _dQ[XR ing in coordination for the
tours, interaction with the pub- PCWTh\dbcZTT_PR^]bcP]c P>]3TRT\QTa 'aT[XTU ministers to go to the districts.
lic, meetings and programmes. fPcRW^eTacWTPRcXeXcXTb^U P\^d]cfX[[QTcaP]bUTaaTSX] Local MLAs and MPs will also
All sections along with farmers, cWTXaST_Pac\T]cb cWTPRR^d]cb^UUPa\Tab join the programme and
should be informed about the P2WXTU<X]XbcTa2W^dWP]c^[S PRa^bbcWTbcPcT express their views.
BC055A4?>AC4AQ 17>?0; significant steps taken through cWT\X]XbcTabc^W^[S PCWTaT[XTUP\^d]cU^acWT[^bb Chouhan said that many
the new agricultural laws SXbRdbbX^]bPQ^dccWT ^Ub^hPQTP]Ra^_bP]S^cWTa important instructions have
QT]TUXcb^UcWT]Tf Ra^_[^bbTbfX[[P[b^QT
C hief Minister Shivraj Singh
Chouhan has said that the
ministers should also give pace
towards the economic devel-
opment of the country.
Chouhan described the
PVaXRd[cdaP[[PfbSdaX]VcWTXa
c^dabX]cTaPRcX^]fXcWcWT
X]R[dSTScWXbhTPaX]cWXbX]
PSSXcX^]c^cWT_aTeX^db
been given to senior officials in
public interest at the collector
commissioner’s conference
to the activities of the action taken in the New _dQ[XR\TTcX]VbP]S PaaTPabAb %Ra^aTPaT held this month. This mantra
Corporations, Boards attached Farmers (Empowerment and _a^VaP\\Tb P[b^QTX]VST_^bXcTSX]cWT has been implemented while
to their departments. Schemes Protection) Agreement on PCWTSTcPX[b^UcWT_a^eXbX^]b PRR^d]cb^U"$$[PZW tightening the administration,
should be implemented on Price Assurance and Services ^UcWTbT[Pfb\PSTU^a UPa\Tab^UcWTbcPcT for public welfare.
time in the interest of the Act, 2020 to provide the high- A similar conference will
common man. They must keep est value of paddy to farmers in this, the ministers should take crops and other crop losses will be held again on January 4 in
a constant watch over the activ- Hoshangabad district as ideal the lead and complete this also be included this year in which the concerned ministers
ities of their departments. They and hoped that such steps are work. this in addition to the previous will also be present during the
must work hard day and night taken in other districts also. The Chief Minister arrears. Rs 1600 crore are also discussion of the particular
to fulfil the goal of The details of the provisions of informed that on December 18, being deposited in the accounts department.
Atmanirbhar Madhya Pradesh. these laws made for improving relief amount will be trans- of 35.50 lakh farmers of the The Minister should also
Chouhan was addressing the economic condition of ferred in the accounts of farm- state. ensure that action is taken in 8]eXTf^UcWT_a^_^bTS0bbT\Q[hbTbbX^]^]3TRT\QTa!'!(P]S"?a^cT\B_TPZTaAP\TbWfPaBWPa\PP[^]VfXcW
the Cabinet members today farmers should also be made ers across the state. The relief Chouhan said that he him- terms of points of discussion of ?Pa[XP\T]cPah0UUPXab<X]XbcTa=Pa^ccP\<XbWaPP]S<;0?2BWPa\PX]b_TRcTScWTbXccX]VPaaP]VT\T]cb^UcWT\T\QTabX]
through a video conference available to the public. For amount for the loss of soyabean self will transfer the amount in the department. 7^dbT^]CdTbSPh ?X^]TTa_W^c^
8Q^T\__]=U\Q" "
Uf_[UcW__TbUc`_^cU
BC055A4?>AC4AQ 17>?0; stuff for their houses they could
not only buy decorative items
2ULHQWDWLRQSURJUDPPHIRU 0cd[:WTZPSTbQ^^Z³<T:X6PXXbPQ^dcaTPb^]U^aQTX]VWP__X]Tbb
03*RYW352VFRQFOXGHV
BC055A4?>AC4AQ 17>?0;
BC055A4?>AC4AQ 17>?0; Finance industry. In the years
to come, Atul plans to work
Khekade.
The book gives us a clear
Twitter has been a major
platform to redress public griev-
at its new campus.
Before the valedictory M e Ki Gai, a page-turner
fictional novel, authored
close to the grassroots level to
ensure Fintech/Blockchain-
vision of what we really want to
do in life, whether a person will
T he orientation programme
of first batch of Public
Relations officers of MP
ances. He also called upon pub-
lic relations officers for blogging.
Chairing the session, Vice
function, experts of different
fields addressed sessions, and
interacted with participants.
by serial entrepreneur Atul
Khekade, shares the tale of a
young man discovering 'ikigai',
based banking reaches every
person in the world enabling
financial freedom.
be happy doing it, whether
there is a commercial scope.
One can get to know them by
Government concluded today Chancellor Prof KG Suresh said Joint director (news) of happiness, love, and riches. "As a first-generation connecting to a higher-level
in Makhanlal Chaturvedi the orientation programme was Doordarshan centre Bhopal, Ikigai is a Japanese concept entrepreneur, I have had my consciousness.
National University of a forum for idea exchange. Puja P Vardhan, Editor of about the reason for own share of struggles. Though This can be self-realization
Journalism and Human interest stories related Bansal News Sharad Dwivedi, being. there are some books on ikigai, or conversation with an exter-
Communication, Bhopal. In with success of government Director and Founder of Atul Khekade is a writer, they make it look like it's some nal person who has explored
the valedictory function, programmes can be placed in GreyMatters Communication Financier, and Entrepreneur. As sort of a quick fix or magical that depth in life. In some cases,
Director, Public Relations, media. Third party endorsement Navneet Anand, HoD of New a serial entrepreneur, Atul has wizard that can change your life it can be a godlike person cre-
Ashutosh Pratap Singh said a should be made in press releas- Media Technology Department built a global distribution sys- suddenly. ated through a figment of one's
public relations officer must be es. The Vice Chancellor said that Prof P Sasikala, former DG of tem for Air Charter Industry Finding one's free flow is imagination, or maybe the god
updated with changing media the University will develop a Doordarshan Veena Jain, Dean and an executive education more like a journey. My book itself depending on what the
technology and trends and training centre for public rela- of Jagran Lake City University platform. Atul has led a start- 'Me Ki Gai' presents this con- person believes in and what
update his or her skills as per tions officers of not only Madhya Diwakar Shukla addressed the up to build a fraud prevention cept in the form of a fiction works in the case of that indi-
the requirements. Pradesh but across the country, sessions. system in the Banking and novel," said Atul vidual.
\Qe^SXUTQdCF<
mati paana kya jane Look, do The second performance BC055A4?>AC4AQ 17>?0; in drug peddling and trans- The accused were carrying
BC055A4?>AC4AQ 17>?0;
T B
The books like Heart Less
he Bhopalites enjoyed the
calm devotional Bhakti
Sangeet and folk music on
not believe in Nayanva, nor do
you offer hymns like
Ghanshyam to you, and you are
was given by Dharam Singh
Barkade and fellow, Dindori
from a Gond tribal narrative
ilkharia police has nabbed a
miscreant from Gairatganj
porting of liquor illegally.
Police said that the accused
carrying liquor failed to produce
liquor over a scooter bearing reg-
istration number MP04CS4896
which was seized and details of
Author Marissa Mayer, Fact Tuesday at Madhya Pradesh awakened by boat boat focusing on Raja Heera Khan forest area and recovered illegally licence regarding the liquor. The which would be investigated as
$OWKRXJKHYHU\SRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHO\IRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULW\RIRUELQGLQJLQDQ\ZD\RQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQ\UHVSRQVLELOLW\IRUDQ\
GDPDJHRUORVVWRDQ\SHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQ\DFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO\5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULI\DQGVHHNDSSURSULDWHDGYLFHWRVDWLVI\WKHPVHOYHVDERXWWKHYHUDFLW\RIDQ\NLQGRIDGYHUWLVHPHQWEHIRUH
UHVSRQGLQJWRDQ\FRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQ\HPSOR\HHRIWKH3LRQHHU*URXS·VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQ\NLQGRIFODLPPDGHE\WKHDGYHUWLVHUVRIWKHSURGXFWV VHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQ\NLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV
XR_X+D25TYZVWDf\YSZc
3C4>A60=8I4B>=;8=4CA08=8=6F>A:B7>?
1W^_P[) CWT3T_Pac\T]c^UCTRW]XRP[4SdRPcX^]Xb_a^eXSX]VP]
BC055A4?>AC4AQ 17>?0; ^__^acd]Xchc^cWTbcPcT³b4]VX]TTaX]VP]S?^[hcTRW]XRbcdST]cbc^
d]STabcP]SP]S[TPa]cWT]dP]RTb^U\^STa]R^dabTb[XZT0acXUXRXP[
8]cT[[XVT]RT<PRWX]T;TPa]X]VP]S3PcPBRXT]RT0]^][X]TcaPX]X]V
?=BQ 10C78=30270=3860A7 Punjab also. It is conspiring to
set our peace-loving Hindu
believes only in emotionally
exploiting the farmers’ sacrifices
W orld develops with time,
but never changes for
women. Women are exploited
f^aZbW^_WPbQTT]^aVP]XiTS^]3TRT\QTa 'P]S (d]STacWTY^X]c
PTVXb^U<XRa^b^Uc2^\_P]hP]SCTRW]XRP[4SdRPcX^]3T_Pac\T]cCWXb
caPX]X]VfX[[QTUaTT^UR^bc4]VX]TTaX]VbcdST]cbfX[[Y^X]cWTcaPX]X]V
T earing into the Bharatiya
Janata Party (BJP) over the
farmers’ protest, the Shiromani
brethren in Punjab against
their Sikh brethren with whom
they have shared strong bonds
but remains so ungrateful to
them that it is painting them as
anti-national,” he said.
even today, just the methods
have changed," said the ace
actor of Bollywood Annu
f^aZbW^_^]3TRT\QTa 'P]S?^[hcTRW]XRbcdST]cb^]3TRT\QTa (
BcdST]cbUa^\P[[QaP]RWTbRP]cPZT_PacX]cWXbf^aZbW^_BcdST]cb
Akali Dal president Sukhbir of blood for centuries. The BJP “Today, it is the farmers. Kapoor. fX[[QTX]ca^SdRTSc^[PQTgTaRXbT^U0acXUXRXP[8]cT[[XVT]RT<PRWX]T
Singh Badal on Tuesday wants to replace those bonds of Nobody knows what the BJP The actor was in Bhopal on ;TPa]X]VP]S3PcPBRXT]RTQhbdQYTRcTg_TacbX]cWXb"W^da^][X]T
accused party’s former ally of blood with bloodshed.” might say even about soldiers Tuesday to talk about his bTbbX^]BcdST]cbfX[[P[b^QTPQ[Tc^PbZ`dTbcX^]b^][XeT
being “the real tukde-tukde Continuing to train guns at tomorrow if it suits that party. upcoming web series RWPcBcdST]cbfX[[QTTeP[dPcTSPccWTR^]R[dbX^]^UcWTf^aZbW^_
gang” and destroying the the BJP, he said that the saffron The farmers are hurt and angry Purushpur. Known for his bril- CWXach`dTbcX^]bfX[[WPeTc^QTP]bfTaTSQhcWT\X]!\X]dcTb>]
national unity by maliciously party has been resorting to against the BJP and not against liant work in movies like bR^aX]V%_TaRT]c^a\^aTcWThfX[[QTVXeT]PRTacXUXRPcTQh
“pushing patriotic Punjab into dangerous conspiracies to sab- the Government,” he said. Tezaab, Vicky Donor, Jolly LLB <XRa^b^Uc
communal flames” for political otage the hard-earned atmos- Later, in a statement issued 2 and many more, the actor will
gain. phere of peace and communal from the party headquarters in now be spreading his charm in =^cTSPRc^a0]]d:P_dacP[ZX]Vc^\TSXP_Tab^]bX]1W^_P[^]CdTbSPh 2<<>DA=B34<8B4>590H0=CA0>1706F0C
“BJP is the real ‘tukde- harmony just for the realization Chandigarh, Sukhbir said: the upcoming web series ?X^]TTa?W^c^ 1W^_P[)2WXTU<X]XbcTaBWXeaPYBX]VW2W^dWP]aTPRWTSAXbWX=PVPaP]S
tukde’ gang in the country of petty political goals. “BJP “SAD deems its national duty to 'Purushpur'. \TccWT1WPVfPcUP\X[h2WXTU<X]XbcTa2W^dWP]Tg_aTbbTSVaXTU^eTa
today. It has been splitting the leadership must realize that caution the countrymen against Talking about the series, brilliant sets and the questions Kapoor said, "Censorship on cWTST\XbT^U9PhP]caP^1WPVfPc^U]PcX^]P[XbcXST^[^Vh2W^dWP]_PXS
country into pieces by setting their party today has become BJP’s desperate and destructive Annu Kapoor said, "Women being raised on society are the the OTT platform is a matter U[^aP[caXQdcTbc^1WPVfPc2WXTU<X]XbcTa2W^dWP]\Tc;PcT9PhP]caP^³b
one community against anoth- the most powerful divisive game-plan in Punjab.” have been exploited for cen- USP of this web series," he under consideration. Self-con- UP\X[hP]SR^]b^[TScWT\2W^dWP]aTPRWTSBP[PXhP]TPa1W^_P[P]S
er. So desperate it is for power force. It has been resorting to “This party is desperate for turies and even are exploited said. trol is more important than Tg_aTbbTSWXbR^]S^[T]RTb^eTacWTST\XbT^U?PcT[;PcTAPYZd\Pa
and has no scruples about tak- dividing the country and its power that it has no qualms today, just the methods of bus Talking about the movies, censorship. There has been <P[eXhPYX?X_[XhPfP[T2WXTU<X]XbcTa2W^dWP]\TccWT\T\QTab^U
ing the communal polarization people by spreading hatred in about making Punjabis thirst exploitation have changed. Our he said, "The cinema will return too much obscenity." cWTQTaTPeTSUP\X[h7T^UUTaTSU[^fTab^]cWT_^acaPXc^U<P[eXhPP]S
route and setting the country the name of religion,” he said. for one another’s blood and upcoming web series to its charm soon. As soon as On asking about _PXSW^\PVT
on communal flames,” he said Referring to the ongoing destroy the fabric of unity and 'Pauruspur' is also based on the we will overcome this pan- Purushpur, he said, "Bhopal has
while talking to the mediaper- farmers' movement, Sukhbir fraternal love which has been exploitation of women." demic the movies will be back never been governed by such
sons at Bathinda.
Sukhbir said: “The BJP
first set the Hindus against the
said that the whole country,
except that BJP, gratefully
acknowledges the debt which we
bequeathed to us by the great
Guru Sahiban and by great
saints and seers like Kabir
He said that Purushpur
will unveil the topics like love,
lust, blood-soaked swords,
in theatres." He further said,
"It's not that the web series has
overtaken the film world, but
cruel leaders and this web
series has no connection with
Bhopal." Annu Kapoor was
=YcSbUQ^dcgX__`U^UT
Muslims. Now, it is determined
to replay that evil game and re-
enact the same tragedy in
owe to our patriotic farmers and
soldiers. “The BJP is provoking
the people to deny that debt. It
Sahib, Baba Farid , Jaidev ,
Namdev and others,” he
added.
royal vengeance, patriarchy
and power fight and gender
struggle. "Wonderful dialogues,
it is the new wave of enter-
tainment."
About censorship, Annu
born in Bhopal. He has been
working in the industry for
more than 30 years .
VYbUQd# ib_\T]Q^#
TQicQW_^QRRUT
&KLOOLQJ&ROGSUHYDLOVWHPS BC055A4?>AC4AQ 17>?0; the same. The two had a fight
WRGLSE\GHJUHHVLQQLJKW
three years ago and from then
2aX\TQaP]RWW^[Sb\XbRaTP]cb #UPa\TabaTcda]X]VUa^\BX]VWd_a^cTbcZX[[TSX]bT_PaPcTPRRXST]cb
X]e^[eTSX]a^QQTaXTbQdaV[Pah 2QHGLHVRI
KHDUWDWWDFN
7_fdd_`b_fYTUQccYcdQ^SUd_
truck in Haryana’s Karnal dis-
trict. In the accident, which
took place on Taraori flyover in
to Saphera under Sadar Police
station in Patiala.
In another road mishap,
BC055A4?>AC4AQ 17>?0; repay borrowed money he
started to commit robberies
the victim Yasmeen was robbed
while she was on her way back
Karnal, a third farmer was
seriously injured while some
two more farmers from Punjab
died while seven others were VQ]Y\YUc_VTUSUQcUTVQb]Ubc
?=BQ 270=3860A7
T he crime branch police of
Bhopal has nabbed two
and burglary.
Later, in the investigation
to home with her husband
Ubed.
others sitting on the trolley
escaped with minor injuries.
injured when their vehicle col-
lided with a truck near
Chief Minister Capt
Amarinder Singh, expressing
Amarinder said: “Punjab
Government will provide all
miscreants near Lalghati when
accused was doing recce on
Monday; accused confessed
the accused confessed three
robberies in Koh-e-Fiza and
one in Gandhi Nagar area.
A complaint was lodged by
the victim with the police and
in her complaint she stated that
P unjab’s four farmers, who
were returning from the
protest sites near Delhi borders,
Taraori police station’s
SHO Inspector Sachin said
that the two deceased were
Bhagomajra in Mohali on
Tuesday.The police officials
said that deceased Deep Singh
grief over the death of five
farmers, said that the State
Government will provide assis-
due assistance to the families of
deceased farmers as well as take
care of treatment of all the
committing four robberies and One burglary was committed when she reached near Data were killed in two separate road aged around 24 years and 50 was a resident of Mohali district tance to the families of injured (sic)”.
1 burglary in past one month, in Koh-e-Fiza area. Colony she was attacked by accidents on Tuesday, while years respectively.Police further while Sukhdev Singh Dadiana deceased farmers as well as take Meanwhile, the farmers’
valuables worth Rs 3.1 lakh Police have recovered four bike borne miscreant and another one died of a heart said that one of the farmers, was a native of Fatehgarh Sahib care of treatment of all the organizations on Tuesday
were recovered from his pos- mobile phones, one purse, Rs robbed her bag carrying a attack in Delhi.As the number travelling in the tractor trolley, district. injured. announced that tributes would
session. 10000 cash, one motorbike mobile phone, Rs 700 cash and of farmers dying during the told them that the truck driver Out of the injured farmers, “Saddened to learn of be paid on December 20 to the
Police said that acting on a and one scooter worth Rs 3.10 documents. protest increasing with each appeared to have fallen asleep four, who were wounded seri- demise of our five farmers. farmers who lost their lives
tip off miscreant was who was lakh. The incident took place at passing day, Punjab Chief behind the wheels which led to ously, have been referred to the Labh Singh Ji and Gurpreet during the farmers’ agitation.
doing recce at Lalghati area and Meanwhile, a 22-year-old around 11.30 pm. The victim Minister Capt Amarinder the accident.The truck driver Post Graduate Institute of Singh of Patiala met with an “On December 20, from 11 am
when he quizzed robberies married woman was robbed of and her husband were not able Singh on Tuesday assured assis- managed to flee from the spot, Medical Education and accident in Karnal, Sukhdev to 1 pm, in all the villages of the
and burglary was confessed by her purse carrying mobile to notice the registration num- tance to the families of the said the police, adding that a Research (PGIMER) and a Singh and Deep Singh of country, tributes would be paid
him. phone, cash and documents ber of the motorbike of mis- deceased farmers. case under relevant provisions government hospital in Fatehgarh Sahib near Mohali, to the farmers who were mar-
The accused identified as near Data Colony under Koh- creant. The police have regis- In the first incident, two of law has been registered in Chandigarh, said the officials, and Makkhan Khan of Moga tyred during the agitation,”
Abhishek alias Karan Malviya e-Fiza police station area late in tered a case under section 392 farmers from Patiala were connection with the incident. adding that the three others who died of a heart attack in said a farmers’ leader address-
of Bihari Colony. Accused is an the night on Monday. of the IPC and have started fur- killed early morning after their The farmers, who were were admitted to a hospital in Delhi (sic),” he said in a tweet. ing the media at
automobile mechanic and to According to the police ther investigation. tractor-trolley was hit by a returning from Delhi, belonged Mohali. In a related tweet, Capt New Delhi.
&RYLG'HDWKWROOFOLPEVWRLQ8¶NKDQG 1^cW_^Xb^]]TRcPaWPeTT\TaVTSUa^\2^eXS_P]ST\XR):WTa
GHDWKV ease to 83502. The authorities
discharged 534 patients from
District hospital Rudraprayag.
The authorities reported
Tehri, 15 from Rudraprayag
and five from Uttarkashi.
?=BQ 347A03D= to be in after returning changed
the scenario. I am basically an
QHZFDVHV
UHSRUWHGRQ
different hospitals of the state
following their recovery on
Tuesday. A total of 75049
177 new patients of the disease
from Dehradun, 104 from
Nainital, 60 from Pithoragarh,
The state now has 6089
active cases of the disease.
Dehradun is maintaining its
T he Covid-19 pandemic has
been like a churning out of
which both poison and nectar
optimistic person and see a ray
of hope in even the worst sit-
uations. A few days into my
7XHVGD\ patients have so far recovered
from the disease and the recov-
25 from Udham Singh Nagar,
24 from Uttarkashi, 18 from
lead at top of the table of
active cases with 1897 cases
have emerged. It has also taught
many that one basically needs
quarantine in Mumbai, I heard
birds chirping and on hearing
?=BQ 347A03D= ery percentage now stands at Haridwar, 17 each from while with 834 active cases three things- getting back to a koel I whistled back in reply.
89.88 percent. Chamoli and Pauri, 16 from Nainital is at second spot. parents/family, essential com- The birds chirping and a clear
T he contagious pandemic
Covid-19 has so far taken
a toll on the lives of 1373 peo-
Two patients of Covid-19
each were reported dead at
Sushila Tiwari government
Almora, 13 each from
Champawat and Tehri, eight
from Bageshwar and four from
Haridwar is at third spot with
517 active cases. Pithoragarh
has 434, Pauri 389, Almora 349,
modities like food and clothes,
and a WiFi connection to stay
in touch with the world. Noted
blue sky were something sel-
dom
Mumbai.”
experienced in
ple in Uttarakhand. On hospital Haldwani, Mahant Rudraprayag. Out of 524 Chamoli 327, Tehri 319, actor Anupam Kher said this Kher further opined that
Tuesday, the state health Indiresh hospital and the patients discharged, 140 are Udham Singh Nagar 293, after releasing his book ‘Your with their arrogant ways,
department reported the death Kailash hospital Dehradun on from Dehradun, 77 from Uttarkashi 260, Bageshwar 191 Best Day is Today!’ at the the oldest bookshop in March 20 and saw the fear of humans had spread mayhem in
of 11 patients of the disease. Tuesday. One patient each suc- Nainital, 61 from Pithoragarh, and Rudraprayag 146 active Natraj Bookshop here on Dehradun for this purpose. an invisible disease in the peo- the world. “However, during
The department also reported cumbed at Himalayan hospital, 57 from Haridwar, 43 from cases of the disease. With 133 Tuesday. He said that this was Speaking about the book ple. In my 36 years as an actor the pandemic even death
496 fresh cases of the disease on Synergy hospital Dehradun, Almora, 40 from Pauri, 32 active cases of Covid-19, the first occasion when he was he said, “I learnt about the pan- I have never taken a holiday became a figure sans feelings.
the day which increased the HNB base hospital Srinagar, from Udham Singh Nagar, 21 Champawat is at the bottom of physically releasing his third demic when I flew back from from work but the Covid pan- In my experience it removed
tally of the patients of the dis- Jaya Maxwell hospital and from Champawat, 19 from the table book anywhere and had chosen New York to Mumbai on demic and the quarantine I had the fear of death.
IHimachal
n a blow to the financial
health of Punjab, Haryana,
Pradesh and Jammu
and Kashmir, the farmers
protest has resulted in daily loss
of C3,500 crore. This means
these States reported to have
incurred over C70,000 crore
due to the ongoing protest. A
traders body in Delhi has esti-
mated over C5,000 crore loss
while the Northern Railway has
incurred losses worth roughly
C2,000-C2,400 crores due to the
ongoing farmers’ protest. D]RTacPX]chPa^d]ScWT impact of the agitation is more
According to top industry caP]b_^acPcX^]^UUPa\ acute for industries in hilly
and commerce federations, a _a^SdRcbc^cWT\PY^a regions of Himachal Pradesh,
?=BQ =4F34;78 persons for commission of daily loss of C3,000 crore to \PaZTcb^U3T[WX=2A Uttarakhand, and Jammu and
offences Indian Penal Code 3,500 crore is resulting in R^d[S[TPSc^ Kashmir which are dependent
?=BQ =4F34;78 Cases have come down to Noting that Delhi has
T he Enforcement Directorate
(ED) has filed a prosecution
complaint (chargesheet) before
Sections relating to criminal
conspiracy, criminal breach of
trust, cheating and forgery
economies of the region from
the value chain and transport
disruption because of protests.
bXV]XUXRP]c[^bbTbc^
cWTUPa\bTRc^aX]
on transport of the goods by
road.
There are fears that the
almost 22,000. This is the kind made progress, he said, “We the Special Court, PMLA, among others. They said the detours due to cWTbTBcPcTb uncertainty around the trans-
T he Government on Tuesday
said that Covid-19 cases
and deaths are declining in
of number we all experienced
in July. So that is very reassur-
ing. As a nation, we seem to be
congratulate the Delhi
Government as also all the
other governments who have
Ahmedabad against Hirak
Biotech Ltd and its directors
Pratik R Shah and Niketa
“The said charge sheet dis-
closes that Pratik R Shah in con-
spiracy with other accused
blockades of highways are lead-
ing to 50 per cent more time
and distance for movement of
IT have become their lifeline.
Besides, vibrant services sectors
including tourism, trading,
portation of farm products to
the major markets of Delhi-
NCR could lead to significant
India which is “a very reassur- now doing very well. done so well in contributing Baldevbhai Dave under fraudulently availed loan/over- goods that can lead to 8-10 per transport and hospitality, have losses to the farm sector in
ing trend”, but cautioned the “We are saving lives. But towards such a significant con- Prevention of Money draft facility against FDs from cent increase in logistics costs, added to the strength of the these States.
citizens not to let their guard remember, this cannot be taken trol (in cases) in recent times.” Laundering Act (PMLA) in a the bank and also increased thus leading to rise in prices of regions, known for their enter- During winters, tourism
down as an overwhelming pro- for granted. An overwhelming Dr Paul, however, loan default case of Ahmedabad overdraft limit without any res- daily items and essentials. prising farmers, entrepreneurs sector is a major revenue and
portion of the country’s popu- proportion of our population is expressed concern over the Peoples Cooperative Bank Ltd. olution and withdrew beyond ‘’The size of the combined and innovators. livelihood source in these con-
lation is still “very very sus- still very very susceptible to the Covid-19 situation in some Besides Hirak Biotech Ltd the overdraft limit without any economies of Punjab, Haryana, While the Confederation of tiguous States. But there is
ceptible” to the virus and the virus. And the situation can states like Uttarakhand, and its directors, Platinum security. In this manner the Himachal Pradesh and J&K is Indian Industry (CII) said the apprehension that the farmers’
situation may escalate unex- escalate unexpectedly,” Paul Nagaland and Himachal Corporation Ltd. were involved accused defaulted the loan sanc- about C18 lakh crore. With the disruption in supply chain and protest is likely to adversely
pectedly. said while cautioning against Pradesh and stated all efforts to in the siphoning of bank loan tioned by APCBL and thereby ongoing farmers’ agitation and logistics due to the agitation by impact the sector this winter.
“While there is a continu- any laxity. control the spread are being availed from Ahmedabad causing loss of C25.25 crore to blockade of roads, toll plazas farmers in many parts of India The period from December to
ous increasing trend in Covid- He further said the reas- made in collaboration with Peoples Cooperative Bank Ltd., the bank, it said. and railways, the economic will have a bearing on the March is critical due to the
19 cases and deaths globally, suring thing is that people are these governments. the ED said. Investigation under PMLA activities have come to a halt,” economy over the coming days vacation period and the snow-
particularly in America and saying the R0 has come below Union Health Secretary On December 8, a provi- revealed that accused Shah and said ASSOCHAM President and may impinge the ongoing fall in the mountains.
Europe and the situation in the one which means the pan- Rajesh Bhushan said that more sional attachment order was Niketa Baldevbhai Dave, direc- Niranjan Hiranandan said on recovery from the economic On the other hand, the
world is becoming worrisome, demic is shrinking. “So we than 15.55 crore tests have issued under PMLA on identi- tors of Hirak Biotech Ltd. tried Tuesday. Assocham urged the contraction due to Covid-19 Confederation of All India
in contrast the scene in India should be happy about that but been conducted so far for fication of Proceeds of Crime in to transfer/dispose off 16 plots Government and farmers’ pandemic. Traders (CAIT) said in the last
is satisfying as the cases and cautiously happy,” he said as he detection of coronavirus infec- the form of 16 plots located at held in the name of Hirak organisations to resolve the The CII said the farmers’ 20 days, trade and other activ-
deaths are declining,” Dr V K added that “looking at the pre- tion in the country, and the village Sachana, Taluka Biotech Ltd. Accused Dave, was impasse over the new agri-laws protests, which have intensified ities of about C5,000 crore have
Paul, member (health) at NITI sent global scenario, a second cumulative positivity rate has Viramgam in Ahmedabad dis- arrested on October 13 this year as the disruption caused by over the past couple of weeks, been affected in Delhi and its
Aayog, said at a presser here. or third peak may occur in declined to 6.37 while the aver- trict worth Rs 10.07 crore . and is in judicial custody. Now, farmers’ protests was resulting have led to obstruction of traf- surrounding states. According
More than 94 lakh patients India, though it is impossible to age daily positivity rate during These attached assets were held after attachment of the Proceeds in a huge daily loss. fic and road blockades across to an estimate, about 30 to 40
have recovered from Covid-19 do a definite prediction.” last week was 3.00 per cent. in the name of Hirak Biotech of Crime to the tune of C10.07 Though the economies of multiple checkpoints in the percent of the goods coming to
in the country, while present- Dr Paul specially men- India’s Case Fatality Rate Ltd, Ahmedabad, the agency crore, Prosecution Complaint Punjab, Haryana and Himachal northern states of Delhi-NCR, Delhi have been affected by the
ly there are only about 3.4 lakhs tioned that Uttarakhand, (CFR) is also among the low- said. has been filed before the Special Pradesh are predominantly Punjab, Har yana, Uttar movement of farmers, which is
active cases and it is declining Nagaland and Himachal est in the world. At present, ED initiated investigations Judge for confiscation of the based on agriculture and hor- Pradesh and Rajasthan, and in adversely affecting the trade
further. Pradesh have a high proportion India’s CFR is 1.45 per cent, under PMLA on the basis of a attached assets apart from ticulture, several industries like smaller measure, in many other and other activities of Delhi
“Mortality is declining and of cases that needs to be con- whereas globally it is 2.26 per charge sheet filed by CID, awarding punishment to the food processing, cotton textiles, States. and neighbouring States, the
it is well below 400 per day. trolled. cent, Bhushan said. Gandhinagar against various accused persons, it added. automobile, farm machinery, As per the estimates, the traders’ body stated.
?PcT[´bTUU^acbc^X]cTVaPcT$% B2PbZbBcPcTbc^VXeTC!:_Ta\^]cWU^aTSd^URWX[SaT]aTbc^aTSfXcWUP\X[XTb
_aX]RT[hBcPcTbfXcW8]SXPfX[[ ?C8Q =4F34;78 each child who was in a child
care institution (CCI) and has
Taking note of the plight of
children who are residing in
A bench headed by Justice
L Nageswara Rao also said state
The top court said that it
might be necessary for the states
cation and this amount has to be
given at the recommendation of
3;A aRcej`WURT`Zed+5ZUZ`_:AD`WWZTVcd¶cVTR]] 6XYHQGXPD\MRLQ%-3RQ)UL B0D60AB4=6D?C0 Q :>;:0C0 Adhikari who addressed a either left the party or had been
B0D60AB4=6D?C0Q :>;:0C0 high alert whenever there is a ±3daX]VcWTXaad[T Pradesh connections Banerjee asked, “on what surety they are huge rally at Haldia on Tuesday singing rebellious tunes saying
T\_[^h\T]cWPbbWad]ZQh#
A mid reports that the
Ministry of Home Affairs
VVIP movement … but one
has also to explain why there
would 50 vehicles in the VVIP’s
_TaRT]cP]SWTaTcWThWPeT
said “truth to be told the BJP is
a party of Chambal dacoits who
have come to loot Bengal and
distributing employment cards
to the people… my question is
what will this job card to …
R ebel Trinamool Congress
leader and former State
Minister Suvendu Adhikari is
is the son of powerful Trinamool
Congress satrap and former
Union Minister Sisir Adhikari,
there were people who after
profiting from the party for all
these years were ditching it.
R^\TfXcWY^QRPaSbc^[daT
could send a notice to Bengal convoy and why vehicles of cWT_T^_[TCWXbfX[[]^c ravage its unity by creating divi- what validity it has,” alleging likely to join the BJP in a week’s also an MP. His younger broth- Apparently referring to
Chief Secretar y Alapan criminals including a convict- bTaeTP]h_da_^bTPbcWT sion among the people of this during the BJP’s tenure the time his close aides said. In fact er Divyendu is also a TMC MP. Adhikari’s differences with her
Bandopadhyay seeking clarifi- ed person should follow him,” State.” national employment had Adhikari, rated as the most Dropping hints about nephew Abhishek Banerjee, she
cations as to why the three IPS Banerjee said at a rally in _T^_[TfX[[aTYTRccWT\²bWT Despite being a party of shrunk by 40 percent. powerful mass leader in the Suvendu Adhikari’s saffron plans said “The question is not of hier-
officers requisitioned on Jalpaiguri in North Bengal. bPXS outsiders the BJP won all seats “During their rule TMC after CM Mamata his close aide Kanishka Panda archy we but of serving the peo-
Central deputation were not Wondering as to why the summoned by it. This apart the the seats in North Bengal in the employment has shrunk by 40 Banerjee may join the BJP as who was last week expelled ple… will stand by people and
released by the State Central Government would State administration also failed 2019 general elections, percent and here they have early as on Friday, sources said. from the party said “Bengal, par- fight for them. That is our
Government, Chief Minister interfere in law and order mat- to release the three IPS officers Banerjee grudgingly told her come with job cards to lure the According to sources ticularly the western part of the resolve... After profiting from the
Mamata Banerjee on Tuesday ters which was exclusively a --- in charge of Nadda’s secu- audience. “They came from people. This will not serve any Adhikari — who held an apo- State will see a saffron storm in party and the Government some
called the BJP a party of dacoits State subject Banerjee said it rity --- called on central depu- outside and won all the seats in purpose as the people will litical rally at Haldia on Tuesday 2021 Assembly elections.” people are hobnobbing with
and slammed it for subverting went against the federal norms. tation. North Bengal while TMC did reject them,” she said. — would first resign his mem- On Adhikari’s joining the other parties.”
federal norms. “The question is why should Raising the pitch of her not win a single seat... I want On Darjeeling Gorkha bership in the State Assembly saffron outfit he said we have Apart from Adhikari a
The three IPS officers --- the Central Home Ministry call attack the Chief Minister called to ask what was our fault … issue she said “the BJP has been before flying to Delhi on already been with the saffron number of TMC leaders includ-
an IGP, a DIG and an SP- IPS officers of a State cadre on the BJP a party of dacoits say- Are they Ramakrishna creating divisions not only Thursday. On Friday he was ideals as this colour stands for ing his former ministerial col-
ranked officers --- in question deputation without the State’s ing “they always accuse others Paramahansa or Swami among religions but also in the likely to join the BJP in presence sacrifice and there is no other league Rajiv Banerjee, Asansol
were in charge of BJP nation- permission … why the State of corruption and theft but I Vivekananda … no they are not Hills by giving false hope to the of senior leaders like Amit Shah leader in Bengal who has done Mayor and MLA Jitendra
al president JP Nadda’s securi- Government should be coerced must say the BJP is the biggest … they only spread hatred Gorkha population about the and JP Nadda before flying a bigger sacrifice than him.” Tewari, other Legislators like
ty when his convoy was to release the said officers,” she party of thieves… in fact it is and divide people,” Banerjee creation of a new Gorkhaland back to Kolkata the next day Meanwhile, Chief Minister Mihir Goswami, Sil Bhadra
attacked by alleged Trinamool asked. a party of dacoits …” said. … but the leaders like Bimal with the Union Home Minister. Mamata Banerjee for the first Dutta etc, Coochbehar MLA,
Congress men on December 10 The Bengal Chief Secretary Stopping short of naming Slamming the saffron out- Gurung have seen through The two leaders might hold a time since Adhikari’s rebellion Basunia have openly expressed
while he was going to attend a and Director General of Police leaders like Nadda and his fit for giving false employ- their ploy and returned to the joint rally at East Midnapore on on Tuesday made a circuitous decent in the party. In fact
meeting at Diamond Harbour. had skipped an appearance in party colleague Kailash ment promises to the people of Trinamool fold after sitting in Saturday. Shah is coming to reference of him and many Goswami has already joined
“The security remains on the Home Ministry after being Vijabargiya who have Madhya Bengal, the Chief Minister their lap for six years.” Bengal in a two-day visit. other leaders who had recently the saffron outfit.
- . *RYWLQYLWHV,PWLD]$OL
assembly election would be a emerging in the State and that
=APX[fPh6<QaXTUbPQ^dcbcPcdb^UDB1A; BWPaYTT[8\P\´b repeat of the Local body elec-
tion and this is the reason
is the need of the hour,” said
septuagenarian P Rajan, former
_a^YTRcbWPaTbAPX[fPhbeXbX^]U^a9: QPX[_TcXcX^] behind the confidence of the senior editor, Mathrubhumi, a
WRSURPRWHDUWDQGFXOWXUH
Congress,” said K Sudhakaran, Malayalam daily.
_^bc_^]TS]Tgc
MP and veteran Congress The CPI(M) candidates for
Jammu: Ashutosh Gangal, leader. the local body election have
Northern Railway General The Congress-led UDF deliberately avoided their party
?8>=44A=4FBB4AE824Q
90<<D
translated into best
cinematic presen-
Manager, who is on a visit to
see the Railway work sites in
WTPaX]V^]3TR & had swept the Lok Sabha elec-
tion held in 2019 May and most
symbol (hammer and sickle)
and this has surprised many
tations. He said that J&K held a press conference in Aligarh: The hearing on the of the seasoned political com- followers of the party. “It is due
#$$"]_bUdUcd
and Army Infotech Company
! iUQb_\TWYb\bQ`UTRi $08ZLOODXGLW%DVLF
(GX'HSWLQ$OLJDUK
0<DUPRd[chVXeTb[TRcdaT^]
=PcX^]P[?T]bX^]BRWT\T N ow people will not only buy
ration from Government
has made an agreement for
West U.P. The Army Infotech
i_edXY^E@c6Yb_jQRQT ration depot but will also be able Company has prepared an E-
`_cYdYfUY^=QXQ
0[XVPaW)CWTaTb_^]bXQX[Xch^U 0[XVPaW) CWT=PcX^]P[?T]bX^] to deposit electricity bills of Wallet mobile app which will be
b^RXP[PdSXcWPbQTT]VXeT]c^cWT BRWT\TVXeTbP]^__^acd]Xchc^ their homes, shops, the factory installed on the dealer’s mobile.
QSSecUTQRcS_^TY^W 0[XVPaW<db[X\D]XeTabXch0<D
^]cWTX\_[T\T]cPcX^]^U
X]eTbcP]SPRRd\d[PcTbPeX]VbP]S
VTc[d\_bd\P\^d]cPbaTVd[Pa
here. For this, the login ID of the
E-Wallet will be given to all 1352
Its login ID and password will be
given to the ration dealers. After
Firozabad (UP): A 10-year-old At the time, a 20-year-old V^eTa]\T]cbRWT\TbPccWT X]R^\TcWa^dVWP]]dXch_[P]^] ration dealers of the district. this, the dealers will recharge
C=A067D=0C70Q <D<108 girl was allegedly raped by a man from the same village bRW^^[aTbXST]cXP[bRW^^[1B0 aTcXaT\T]cbPXS?a^U<BWPZTT[ The dealers will receive a their E-Wallet, after which he
youth in a village in Uttar caught her and raped her, ^UUXRT01B0^UUXRT1[^RZ 0W\TSBP\SP]X3TP]5PRd[ch^U commission of Rs. 17 per bill for will charge from the public the
ATb^daRT2T]cTa1A2^UcWT ;Pf0[XVPaW<db[X\D]XeTabXch
T he Covid-19 situation con-
tinued to be very much
under control in Maharashtra
Pradesh's Firozabad district,
police said on Tuesday.
The incident took place
Jasrana police station SHO
Jitendra Kumar Dwivedi said.
An FIR was registered on
3T_Pac\T]c^U1PbXR4SdRPcX^]
PRa^bbcWTSXbcaXRcCWT0<DcTP\
0<D7TfPbST[XeTaX]VP[TRcdaT
^]=PcX^]P[?T]bX^]BRWT\TP]S
depositing a bill ranging from
Rs. 1 to Rs. 10,000. At the same
time, if the amount of the bill is
cash bill for their electricity bill
and deposit the bill through his
E-Wallet app. For this dealer will
on Tuesday, as 3442 people test- on Monday night in Jasrana Tuesday based on a complaint fX[[TeP[dPcTP]SeTaXUhcWT 6^eTa]\T]cX]cWT]PcX^]P[ more than this, he will get a get a commission of Rs 17 per
ed positive for Coronavirus total infections from 2,91,113 area when the girl was going to by the girl's family members, he PePX[PQX[Xch^U_Ph\T]cP]SR^]cT]c fTQX]Pa^aVP]XbTSQhcWT commission of 0.5 % to the total bill ranging from Rs 1 to Rs
and 70 more people died of the to 2,91,634. her home after attending a said adding that attempts are on \PSTR^]RTa]X]VbRWT\TbX] 3T_Pac\T]c^UI^^[^Vh?6 amount. From this week, this 10,000 and above it will be
pandemic in various parts of Meanwhile, the number of party hosted by a former village to arrest the accused, who is :PbcdaQP6P]SWXATbXST]cXP[ 2^[[TVTBWXZ^WPQPS5Xa^iPQPS plan is ready to be implement- given as 0.5 percent of the billed
the state. “active cases” total cases in the head. absconding. PTI BRW^^[b1A2P]S^UUXRTb DccPa?aPSTbW ed. District supply officer Rakesh amount.
A day after Maharashtra state dropped from 72,383 to
recorded 2,969 infected and 60 71,356. The fatality rate in the
fatalities, the number of infec- state stood at 2.56 per cent.
tions went up by 473, while the Pune district, which con-
deaths rose by 10 in the state. tinued to be the worst-affected
With 3442 fresh infections, city-district in Maharashtra,
the total infections climbed saw the total number of cases
from 18,83,365 to 18,86,807. increase from 3,62,793 to
Similarly, with 70 new deaths, 3,63,284, while the total num-
the Covid-19 toll in ber of deaths in Pune increased
Maharashtra went up from from 7631 to 7642.
48269 to 48,339. Thane district remained
As 4,395 patients were dis- in the third spot --after Pune
charged from the hospitals and Mumbai – after the total
across the state after full recov- number of infections rose from
ery, the total number of people 2,48,028 to 2,48,371, while the
discharged from the hospitals total deaths climbed from 5404
since the second week of March to 5408.
this year rose to 17,66,010. Of the 1,18,06,808 samples
The recovery rate in the state sent to laboratories, 18,86,807
rose marginally from 93.54 have tested positive (15.98 per
per cent to 93.60 per cent. cent) for COVID-19 until
With seven new deaths, the Tuesday.
Covid-19 toll in Mumbai went Currently, 5,24,059 peo-
up from 10,984 to 10991, while ple are in home quarantine
the infected cases went up by while 4316 people are in insti-
521 to trigger a jump in the tutional quarantine.
^_]X^]
17>?0; kF43=4B30H k3424<14A %!!
gggTQY\i`Y_^UUbS_]
%
UPRTQ^^ZR^\SPX[h_X^]TTak /CWT3PX[h?X^]TTak X]bcPVaP\R^\SPX[h_X^]TTa
5HSHDWHGIDLOXUHV
A2A6CH:E9A2DD:@?
FaW`cdR]V
:LOO$LU,QGLDILQDOO\ILQGVRPHRQHRWKHUWKDQWKH
*RYHUQPHQWRI,QGLDWRIXQGLW"
$ CWT^]V^X]V8]SXP2WX]PbcP]S^UUhTcPVPX]_^X]cbc^8]cT[[XVT]RT[P_bTbP\XS
LU,QGLDIRU\HDUVKDVEHHQRQHRI,QGLD·VPRVWJOR
ULRXVH[DPSOHVRIDZKLWHHOHSKDQWQRWMXVWEHFDXVH
WKHDLUOLQHRSHUDWHG%RHLQJ¶-XPER-HWV·SDLQW
HGLQZKLWH0XFKOLNHRWKHU3XEOLF6HFWRU(QWHUSULVHV aT_^acbcWPccWT2WX]TbTV^cfX]cTafPaUPaTcaPX]X]VUa^\2P]PSXP]U^aRTb
WKHDLUOLQHEHFDPHDZD\IRUSROLWLFLDQVDQGEXUHDXFUDWV
WRUHSD\IDYRXUVZLWKLQIODWHGOHDVHVDQGSXUFKDVHVRI
DLUFUDIWDQGVHUYLFHV$QGHYHUVLQFHWKHGD\VRIWKH$WDO
%LKDUL9DMSD\HH*RYHUQPHQWWKHDLUOLQHKDVEHHQRQWKH
VKRSZLQGRZDQGXSIRUVDOH&ULSSOHGE\LWVRZQGHEW
$LU,QGLDKDVIRXQGLWLPSRVVLEOHWRQRWRQO\WXUQDSURI
LWEXWDOVREHFRPSHWLWLYHRQDQXPEHURIFRXQWVDJDLQVW 1C8?;:<47C0
GRPHVWLFULYDOVVXFKDV,QGL*RRQLQWHUQDWLRQDOURXWHV
R
ebel News, a Canadian
$LU,QGLDKDVEHHQKROORZHGRXWE\PDVVLYHURXWHULJKWVDOORWWHGWR$UDELDQDLUOLQHVZKRVH far right news network,
JURZWKKDVEHHQSUHGLFDWHGRQWKH,QGLDQSDVVHQJHU:KLOH$LU,QGLDKDVSOD\HGDPDMRU has obtained 34 pages
of documents called
UROHLQWKHUHSDWULDWLRQRI,QGLDQFLWL]HQVIURPIRUHLJQFRXQWULHVVLQFHWKHSDQGHPLFEHJDQ ‘China Files’ establish-
DQGPDQ\RWKHUHYDFXDWLRQH[HUFLVHVRQRFFDVLRQVHYHQHDUOLHUHVSHFLDOO\ZKHQ6XVKPD ing that Canada has been training
6ZDUDMZDVWKH0LQLVWHURI([WHUQDO$IIDLUVWKHDLUOLQHKDVPDGHDSUHWW\SHQQ\IURPLW the Chinese People’s Liberation
Army (PLA) in cold-weather war-
$QGWKDWZLOOQRWVXEVWLWXWHDVDSROLF\RQFHWKHSDQGHPLFEHJLQVWRZHDURIIDQGDLUWUDY fare at its military institution in
HOEHJLQVLQHDUQHVWDJDLQ%XWWKHIODJFDUULHUDLUOLQHLVQRWFRPSHWLWLYHGRPHVWLFDOO\DQG Kingston, bases in Ontario and at
ZKLOHLWPLJKWJDLQRQLQWHUQDWLRQDOVHFWRUVZLWKWKHULVHRIQRQVWRSSRLQWWRSRLQWWUDYHO the Canadian Forces College,
Toronto. Further, it sent to China
LWIDFHVULVNVIURPRWKHU,QGLDQFDUULHUVVXFKDV,QGL*RDQG9LVWDUD+RZHYHUPDNHQR flag-rank Canadian officers to
PLVWDNH$LU,QGLDLVDSRZHUIXOEUDQGDQGRQHZRUWKVDYLQJHVSHFLDOO\LIWKH*RYHUQPHQW teach PLA officers tactics and
RI,QGLDWDNHVDPDMRUKLWDQGDEVRUEVPXFKRIWKHGHEWDVVRFLDWHGZLWKWKHDLUOLQH$IWHU techniques in high-altitude fight-
DOOZK\ZRXOGDQ\VDQHSHUVRQEX\DQDVVHWZKHUHKHLVFULSSOHGE\SULRUGHEWZKHQLW ing. Nearly 200 Canadian soldiers
participated in the October 2019
ZRXOGEHFKHDSHUWRFUHDWHDQDOOQHZDVVHW,IWKHXQGLVFORVHGELGGHUVIRU$LU,QGLDJLYH World Military Games at Wuhan
WKH*RYHUQPHQWDIDLUSULFHIRUWKHDLUOLQHDQGDEVRUEVRPHRIWKHORVVHVDQGPRVWRIWKH and Canadian sailors and naval
HPSOR\HHVLWFRXOGZHOOEHDZLQZLQIRUHYHU\RQH6XUHZULWLQJRIIWKRXVDQGVRIFURUHV ships celebrated the PLA Navy’s
70th Raising Day at Qindhao.
RIGHEWPLJKWEHDKDUGSLOOWRVZDOORZEXWLWLVDORWEHWWHUWKDQFRQWLQXLQJWRDEVRUEORVV Defence and security relations
HVRUVKXWWLQJGRZQWKHDLUOLQHFRPSOHWHO\ORVLQJDQLFRQLF,QGLDQEUDQGDQGWKRXVDQGV between the countries were par-
RIMREV7KHUHDOUHDG\KDYHEHHQLQWKHSDVWGHFDGHPDVVLYHOD\RIIVDQGPDQ\OLYHVUXLQHG ticularly active during 2018-19
despite the Chinese taking two
ODUJHO\RZLQJWRWKHIDLOXUHVRIDLUOLQHVOLNH.LQJILVKHUDQG-HW$LUZD\VDQGWHQVRIWKRX Canadian civilians hostage. It
VDQGVRIFURUHVRISXEOLFPRQH\KDVEHHQORVWLQWKHVHSULYDWHDLUOLQHVDVSXEOLFVHFWRU seems that the Canadian
EDQNVKDYHERUQHWKHEUXQWRIEDGORDQVWRWKHDYLDWLRQLQGXVWU\ Government under Premier Justin Security Review Commission psyche. Foreign Minister S mine Russia’s partnership with rebutted that “there has been an
Trudeau was keen to maintain report of December 1 which Jaishankar has said that the India. His remarks were direct- enormous military response in
:KLOHWKH*RYHUQPHQWRI,QGLDKDVQRWGLVFORVHGWKHLGHQWLW\RIWKRVHZKRKDYHH[SUHVVHG warm relations and not to dis- describes the eight-month-long Chinese have given India five ed at the US which has been our force deployment”, deflect-
LQWHUHVWLQELGGLQJIRUWKHDLUOLQHLWKDVEHHQVXVSHFWHGWKDWDJURXSRIHPSOR\HHVRIWKH please the Chinese overlooking India-China standoff along the differing explanations for threatening India with sanc- ing the initial omissions of any
DLUOLQHDORQJZLWKDSULYDWHHTXLW\ILUP,QWHUXSVDQG7DWD6RQVDUHDPRQJWKHVXLWRUV$V objections raised by the Trump Line of Actual Control (LAC) as deploying large forces along the tions under the Countering counteractions following
Administration over unintended the most severe border LAC. In its latest response to America’s Adversaries Through delayed detection of intrusions.
WKH0DKDUDMDJRHVXQGHUWKHKDPPHUVRXUFHVLQWKH*RYHUQPHQWKDYHFRQILUPHGWKDWLW consequences of transfer of crisis in decades and accuses Jaishankar speaking at a virtu- Sanctions Act (CAATSA) for The Government is making a
KDVUHFHLYHGPXOWLSOHH[SUHVVLRQVRILQWHUHVW:HVWLOOEHOLHYHWKDWVHOOLQJ$LU,QGLDSLHFH knowledge and information to the China of planning the Galwan al session with Sydney-based the purchase of $5.4 billion virtue of necessity in its counter-
PHDOPLJKWEHDZD\IRUWKH*RYHUQPHQWWRUHDOLVHDGGLWLRQDOYDOXHIURPWKHDLUOLQHEXW Chinese though Canada’s Five clash with the blessings of Lowy Institute where he blamed S400 air defence system from deployment. In the same inter-
Eyes partners were not perturbed. Defence Minister Gen Weng China for the standoff and Russia. This is a direct challenge view, he said the standoff could
WKRVHLQSRZHUEHOLHYHWKDWVXFKDVWHSZLOORQO\GHOD\DQGQHHGOHVVO\FRPSOLFDWHWKHVDOH The news network obtained Fei. Two weeks before the clash, breakdown in relations, Beijing to India’s strategic autonomy go the Sumdorong Chu way
:HFDQQRWXQGHUVWDWHWKHLPSRUWDQFHRIWKHDYLDWLRQLQGXVWU\IRU,QGLDDQGZKLOHWKH5DLOZD\V redacted documents, some classi- Global Times warned that India Foreign Office repeated its and one of the sticking points (1986) which took nine years to
KDYHEHHQWKHOLIHEORRGRIWKH,QGLDQSDVVHQJHUWUDQVSRUWV\VWHPIRUGHFDGHVLQDFRXQ fied secret and for Canadian eyes would suffer a devastating standard response: “The mer- in the India-US Defence resolve. But then while the
only, 19 months after it sought blow if it got involved in the its of the situation are very clear. Partnership on which the geopolitical context and limited
WU\WKHVL]HRI,QGLDDQDIIRUGDEOHUHOLDEOHDVZHOODVDSURILWDEOHDYLDWLRQLQGXVWU\LVYLWDO them on a Freedom of US-China rivalry. The report India is totally responsible for Trump Administration scale of deployment were vast-
QRWMXVWIRUFRQQHFWLQJSHRSOHDQGHQDEOLQJWKHHFRQRP\EXWPRVWLPSRUWDQWO\LWLVRQH Information request but as the notes that while the “Chinese the situation.” The standoff has remained discreetly silent. ly different, India was tactically
RIVWUDWHJLFLPSRUWDQFH$ODUJHFLYLOLDQDLUIOHHW³PXFKOLNHDODUJHFLYLOLDQPHUFKDQWIOHHW documents were not properly Government might deem its hit an impasse with no prospect Although India is still sit- in a commanding position hav-
redacted, they were legible. When Ladakh venture to acquire ter- of any thaw this winter; the ting on the fence in deference ing surrounded the PLA intru-
LQFHQWXULHVSDVW³LVDZD\WRPRYHPLOLWDU\DQGRWKHUVWUDWHJLFDVVHWVTXLFNO\0DQ\ there was resistance to implement- ritory a success, it failed to dis- Chinese and Indian tanks are to China, it has indicated to sion at Wangdung which was
KDYHDUJXHGWKDWWKLVLVZK\,QGLDVKRXOGUHWDLQDSXEOLFDLUOLQHEXWPDQ\ODUJHQDWLRQV ing the exchange programmes — suade India from building infra- just 20 metres apart near Beijing both in words and beyond the Indian limit of
SDUWLFXODUO\WKH8QLWHG6WDWHVGRQRWKDYHDQ\DLUOLQHFRQWUROOHGE\WKH*RYHUQPHQW,Q the Chief of Defence Staff put on structure or aligning with the Kailash range. The Chinese deeds the options available to it patrolling. Still Wangdung was
hold one joint section-level exer- US, where results have been cancelled the joint release of a for crossing the Rubicon. US an Intelligence lapse!
IDFWDSURIHVVLRQDOO\UXQ$LU,QGLDZKLFKLVSURILWDEOHDQGQRWDWD[SD\HUVXEVLGLVHGRSHU cise in winter warfare in Canada counterproductive”. The Indian stamp on the 70th anniversary Democratic lawmaker Mark The Intelligence and oper-
DWLRQWKDWFRPSHWHVZLWKWUXHSULYDWHDLUOLQHVZLOOOHDGWRDOHYHOSOD\LQJILHOGDQGWKHRYHU — orders were given that no Government, though, has of bilateral relations. The date Warner, speaking last week at ational failures on the LAC this
DOOJURZWKRIWKH,QGLDQDYLDWLRQVHFWRU+RZHYHUDVWKHVD\LQJJRHVWKHUHLVRIWHQDVOLS training was to be suspended denied both loss of any for the ninth military dialogue the Hindustan Times year are compounded by the
without consulting the Chief of territory or alignment with the has not been communicated by Leadership Summit, said: “India Rebel News revelations of the
EHWZHHQWKHFXSDQGWKHOLSDQGLWUHPDLQVWREHVHHQZKHWKHUWKHVDOHJRHVDKHDG Privy Council. These documents, US. Although no clinching evi- Beijing and while channels of should join a ‘Coalition of the Chinese getting winter warfare
made public last week, clearly tell dence was presented in the communication remain in sus- Willing’ with the US and other training from the Canadian
India that the Chinese had been report, tell-tale signs were there pended animation, both sides democracies to confront China’s armed forces in 2018-19. In a
22AdR^SZeZ`_
preparing for high-altitude war- that China was working to a are talking at each other. model of State-sponsored similar situation in 1984, India
fare since 2018-19 — especially in premeditated grand design of Russia, which enjoys the authoritarian capitalism.” Just as got a tip-off that Pakistan was
the winter of 2019 — and have forcibly altering the LAC in best of relations with both Trudeau wants to be nice to buying snow clothing in Europe
received training, expertise and Ladakh for which preparations India and China, has entered China, India does not wish to and pre-emptively occupied
+DYLQJHVWDEOLVKHGLWVHOILQ'HOKLFUHGLWDEO\WKHSDUW\LVQRZ equipment from Canadian
Defence Forces during bilateral
had started in mid-2019, if
not earlier, as the ‘China Files’
the fray not in helping to break
the logjam but adding fuel
offend Beijing as it cannot
independently deter Chinese
Siachen. The last GOC Ladakh
Sub-Area, Maj Gen Yash Mor
SODQQLQJWRWHVWWKHZDWHUVLQ83$VVHPEO\HOHFWLRQV military exchanges in China and indicate. These predate the to the fire by accusing the coercion on the Himalayan who was there at the time of
7
Canada. The Trudeau Mahabalipuram/Chennai West of “anti-China games”. frontiers due to conspicuous intrusions, lamented this week
KH$DP$DGPL3DUW\$$3DIWHULQLWLDOKLFFXSVLQ Government’s record of sensitiv- summit and are akin to Prime Foreign Minister Sergei Lavrov power asymmetry. about “our repeated failures to
LWVDPELWLRQVWRVSUHDGLWVZLQJVQDWLRQZLGHOHDUQW ity towards India’s security con- Minister AB Vajpayee’s historic set the cat among the pigeons Jaishankar’s continuing read Intelligence”.
cerns has at best been lax, given Lahore visit coinciding by saying that the western pow- reliance on diplomacy stems (The writer, a retired Major
WKHKDUGZD\WKDWLWKDGWRILUVWHVWDEOLVKLWVSROLWL that its Defence Minister and with Gen Musharraf ’s plan- ers were promoting Indo- from ground reality and realpoli- General, was Commander, IPKF
FDOOLIH·VORQJQHVVZLWKSURRIRILWVJRYHUQDQFHVNLOOV7KLV Leader of the Opposition are ning of Kargil. Pacific Strategy and tik. When asked by a journalist South, Sri Lanka, and founder
LVZK\LWDEDQGRQHGLWVSDQ,QGLDHIIRUWVFRQVLGHULQJLWV both Khalistani sympathisers. Lies and deceit are Quadrilateral Security Dialogue about India’s reaction to Chinese member of the Defence Planning
These revelations fit in neatly ingrained in the Chinese to engage India in anti-China intrusions being diplomatic Staff, currently the Integrated
OLPLWHGDSSHDODPRQJWKHFLYLOVRFLHW\DQGFRQFHQWUDW with the US-China Economic, Communist Party and PLA’s games and also trying to under- rather than a pushback, he Defence Staff)
HGRQVHFXULQJ'HOKL$QGQRZWKDWLWLVLQWRLWVWKLUGWHUP
LQWKHFLW\6WDWHULGLQJDPDVVLYHYHUGLFWDQGKDYLQJPDQ
DJHGWRVWDYHRIIWKH%-3FUHGLWDEO\LWLVQRZFRQVLGHU B>D=318C4
LQJVSUHDGLQJLWVIRRWSULQWDFURVVWKHFRXQWU\2IFRXUVH FWhXbcWT6^eTa]\T]c 8cXbcWTR[TPaTbc 3WhP]2WP]SXb^]T^UcWT 8cWX]ZXcVTccX]VWXcP]SbdU
LQWKLVHIIRUWLWLVIROORZLQJDJURXQGXSSROLF\SURYLQJ ad]]X]VPfPhUa^\cWT ST\^]bcaPcX^]^UcWT VaTPcTbcW^RZTh_[PhTabX]cWT UTaX]VR^]RdbbX^]bXb\^aT
FX]cTaBTbbX^]P]S fX[[^UcWT0\TaXRP] c^S^fXcWcWTUPRccWPc
LWVFUHGHQWLDOVLQORFDO*RYHUQPHQWSROOV(PEROGHQHGE\ WXSX]VQTWX]SP_P] _T^_[T8]cWXbQPcc[TU^a
WXbc^ah^U^da]PcX^]P[b_^ac
TeTahQ^ShWPbV^ccWTXa
P]SXcXbP\PccTa^U_aXSTc^
WKHSDUW\·VPDLGHQZLQLQWKH*RD]LODSDQFKD\DW HOHF ST\XR.CWThPaTbdQ cWTb^d[^U0\TaXRP SXaTRcWXbQX^_XR7^_X]Vc^ Ua^]c_aTbbfWTaTcTRW]XRP[[h
WLRQVLWVFRQYHQHUDQG'HOKL&KLHI0LQLVWHU$UYLQG.HMULZDOKDVVDLGWKDWWKH$$3ZLOOFRQ eTacX]VST\^RaPRh ST\^RaPRh_aTePX[TS P]]^d]RTcWT[TPSPRc^ab^^] cWThPaT\^eX]VU^afPaS
WHVWWKH8WWDU3UDGHVK83$VVHPEO\HOHFWLRQVLQ7KH*RDZLQLVVLJQLILFDQWIRUWKH 5^a\TaD]X^]<X]XbcTa DB?aTbXST]cT[TRc 5X[\SXaTRc^a 5^a\Ta8]SXPRP_cPX]
¯<P]XbWCTfPaX ¯9^T1XST] ¯0QWXbWTZ2WPdQTh ¯Bd]X[6PePbZPa
VLPSOHUHDVRQWKDWDOWKRXJKWKH%-3GRPLQDWHGWKHUHVXOWVWKH2SSRVLWLRQ&RQJUHVVSHU
IRUPHGSRRUO\DQGWKH$$3VHHPHGWREHJDLQLQJDWWKHODWWHU·VH[SHQVH2IFRXUVHWKH
$$3LVSOD\LQJLWELJLQ83E\KDUSLQJRQLWVFRPSDUDWLYHO\VXSHULRUSHUIRUPDQFHLQFLWL]HQ
IULHQGO\JRYHUQDQFH,QIDFW.HMULZDODOPRVWODXQFKHGDFDPSDLJQ\HVWHUGD\DVNLQJZK\
;4CC4AB C>C74438C>A
SHRSOHIURP83ZRXOGKDYHWRORRNDW'HOKLIRUKHDOWKVHUYLFHVDQGHGXFDWLRQLQDQREYL DXUbUµcQdY]Ud_cd_` <U3QbbU*1]QcdUbS\Qcc
RXVUHIHUHQFHWRKLVVXFFHVVIXOUXQZLWKPRKDOOD FOLQLFVIUHHHOHFWULFLW\ZDWHUHGXFDWLRQ
Sir — This refers to the editorial 1^WbiVQb]UbcTUcUbfUQci]`QdXUdYSUQb Sir — The great English novelist
DQGKHDOWKFDUHIDFLOLWLHV,WZRXOGHQWHUWKHFRQWHVWDVDQRXWOLHUKRSLQJWRHQFDVKRQWKH
C
‘Now, hunger strike’ (December WXbaTUTabc^cWTPacXR[T²0bfXUcT]Sc^UPa\Tab´bcXa John Le Carre, whose real name
YDFXXPFUHDWHGE\WKH&RQJUHVV%XWWKHTXHVWLRQLVZKHWKHULWZRXOGEHRSHQWRDOOLDQFHV 15). The protests against the agrar- STbXaPQ[T³ 3TRT\QTa $ Qh :P[hP]X BWP]ZPa was David Cornwell and who
FP[ZX]VS^f]cWT\T\^ah[P]T^]cWTU^^SRaXbXbX]
WRSXVKXSLWVWDOO\DQGUHOHYDQFH$OUHDG\6DPDMZDGL3DUW\63FKLHI$NKLOHVK<DGDYKDV ian laws represent a significant
8]SXP_^bc8]ST_T]ST]RTc^XcbbT[UbdUUXRXT]RhPUcTacWT
passed away recently aged 89,
movement in mass political mobil- will probably be known as the
VDLGWKDWKLVSDUW\ZRXOGIRUPDQDOOLDQFHZLWKVPDOOHUSDUWLHV+LVUHDVRQKLVH[SHULHQFH isation in India. The Government, 6aTT]ATe^[dcX^]fWXRWfPbQa^dVWcPQ^dcSdaX]VcWT greatest spy writer of any era,
KDVQRWEHHQJRRGZLWKWKHELJJHUSDUWLHV7KH$$3LVQRZDOVRH\HLQJ3XQMDEZKHUHLW on the other hand, believes that the [TPSTabWX_ ^U U^a\Ta ?aX\T <X]XbcTab ;P[ 1PWPSda anywhere.
KDVVLJQLILFDQWSUHVHQFHZLWK0/$V,WKDVDOUHDG\ZRQRIWKHVHDWVLQ'HOKLZLWK movement has been taken over by BWPbcaXP]S8]SXaP6P]SWXcWTfaXcTaWPbc^dRWTSd_^] Before him, it was Ian Fleming
“political” elements. TeTahbXV]XUXRP]cSTeT[^_\T]cRPdbX]Vd_bP]SS^f]bX] and his flamboyant spy character
DYRWHVKDUHRIQHDUO\SHUFHQWDIHZRIWKHPRQ3XQMDELGRPLQDWHGVHDWV$QGQRZLW While the movement’s cWTR^d]cah³bPVaXRd[cdaTbTRc^aP[[cWTbTSTRPSTbfWX[T James Bond, who ruled the roost.
KDVWKURZQLWVORWZLWKWKHIDUPHUV·DJLWDWLRQGRPLQDWHGDVLWLVE\DJULFXOWXULVWVIURP3XQMDE strengths are clear, the problem with WTab^[XRXcdST^eTacWT^]V^X]VbcP]S^UUQTcfTT]cWTD]X^] Le Carre was a wholly different
DQGHYHQWKURZQEDUEVDW&RQJUHVV&KLHI0LQLVWHU&DSW$PDULQGHU6LQJKIRUWRQLQJGRZQ it is not too much of politics but too 6^eTa]\T]cP]S"^SSUPa\Tad]X^]bU^[[^fX]VcWT_a^ story, no bang-bang stuff but
little of it. Politics entails different \d[VPcX^]^UcWT]TfUPa\[PfbP[b^bcP]SbYdbcXUXTS cf^cWPcbTT\bc^WPeTRd[\X]PcTSX]cWT^]V^X]VbcXa provoking reflection. Le Carre’s
KLVDWWDFNGHVSLWHWKHLQLWLDOIXU\2IFRXUVH6LQJKKDVEHHQDWWKHIRUHIURQWRIWKHIDUPHUV· elements and agitation is only one CWXbXbaTP[[hP\PccTa^UVaTPc_dQ[XRR^]RTa]cWPc 7T]RTcWTfaXcTa³b^QbTaePcX^]cWPccWTb^^]TaPbfXUcb^[d intricate plots came from the Cold
DJLWDWLRQSDVVLQJDPHQGPHQW%LOOVWRWKHWKUHH&HQWUDOIDUP$FWVLQWKH$VVHPEO\LQVLVW of them. Good politics also involves \P]hPa^d]S^UcP[ZbQTcfTT]cWTUPa\Ta[TPSTabP]S cX^]c^cWT_a^cTbcbXbU^d]ScWTQTccTaW^[SbV^^SP]S War, in which for a time he was
LQJRQPHHWLQJWKH3UHVLGHQWDQGVHQGLQJKLVOHJLVODWRUVWR'HOKLWRVWDJHDGKDUQD+HKDV the ability to negotiate, reconcile the cWT 6^eTa]\T]c P]S cWT bXTVT Pa^d]S cWT ]PcX^]P[ \TaXcbPccT]cX^]X]cWT]PcX^]P[P]S_dQ[XRX]cTaTbc himself a participant as a junior
demands of a movement with the 2P_XcP[³b Q^aSTab WPeT aT\PX]TS X]R^]R[dbXeT TeT] Pb 5Pa\Tab WPeT P[fPhb Q^a]T cWT Qad]c ^U ]PcdaP[ British spy. Le Carre shunned lit-
EHHQRQHRIWKHOHDGLQJ&RQJUHVVYRLFHVLQDUWLFXODWLQJSURWHVWVDJDLQVWWKHIDUP$FWV possibilities of what can be attained, \P]h]PcX^]P[RT[TQaXcXTbUa^\ePaX^dbUXT[SbWPeTSTRXS RP[P\XcXTb[XZTU[^^SbSa^dVWc^a\PaPdSX]VP]X\P[bP]S erary awards and State honours.
+RZHYHUWKH$$3KRSHVWRPDNHJDLQVIURPWKHDQWLLQFXPEHQF\IDFWRUDJDLQVWKLP recognition of the balance of power, TSc^aTcda]cWTXaBcPcTW^]^dabX]PbW^f^Ub^[XSPaXch cWTh[PQ^daT]S[Tbb[hX]X]R[T\T]cfTPcWTa8c³baTP[[hP When the Cold War ended, he
DQGEHQHILWIURPWKHHURVLRQRIWKHEDVHRIWKH6KLURPDQL$NDOL'DO6$'7KRXJKWKHODW and when to declare victory. This fXcWcWTPVXcPcX]VUPa\Tab _XchcWPccWTbTP]]PSPcPb cWT\bT[eTbWPeTc^bXc^]a^PSb wrote grippingly, fluently and with
element of politics is missing in the 8a^]XRP[[hcWT2T]caT³bR[PX\cWPccWT]TfUPa\[Pfb c^VTccWTXae^XRTbWTPaS understated eloquence, following
WHUKDVQRZZDONHGRXWRIWKH1DWLRQDO'HPRFUDWLF$OOLDQFH1'$RYHUWKHIDUPODZVLW movement. Once the protests esca- PaT\TP]cU^acWTP\T[X^aPcX^]^UUPa\TabP]ScWT[PccTa Azhar A Khan his deep on-location research
KDVEHHQWRROLWWOHDPRYHWRZUHVWFRQWUROLQWKH6WDWH7KH$$3ZDQWVWRXVHWKLVGLVDS lated and the Government had no ]TVPcX]VXcd]STabR^aTbP²\Xbd]STabcP]SX]V³QTcfTT]cWT Rampur about the drug trade, big pharmas
SRLQWPHQWZLWKWKH6$'WRLWVDGYDQWDJH.HMULZDO·VSDUW\KRZHYHUVWLOOKDVWRZRUNRQLWV choice but to engage and offer con- and torture in the wake of
cessions, good political leadership icy is leading to a fast-changing ities — including reservation ben- America’s questionable interven-
EDVHLQ3XQMDE,WKDVWRUHEXLOGFRQQHFWZLWKWKH0DOZDUHJLRQ³WKHHSLFHQWUHRIDJUDU among the protesters would have E^VUddUbUT`_`e\QdY_^ demography in the country where efits, freebies, subsidies, tions in Iraq and its ‘war on terror’.
LDQGLVWUHVV³ZKLFKLWKDVORVWVLQFH7KH$$3KDVWRWDNHFDUHRIIDFWLRQDOLVPLQ meant leveraging the movement. Sir — It refers to the Health the population of a particular Government jobs and He was among the rare breed
WKH6WDWHXQLWZKLFKKDVQRWEHHQTXLWHDWSHDFHZLWKWKHFHQWUDOOHDGHUVKLS,IWKHSDUW\LV But no group wants to be seen Ministry unexpectedly opposing minority community is increasing service/promotions — may be of writers whose characters
VHULRXVDERXWSXVKLQJLWVHOIWRWKHIRUHIURQWLWKDVWRZRUNRQFRQVROLGDWLQJDSROLWLFDOEDVH as “compromising” for fear of being the much-required two-child at a faster rate and thus decreas- auto-terminated on the birth of teetered on the fine line between
seen as “sold out” to the norm when, in an affidavit filed in ing the population percentage of the third child in a family. Such right-wrong and good-bad.
WKDW·VGLIIHUHQWIURPWKHH[LVWLQJSOD\HUVZKRKDYHEHHQVHHQDVFKDPSLRQLQJWKHLQWHUHVWV Government or corporates or has the Supreme Court, the Ministry the majority community. parents should be barred not Shovanlal Chakraborty
RIWKHHOLWH7KLVKDVDOLHQDWHGPXFKRI3XQMDE·VPDVVHVIURPWKHSROLWLFDOFODVVDQGWKH the courage to tell the farmers that stated that any such step could be At least the incentives given only from the right to contest elec- Kolkata
$$3ZDQWVWRVSHDUKHDGWKDWFKDQJH7KHIDUPHUV·SURWHVWVDUHMXVWWKHEHJLQQLQJ7KH the deal on offer is reasonable. counter-productive leading to for small families should be tions but also the right to vote.
BT]Shh^daUUTTSQPRZcc^)
N Sadhasiva Reddy demographic distortions. replaced by disincentives for larg- Subhash Chandra Agrawal
TXHVWLRQLVFDQLWZUHVWWKHDOWHUQDWLYHVSDFH" Bengaluru The absence of any such pol- er families. All Government facil- New Delhi [TccTabc^_X^]TTa/V\PX[R^\
P]P[hbXb
17>?0; kF43=4B30H k3424<14A %!!
gggTQY\i`Y_^UUbS_] &
58ABC2>;D<=
1gQfUY^VQf_eb @?9>D2>D=C4A@?9>D
_VSX_YSU C74B>20;;4350A<4A068C0C8>=70A3;H
A4<08=B050A<4AB´068C0C8>=8C70B6>C
8=58;CA0C431H;45C8BC0=3<0>8BC4;4<4=CB
5>AC74<>386>E4A=<4=C38BB4=C8=6
BCD34=CB0A40=C8=0C8>=0;B0=3?A>C4BC8=6
50A<4AB0A4:70;8BC0=8B
0Q^acX^]XbRdaaT]c[hP]XbbdTX]\P]hR^d]caXTb
°D=8>=<8=8BC4A °2>=6A4BB;4034A
P]SX]P[\^bcTeTah^]T^UcWT\cWTaT³bP\PY^aXch
?8HDB76>H0; A07D;60=378
X]UPe^da^UXcP\^]VcWTh^d]VTa_^_d[PcX^]
0LOHVWUDYHOOHG\DUGVWRJR
7GI>>5 3H4A *RRGVDQG6HUYLFHV7D[UDWHVFDQFRPHGRZQRQO\ZKHQWKHUDWHRI
* FRPSOLDQFHLPSURYHVIRUWKLVJUDQGWD[UHIRUP
HW\RXUURVDULHVRIIRXURYDULHVµFKDQWHGWKHZRPHQPDUFK
LQJLQVXSSRUWRIWKHUHIHUHQGXPWKDWPDGHDERUWLRQOHJDO
LQ,UHODQGLQ7ZR\HDUVODWHUWKHHOHFWLRQEURNH
WKHFHQWXU\ORQJVWUDQJOHKROGRQSRZHURIWKHWZR&HQWUH5LJKW
SDUWLHV)LDQQD)DLODQG)LQH*DHO7KH\JRWIHZHUWKDQKDOIWKH
YRWHVHYHQWRJHWKHU'LGWKHPDVVPRELOLVDWLRQDJDLQVWWKH
DQWLDERUWLRQODZUDGLFDOLVH,ULVKSROLWLFVDQGWULJJHUWKDWVKLIW"
3UREDEO\$QRWKHUFRXQWU\ZKHUHWKH&DWKROLF&KXUFKKDVWUDGL
WLRQDOO\GRPLQDWHGSROLWLFV3RODQGLVQRZVHHLQJDPDVVPRELO
LVDWLRQ WRR $ERUWLRQ RQ GHPDQG ZDV OHJDO LQ 3RODQG XQGHU
&RPPXQLVWUXOHEXWVLQFHGHPRFUDF\FDPHLQWKH&DWKROLF
&KXUFKKDVEHHQVWHDGLO\SXVKLQJEDFNDERUWLRQULJKWV
6RRQDIWHUWKH/DZDQG-XVWLFH3DUW\ZRQWKHHOHFWLRQ
LWWULHGWRSXVKDODZWKURXJK3DUOLDPHQWEDQQLQJDERUWLRQVLQFDVHV CE281C8381>4B1?0=34H
RIIRHWDODEQRUPDOLW\EXWWKHSROLWLFLDQVUHWUHDWHGLQWKHIDFHRI
T
PDVVSURWHVWVSDUWLFXODUO\E\ZRPHQ6RWKH*RYHUQPHQWWULHG he Narendra Modi-led Union Government is
DGLIIHUHQWDSSURDFK$PHULFDQVZLOOUHFRJQLVHWKLVVWUDWHJ\7KH cracking the whip on tax evaders in the coun-
try to ramp up Goods and Services Tax (GST)
/DZDQG-XVWLFH3DUW\SDFNHGWKHFRQVWLWXWLRQDOFRXUWZLWKSDUW\
collections. Nationwide raids by the Directorate-
OR\DOLVWVDQGODVW2FWREHUWKHFRXUWHIIHFWLYHO\EDQQHGDOPRVWDOO General of GST Intelligence unearthed 4,586 fake
DERUWLRQV%XWWKHFRXQWU\H[SORGHGLQSURWHVW6XGGHQO\DORWRI entities registered under the GST regime.
3ROHVDUHRSHQO\DQJU\DWWKH&DWKROLF&KXUFKDOWKRXJKLWLVDV Countrywide 132 people were arrested in 1,430 cases
FORVHO\OLQNHGZLWK3RODQG·VLGHQWLW\DQGQDWLRQKRRGDVLWZDVZLWK related to illegally availing or passing on of bogus
,UHODQG·V Input Tax Credit. Plus, more than six months’ default
7KHODWH3RSHDQG6DLQW-RKQ3DXO,,LVUHYHUHGDVWKHRQO\ in filing monthly tax returns led to the cancellation
3ROLVK3RSHDQGDJUHDWQDWLRQDOKHUREXWDVWDWXHRIKLPQHDU of GST registrations of 1,63,042 entities.
:DUVDZUHFHQWO\KDGLWVKDQGVGDXEHGZLWKUHGSDLQW2QO\ Tax evasion in the country is rampant and strong
SHUFHQWRI3ROHVQRZKDYHDSRVLWLYHYLHZRIWKH&DWKROLF&KXUFK anti-evasion measures are needed as GST collections
DQGDPRQJWKH\RXQJLW·VGRZQWRQLQHSHUFHQW:LOOWKLVHQGXS are way below expectation and potential. This is at
a time when the economy of the nation, which was
UHVKDSLQJ3ROLVKSROLWLFV"3UREDEO\\HV$QGLQ$UJHQWLQDWKH/RZHU already in the red, has taken a crippling blow due
+RXVHRI&RQJUHVVKDVMXVWSDVVHGD*RYHUQPHQWEDFNHG%LOOWR to the Coronavirus pandemic. The Government,
OHJDOLVHDERUWLRQFXUUHQWO\FRQVLGHUHGDFULPHLQDOPRVWDOOFLU which is trying to combat the pandemic, needs all
FXPVWDQFHV(YHQZRPHQZKRKDGVSRQWDQHRXVPLVFDUULDJHV the money that it can garner to keep the anti-COVID
KDYHEHHQDFFXVHGRIDERUWLRQDQGMDLOHGIRUKRPLFLGH momentum going.
%XWWHQVRIWKRXVDQGVRIZRPHQFDPHRXWLQ%XHQRV$LUHV The Lok Sabha was informed in March that GST
ODVW)ULGD\WRJUHHWWKHSDVVDJHRIWKHOHJDOLVDWLRQRIDERUWLRQ$ evasion of C70,207 crore had been detected between
ORFDOQHZVZHEVLWHFDOOHGLWD´WVXQDPLRIMR\µ7KH\ZLOOEHRXW July 2017 and January this year, of which C34,591
DJDLQLQVWUHQJWKODWHUWKLVPRQWKWRHQVXUHWKDWWKH6HQDWHSDVV crore had been recovered. The Directorate-General
HVWKHQHZODZZKLFKLWSUREDEO\ZLOO³DQGWKDWZLOOXQOHDVK of Analytics and Risk Management has identified
over 12,900 business entities suspected of availing
DZDYHRIGHPDQGVIRUVLPLODUUHIRUPVDOORYHU/DWLQ$PHULFD Input Tax Credit since July 2017 through bogus
0RVWFRXQWULHVLQ&HQWUDODQG6RXWK$PHULFDRQO\DOORZDERU invoices worth over C1,00,000 crore till March this
05C4A5D;;
WLRQLQFDVHVRIUDSHRUULVNWRWKHPRWKHU·VOLIHWKDQNVWRWKHWUD year. 0DC><0C8>=8B
GLWLRQDOSRZHURIWKH&DWKROLF&KXUFK8QWLOQRZRQO\&XEDDQG Collection from taxes subsumed in the GST was 03>?C431H gates of factories and godowns the E-Way no longer be necessary. The tax returns can deregistration by some Central Excise-
8UXJXD\KDYHDOORZHGDERUWLRQRQGHPDQG%XWIRUWKHPDMRULW\ about six per cent of the Gross Domestic Product C0G?0H4AB4E4= Bills system was rolled out in April 2018 be generated by a system that matches exempt units located in the Himalayan/
RI/DWLQFRXQWULHVZKHUHPRVWSHRSOHDUHQRORQJHUUXUDOSHDV (GDP) in 2016-17. In contrast, the GST collections ²0BB4BB<4=C³0B to track the movement of taxable goods. invoices. North Eastern States whose business
DQWVWKHZULWLQJLVQRZRQWKHZDOO to GDP ratio was 6.25 per cent in 2018-19 and six D=34ABC>>38= This also reduces Income Tax evasion by Tax evasion can be detected by apply- became unviable under the destination-
:KLFKEULQJVXVQDWXUDOO\WRWKH86ZKHUHYHU\IHZSHR per cent in 2019-20. GST collections were about C74<0=D0; transporters as they need to get registered. ing analytical tools and Artificial based GST. Some 82 lakh registered sell-
SOHWKLQNRIWKHPVHOYHVDVSHDVDQWV7KHODQGVFDSHLVTXLWHVLP C7,40,650 crore in 2017-18, C11,77,370 crore in 2018- BHBC4< Capturing the vehicle registration num- Intelligence to the massive data that ers filed detailed returns for November
LODUZLWKHYDQJHOLFDO&KULVWLDQVHYHQPRUHPLOLWDQWO\RSSRVHGWR 19 and C12,22,131 crore in 2019-20. <0H=> bers into a trackable IT system, the E-Way crores of invoices generate. In fact, the GST and over 20 lakh GST taxpayers opting for
GST collections were about C32,000 crore and ;>=64A14 Bills and the FASTag system help check system should reach the same maturity in the Composition Scheme are exempt from
DERUWLRQ WKDQ &DWKROLFV <HW WKH DERUWLRQ UDWH DPRQJ &DWKROLF C62,000 crore during April and May. The next four other malpractices. For instance, in the terms of providing visibility of Input Tax filing detailed returns. As a taxpayer facil-
ZRPHQPDWFKHVWKHQDWLRQDODYHUDJHDQGHYHQDPRQJHYDQJHO months saw an average collection of C90,000 crore
=424BB0AH Bihar fodder scam, the Comptroller and Credit as is now available for verification itation measure, almost 94 lakh small GST
LFDOZRPHQLWLVDERXWKDOIWKDW$ERUWLRQVLQWKH86DUHQRZDW per month, which improved to C1,05,000 crore per C74C0G Auditor General (CAG) detected that cer- and tracing of TDS/TCS credits by taxpayers are now allowed quarterly fil-
WKHORZHVWUDWHVLQFHWKHNH\6XSUHPH&RXUWGHFLVLRQWKDWOHJDOLVHG month in the last two months, showing a robust A4CDA=B tain vehicles supposedly used for fodder Income Tax assesses. ing of return with monthly payment.
DERUWLRQ5RHYV:DGHEDFNLQEXWWKDW·VPDLQO\GXHWR recovery. 20=14 transport were actually registered two- One common problem, especially for The GST rate rationalisation is also on
EHWWHUFRQWUDFHSWLRQ1HYHUWKHOHVVDOPRVWDTXDUWHURI$PHULFDQ If the GDP at factor cost (proxy for the total base 64=4A0C43 wheelers, proving fake procurement. small businesses, is that the GST system course. Almost 99 per cent of all com-
ZRPHQSHUFHQWZLOOJHWDQDERUWLRQDWVRPHSRLQWLQWKHLU of indirect taxes) is assumed to be C160 lakh crore 1H0BHBC4< Officials have found lakhs of E-Way is not designed to distinguish a sale on full modities are now taxed with GST at the
OLYHVPRVWZKHQWKH\DUHLQWKHLUV and 60 per cent of this GDP pays an average GST C70C<0C274B Bills being cancelled within a few hours, upfront payment and a sale on credit and rate of 18 per cent or lower. Consumers
$JUHDWPDQ\RIWKHVHZRPHQKDYHDERUWLRQVEHFDXVHRIWKHLU of 15 per cent, the GST revenue should be C1,20,000 8=E>824BC0G indicating undocumented delivery to a sale on Equated Monthly Installments. tend to compare GST rates with erstwhile
OLIHFLUFXPVWDQFHV7KUHHILIWKVRIWKHPDOUHDG\KDYHDWOHDVWRQH crore per month. Obviously, at the moment, the GST 4E0B8>=20=14 intra-city or nearby destinations or mul- Why force a seller to pay GST even before Sales Tax/Value Added Tax (VAT) rate not
revenue is below expectations and its potential. 34C42C431H tiple trips being made against a single E- he gets paid for the supplies? Even allow- realising the basic fact that the GST sub-
FKLOGDQGKDOIRIWKHPDUHOLYLQJEHORZWKHSRYHUW\OLQH$OOWKDW The Centre and State Governments across the Way Bill to transport excess undeclared ing quarterly filing of GST returns with sumes Central Excise which has been hid-
ZRXOGKDSSHQLIDERUWLRQZHUHPDGHLOOHJDOLVWKDWWKHEDFNVWUHHW country are taking steps to overcome resistance to
0??;H8=6 goods. To curb misuse, E-Way Bills are monthly payments does not address this den in the price of products on which VAT
DERUWLRQLVWVZRXOGUHDSSHDUDQGORWVRIZRPHQZRXOGGLHRUHQG formalisation and digitalisation, rationalisation of 0=0;HC820; now being integrated with the FASTag sys- problem. was applied. When the invisible Central
XSPDLPHGLQVRPHZD\ GST rates and curbing tax evasion through claims C>>;B0=3 tem being used for electronic collection Small businesses selling to big buyers, Excise and other taxes are subsumed in the
863UHVLGHQW'RQDOG7UXPSLVJRQHQRZZLWKWKH(OHFWRUDO of fake or excess Input Tax Credits, misinvoicing or 0AC858280; of tolls on National Highways and the including governments and Public Sector visible GST, it is bound to be seen high-
&ROOHJHSXWWLQJ-RH%LGHQILUPO\LQWKH:KLWH+RXVH%LGHQIRU undocumented sales. The GST system includes cer- 8=C4;;864=24 Vahan database, too. Undertakings, routinely face payment er than VAT.
PDOO\ZRQ(OHFWRUDO&ROOHJHYRWHVDVHOHFWRUVYRWHGLQ6WDWH tain checks on tax evasion like mandatory audits, C>C74<0BB8E4 There have been instances where delays though some progress has been For instance, the pre-GST taxation of
FDSLWDOVDURXQGWKH86HLWKHUYLUWXDOO\RULQSHUVRQIXOILOOLQJDSUR matching of returns, E-Way Bills, reverse charge 30C0C70C unscrupulous dealers have used fake made recently. It would be desirable if in goods was a typical standard VAT at the
IRUPDUHVSRQVLELOLW\WKDWZRXOGQ·WKDYHUHFHLYHGVRPXFKSXEOLF mechanism and invoice matching. These are being 2A>A4B>5 invoices for inputs not received to claim a GST2.0 upgrade, a receipt-based GST rate of 14.5 per cent, Central Excise at the
DWWHQWLRQEXWIRU7UXPS·VUHIXVDOWRDFNQRZOHGJHKLVGHIHDW7UXPS gradually introduced. To check the practice of set- 8=E>824B undue Input Tax Credit. Such invoices system can be implemented where the rate of 12.5 per cent and CST at the rate
ting up shell firms for fraud, the Government has 64=4A0C4 don’t have any corresponding supply of GST would be payable to the Treasury of four per cent. With the cascading effect
H[SHFWHGO\ZRQ+RZHYHUHYHQWKRXJK7UXPSLVRXWKHKDV mandated Aadhaar authentication for GST registra- goods/services or not to the full extent and only on receipt of full or pro rata payment of tax on tax, the total levy paid by the end
SDFNHGWKH866XSUHPH&RXUWVL[WKUHHZLWK&RQVHUYDWLYHVZKR tion. The GST law permits deemed registration 21 do not involve actual payment of GST on for the supplied goods/services. One the- consumer was over 30 per cent. Inclusion
DUHWKRXJKWWREH´SUROLIHµ,IWKH\GHFLGHWRUHEDQDERUWLRQWKH\ days after an application is filed. Authorities will now them. This practice also leads to defraud- oretical option to implement this, at least of petroleum products in GST, if neces-
ZLOOFHUWDLQO\XQOHDVKPDVVSURWHVWVRQDVFDOHWKDWWKH86KDV physically inspect and verify entities obtaining ing of banks by exaggerating turnovers and for small businesses, could be to allow sary by adjusting non-GST taxes like
QRWVHHQEHIRUHMXVWOLNHLQ,UHODQGDQG3RODQG7KH´SUROLIHµPRYH deemed GST registration without Aadhaar. money laundering. them to opt for Cash Accounting rather Customs duty, allowing Input Tax Credit
PHQWLVQRLV\EXWSHUFHQWRI$PHULFDQVVXSSRUWDERUWLRQULJKWV Ever since the Economic Administration The July 2019 CAG report on GST, than Accrual Accounting. However, that across full value addition chains, further
$EDQLQWKH86PLJKWHYHQWULJJHUDZRPHQ·VJHQHUDOVWULNH7KH Reforms Commission, chaired by LK Jha in 1984, expressed concern over the continuing will create problems when they grow and lowering of rates with continuing strict
ULJKWLVDOUHDG\UDGLFDOLVHGLQWKH86EXWWKHUHVWRIWKHFRXQWU\ highlighted how 80 per cent of Excise manpower delay in the full invoice matching system have to leave the small business tag. A bet- action against tax frauds can make GST
LVULSHIRULWWRR then guarded gates of low revenue yielding facto- which has made the system prone to Input ter option will be to introduce payment more acceptable and yield more revenues.
$ERUWLRQLVFXUUHQWO\DQLVVXHLQPDQ\FRXQWULHVDQGLQDOPRVW ries, tax administration in India has been moving Tax Credit frauds. The system was intend- tracking, whose benefits will go beyond Digitalisation and formalisation of
away from physical controls to self-assessment. ed to be designed based on 100 per cent the GST sphere in checking defaults and businesses poses some short-term costs
HYHU\RQHRIWKHPWKHUH·VDPDMRULW\LQIDYRXURILWDPRQJWKH However, the truth is that a trust-based tax assess- invoice-matching to ensure system-veri- delinquencies. and hassles, but it is inevitable and it alone
\RXQJHUSRSXODWLRQ:KDWPHVVDJHGRHVWKLVKDYHIRU5LJKWZLQJ ment system is effective only when there is the deter- fied Input Tax Credit, correct settlement It is a creditable achievement that the holds the promise of giving long-awaited
JRYHUQPHQWVWKDWFOLQJWRSRZHUE\ZDJLQJ´FXOWXUHZDUVµWRFRE rence of test checks and fear of penal action on detec- of the Integrated Goods and Services Tax number of registered businesses under justice to the overtaxed. GST rates can
EOHWRJHWKHUQDUURZPDMRULWLHV"6WD\DZD\IURPWKHDERUWLRQLVVXH tion of breach of faith in test checks. and for minimising direct human inter- taxes subsumed in the GST has increased come down when compliance improves
,WZLOOH[SORGHLQ\RXUIDFHV Otherwise, the tax system will be no different face with assessees. After full automation from 72 lakh to 1.28 crore, despite signif- for this grand tax reform.
*Z\QQH'\HU·VQHZERRNLV¶*URZLQJ3DLQV7KH)XWXUHRI than managing the collection boxes placed in reli- is adopted by taxpayers, even “assessment” icant de-registrations due to increased (The writer is former Special Secretary,
'HPRFUDF\DQG:RUN· gious places. Since tax inspectors no longer guard as understood in the manual system may thresholds for registration and voluntary Ministry of Commerce and Industry)
$MXVWFDXVHEXULHGLQWKHVDQG
5>A486=4H4
6GRKYZOTOGTYRUUQ[VZU9G[JO'XGHOGGYZNKUTR_XKSGOTOTMGRR_OTZNKOXJXKGSULGNUSKRGTJH[ZZNKLXOKTJYKKSYZUHKHKZXG_OTMZNKS
namely Bahrain, the UAE and Sudan. To undermine the impact of the result of these diplomatic agreements international community gave a muted The hush-hush Saudi recognition
However, one issue that remains agreements, Iran stitched a $400 bil- was the Palestinians being left high and response to all this. However, despite of Israel signals a paradigm policy shift,
unaddressed that can have ubiquitous lion strategic partnership with China dry. For decades they have been fight- the opprobrium from the UK and for it could lead to the creation of new
ramifications for peace and stability in in late September. Iran approved ing for the two-State solution. First, Germany, Israel continues to violate history and may signal a dramatic
West Asia and the Middle East is the China’s access to its defence and Britain betrayed them through the Palestinian rights. The United Nations change in the way the Jewish-Muslim
two-State solution. The normalisation financial systems so much so that Iran Balfour Declaration of 1916, then the is powerless to act as the West calls the relations evolve. What, however, needs
agreements have covertly sidelined the is now a de jure part of the Belt and Sykes-Picot Agreement, followed by shots at the world body. Perhaps it is to be remembered is that Palestinians
issue of the Palestinians. Road Initiative (BRI) much to India’s the formation of Israel in 1948 with pretty clear that Palestinians will face look up to Saudi Arabia as the only C74F>A;38B
Transformation of West Asian
politics: One thing that is very clear
chagrin. The scales appear firmly tilt-
ed in Israel’s favour however. With the
utter disregard for the rights of the
Palestinian people. These agreements
further rights violations in the coming
years.
remaining ally in their dream of a
homeland and their ally seems to be F0C278=6
@B1>1I;E=1BB7><4
from the normalisation agreements change of regime in the US, it will be have not only alienated the Palestinians Saudi recognition of Israel a slowly betraying them. 1TXYX]VQT[XTeTbcWPccWT
between Israel and the Gulf Arab States very interesting to see what happens who are almost facing an existential potential death knell?: The recent As of now, there appears little hope
Va^cTb`dTWd\P]aXVWcb
T
he last few months of the outgo- is that the politics of West Asia has with the new Biden Administration. crisis but also point to a deeper “esoteric” meeting between Israeli and for the Palestinian cause. The only
ing Trump Administration were undergone drastic transformation. It Should it choose to follow a more schism within the Muslim world. Saudi officials and the subsequent remedy for them is perhaps an urgent PQdbTb^UcWTDXVWdabX]
very hectic, especially seen from will not be the same any more. Henry reconciliatory policy towards Iran The Palestinian cause has been allowance given to Israeli flights to use course correction by the internation- GX]YXP]VWPeT]^cWX]Vc^S^
the foreign policy perspective. In an Kissinger in his famous book ‘World and think about resurrecting the Iran jettisoned by the Gulf monarchies who Saudi airspace, generated a new churn al community. The new liberal US fXcWU^aTXV]Tab1dc2WX]P³b
otherwise turbulent and highly-frag- Order’ wrote that geopolitics and nuclear accord, it would end up alien- earlier were the most vocal endorsers in West Asian geopolitics. However, leadership under Joe Biden must pres- TR^]^\XR\XVWcWPb\PST
ile four years of the Trump presiden- strategic considerations triumph reli- ating Israel and the Sunni Gulf monar- of the two-State policy. In fact, the when seen from the prism of the surise Israel into halting all settlement
cy marked by foreign policy disasters, gious issues. chies. If Biden follows a hard line height of irony is the volte-face by the Palestinian cause, it potentially signals building works and ask the Jewish State XcbQdbX]TbbTeTah^]T³b
the last six months were landmark vis- These diplomatic agreements are towards Iran, the outcome will be a Gulf monarchies vis-à-vis the Israeli its death knell. The primary reason for to respect Palestinian rights. If that fails, QdbX]TbbCW^dVW2WX]TbT
à-vis Trump’s West Asia policy. In early symptomatic of a Zionist-Sunni recalcitrant Iran pursuing a virile pol- occupation of West Bank. Israel this is the fact that Saudi Arabia is the the international community should ^UUXRXP[bbW^fbXV]b^U
August, the Trump administration alliance against Shia Iran. Iran finding icy using its proxies to destabilise the promised to postpone the building of core State in the Islamic world despite think about imposing sanctions on d]TPbTPcfTbcTa]_aTbbdaT
oversaw the signing of the Abraham itself isolated is desperately trying to entire Middle East and West Asia. In new settlements as a part of the recog- the emergence of fissures in Muslim Israel. One thing is very clear,
accords which are a series of peace- find a way out of this stranglehold such a context the old fissures in West nition agreement considerations but unity, following the emergence of a Palestinians have to dig in and fight for
TR^]^\XR\TP]bWPeTcWTXa
cum-normalisation agreements because Arab-Zionist bonhomie is Asia will be aggravated. never said anything about bringing the parallel grouping led by Malaysia, their cause. [X\Xcb
between Israel with three Arab States, clearly in the US’ strategic interest. No justice for Palestinians: The construction work to a halt. The Turkey and Pakistan. (The writer is a columnist) CWT6dPaSXP] TSXc^aXP[
17>?0; kF43=4B30H k3424<14A %!! f^a[S'
4;42C>AB2>=58A<F8= 86EODPHV,UDQIRUDEGXFWLRQ
EZ^Ve`efc_eYVaRXV+;`V3ZUV_ GHDWKRIH[)%,DJHQW/HYLQVRQ Washington: The Trump
administration for the first time
The announcement is the
latest in a series of tough actions
for years about its involvement
in his disappearance through
,QDILUVWOHDGLQJ5HSXEOLFDQV
Washington: US President- has formally blamed Iran for the the Trump administration has disinformation campaigns
elect Joe Biden has told elec- presumed death of retired FBI taken toward Iran as it works to aimed at deflecting responsi-
tion-weary Americans that it is agent Robert Levinson, publicly cement an aggressive posture bility and covering up the gov-
time to “turn the page”, after the
Electoral College affirmed his FRQILUP%LGHQSUHVLGHQWHOHFW identifying two Iranian intelli-
gence officers believed respon-
that may complicate any efforts
by incoming President Joe
ernment’s role.
“The abduction of Mr.
triumph over President Donald sible for his abduction and Biden and his national securi- Levinson in Iran is an outra-
Trump, who has refused to Washington: For the first time, time has come to move on. imposing sanctions against ty team to radically change geous example of the Iranian
concede and filed a litany of a groundswell of leading “At some point you have to them. course once they take office next regime’s willingness to commit
legal challenges to overturn the Republicans have said that face the music,” said Sen. John Levinson disappeared in month. US officials pre-emp- unjust acts,” Treasury Secretary
poll results. Democrat Joe Biden is the Thune of South Dakota, the Iran under mysterious circum- tively made clear Monday that Steven Mnuchin said in a state-
The 538-member Electoral winner of the presidential elec- second-ranking GOP leader. stances more than a decade ago, no deal with Iran should be ment.
College on Monday pushed tion, essentially abandoning “Once the Electoral College set- and though US diplomats and finalised without providing for The Iranian intelligence
Biden past the 270-vote thresh- President Donald Trump’s tles the issue today, it’s time for investigators have long said the release of Americans who officers, Mohammad Baseri
old to win the bitterly-contest- assault on the outcome as the everybody to move on.” they thought he was taken by remain detained there. and Ahmad Khazai, are alleged
ed race for the White House. It Electoral College certified the Sen. Roy Blunt of Missouri, Iranian government agents, Besides calling out two to have been involved in
was one of the crucial steps vote. the chairman of the inaugural Monday’s announcement in the high-ranking intelligence offi- Levinson’s abduction and prob-
required for the 78-year-old With states affirming the committee, said the panel will final weeks of the Trump cers by name, US officials also able death. Under the sanc-
Democrat to take office on results, the Republicans faced now “deal with Vice President administration was the most said the Iranian regime sanc- tions, any property or assets
January 20 as the 46th US ?aTbXST]cT[TRc9^T1XST]fP[Zb^UUbcPVTfXcWWXbfXUT9X[[1XST]PUcTacWT4[TRc^aP[ a pivotal choice — to declare Biden as the president-elect.” definitive assignment of blame tioned the plot that led to they hold in the United States
President. 2^[[TVTU^a\P[[hT[TRcTSWX\Pb?aTbXST]c 0? Biden the president-elect, as the Just last week, the Republicans to date. Levinson’s abduction and lied would be frozen. AP
Under the US system, vot- tally showed, or keep standing on the inauguration committee
ers actually cast their ballots for In a speech from his home- was lit in this nation a long time silently by as Trump wages a had declined to publicly do so. $URXQGWKH
electors, who in turn, formal-
ly vote for candidates weeks
after the presidential election.
town of Wilmington, Delaware
after the announcement of his
victory in the election, Biden
ago. And we now know noth-
ing, not even a pandemic or an
abuse of power, can extinguish
potentially damaging campaign
to overturn the election.
Senate Majority Leader
He said Monday’s Electoral
College vote “was significant.”
Texas GOP Sen. John Cornyn
%RNR+DUDPFODLPV *OREH
Biden won the November 3
election with 306 electoral col-
lege votes to incumbent
said the US democracy had
been “pushed, tested and
threatened” and “proved to be
that flame,” Biden said.
“In this battle for the soul
of America, democracy pre-
Mitch McConnell, R-Ky., was
quiet on the issue Monday. But
a number of senators said the
said barring further legal chal-
lenges it appears Biden will be
president. AP
NLGQDSSLQJRI1LJHULD =PXa^QX) B^\P[XP³b6^eTa]\T]c
bPhbXcWPbbTeTaTScXTbfXcW
Republican President Trump’s
232.
resilient, true and strong”.
He criticised President
vailed. We the people voted.
Faith in our institutions held. VWXGHQWVLQQRUWK bcaPcTVXR]TXVWQ^a:T]hP°c^
bPUTVdPaScWTd]Xchb^eTaTXV]ch
The Electoral College votes
will now be sent to Congress to
Trump’s attempts to overturn
the result and said the “will of
The integrity of our elections
remains intact. And so, now it AFE:?4@?8C2EF=2E6D3:56? Lagos (Nigeria): Nigeria’s Boko “What happened in
bcPQX[Xch^UcWTR^d]cah±
8b[P\PQPS)?PZXbcP]³b]PcX^]P[U[PV
be counted formally next the people prevailed”. is time to turn the page. To 0?Q <>B2>F came a day after the Electoral Haram jihadist rebels have Katsina was done to promote RPaaXTaR[TPaTS _X[^cb^dc^UcWT
month. Though some House “The rule of law, our unite. To heal,” he said. College confirmed Biden as the claimed responsibility for the Islam and discourage un- # fW^bT[XRT]RTbc^U[hfTaT
bdb_T]STSX]cWTQPRZSa^_^UcWT
Republicans have indicated
they will object to the results in
key states, they can do little
Constitution and the will of the
people prevailed” over Trump’s
efforts to undo the results of the
Biden said the election
outcome should be celebrated,
not attacked, that more than 81
R ussian President Vladimir
Putin on Tuesday congrat-
ulated Joe Biden on winning
nation’s next president, ratify-
ing his November victory in an
authoritative state-by-state
abduction of hundreds of stu-
dents in an attack on a boys
school in northern Katsina
Islamic practices as Western
education is not the type of
education permitted by Allah
UPZTSTVaTTbR^]ca^eTabh
PRR^aSX]Vc^P\TSXPaT_^ac^]
more than delay the process election, the former US vice million votes were cast for him the US presidential election repudiation of President State, a Nigerian online news- and his Holy Prophet,” the CdTbSPhBT]X^aPSe^RPcTBP[\P]
during a joint session of president said. and Vice President-elect after weeks of holding out. Donald Trump’s refusal to con- paper says. paper quoted Shekau as saying. 0ZaP\APYPX]U^a\TScWTBd_aT\T
Congress on January 6. “The flame of democracy Kamala Harris. PTI Putin’s message to Biden cede that he had lost. More than 330 students are There has been no inde- 2^dacPQ^dcXc^]<^]SPhfWX[T
missing from the Government pendent verification of the aT_aTbT]cX]VcWTPXa[X]Tb
86$WWRUQH\*HQHUDO $XVWUDOLDQ30VD\V
Science Secondary School in audio message but Shekau has :PQd[) 0Q^\QX]VP]SPbW^^cX]V
2d^\^ST]XTbU^a\Ta Kankara after gunmen with
assault rifles attacked their
in the past released video and
audio messages on Boko
PccPRZX]:PQd[ZX[[TSPc[TPbccWaTT
_T^_[TX]R[dSX]VPST_dch
PXST´bbTgdP[ school Friday night. Haram’s behalf. _a^eX]RXP[V^eTa]^afWX[TPST_dch
:LOOLDP%DUUUHVLJQV &KLQDFRDOEDQZRXOG
The Daily Nigerian said it Nigerian presidential _a^eX]RXP[R^d]RX[RWXTUfPbZX[[TS
WPaPbb\T]cP[[TVPcX^]b received an audio message spokesman Garba Shehu said X]fTbcTa]0UVWP]XbcP]^]
from Boko Haram leader in a statement Monday that CdTbSPh^UUXRXP[bbPXS
EUHDFK:72UXOHV
Albany: New York Govoner Abubakar Shekau saying that “the kidnappers had made con- 1adbbT[b) CWT4da^_TP]D]X^]³b
Andrew Cuomo has denied a Washington: US Attorney his group abducted the school- tact and discussions were P]cXUaPdSQ^ShbPXSP[\^bc
former aide’s allegations over General William Barr, who of boys because Western educa- already on, pertaining to the #[XcTab^USP]VTa^dbWP]S
that he sexually harassed her by late had publicly differed with tion is against the tenets of safety and return” of the chil- bP]XcXbTaWPeTQTT]bTXiTSPRa^bb
making inappropriate com- President Donald Trump on Canberra (Australia): agreement and so we would Islam. dren to their homes. AP cWTaTVX^]
ments about her appearance. allegations of voter fraud in the Australia’s prime minister said hope that’s certainly not the
Cuomo told reporters on November 3 presidential elec- Tuesday that China would be in case.” Coal and iron ore are
Monday the claims that former
economic adviser Lindsey
Boylan made in a series
tions, has resigned.
Trump has appointed his
deputy Jeff Rosen as the Acting
Jeff Rosen, an outstanding per-
son, will become Acting
breach of World Trade
Organization rules as well as a
bilateral free trade agreement if
Australia’s most lucrative
exports. But Australian exports
appear to have suffered due to
>R]UZgVdT`_dZUVcdSfcjZ_X
=R_\R>fd]Z^dUjZ_X`W4`gZU
of tweets Sunday were “not Attorney General. Attorney General. Highly it banned Australian coal. deteriorating bilateral relations
true.” “Just had a very nice meet- respected Richard Donoghue Prime Minister Scott since Australia called for an
“I fought for and I believe ing with Attorney General Bill will be taking over the duties of Morrison was responding to a independent inquiry into the
a woman has the right to come Barr at the White House. Our Deputy Attorney General. report in the Chinese state- coronavirus pandemic.
forward and express her opin- relationship has been a very Thank you to all!” Trump said owned Global Times newspa- Trade Minister Simon Colombo (Sri Lanka): The humane response,” Hood told since March reached 33,477 on
ion and express issues and good one, he has done an out- as he tweeted the two-page res- per that the Chinese National Birmingham said Australia was Maldives president’s office says The Associated Press. Tuesday, including 154 fatalities.
concerns that she has,” the 63- standing job! As per letter, Bill ignation letter of Barr. Development and Reform close to finalizing a complaint it is discussing how to provide There was no immediate In other developments in
year-old Democrat said, mak- will be leaving just before Barr, in his letter, said, “As Commission had given power to the World Trade a “humane response” to a confirmation from Sri Lanka of the Asia-Pacific region: —
ing his first comments on the Christmas to spend the holi- discussed, I will spend the plants approval to import coal Organization over Chinese tar- request from neighbouring Sri such a request. Sri Lanka’s gov- Authorities in Sri Lanka said on
allegations. “But it’s just not days with his family...,” Trump next week wrapping up a few without restrictions except for iffs imposed on barley. Lanka to allow burials for ernment in March announced it Tuesday that more than 3,000
true.” Cuomo’s press secretary announced on twitter Monday remaining matters important to Australian coal. “We see these reports and Muslims who die of Covid-19. will cremate the bodies of all Covid-19 cases have been
previously denied the claims on night. the administration, and depart Morrison said he was treat- obviously are deeply troubled Presidential spokesman people who die of Covid-19, say- detected in the country’s high-
his behalf. AP “Deputy Attorney General on December 23.” PTI ing the report as “media spec- by them,” Birmingham told Ibrahim Hood said on Tuesday ing the coronavirus could con- ly congested prisons, as infec-
ulation” because the Chinese Australian Broadcasting Corp. that President Ibrahim taminate underground water. tions also surge in the capital
government had yet to clarify Referring to the reported coal Mohamed Solih has received a Sri Lankan Muslims have and its suburbs. They said that
its position. import ban. request from Sri Lanka to look urged the government to allow 2,984 inmates and 103 guards
“If that were the case, then “They, if true, would indi- into the possibility of allowing burials, citing their religious have been confirmed to have
that would obviously be in cate discriminatory trade prac- such burials. beliefs. They accuse the gov- the disease in seven prisons
breach of WTO rules,” tices being deployed by “The request has been ernment of denying Muslims a around the country. Sri Lankan
Morrison told reporters. Chinese authorities and we received. At present we are con- basic right without scientific prisons are highly congested,
“It would be obviously in would urge them to rule that sidering and discussions are grounds, since many countries with more than 26,000 inmates
breach of our on free trade out swiftly,” he added. AP ongoing with regard to what in the world allow burials. crowded in facilities with a
would be the appropriate and Sri Lanka’s confirmed cases capacity of 10,000. AP
DTZV_eZdedhRc_`W
TReRdec`aYZT`Z]
daZ]]Wc`^RSR_U`_VU
dYZaZ_CVUDVR
HYHQLQ)<5HSRUW ePRRX]PcX^]SaXeT
rency. Besides, subdued trad-
?C8Q =4F34;78 added. ing in domestic equities also
New Delhi:Oil marketing com- “We remain committed to put pressure on the domestic
7RTVS``\U`fS]VdU`h_`_:_UZR¶d C9@Y^V\_gcXYd
UZXZeR]Xc`heYYV]adD>3d #!]_^dX\_g
80=BQ =4F34;78 ecosystem for small business address during the event. QdC'# "Sb
growth in the country by “So, decisions that are New Delhi:Investment in
25
A
midst rising vulnerabilities in the pan-
demic-hit world economy, atmanirb-
harta (self-reliance) is a recovery-cum-
growth strategy not only for countries but also
for the working professionals. Both business-
es and employees are facing tough competi-
tion in the market today. In such a turbulent
S_\\UWU\YVU
time, entities with advanced and futuristic
skills are incredibly exceptional.
Willingness to learn is the way forward to
T he curtain ‘The Grand
Beginning of College Life
‘unfolds,
upcoming opportunities. Those who contin- The gladness wave keeps
ue updating themselves seldom encounter fail- gushing leading to so much
ures. Today, to counter the ramifications of delight all around
COVID-19 on the world economy, there is an New campus, new friends,
urgent need to adopt an open talent economy new style of learning and
based on intellectual & skill collaborations. The training&lifestyle too,
onset of e-learning platforms has enabled com- There will be so much
panies and human resources to adopt cutting- happening around you, in
edge skills from certified coaches and indus- you and through you,
E@D?
try experts. The user-generated content on Some of you may be care-
these platforms plays a pivotal role in business free, some overly busy and
learning in the current scenario, especially for some make history!
businesses interested in digital transformation. Blended learning, cutting
The competency level of a business across disciplines is an art for
depends on how competent its employees are. you to explore,
That’s why the HR managers of progressive Classes, labs, clubs, fests
41D5
firms always show interest in candidates all of many a kind, competi-
equipped with advanced professional skills and tions and programs galore
are willing to up-skill themselves further. As Including networking,
per the latest study by Robert Half, a global industrial visiting, camping, 3a00]STa[TT]3
3XP]P;;PiPadb??WX[X\Xb
staffing firm, 84 per cent HR managers pre- representing, winning and- 0bbXbcP]c?a^UTbb^aBA<8BC
fer hiring employees whose skills can be honed losing,
easily through training. Sometimes, candidates Also learn new languages, Ensure your resume is
willingness to learn new skills helps them to skills, art and explore your tal- exclusive to attract the best
secure a desired job despite lacking the exact ents while you are here, prospects available,
job qualifications. Here, HR managers believe It may keep you occupied, Bring out the author, poet,
that a persona proclivity for developing skills preoccupied too but will aid to dancer, lyricist, researcher,
matters more than his/her qualifications to career building. and the player in you
accept additional responsibilities. Some under estimate you You will certainly enjoy
Digitalisation of businesses has increased Networking, Decision-making, Negotiation, lose its valuable and essential people because and some overdo, but never the thrill as you fill your
the role of technology in various operations to and Leadership Skills, which every successful their presence is imperative to achieve long- worry about it heart, soul and mind.
manifolds. From marketing to manufacturing, professional needs can be acquired and pol- D?B:8;;8=68B=><>A4 term goals and objectives. But, to keep them You don’t have to be the Soon it will be time to bid
almost every business activity today is man-
aged by technology. Hence, to make their
ished through bespoke e-learning programmes.
They are useful in developing both hard and
0=4G?4=B8E40=3 engaged and motivated, the employer must
ensure their personal and professional growth.
version of their opinions! Your
goal to be your priority!
adieu to your alma mater and
move on
employees tech proficient, companies are soft skills among employees. BCA4=D>DB05508A Upskilling is no more an expensive and stren- Make good memories, eat The curtain ‘The End of
facilitating learning for them. On the other
hand, many traditional businesses which have
Detailed and interactive videos by the sea-
soned trainers can be viewed again and again C70=:BC>C74 uous affair. Thanks to the digitisation of com-
munication that has made learning and
well, exercise, learn new
things regularly,
College Life’ will drop and
there’d be no replay,
heavily borne the brunt of the current pan- by an individual to derive maximum from a 3868C8B0C8>=>5 upskilling immensely affordable for both Also plant saplings, con- So be prudent and engage
demic have no better option than going dig-
ital to compete in the market. This is where
course module. Besides, s/he has the option to
choose more than one online coach or subject 2><<D=820C8>=C70C companies and individuals. Availability of e-
learning content in various formats and in dif-
tribute to animal care and
engage in research too
in craftingthe supreme version
of you.
e-learning programmes for entrepreneurs and matter expert. The content can be further cus- 70B<034;40A=8=6 ferent languages is greatly benefiting them Above all never shy away Serve the society whole-
managers are ensuring a smooth transition for tomized to topics of business relevance while serving well-informed and sophisticat- as participation will endorse a heartedly and do it free as far
them. By pursuing these skill-oriented cours- depending on an organisationrequire- 0=3D?B:8;;8=6 ed customers. Also, accessing industry lead- nice learning. as possible;
es, the victims of layoffs are re-entering into ments.Moreover, with the unprecedented 8<<4=B4;H055>A301;4 ers and thought leaders is no more a luxury It’s a demanding world out For to live in the happy
the job market. developments in region-specific virtual train- for small businesses. Like corporates, small there and to have an edge over memories of people is one
E-learning training programmes are use- ing programmes, the industry is receiving 5>A1>C72><?0=84B businesses too can empower their employees others, great form of victory.
ful in developing both hard and soft skills
among employees. Business skills such per-
immense benefits of localised content in ver-
nacular languages.
0=38=38E83D0;B with the experience and insights of eminent
personalities and consultants.
You need to be the best of
yourself! So, explore and
CWTfaXcTaXb0bbXbcP]c?a^UTbb^a
BA<8]bcXcdcT^UBRXT]RTP]S
taining to Data Analysis, Financial Accounting, It is always difficult for an organisation to CWTfaXcTaXb5^d]STa24>^UB_TPZ8] experiment ardently, CTRW]^[^Vh
W
/HW¶VEHRQOLQH 4US_TUQcUSebUVedebU
hile work and business has
moved to operating virtually,
the pandemic also has impacted on
how companies need to approach
employee growth and learning.
With social distancing and gather- CWT_aPRcXRT^U_a^VaP\\X]V[TPa]X]VP]SR^SX]VXb]^c[X\XcTSc^P]hPVT8cXbPbTRdaT
ing limits in effect, eLearning has
become the norm, and workplace
FXcWcX\TTeT]T;TPa]X]VXbTe^[eX]V2^\_P]XTbPaT RPaTTa^_cX^]X]cWT]Tff^a[SbPhbB78EA0<27>D370AH
training has turned into webinars
Q[T]SX]V]TfTafPhbc^RaTPcTP]X]cTaTbcX]V\Xg^U
O
and online classrooms. ver the last decade, new tech-
T;TPa]X]V\TcW^SbbPhb?A0B>>==860<
ELearning gives the benefit to nology has transformed
learn anytime and anyplace. The almost every aspect of our
biggest advantage that eLearning lives. In every home, each hand, on
provides for organisations is flexi- enthused. Gamification or Game- every desk, transportation to medi-
bility. Over the last decade, based learning is being used to both tation, Artificial intelligence and cod-
eLearning has found its way in the engage and educate. ing has proved to be humanity’s
corporate circuit and now will Given the uniquity of eLearning greatest innovation of man and
become a necessity. A LinkedIn and making any piece of content machine partnership. With the pro-
Learning report points how 66% of available, there are no limits to the gressing world, we know it is never
learning and development profes- possibilities and benefits of too late for anything. As in the field
sionals say that their roles within eLearning. It is not just enriching for of coding, well, the doors of new
their organisations have grown sig- employees but for organisations learning are always open.
nificantly since COVID-19 out- too, by saving operation costs and The practice of programming
break. Around 68% respondents also time investments. It is an opportu- learning and coding is not limited to
indicated that employers have nity to develop new skills and pro- any age. It is a secure career option in exercise. language. It involves constant use of
stressed on learning programmes mote creativity, making the employ- the new world and develops an Coding helps in shaping your brain parts for different functions of
and improve internal collabora- ees feel more empowered in the appreciation for how things work mental models coding. As coders also learn other
tion. The appetite for learning pro- roles. therefore helps mind growth in a pos- When choosing the language of programmers code, they try to write
grammes along with the remote However, good eLearning is itive direction. Some studies show that coding be it Java, Python, C, Cobol, it again with a new way. So in this way
working scenarios has pushed for not just about content curation and the coders develop high cognitive Fortran, or Basic you have to be care- coding also keeps the brain active.
companies to develop and prioritise helping employers train employees, panies as a part of their new L&D delivering it but speaks of the organ- skills and they have lesser chances of ful. Starting with the language can be As all these studies prove that
eLearning. Further, upskilling of but also in make it interactive and initiatives are also helping employ- isation’s overall competence devel- having memory loss. very hard, but once you start with one coding is good for cognitive devel-
employees using virtual and a two-way process. Some companies ees to expand their skillset and opment agenda. While organisations It improves the coders brain language, the coding dictates and opment it is essential for the young
eLearning has become necessary in are also enabling personalised or explore new capabilities online. have transitioned to eLearning to health and lets them think actively. helps in thinking about data struc- students to learn it from an early age.
the wake of coronavirus crisis. customised learning and trainings to Whether it is via massive open suit the needs of the present sce- Other studies have revealed that tures, algorithms, etc. The language Coding keeps the mind active and
There has been a need to enhance help employees learn specific skills online course (MOOC), sabbaticals nario, a solid eLearning strategy is coding uses parts of the brain asso- helps your mind work in a constant running all the time. Coders often
learning mechanisms for employees to graduate to new roles. There is and external coaching — these a must to make employees fit for bet- ciated with memory, language pro- way that one can tell who wrote it just program while hiking, jogging, bik-
while working remotely. also been a transition to rejig the avenues are enabling employees ter and higher roles. With the objec- cessing, attention and logic. It acts as by looking at the anonymised code. ing, or even eating. Also, as you keep
Companies are already on this standard presentation and excel stay high-spirited during the chal- tive to nurture future ready skill sets, a good brain exercise although many Coding isn’t just about Math on coding your mind gets familiar to
path. The learning and development handout content and digitalise it and lenging times. it would be key to witness how com- believe that coding is just logic and and Logic the language and you will find it less
approach has also gone completely make it more interesting and inter- With time, even eLearning is panies chalk out their eLearning math but it is much more than that, Many believe that coding is all essential to refer to the guide. This
digital and virtual. Some examples active. evolving. Companies are blending strategies that helps employees har- it involves memory, logic, math, cre- about math and logic but it is not lim- brain exercise lets you be creative and
include virtual instructor led train- The pandemic scenario has also newer ways to create an interesting ness the eLearning opportunities. ativity, language and attention. Few of ited to this. The area spans more than lose your burdened mind.
ings, or webinars or webcasts and brought mental and psychological mix of eLearning methods — to CWTfaXcTaXb?aPb^^]=XVP\ the points say that coding is essential this. The coders also need to have bet-
podcasts- virtual collaborations is health in the spotlight. Many com- keep the workforce motivated and 2C>2^U^d]STaBcaPcQTP]b for the brain and it is a good brain ter creativity, attention, reasoning, and CWTfaXcTaXb5^d]STa2^STEXSWhP
:^a`ceR_ee`TY``dVhZdV]j
4[TPa]X]VWPbTUUTRcXeT[hQ[T]STSX]bcXcdcX^]P[[TPa]X]VFWX[TcWT_[PcU^a\bWPeTPVdbW
´5h`UbY]U^dQ\\UQb^Y^W
YcdXUgQiV_bgQbTµ
DXU`bUcU^d`Q^TU]YSXQc_`U^UTdXU
^UR^dabTbbT[TRcX]VcWTaXVWcUXcRP]QTRWP[[T]VX]VbPhb6060=0A>A0 WQdUgQid_Q^UggQfUY^dXUUTeSQdY_^
cUSd_bRbY^WY^WQVbUcX_VRbUQdXQYbV_b
T
he COVID-19 pandemic is
a paradigm of humans
learning to adapt new ways
]Q^icdeTU^dccQicF9F5; 71EB
of life and change nature of day
T
to day operations. The way online he COVID-19 pushed entire
space has taken over academic India into lockdown in March
and non-academic learning, busi- including schools and colleges, to
ness operations, exchange of prevent the spread of the deadly virus.
information, there is no going The entire education system was
back for most. brought to a halt. Now, the lockdown
E-learning has effectively has been lifted gradually but there is no
blended institutional learning as certainty in when the educational
well as professional upskilling, institutions will re-open.
while maintaining a nuanced The present pandemic has opened
approach for all. The openness of the gateway to a new wave in the edu-
individuals and corporates to cation industry. While most sectors are
understand and analyse the struggling to keep up with lesser
impact of edtech has broaden the demands in the pandemic, the edtech
scope for the industry. While the industry is seeing a significant increase
platforms have a gush of cours- in their consumer base.
es, selecting the right fit can be The new changes in the National
challenging. Education Policy (NEP) rolled out by
With the help of this checklist, the UC are prominent aspects of this
you will be able to set yourself on wave. The policies have altered the
the path of a successful online entire education system that was being EXeTZ6
6Pda
learning experience. followed in the country since decades 24>R^U^d]STa^U?aT_>][X]T
by modifying the existing 10+2 model
GOAL SETTING by 5+3+3+4 format. Another major dents to be enriched in multiple disci-
Assess and opt for an online change is diminishing the rigid bound- plines. The digital shift is influencing
course that elevates your growth aries between the three streams- arts, parents and students to enrol in tech-
trajectory. Finding a course that commerce, science, now students are oriented short-term courses such as
meets all expectations can be a free to choose their set of subjects. All designing, coding, and many more.
tedious process, hence it is these changes have created a new type With the current situation and con-
important to filter your criteria. your capability and augment Coaches are the backbone of For example, due to of learning — experimental learning sumer behaviour patterns, concise
It is important that individuals your operations. any e-learning platform, there- increased demand, digital mar- which emphasizes on critical thinking learning is certainly the future.
should be able to determine the Picking up non-academical fore seek for coaches who are keting courses have suddenly with discovery-based, discussion-based Concise learning helps students in
reason for choosing a particular course help in adding an edge to CWTT\TaVT]RT experts in the domain and whose surged prices, however, explore and analysis-based learning, eliminat- practical learning and improves their
course — to become employable,
to crack a competitive exam or
overall persona, hence select a
platform that offer certified
^U\d[cX_[T insight is not only academic but
offer comprehensive insight.
platforms that offer the same
course at competitive prices.
ing the concept of carrying heavy
books to schools.
understanding, self-organisation and
time-management. It keeps them
just a new hobby. This will ensure course of courses by certified X]Sdbcah_[PhTab Very often there are hidden costs The new wave of education has engaged and motivated and enhances
that the time and amount spent
is adequately used.
coaches. The course must offer
valuable course material, inter- WPbT]PQ[TS FLEXIBILITY & AFFORDABILITY
The online platforms foster
embedded into the format of a
course, hence one must read
come as a breath of fresh air for most
students but also as an obstacle for oth-
independent learning. Concise learn-
ing benefits students by improving their
Whereas, corporates and active classes and a more trust- [TPa]Tabc^ independent learning. Online reviews and do a diligent research ers. Quality education for all sectors of active learning, it eliminates the time
entrepreneurs should evaluate ed experience with personalised platform should be able to design before investing. society has been an on-going battle in that is wasted while passively studying.
who needs the course and why, attention. XST]cXUhP]S a course journey for the learner. Often online learning plat- India. UNESCO stated that around 320 Students do not feel the need to cram
for example, a marketing team EXPERTS AND METHODOLOGY SXbcX]VdXbW Considering factors like user forms overpass the approximately million learners in the country have their books and ultimately ace their
might need a training for digital While browsing the e-learn- interface, course accessibility 15 per cent of the billion popu- been impacted by the pandemic, the exams. With concise learning, students
marketing while leadership might ing learning platform, keep an _[PcU^a\bX] post completion, course avail- lation in the world, this popula- majority of them belong to socially dis- can focus more on topics that are dif-
need resilience training. eye on course variety and its ped- PRR^aSP]RTfXcW ability in low internet band- tion is specially-abled who need advantaged backgrounds. ficult for them to understand instead
Think about why do you agogy. It is ideal to enroll into width, etc. are imperative as it dedicated coaches and platforms On the other hand, concise learn- of going through the entire lesson. It
need a certain course and how non-traditional courses like `dP[XchP]S defines your learning experi- for better future. Talented indi- ing and the freedom of choice has given also maintains the curiosity in students
will it strike your growth ambit
in the short or long run.
Artificial Intelligence, Data
Science, Machine Learning
_aXRT;TPa]Tab ence. To ensure effective learning
for corporates, platform should
viduals with certain disability are
masters of multiple traditional
a chance for students to elect their
courses, teachers, and tune into video
and motivates them to solve problems.
In other words, concise learning is
alongside leadership and soft bW^d[SRP[Rd[PcT be able to customize the course and non-traditional subjects. lessons according to their needs. With effective and meaningful learning.
COURSE CREDIBILITY
Accreditation is like a pro-
skills. While researching, look for
platforms that offer live courses
cWTA>8Qh in accordance to the organisation.
The emergence of multiple
Find platforms that carter to
varied audience to experience
the abundance of courses that are
available online, learning more in less
We offer online live classes, along
with class and subject-specific course
tective layer for your online with expert coaches instead of STcTa\X]X]VcWT industry players has enabled holistic learning. An excellent e- time is the need of the hour. Parents, content and Test series. The dedicated
course and can help you mark a
difference between good and
just pre-recorded lectures. Live
courses amplify learning and
ch_T^UR^dabT learners to identify and distin-
guish platforms in accordance
learning course is an eminent
opportunity to be in control of
the key decision-makers want their
children to stay ahead of time and
and experienced team of tutors sup-
ports students through both online and
brilliant coaches and platform. ensures effective engagement with quality and price. Learners your destiny. expand their learning capacities. offline mediums with its course mate-
Identify your skill gap and look between the learner and the should calculate the ROI by CWTfaXcTaXb24>BcaPcTVXR6a^fcW Education is no more limited to a sin- rial available on the app, YouTube and
for a skill set that will enhance coach. determining the type of course. ;TPSTaETacTg6[^QP[BTaeXRTb gle field of study; current times ask stu- the website.
9 <8=38C
dbc\^]cWbPUcTacWT^dcQaTPZ^U2^eXS 0\PY^aRWP[[T]VTcWPcRP\TU^aTfXcW TSdRPcX^]FWPcV^Tb^]PcW^\TX\_PRcbP \^Sd[TXbR^]SdRcX]VPbbTbb\T]cbP]S
(cWTF^a[S1P]ZSTR[PaTScWPccWT cWT^]bTc^UaT\^cT[TPa]X]VfPb[PRZ^U bcdST]cb_a^_T]bXchc^[TPa] TgP\X]PcX^]b8cbTPbXTac^PbbTbbcWT
_P]ST\XRWPSRPdbTS\^aTcWP] % aXVWcc^^[bP]ScTRW]XRP[Z]^fW^f^] B^\T^UcWTbTUPRc^abX]R[dST_^eTach bcdST]cb^]cWTQPbXb^U\d[cX_[TRW^XRT
QX[[X^]RWX[SaT]P]Sh^dcWfWXRWR^]bcXcdcTb bcdST]cb_PacPbfT[[Pb_PaT]cbP]S TgXbcT]RT^US^\TbcXReX^[T]RT[XZT `dTbcX^]bX]cWTR^]cTgc^U^][X]T[TPa]X]V
Pa^d]S'^URWX[SaT]T]a^[[TSX] cTPRWTab<^bcX]bcXcdcX^]baT[XTSWTPeX[h^] aT[h^]^cWTacWXaS_PachP__[XRPcX^]bCWXb cdc^aXP[bcWT]TTS^UcWTW^daXbc^X]cTVaPcT bXcdPcX^]bP]SbT_PaPcTS_PaT]cbC^cPRZ[T P]ScWPcXbfWPc\^bcTScTRW_[PcU^a\baT[h
TSdRPcX^]P[X]bcXcdcX^]bPRa^bbcWTf^a[Sc^ cWXaS_PachP__[XRPcX^]bcWPcWPScWT f^d[S]^cYdbcRdcS^f]^]cWTcTRW]XRP[ \TRWP]Xb\bbdRWPb_^SRPbcbP]SbX\X[Pa cWTbTbXcdPcX^]bcTPRWTabP]SX]bcXcdcX^]b ^]7^fTeTaP]TUUTRcXeTfPhc^PbRTacPX]
QT^dc^UbRW^^[PRa^bbPb\P]hPb % _a^eXbX^]^UeXST^R^]UTaT]RTRP[[X]VFWX[T R^\_[XRPcX^]bQdcP[b^aT`dXaT[TbbTa c^^[bcWPcaT`dXaT[TbbSPcPdbPVTPbfT[[ ]TTSc^T]WP]RTR^\\d]XRPcX^]fXcW cWTPRd\T]^aP_cXcdST^UPbcdST]c.
R^d]caXTbX]R[dSX]V8]SXP cWTbTc^^[bcda]TS^dcc^QTR^]SdRXeTU^a X]cTa]TcQP]SfXScW CWT^][X]TbcaPcTVhSTeXbTS\dbcQTbdRW _PaT]cbP]SVdPaSXP]bFWX[TcWTUaT`dT]Rh CWTP]bfTaXb]^ATP[[TPa]X]VRP]QT
6^X]VQhW^fcWT[PcTa_Pac^U!! ^UUXRT\TTcX]VbcWThUPX[TSc^b^[eTcWT 0UTfTg_TacbWPeTaPXbTSR^]RTa]bcWPc cWPcXcTUUTRcXeT[haTPRWTb_T^_[TUa^\P[[ ^U_PaT]ccTPRWTa\TTcX]Vb]TTSbc^QT \TPbdaTScWa^dVWbdQYTRcXeTPbbTbb\T]cb
d]U^[STSXcXb^][h^QeX^dbcWPccWTbXcdPcX^] _da_^bTfWT]XcRP\Tc^TSdRPcX^] cWTX]RaTPbTSaT[XP]RT^]^][X]Tb_TRXUXR bcaPcP^Ub^RXTch X]RaTPbTScTPRWTab\dbcT]bdaTcWPccWTh 0[b^P]TUUTRcXeTc^^[XbP[b^]TTSTSU^a
\dbcWPeTPVVaPePcTSQh]^fCWT CWTcTRW]XRP[]dP]RTbPRcTSPbP bcaPcTVXTbf^d[ST]cPX[aTPRWX]V^][h 0ccWTPS\X]XbcaPcX^][TeT[ TUUTRcXeT[hR^\\d]XRPcTcWTR^]RTa]bP]S cTPRWTabc^RWTRZcWTbTPbbTbb\T]cbC^
d]_aTRTST]cTS_P]ST\XRP]ScWT_a^[^]VTS WX]SaP]RTX]TUUTRcXeTdcX[XiPcX^]^UcWTc^^[b RWX[SaT]Ua^\QTccTa^UUUP\X[XTb7^fTeTa V^eTa]\T]cbP]SX]bcXcdcX^]bRP][^^Z \PZTcWT_PaT]cb^aVdPaSXP]bPfPaT^UcWT ^eTaR^\TcWXb\PY^a^QbcPR[TX]cWT
[^RZS^f]bXcdPcX^]WPeT_^bTSX]]d\TaPQ[T P]SPSSX]Vc^cWTf^TbfPb[PRZ^Ubca^]V cWXbR^]RTa]W^[Sb[Xcc[TaT[TeP]RTX]cWT c^fPaSbf^aZX]VfXcWcT[TR^\_[PhTabc^ [PbcX]VX\_PRc^]bcdST]cbTSdRPcX^]Pb _aTePX[X]VTSdRPcX^]bhbcT\fT_a^eXSTP]
RWP[[T]VTbfXcWaTVPaSc^cWTTSdRPcX^] X]cTa]TcQP]SfXScW0]TUUTRcXeTfPhc^STP[ fPZT^UcTRW]^[^VXRP[PSeP]RT\T]cbcPZX]V X]ca^SdRTiTa^aPcT_^[XRhc^Ud[UX[[ fT[[Pb[XUT?PaT]cb^]cWTXa_Pac]TTSc^QT 4ScTRW_[PcU^a\cWPcR^\TbfXcWP
bhbcT\6XeT]cWTbcPcT^UcWTTSdRPcX^] fXcWcWTbTa^PSQ[^RZbXbV^X]VU^acWTaXVWc _[PRTPcPaP_XS_PRTPa^d]Sdb TSdRPcX^]P[]TTSb5PRc^ab_TacPX]X]Vc^ aTb_^]bXeTc^cWTR^]RTa]baPXbTSP]ScPZT R^\_aTWT]bXeTPbbTbb\T]cbhbcT\fWXRW
bhbcT\X]^daR^d]cahcWTbXcdPcX^] 4ScTRW_[PcU^a\fWXRWWPbXcb^f]W^bc FWX[T\^bcTSdRPcX^]_a^eXSTabWPeT bcdST]cbUP\X[XTb_[PhP_Xe^cP[a^[TX] TUUTRcXeTaT\TSXP[b^[dcX^]b PSSaTbbTbP[[cWTPU^aT\T]cX^]TSR^]RTa]b
QTR^\Tb\^aTf^aaXb^\TX]8]SXP bTaeTaU^aR^]SdRcX]VR[PbbTbP]SS^Tb]c U^RdbTS^]_^_d[Pa\^STbbdRWPbeXST^ STcTa\X]X]VPcTPRWTabPQX[Xchc^_a^eXST 0bXV]XUXRP]cR^\_^]T]c^UTSdRPcX^] CWTfaXcTaXb3TeA^h5^d]STa3XVXcP[0aXbc^cT
µ*HWXQLTXHH[SHULHQFH
;^RPcX^])F^aZ5a^\7^\T
BcX_T]S)C !_Ta\^]cW B<0AC?7>=40810B430??;820C8>=5>A50A<4AB
;X]Z)X]cTa]bWP[PR^\X%#&((($
0
]PVaXcTRWbcPacd_R^U^d]STSQh R^\X]VUa^\bPcT[[XcTP]Sb\Pac8^C
438C8=6>?4A0C8>=B0C202CDB
WRH[SDQGSHUVSHFWLYHV¶ cWTbcdST]cb^U88C6dfPWPcXP]S
P[d\]X^U=8CBX[RWPaP]S3XQadVPaW
D]XeTabXch0bbP\WPbSTeT[^_TS
STeXRTb0VB_TPZR^]bXSTabd_c^!
[^RP[Ra^__PaP\TcTabfWXRWPaTZTh
X]SXRPc^ab^UcWTXaWTP[cW[XZTcT\_TaPcdaT
2><<D=820C8>=B 0VB_TPZP\d[cX[X]VdP[b\Pac_W^]T aPX]UP[[bd][XVWcW^dabb^X[WTP[cWbcPcdb
gramme in the UK from any
other source. ;^RPcX^])F^aZ5a^\7^\T CWT_P]ST\XRWPb]³cSP\_T]cWTb_XaXc^U P__[XRPcX^]U^aUPa\Tabc^b\Pac[h
\P]PVTcWTXaUPa\bP]SaT\^cT[h\^]Xc^a
P\^]V^cWTabc^P[TacUPa\TabPQ^dc
_a^QPQ[TRa^_cWaTPcbX]PSeP]RTP]S
Meet the English language BcX_T]S)C! _Ta\^]cW
;X]Z)X]cTa]bWP[PR^\X%#&(((&
bcdST]cbc^bcdShPQa^PSB038@10B70 SXbcaTbbPRcXeXcXTb bdVVTbcQTbc_aPRcXRTbc^cPRZ[TcWT
T
he British Council requirement.
3TeT[^_TSfXcWPV^P[^U^_cX\XbX]V X]R^\X]VcWaTPc
invites applications for
scholarship to support
Return to your country of
citizenship for a minimum of
3TPS[X]T)3TRT\QTa!#!! cT[[bh^dfWhbcdShX]VX]U^aTXV] cWTX]UPa\_a^SdRcXeXchcWa^dVW08cWXb CWTP__P[^]VfXcWcWT8>CWPaSfPaT
P__[XRPcX^]fX[[WT[_cWTUPa\TabX] WPbQTT]cTbcTSU^acWT_PbccWaTT
women and girls in STEM
around the world. Each of
two years after your scholarship
award has ended.
2>=C4=CFA8C8=60CE8C0;8CH;8E8=6 d]XeTabXchXbaTfPaSX]V \PZX]VSTRXbX^]bP]S\P]PVX]VUPa\ \^]cWbfXcW$UPa\TabP]Scf^cTP
these scholarships covers full You are required to show in 2>;;464 PRcXeXcXTbQhcWTR[XRZ^UPbX]V[TQdcc^] TbcPcTb=TPa[h!$UPa\TabWPeTP[aTPSh
;^RPcX^])F^aZ5a^\7^\T daeXbX^]RP]b^\TcX\Tb f^aZfXcWc^_]^cRWUPRd[ch ^]cWTXab\Pac_W^]T^aR^\_dcTa QTT]_a^eXSTSWP]Sb^]caPX]X]VX]
>
tuition fees, monthly stipends, your application that you are 0VB_TPZfPb[Pd]RWTSQh?a^UTbb^aC6 dcX[XiX]VcWTUd[[_^cT]cXP[^UcWTP__CWT
a return economy class ticket active in the field with work BcX_T]S)C _Ta\^]cW QT[X\XcTSc^fWPcfTeT \T\QTab
;X]Z)X]cTa]bWP[PR^\X%#&(((' BXcWPaP\3XaTRc^a88C6dfPWPcX \^QX[TP__XbR^\_[TcT[hUaTTU^aVT]TaP[
and other study-related costs experience or with a proven Tg_TaXT]RTSX][XUTQdc D]XeTabXcXTbPQa^PSP[b^ 3aXeT]QhWh_Ta[^RP[Ra^_SPcP b\P[[UPa\Tab
like IELTS exam fee, visa appli- interest in the programme area 3TPS[X]T)3TRT\QTa!#!! bcdShX]V WPeTP]TgcT]bXeT]Tcf^aZ^U
cation, NHS surcharge and you are applying for. PQa^PSRP]QT _Pac]TabWX_bfXcWaTbTPaRW
study materials. You are willing to demon- 42><<4A24<0=064<4=C PUP]cPbcXR X]bcXcdcTbcWTaTQh_a^eXSX]V 88CA>>A:447>=>DA43
No of scholarships for strate future contribution to 0C;>><2A RWP]RTc^ \^STa]aTbTPaRWUPRX[XcXTbc^
Indian students: 1 capacity-building and socio- ;^RPcX^])3T[WX6daVP^] WT88CA^^aZTTWPb _aTbT]cTSQh?a^UTbb^a cWT\c^R^]cX]dTcWTXa
C
Eligibility: To be eligible economic advancement RWP]VTcWXb bcdST]cb5^aX]bcP]RTfWX[T
BcX_T]S)C&C _Ta\^]cW BcdShX]V bcdShX]VPcP]X]cTa]PcX^]P[d]X QTT]PSYdSVTSPbcWT 0bWdc^bWBWPa\P X]]^ePcX^]c^aTe^[dcX^]XiT
for the scholarships for women through the benefits achieved CWT<^bc8]]^ePcXeT BTRaTcPah3BCP]S:aXb ^daX]SdbcaXTbU^aUdcdaT
in STEM, you must: Be a after graduating from UK high- ;X]Z)X]cTa]bWP[PR^\X%#' X]cTa]PcX^]P[[h^UUTabP eTabXchh^d\PhaTRTXeTcWT
0__[XRPcX^]STPS[X]T)3TRT\QTa!# 8]bcXcdcT^UcWTHTPaU^aXcb 6^_P[PZaXbW]P]_Pbc 7TbPXS)°CWT
woman (cis-gendered or trans) er education and returning W^bc^Ud]X`dTTg_TaXT]RTb ^__^acd]Xchc^f^aZX]cWT X]]^ePcX^]`d^cXT]cX]cWT _aTbXST]c288P]S 6^eTa]\T]cP]SX]Sdbcah
or identify as non-binary. your home country. !! c^Tg_P]S^da_Tab_TRcXeTb aTbTPaRWfX]V^UcWTf^a[Sb 2888]SdbcaXP[8]]^ePcX^] RWPXa\P]288=PcX^]P[ bW^d[SaTP[XbTcWPc
Be a passport holder and You must demonstrate a P]S_a^eXSTbbcdST]cbfXcW [PaVTbcUXa\bbdRWPb0__[T 0fPaSb!! BcPacd_2^d]RX[ SXbad_cX^]cWa^dVW
permanent resident of one of plan and passion to engage ?HC7>=34E4;>?<4=C0C V[^QP[RPaTTa^__^acd]XcXTb <XRa^b^Uc^a0S^QT CWTPfPaSRTaT\^]h BWPa\PR^]VaPcd[PcTS R^]eTaVT]RT^U
the eligible countries — India. other women and girls in 43D6>A8;;0 cWPcWPeTcWT_^cT]cXP[c^ 0RRTbbc^WP]Sb^]Tg_T fPbWT[Sc^SPhSdaX]VcWT P[[fX]]TabP]S^cWTa cTRW]^[^VhP]ST]cTa_aXbT
Have submitted an appli- STEM from your home coun- ;^RPcX^]);dRZ]^f caP]bU^a\cWTXa[XeTb aXT]cXP[[TPa]X]V) CWXbXbP !%cW3BC288CTRW]^[^Vh P__[XRP]cbU^acWTXa RP]QTPVP\TRWP]VTa
cation to study on one of the try. BcX_T]S)C !_Ta\^]cW B^fWhXbbcdShX]VPQa^PS V^^SfPhc^Q^^bcR^[[TVT Bd\\XcCWTPfPaSfPb X]]^ePcX^]P]SdaVTS U^acWTTR^]^\h±
eligible University of You agree that your per- ;X]Z)X]cTa]bWP[PR^\X%#'"
Strathclyde postgraduate pro- sonal data being shared with b^aTfPaSX]VcWPcTeT]X]bdRW [TPa]X]V^dcR^\Tb0[\^bcP[[
0__[XRPcX^]STPS[X]T)3TRT\QTa!#!! P]d]_aTRTST]cTSbXcdPcX^]. R^[[TVTbPQa^PSWPeTWP]Sb^]
grammes. the British Council as a condi-
7XVW`dP[XchaTbTPaRW [TPa]X]VX]cTVaPcTSX]c^cWTXa 60<8=65>A?A>54BB8>=0;4B?>ACB?;0H4AB
Have completed all com- tion of applying for the bursary.
D8DG34B86=0CE>;D<4CA44 RT]caXRTSdRPcX^])CWTUd]SP RdaaXRd[d\b?a^VaP\bfXcW WT1T]@P]]^d]RTScWT[Pd]RW^U _^fTaUd[_TaU^a\P]RTP]SUPbcaTUaTbW
C
ponents of an UG degree that If you are awarded a schol-
will enable you to gain entry arship, you agree to maintain ;^RPcX^])2WP]SXVPaW \T]cP[aTPb^]cWPcP[PaVT]d\ P__[XTSPRcXeXcXTb^UUTaX]cTaTbc ]TfVP\X]V\^]Xc^abdQQaP]S aPcTcWT]TfaP]VT^U\^]Xc^abRaTPcTP]
onto a PG programme at the contact with the British BcX_T]S)C _Ta\^]cW QTa^U8]SXP]bcdST]cbcaPeT[ X]VTg_TaXT]RTbcWPch^dRP] <>18DIP]S]TfG;:bTaXTbd]STa X\\TabXeT_[PhX]VUXT[ScWPcT]WP]RTbcWT
University of Strathclyde. Council and act as an ambas- ;X]Z)X]cTa]bWP[PR^\X%#'# PQa^PSXbc^PRR^\_[XbWWXVW X]R[dST^]h^da2E^aaTbd\T I>F84aP]VT VP\X]VTg_TaXT]RTb
Demonstrate a case for sador for the UK and engage 0__[XRPcX^]STPS[X]T)3TRT\QTa!#!! `dP[XchaTbTPaRW <^aT^eTabcdST]cbWPeT CWTR^\_P]hX]ca^SdRTS1T]@ CWT]TfI^fXTG;:BTaXTbQaX]Vb
financial support need via a with activities as part of a 4G!$ X]cWT<>18DIbTaXTbP]S P]P\P[VP\PcX^]^UR^\U^acP]S
1TXcT]VX]TTaX]VcTRW]^[^ cWT[TeTaPVTc^PRRTbbWXVW G;!$#%:P]SG;!# :X]I>F84aP]VT R^\_TcXcXeTTSVTcWPcfX[[UdacWTaT[TePcT
means-test conducted by the STEM alumnus. Any involve- =4C34E4;>?<4=C0C2B< VhbRXT]RTb^aP]h^cWTaUXT[S cTRW[PQ^aPc^aXTbU^aaTbTPaRW
University of Strathclyde. ment in these activities during CWT<>18DIaP]VTXbSTbXV]TSU^a ^da_aTbT]RTX]cWTVP\X]V\^]Xc^a
C427=>;>684B U^aTXV]X]bcXcdcTb^UUTa PRcXeXcXTbCWThP[b^T]Y^hcWT VP\X]VT]cWdbXPbcbfW^ST\P]S \PaZTcX]8]SXP
Have not previously stud- your study in the UK will take ;^RPcX^])1WdQP]TbfPa
ied at degree level or higher in up no more than five hours per PSeP]RTSaTbTPaRW_a^VaP\bX] QT]TUXcb^U[XQaPaXTb_PRZTS X\\TabX^]P]S_TaU^a\P]RTX]?2P]S FXcWcWXbaP]VTfTPX\c^UPRX[XcPcT
BcX_T]S)C _Ta\^]cW P[\^bcP[[bdQYTRcbATbTPaRW fXcWQ^^Zb^]P[[bdQYTRcb 2^]b^[TVP\TbI>F84G;aP]VTXb VP\TabfXcWcWT\^bcR^\U^acPQ[T
the UK or lived recently in the term.
UK. Application deadline: It ;X]Z)X]cTa]bWP[PR^\X%#'% _a^b_TRcbPaT\PV]XUXRT]cP]S CWTfaXcTaXb24>U^d]STa^U4Se^h b_TRXUXRP[[hSTbXV]TSU^aTB_^acb VP\X]VVTPac^W^]TcWTXabZX[[bP]STgRT[
You must not be in receipt is March 1, 2021. 0__[XRPcX^]STPS[X]T)3TRT\QTa (!! bcdST]cbVTcP]^__^acd]Xchc^ _[PhTab2^\QX]TSfXcWPbch[XbWSTbXV] X]c^da]P\T]cb
17>?0; kF43=4B30H k3424<14A %!!
b_^ac !
7f]]jWZe3f^cRY\Vje` 6PePbZPa´b_XRZ)?P]c^eTaBPWPPb
ZTT_Ta6X[[^eTaBWPfPb^_T]Ta
:_UZR¶dTYR_TVd+3`cUVc
?C8Q =4F34;78
?C8Q =4F34;78
F
ormer Australia captain series against Australia, starting Thursday. so he can play a few rash shots here and
Allan Border believes a Gavaskar said that with a blistering 73- there, but he looks a seriously good play-
fully fit Jasprit Bumrah ball 103-run knock in the second warm-up er, this kid. He would be my pick out of the
will be the key to India’s game under his belt, Pant will give India guys I saw.
prospects of retaining the four- more flexibility in the first Test, the only day- “I know you guys (rate) Shaw but it
match Test series Down Under. night game, to be played in Adelaide. seems to me like he plays a shot-a-ball.
Calling himself a big fan of “It is going to be a tough one for the tour Against the new ball, he looks good on flat
the India pace spearhead, selection committee because Rishabh played tracks, but in Australia, you’ve got to be a
Border said Bumrah has the in all the 4 Test matches four years ago. He little bit more watchful about your shot
potential to make a difference also got a hundred and seemed he got under selection,” he added.
between the two sides in the the skin of the Australian players with his Gavaskar agreed with Border and said
much-anticipated rubber, start- chirping behind the stumps. Shaw needs to get back to the drawing board
ing in Adelaide from Thursday. “...When you just came off a hundred and work on his weaknesses — inconsis-
“Well I am a huge fan of few days earlier, he would be the choice of tency and poor shot selection.
Bumrah. If he keeps himself fit. the management I think,” Gavaskar said. “I think he’s (Shaw) got to spend a lit-
We are talking of a guy who can Gavaskar said he preferred Pant over a tle more time assessing his batting. Because
win games for you fellows. I more-accomplished keeper in Saha, as as an opening batsman, you’ve got to give
worry about him because on Australian pitches are not so demanding yourself time to see what the pitch is doing,
our pitches you get a little bit when it comes to keeping wickets. see what the bowlers are doing,” he said.
of bounce and sideways move- “When you are playing on pitches “Trying to bat the way he’s batting at the
ment,” said Border. where the wicketkeeper has to stand upto moment is not going to make him a con-
“For India to win, I am the stumps, where the ball turns out a lit- sistent player. Yes, he’s going to make runs
worried about Bumrah. If he tle bit that’s when you tend to take your best once in a while but he’s got to tighten up
fires up like he did last time, get wicketkeeper, in which case Wriddhiman his defence.”
important wickets, ruffle a few Saha would be the obvious choice,” he Gavaskar, however, was pretty sure
feathers with the ball, I reckon explained. about other opener, saying Mayank Agarwal
he could be the real difference,” “But here, India will having pacers is the player to watch out for in the series.
he added ahead of the series. where you can stand behind and have lit- “For me the player to watch out for
Bumrah accounted for 21 tle more time, my feeling is that they will Gavaskar. from India will be Mayank Aggarwal. He
wickets in four matches in go for Rishabh,” Gavaskar said while pre- “So with uncertainty at the top, they came to Australia for the last couple of Test
2018-19, playing a key role in viewing the series named after him and would like to strengthen their batting and matches two years ago and he actually,
India’s first-ever Test series Allan Border. so Rishabh Pant will play. I am hoping he showed the way because till then India had
win in Australia. Both Gavaskar and Border batted for (Rishabh) plays at 6 because then that will not got any start,” the Little Master said.
“You always think that 8]SXP]_PRTa9Pb_aXc1d\aPWRT[TQaPcTbPUcTaWTSXb\Xbb0dbcaP[XP]QPcb\P]BWPd]<PabW[QfSdaX]V"aSCTbc^U! ' (
Shubman Gill over Prithvi Shaw to open allow you to pick 5 bowlers to try and get “He showed how to tackle Nathan
your batting line-up will get 1^aSTa6PePbZPaca^_WhbTaXTbPc<T[Q^da]T2aXRZTc6a^d]S 0?5X[T??XRcdaT
along side Mayank Agarwal in the series. 20 Australian wickets,” he added. Lyon. He has gone from strength to
enough runs, you need the 20 “...India is a little bit shaky at the top of In the two warm-up games, Gill’s strength. Look at the season he had last year,
wickets to win the Test. If he “So he will want to hit the pens from there,” he said. surely the Aussies will be the order. They don’t know who they are scores — 0, 29, 43, 65 — got better with where he scored a double hundred against
stays fit, he is the one who is ground running at Adelaide “It’s hard to replace anyone favourites for the games where going to go with. Mayank Agarwal is of every knock while Shaw — with scores of South Africa.
going to be a key,” the former and try and get India off to a like him. So we have to wait he is not playing. That is for course a certainty. But who’s the other open- 0, 19, 40, 3 — looked out of sorts. “So he’s the guy I really am looking for-
Australia skipper added. flying start and see what hap- and see the impact it has but sure.” er — Shubman Gill or Prithvi Shaw?” said And Border was mighty impressed by ward to in this series,” Gavaskar added.
From Australia’s point of