Professional Documents
Culture Documents
Editorial Delhi
Sundar Bai, an opium farmer, and her son Anil tend to their poppy crop in a field in Neemuch district on the Madhya PradeshRajasthan border. SHASHI SHEKHAR KASHYAP
Uncertain future in
pand the licensing for unlanced poppy and has turn when six farmers were killed in police firing.
decided to set up a processing unit for Concen The Bharatiya Janata Party (BJP) blamed opium
trate of Poppy Straw of 100MT capacity on a PPP smugglers for instigating the community.
(publicprivate partnership) basis.” Now, the farmers accuse the government of
trying to “create divisions with two systems”.
A question of public health and profits They say that the Centre has introduced a policy
a sea of poppies This is the second crop season since the policy
was revised. Various farmers organisations such
as All India Kisan Sabha, Bharatiya Afeem Kisan
Sangharsh Samiti, and Bharatiya Afeem Vikas
Samiti formed the Samyukt Afeem Kisan Morcha
to raise the issues of opium farmers. When Prime
that is reminiscent of the British era. They have
heard stories about the East India Company
smuggling opium from their region and export
ing it to China and other countries. “Big compa
nies will misuse this crop to maximise profit. If
smugglers have stolen opium from government
Three districts in Madhya Pradesh and Rajasthan together contribute to 80% of India’s opium production. Minister Narendra Modi visited Neemuch to ad factories, what security can be ensured in private
Already facing the problem of stagnant procurement rates and rising input prices, farmers are now angry with dress an election rally last week, these farmers’ factories,” asks Kachrulal Chadawat of Pipliya.
the Union government for opening opium production and processing to private players. A.M. Jigeesh talks to organisations tried to meet him. Modi did not Nand Kishore and Mohan Singh, two farmers
meet them, so they have sent him a memoran who have come to sell garlic at the Dalauda Man
farmers in the Mewar region about their concerns dum demanding that the CPS system be with di in Mandsaur, echo this sentiment. “We do not
drawn, and the traditional system of extracting cultivate opium even on an inch of land more
opium gum be continued. than what is earmarked by the government. Nar
hen Sunder Bai’s husband, Shiv rials can be produced from opium poppy: opium Farmers believe that private companies are cotics officials mark the area twice after giving a
businessline.
SATURDAY NOVEMBER 18 2023
ISHA DAYAL
A
head of the first global
stocktake on climate action,
Higher risk provisioning should not be permanent due to take place at COP28
in Dubai, a new report
he Reserve Bank of India has flagged the risk
T
released by the United
building up in retail loan portfolios of banks Nations on November 14 has reiterated
the need for more action and delivery of
and NBFCs on various occasions; the latest stronger commitments by countries to
being during the October monetary policy avert the climate crisis.
announcement when Governor Shaktikanta Das The target set at COP21 in 2015
under the Paris Agreement, of limiting
asked lenders to strengthen internal checks to temperature rise to 1.5 degrees above
establish safeguards. Thursday’s move by the central the preindustrial levels, is set to be GETTY IMAGES/ISTOCKPHOTO
bank to increase risk weights on certain consumer breached in light of the insufficiency of
I
the expenditure spurred by personal loans n a letter from a soldier in Vietnam stands as one of the most protracted and Human rights organisations are
to his father while preparing a book contentious disputes in modern history, exhibiting double standards in their
and credit card loans such as travel, titled Brave Men, Gentle Heroes: marked by decades of violence, approach to different conflicts. These
entertainment, meeting medical exigencies American Fathers and Sons in World War displacement, and human suffering. At organisations are being handicapped by
or to spend on family functions also II and Vietnam, there was a quote from its core, this conflict revolves around the political agendas, donor interests, or
contributes to economic output. These loans Greek Philosopher Plato:“only the dead quest for sovereignty and pressure from powerful nations,
have seen the end of war.” selfdetermination, with both Israelis impacting the objectivity of their
are needed by small borrowers to bridge Since October 7, TV screens and social and Palestinians claiming the right to a MIDDLE EAST. Unending conflict REUTERS reports and statements related to the
income shortfall. The increase in media have been flooded with graphic homeland. Israeli actions in Palestine.
riskweights should, therefore, not become a content featuring violence and The peace process between Israelis conflict’s humanitarian impact, A just resolution requires
lasting feature. bloodshed in the besieged Gaza strip. and Palestinians has yielded little including displacement, lack of access to acknowledging and rectifying historical
In Israel’s retaliatory strikes against progress because of the discriminatory basic services, and economic hardships, injustices, ensuring the right of return
Hamas’ October 7 offensive, more than bias of Western powers towards Israel. persists due to the failure of the UN. for Palestinian refugees, and challenging
10,000 people have been killed in Gaza in This diplomatic failure has led to a cycle There should be sufficient pressure on the structures of occupation and
POCKET: Lending 2.0 RAVIKANTH 30 days of Israeli bombing (over 60 per of violence and instability. Israel to comply with UN resolutions, discrimination. The twostate solution
cent of them women and children), Several rounds of peace talks, such as which can lead to progress in resolving has been a viable approach to resolve the
which is more than the civilians killed in the Oslo Accords in the 1990s and the key issues such as borders, settlements, IsraelPalestine conflict.
Russia’s war in Ukraine in 20 months. If Camp David Summit in 2000, have failed and the status of Jerusalem. This diplomatic resolution aims to
we consider the attack by Hamas as to yield a lasting agreement. establish two separate and independent
terrorism, Israel is engaged in sheer The international community, WESTERN DOUBLE STANDARDS states coexisting side by side.
murder of Palestinians. including major powers and mediators, Israel, despite its controversial Although its implementation faces
The international community has not should use their diplomatic influence to settlement policies and military actions, challenges, it will achieve a lasting
done enough to protect the rights of create conditions for a sustainable peace receives unwavering support from resolution to the IsraelPalestine
Palestinians. The silence of the West is process. The UN remains a puppet in the Western powers. US military aid to conflict.
deafening. hands of Western powers, especially the Israel has played a crucial role in Israel’s
The West will be wholly complicit in US, in shielding Israeli warcrimes in the military capabilities and its ability to The writer is a research scholar at Central University of
Israeli war crimes in Palestine if it Gaza strip and the West Bank. The carry out operations in occupied Kashmir and a columnist
LETTERS TO EDITOR Send your letters by email to bleditor@thehindu.co.in or by post to ‘Letters to the Editor’, The Hindu Business Line, Kasturi Buildings, 859860, Anna Salai, Chennai 600002.
Climate challenge intrusion of sea waters, more focus Amend the law recover a small stake at least, who duty” (November 14). This is
With reference to ‘Rich nations may should be on building the required With reference to “Due for are otherwise forced to resort to severely hurting domestic palm
have met $100b climate goal last infrastructure for renewable energy. change” (November 17), the apex endless private litigation based on farmers who are unable to realise
year’ (November 17), the OECD data RV Baskaran court’s ruling covering waterfall their contractual agreements. reasonable prices for the palm
reveals bleak performance of rich Chennai mechanism in IBC resolution At the same time, an increase in the fruits, where the cost of harvest is
countries in aiding the poorer process may push tax dues of resolution costs to recover the high due to the thorny nature of
nations financially to meet the cost Welcome SEBI move governments from fifth to second losses to state, would jeopardise plants.
of mitigation on climate change. The news report ‘Subrata Roy’s place to be on the same footing as the investor interests. As aptly An import duty cut sways the
OECD’s concern that the $100b death not to halt probe against secured creditors. pointed out there is a need for domestic oil manufacturers away
target is far below the poor nations’ Sahara group, says SEBI chief ‘, is However, it could also impact the tweaking the mechanism by from local farmers either without
investment needs to be discussed at welcome. But more importantly how recovery chances of other amending Section 53 in notice or effecting sudden collapse
length by the stakeholders of the would ₹25,000 crore assets be creditors who are lower down in synchronization with the court in procurement prices. The
ensuing COP28 climate summit. distributed amongst retail investors the pecking order. ruling. government must protect local
The OECD and any other and how much time will it take. As a social security measure, it Sitaram Popuri palm growers by fixing a minimum
independent body authorised by There are big lessons for the retail would be logical for the state to Bengaluru procurement price without
COP28 must monitor the progress investors to not get carried away by forego a portion of tax dues in case subjecting the farmers to the mercy
of the mitigation activities of the these Ponzi schemes. of distressed companies and Save local palm farmers of big players.
beneficiary countries. Besides Bal Govind remain at same old fifth place to Apropos “Edible oil imports up Rajiv Magal
constructing seawalls to protect Noida help the unsecured creditors to 17.39% in 202223 on low customs Halekere Village (Karnataka)
Published by Nirmala Lakshman at Kasturi Buildings, Jamshedji Tata Road, Mumbai400020 and Printed by N. Vaidyanathan at Dangat Media Pvt. Ltd., No.22, Dighe Midc, Vishnu Nagar, TTC Industrial Area, Dighe, Navi Mumbai400701, Maharashtra on behalf of THG Publishing Pvt. Ltd. Editor: Raghuvir Srinivasan (Responsible for selection of news under PRB Act). ISSN 0971 7528
CM
YK . . . . . . . . BMBME
>
OPINION 11
Volume XXX Number 184
Blue Revolution T
NEW DELHI | SATURDAY, 18 NOVEMBER 2023 his is an Indian success story, the Blue
Revolution, of a rise over two decades, and no
fleeting moment of glory, like 1983. That is because
WEEKEND RUMINATIONS the game in the country has seen systemic changes
for the better. The markets for cricket have all moved
T N NINAN here along with the centre of power. The biggest rea-
The story of Indian cricket is that of a rise over two decades. It is no
Palliatives, not solutions
son behind this success is the rise of a true meritoc-
racy. As Shah Rukh Khan’s latest blockbuster, Jawan,
fleeting moment of glory like in 1983. The game has seen systemic showed, we all love to attack and curse that amor-
E
arly in 1996, your columnist met the then finance minister, Manmohan Singh,
in his North Block office. On being told that the Congress party would not be
changes, with pace attack, fitness, and fielding as its key pillars phously defined thing called the “system” in our
country. What’s the system in cricket? A Jay Shah
talking of economic reforms in its forthcoming Lok Sabha election campaign, today, Anurag Thakur yesterday, Sharad Pawar,
W
Dr Singh retorted: “What else is there to talk about?” hen India began its campaign in this World up. India is the only team in a long time to beat the Jagmohan Dalmiya, N Srinivasan, Madhav Rao
The answer has come in all the elections since then: Loan writeoffs, higher-than- Cup, both its critics and fans had the same Aussies in four consecutive series — the last four. Scindia, or I S Bindra, the day before yesterday, and
market procurement prices for grain, free foodgrain for the majority of consumers, job complaint: That it hadn’t won any Two series each, home and away. Rajeev Shukla all the time, are easy targets. They
reservations for new caste categories, unsustainable pension programmes, an ever grow- International Cricket Council (ICC) trophy for a full In One Day Internationals (ODIs), India became were not cricketers, so what business did they have
decade, since that Champions Trophy in world number one for the first time in January, running the game? It was easy to attack them.
ing list of freebies and subsidies, and (increasingly) cash handouts. There is also credit
Birmingham in 2013. 2013, nearly two years after winning the World Cup Even the holiest of the holy, the Supreme Court
taken for developmental work: Building the physical infrastructure, and the progressive
It always made the knockouts but only to lose, in Mumbai. It has been ranked number one eight of India, waded into that. It is just that it took the
provision of basics (toilets, electricity, and internet connectivity). What economists call once even to Pakistan (Champions Trophy again, at times since. That is an incredible sway over the BCCI from Anurag Thakur and finally handed it
reforms — essentially fiscal discipline and market orientation — never find mention. The Oval in 2017). This meant something had to be most prolific form of the game. For some months back to Jay Shah. The mightiest in Indian bureau-
Perhaps this is to be expected. Voters have learnt to look for what they can get fundamentally wrong with Indian cricket. Fans are earlier this year, Pakistan and Australia grabbed cracy joined hands with the Supreme Court and
today, not jam tomorrow, and seem to choose parties that offer the most generous as fickle as critics are bloodthirsty. In these contrary the spot from us. That was the period when the fan well-meaning virtue signallers to “reform” Indian
packages — which encourages a rush to raid the treasury. Distrust of governments is emotions, both can miss the real story. frustration peaked. We were back there as this cricket and free it from the “clutches” of politicians
such that promises relating to neglected longer-term development issues, like improving It is the revolution in Indian cricket. A revolution World Cup began. and businessmen. That they failed so spectacularly
school education or public health care, have little resonance. my generation could never dream of. And a revolu- In T-20s, now commercially the fastest growing is what saved Indian cricket.
The response from political parties, without exception, is to offer non-solutions to tion built around not one or two star batsmen but format, the Indian reign may not be as consistent. It speaks of the strength of Indian cricket and
the very real problems in agriculture, and of unemployment and low incomes. Consider the most effective pace attack in the world. The rise Yet, it’s been at the top five times since 2011, and the commitment of the much-maligned group run-
the findings of the caste survey in Bihar, and what the promise of increased job reser- of pace, the greater fitness and fielding standards, now for 21 consecutive months since February 2022. ning it that the game was protected through this
vations might mean. The total number of government jobs, in a state with 131 million and the rising wealth of players are the three pillars It is true that a big tournament is decided on upheaval. It cost the Board some ~20-30 crore, most
people, is 2 million. These go disproportionately to the general caste category and on which this revolution is built. the performance on the day of the final match, of it in fees, as part of the court-mandated retired
Why, then, had India not when rankings do not matter. Who judge-bureaucrat re-employment plan and golden
somewhat less so to the backward castes.
won an ICC trophy for so long? would know that better than India, handshakes. But the system of fair selections, invest-
What if this skew were to be corrected, and government jobs were to be distributed Who was to blame — the Board, having won its first World Cup, Lords, ment and development of the game was protected.
proportionately to the major caste categories? The Scheduled Castes, who have about the selectors, the players, or all 1983, entirely against the form book The results, we can see. Indian cricket has among
0.29 million people in government jobs, would get another 0.11 million; the extreme of these? The usual suspect is and the run of play. There were no the fairest and most meritocratic selections for any
backwards would see the number of government jobs go up from 0.46 million by a further the IPL. It supposedly ruined ICC rankings then but nobody would field in our country. Fairer than politics, the civil
0.28 million. The general category and backward castes would be displaced to that extent; the discipline, national com- doubt that Clive Lloyd’s West Indies services, and, for heaven’s sake, the judiciary. It’s
even more so for the general category if the reservation percentage is raised. None of it mitment and talent of Indian was the top team in the world by some been a long time since we saw a true selection con-
adds to the total jobs on offer. The caste-wise changes and higher reservation would cricketers. Worse, it “reduced” distance. Any Indian delusions were troversy. Whoever might run the Board, they know
affect a million jobs. Does anyone believe that this is a meaningful solution to either the them to arrogant showmen quickly dissolved as the West Indies that if they mess up selections and the team per-
caste/social justice issue, or the jobs problem — in a state with 131 million people? greedy for money, privileging came for a bilateral series immedi- formance declines, the market will punish them.
their auction prices above ately following that World Cup final You may not fear the judges. But you fear the fan
Consider next the promises of higher procurement prices for farmers, most impor-
tantly for wheat and rice, to levels well above the ruling market prices. On the one hand, national glory. NATIONAL INTEREST and simply destroyed India in both who is the consumer of the game and who speaks
Tests and ODIs. through the market.
this increases the incentive for farmers to focus still more on wheat and rice and to offload SHEKHAR GUPTA
all marketable surpluses to the government, which would become de facto the sole buyer.
So, bid goodbye to private trade and also to crop diversification — badly needed for,
T here was, and is, however,
another way of assessing
the health of Indian cricket. The decade-long ICC
World cricket’s pecking order has
changed greatly since then, and so
dramatically that in this edition, for the first time,
You can google and check out the geographical,
regional, religious and caste spread of this Indian
squad. You’d find nothing, no institution, which rep-
among other things, better use of increasingly scarce water. trophy drought apart, at the point you are reading the West Indies failed even to qualify, while resents the diversity of India better than this. And
On the other hand, an inefficient public procurement system (where prices paid to this, this same Indian team holds the number one Afghanistan made waves, and the Netherlands everybody is there on merit. Unlike South Africa,
farmers account for barely half the total carrying cost) will be persisted with —leading spot in ICC rankings in all three formats of the game. made an appearance too, returning with one big India never fell for some nonsensical proportional
to grain mountains that can only be given away mostly. Finally, since grain disbursement That many are sceptical of these rankings does not upset (South Africa) to its name. The other big shift system or affirmative action in sport.
prices will stay unchanged (when there is a price), government subsidies will increase. change the fact that they exist and matter. The fans is in what always was the greatest denominator of It is a tribute to a system so robustly meritocratic
Nowhere is there a mention of raising agricultural productivity to international levels, will only be more disappointed if these rankings are power in world cricket: Fast bowling. It is here that that this team represents India’s diversity better than
the only sustainable way to raise farmer incomes. The old Bharatiya Janata Party promise lost. Over the past two decades, we’ve progressively India has made the biggest improvement. any other institution: The Union Cabinet, our chief
of doubling farmer incomes is long forgotten; also, of “more crop per drop”. got used to ranking number one. Some data is worth The Pakistani pace has declined — in fact, it has ministers, the civil services, the leadership of our
We come finally to cash payouts. It is generally agreed that absolute poverty has checking out. never reached its original lethality after the bottle armed forces and security agencies, the judiciary
come down to minimal levels, though Covid has raised the numbers. Yet the Bihar In Test cricket, the most challenging form of top incidents and greater ICC scrutiny of ball-taper- and more than all of these, our typical newsroom.
survey shows that a third of the people live on less than ~6,000 per month. By any rea- the game, India first reached the number one spot ing, never mind the frequent celebrations, especially That is the biggest message from this breathless
in 2009 — 77 years after playing its first Test. Since in the English media, over the rise of some new pro- rise of Indian cricket. That merit will find its way to
sonable yardstick, that is penury. Perhaps incomes have been under-reported, as often
then, India has held the number one spot in Test digy: From Mohammad Amir to Shaheen Shah the top, provided you create a true meritocracy. It
happens in such surveys. And people in most other states would be better off. Still, 76
rankings seven times, with periods at the top lasting Afridi. The Australians are more than adequate in follows that only the market can ensure that, as
years after Independence, there is every case for providing an income supplement to 70 months, or almost six years. Of these 70 months, that department, while South Africa and England cricket shows, not any government fiat, judicial
the most deprived. Like the employment-guarantee scheme, this would reflect the fai- 49 fall between January 2016 and January 2022. are reconstructing. Both the talent and the depth in intervention or affirmative action.
lure of the Indian state to do well by all its citizens. Politicians hide that failure under Australia pushed India to number two from this department are key factors in reaching the top,
growing largesse —which are palliatives, not solutions. January 2022 to May 2023, then India climbed back and staying there so often and for so long. By special arrangement with ThePrint
W
other trade spheres, the relationship is also ship. Indians with Israeli visas have trouble sequent 50 years). If the Gaza assault con- hen Mick Jagger invoked minotaur and walk out alive. He did
strong — India is Israel’s second-largest trad- getting into some Arab countries, but they tinues, Opec’s Arab members may again lev- Kali on his recent trip to that with help from the princess,
ing partner in Asia (excluding defence). can enter and work in others. erage their energy and significant financial India, as the inspiration for Ariadne, who handed him a ball of
VIEWPOINT India exported around $5.5 billion worth It would be an understatement to say clout to punish Israel and its friends. the iconic Rolling Stones logo, he did yarn that he unspooled as he walked
of petroleum products to Israel last year, and Israel doesn’t get on with the Arab world, or India needs to walk a diplomatic tight- not just remind everyone of the huge in. The labyrinth reveals itself differ-
DEVANGSHU DATTA imported raw diamonds, electronic compo- Iran, or Russia for that matter. The conflict rope. It cannot give up the oil. Nor can it influence the East and its iconogra- ently to heroes and ordinary people
nents, etc. There are many Indo-Israeli with Hamas started with a horrifying mas- give up on the trade and defence ties with phy have had on an entire generation in the Greek world.
I
ndian passports issued before 1992 carried Research & Design (R&D) projects, including sacre targeting Israeli civilians. It has esca- Israel. Nor can it risk loss of residency and of musicians (read Grateful Dead), In the Persian world, the labyrinth
two exclusions: The document was not cutting-edge defence applications in avionics, lated with equally horrifying massacres of livelihoods for all the NRIs who live and but also struck a high note for the is wrapped up in a different set of
valid for South Africa or Israel. If you drone development, electronic equipment, Palestinians as Israel has retaliated. All of this work in the Arab nations. It is, therefore, power of mythic imagery. A book ideas — as a walled garden, for
wished to travel to the latter, the visa was snooping (Pegasus is an Israeli product, for has been highly visible across media and hard to take any official stand. India will from his brother with the image of instance. The first such garden was
issued by the Israeli Consulate in the erstwhile example), GPS–related R&D, aerospace, social media platforms, with the usual fake have to equivocate, as indeed it has done Kali had Jagger hooked and led to built by Cyrus the Great sometime in
Bombay as a separate document without a renewable energy, information technology news thrown in. This has led to a further hard- successfully so far. the making of what is now an 6th C BCE and the word for such gar-
passport stamp. That changed when the two (IT) and other high-tech areas. ening of attitudes. In one sense, India has already suffered instantly recognisable logo — a lol- dens is “pari-daiz1i”. This is also the
nations established full diplomatic relations. While India exports petroleum products Thus far, Arab nations have not come up collateral damage because of higher, more ling tongue framed by ruby red lips root of the word paradise. According
However, there was a strong, if clandes- (it has surplus refining capacity), it is with a concrete response to the ongoing con- volatile energy prices. There is no conceivable — one that has effortlessly bridged to Unesco, the idea of paradise as a
tine, relationship. During the Indo-Pak War famously dependent on energy imports. Over flict. However, while most Arab governments resolution to this conflict in any reasonable cultural and geographical barriers. perfect garden stands as a metaphor
of 1965, Israel supplied mortar shells and 85 per cent of India’s crude and over 50 per aren’t directly driven by public opinion, they timeframe. Israel versus Hamas adds a set of This is not the first time that an for the divine order and the unifica-
other munitions. In 1971, Israel again supplied cent of its natural gas are imported. A large may find it difficult to ignore the emotional “known unknown” geopolitical risks that ancient symbol has been used to con- tion and protection of the faithful
munitions. By the Kargil War of 1999, the proportion of that is supplied by Muslim- impact on their citizens if the conflict con- may directly affect India’s economic interests. vey a modern ethic, nor is it rare for through Islam.
defence relationship was well-established majority Arab nations, apart from Russia. tinues, and God forbid, if it escalates. That might, at some stage, become an issue the world of art and commerce to dip In the Indian context, the laby-
and no longer clandestine. Israel supplied Moreover, roughly 9 million non-resident In 1973, in the aftermath of the Yom that impacts Indian financial assets. into the richly layered world of mythic rinth is the chakravyuha of the
imagery. From Medusa’s snake-like Mahabharata that reveals itself only
locks to the coiled serpent that Vishnu to those who possess the requisite
rests upon, to the potent symbolism knowledge. It adds an additional layer
E
verywhere in the world malaises are vergent slings of multiple ravaging”. When I Udhayanidhi Stalin said something similar, the median pay of workers, he or she is inviting upon his childhood memories of tongue have found multiple uses too.
common: Worker insecurity, crony string together recent events and episodes, though his comment misfired. adverse attention. During my service years, Greek mythology and the story that It is a symbol of insatiable hunger,
capitalism, political bribery, racism, buttressed by writings of commentators, I Third —inequalities in the cultural world. the ratio in India was not so acute; it appears none could turn away from Medusa’s according to the stories in the Devi
and, more broadly, inequality. I was born see a pattern. Take, for example, the strike by Hollywood to be a new trend. gaze for his logo. Mahatmya, where Kali is summoned
when India was ruled by Lord Wavell. Our First — a reference to gender inequality. technicians, writers, and actors. Threatened Are the nomination and remuneration The universal appeal of mythical by Durga to behead the demons and
generation was inspired by leaders who The woman Prime Minister of Iceland joined by technology and aggrieved by a widening committees (and boards as a whole) monitor- symbols comes from the wonder and suck their blood dry. Another story
served jail sentences to win independence, a public strike to draw the nation’s attention disparity in earnings, the strikers feel inse- ing this fact carefully and closely enough? awe they evoke, according to Joseph ties the tongue to a morality tale,
though, after independence, most of us to the widespread gender-based pay gap and cure about their self-worth and future. The Boards of sustainable, humane, and enlight- Campbell (The way of the animal about how the goddess bit her tongue
sought a different life for ourselves and our sexual violence — Iceland, whose image in “winner-takes-all” stars aggravate the over- ened (SHE) companies should take stock of powers: Historical Atlas of World when she found herself astride Shiva
country. Similarly, the children of liberalisa- the world is of gender equality! Centuries ear- whelming sense of unfairness. In early 2023, such leadership vectors. As stated in my Mythology). These symbols and their in the middle of the carnage. She is
tion admire those who worked incredibly lier, Draupadi’s invective on her vastraharan the Walt Disney Company Board received a recent book Inside the Boardroom, directors meanings also adapt easily, and their mortified by what she has done and
long hours with meagre resources. Like our (disrobing) was focused on what constituted rebuke from Abigail Disney, granddaughter should respond to the prodromal or advance meanings have evolved over time. it is this moment that the image cap-
generation did, they too seek a life different equality, character, and fairness, possibly the of the founder, about the unfairness of not signals with wisdom. Societal or corporate The mythical symbolism around tures. The oldest association between
from their seniors. first recorded public admonition on gender adequately rewarding “the real people who action must be born out of a nuanced view mazes and labyrinths follows an inter- the Kali as a goddess and the lolling
They desire rapidly improving opportu- bias and lack of honour. The Seneca Falls make the Disney magic happen”, the theme of the future rather than be inspired by a his- esting trajectory. In Greek myths, the tongue is probably from the
nities for jobs, infrastructure, education, and Convention of 1848 in the US highlighted park workers. torical perspective. labyrinth is an ambiguous space that Mundaka Upanishad (an ancient
health. They also seek integrity and exem- those women who demanded equality. The Last — inequalities in the corporate world. The drumbeats of corporate inequality are is used to cage monsters. The story of text that is part of the Atharva Veda)
plary leadership in public life, both of which Women’s Social and Political Union (WSPU) My generation was raised on leadership being heard in many ways — compensation Theseus and the minotaur, for where Kali is identified as one of the
are well below their expectations. The jobless of the 1900s, also known as the Suffragette models who were brawny, tough-talking, differentials, hours of work, work-from- instance, invokes the labyrinth as a tongues of Agni, the fire god.
youth are forced to migrate. Crumbling urban Movement, shook Georgian England at its macho chief executive officers like Sewell home, gender pay parity, and so on. trap. The minotaur was born out of a Mythic symbols are laden with
infrastructure creates slums. City commutes roots. As an aside, an early newspaper picture Avery, Harold Geneen, and Lee Iacocca. Companies must consider how they can miti- union between the Cretan queen meaning; they are malleable and
are long and hazardous. The multiple dimen- of the demonstrating women had one brown Nowadays, well-researched articles commu- gate and manage the trend. Pasiphae and the sacred bull of powerful and they speak to a wide
sions of inequality are morale-sapping and face tucked amid the several white ones. She nicate the need for empathy and understand- Poseidon. It was hidden away inside audience. Unfortunately, however,
potentially implosive, causing deep fissures was Sophia Duleep Singh (1876-1948), grand- ing. (“CEOs don’t need to be monsters”, The The writer is an author and a business a labyrinth built by the master crafts- their power has been mostly mis-
in society. In the short term, policymakers daughter of Maharaja Ranjeet Singh, the Lion New York Times, September 27, 2023; “Inside commentator. www.themindworks.me. man of the gods, Daedalus. No one used, by religious zealots and politi-
may inadvertently miss the tectonic effects of Punjab. Sophia’s is an interesting story, but Starbucks’ Dirty War against Organized rgopal@themindworks.me could enter or leave the labyrinth — cal opportunists.
16 NEW DELHI
SATURDAY
NOVEMBER 18, 2023
Opinion
{ OUR TAKE }
E STA B L I S H E D I N 1 9 24
The future of the
Xi, Biden plan IMEC hinges on
a reset of ties
Beijing reaches out to Washington, American
businesses. Whether it marks a strategic shift
stable West Asia
or a tactical manoeuvre remains to be seen If completed, the multi-State strength of member countries’ economies,
allowing for competitive yet free entry into and
project will establish India as
T
he much-anticipated meeting between US exit from the market. Additionally, successful
President Joe Biden and his Chinese the Asian authority on trade corridors build vertical as well as horizontal
counterpart, Xi Jinping, ended on a reassuring network integration, allowing for multiple
instead of China. However, points of contact between trade centres of
note although President Biden’s comment at a Delhi’s track record on member nations, and connecting technology
press conference after the meeting that he still with local and regional institutions. For exam-
considers Xi a “dictator” helped put the relationship
economic corridors is mixed ple, the Greater Mekong Subregion (GMS) and
its three associated corridors were largely suc-
in perspective and show the extent to which the two
O
n the sidelines of the G20 Leaders’ cessful both because the region, with its rich
most powerful nations in the world differ in their Summit in New Delhi in Septem- resources and high levels of tourism, was con- Implicitly, the India-Middle East-Europe Economic Corridor is expected to be a counter-
worldview. The meeting was not expected to break ber, Prime Minister Narendra ducive to setting up corridors, and because it economic corridor to China’s Belt and Road Initiative ANI
Modi announced the India-Middle had specific “hubs” that could be networked
new ground on points of bilateral tensions, but the East-Europe Economic Corridor together and developed infrastructurally. in the same corridor, China and India struggled creating an official FTA, but no further infor-
four-hour meeting did suggest a willingness on the (IMEC), a planned new trade route When corridors fail they often do so due to a for power within BCIM. mation has been released since.
part of Beijing to step back and reassess its relations running from India to Europe. Involving Saudi lack of extant social, economic, or political BIMSTEC, an economic corridor created to It is hard to predict whether IMEC will fall
Arabia, the United Arab Emirates, cohesion within member countries or foster socioeconomic growth in the Bay of Ben- into the same trap as India’s past corridors. If
with Washington with the intent to bridge the France, Germany, Italy, the European the region as a whole, undermining gal region in the wake of the failed South Asian completed, the project will establish India as
widening gap between them. For the global economy Union, and the United States (US) in attempts to create networks. The Chi- Association for Regional Cooperation (SAARC), the Asian authority on trade instead of China.
yet to recover from the pandemic-induced slowdown addition to India, IMEC aims to build na-Pakistan Economic Corridor has been largely unsuccessful due to its inabil- Chinese experts thus far doubt the infrastruc-
trade and infrastructural networks (CPEC) failed largely due to Pakistan’s ity to produce a Free Trade Agreement (FTA). tural proposals that IMEC is promising, cri-
and the wars in Ukraine and Gaza, the thaw in the and foster economic development and political and social instability, which Without a defined framework or economic tiquing the US’s pattern of making empty
relations between the two powerful economies will connectivity among these nations. Manjari posed a security threat and created a plan, the corridor remains stagnant and unable promises. While it is difficult to compete with
come as a relief. There was all the more reason for The corridor will strive to reduce Chatterjee lack of leadership in the project. But to make progress on initiatives such as its Mas- China’s BRI, which was established over a dec-
production costs, secure supply even in countries with strong political ter Plan for Transport Connectivity. In 24 years, ade ago and includes about 150 countries,
Beijing to reach out to Washington since the chains, improve trade efficiency, cre- Miller cohesion, other factors can matter — the corridor has held only four summit meet- IMEC, in line with the US’s commitment to
American policy of containment had started to hurt ate jobs, and lower greenhouse gas neglect to link smaller, cross-border ings and done a poor job of connecting friendshoring, could theoretically enable a
its economic prospects. Xi’s outreach to American emissions. Implicitly, IMEC is roadways in addition to major high- domains such as energy, infrastructure, and small number of ‘technologically and finan-
expected to be a counter-economic ways, high costs on exports, overly trade. cially capable’ countries like the US and India to
businesses suggests acceptance of the truth that a corridor to China’s Belt and Road Ini- complex logistical processes and inad- Though all members except Bangladesh do so.
stand-off with the US could only further the tiative (BRI). The Israel-Hamas war equate information-sharing can all signed a Free Trade Area Framework Agree- To be proactive, IMEC is already planning to
slowdown. On its part, the US has exploited the has now thrown the future of IMEC in doom success. ment — which created forums through which address some problems that commonly befall
jeopardy. But even prior to the out- India’s track record on economic to discuss trade issues — in 2004, this has not economic corridors. For one, minor, missing
perception of an aggressive China, a view prevalent in break of the conflict, IMEC faced sig- corridors is mixed at best. Past corri- yet produced an FTA. In March 2023, BIMSTEC cross-border roads are being noted so that they
many world capitals, to initiate strategic nificant challenges, not the least of
Clare dors that India has been involved in, Secretary General Tenzin Lekphell announced can be built under IMEC to achieve higher net-
which is that, as India has repeatedly Harris such as the Bangladesh-China-India- that member nations were in the final stages of work connectivity. IMEC also aims to include
conversations through Quad, Indo-Pacific, AUKUS,
found, economic corridors are diffi- Myanmar Economic Corridor (BCIM) private sector investment in its projects, some-
and IMEC. Beijing would prefer a pause in this cult to set up and sustain. and the Bay of Bengal Initiative for thing that the GMS neglected to do, to promote
recalibration of power equations in Asia, which is Economic corridors are an integrated net- Multi-Sectoral Technical and Economic Coop- WHEN CORRIDORS FAIL THEY job creation. However, the main issue —
surely not to its advantage. Xi’s remark was telling: work of roads, ports and railways that connect eration (BIMSTEC) have been hampered by OFTEN DO SO DUE TO A LACK whether the project will get off the ground
crucial centres of production to facilitate the inter-regional conflict and lack of agreement on given the current instability in West Asia —
“Planet Earth is big enough for the two countries to movement of goods and people efficiently and trade guidelines. OF EXTANT ECONOMIC, remains to be seen.
succeed…for two large countries like China and the cost-effectively. They are generally created to BCIM, initially started in 1999, intended to SOCIAL, OR POLITICAL
US, turning their back on each other is not an option.” encourage trade and promote infrastructural connect landlocked parts of southwest China COHESION WITHIN MEMBER Manjari Chatterjee Miller is Senior Fellow, Council
and industrial development within and with eastern India as well as Bangladesh and on Foreign Relations, and Associate Professor, Bos-
The approach marks a departure from the aggressive between target countries. There are different Myanmar. Severe conflict in the region pre- COUNTRIES OR THE REGION ton University and Clare Harris is a Research Associ-
tone of China’s wolf warriors who emphasised a conditions that need to be in place for them to vented the formation of strong cross-border AS A WHOLE ate, Council on Foreign Relations.
rising China and spoke about America in unstoppable be successful, not the least of which is the and trade networks. Furthermore, as two rivals The views expressed are personal
U
said later, “Restoring these military-to-military
evolved beyond the role of being mere ibrated to align with the global goal. For exam- enjoins the decision-makers to keep a sharp momentum.
contacts, and not just at the secretary of defence fiscal book-keeping exercises, often ple, to maximise EV penetration, a powerful focus on the redistribution of income and In fact, the government has recently
level, but also at the regional command level and heralding key policy announcements decarbonisation pathway, the government unanticipated costs and deprivation that could announced it would be a part of its power sec-
the operational level, is really critical to helping to to spur demand and ebb market sentiments. needs to formulate the optimal mix of credit- potentially be faced by the lower-income tor reform recipe and plans to nudge electric-
The canvas today is wider than ever with the linked subsidies provided to consumers and classes, both in rural and urban areas. Com- ity distribution utilities to make the installa-
avoid miscalculations and mistakes.” China has Budget signalling significant policy priorities. production-linked subsidies to automobile mercialisation of the biomass supply chain, tions mandatory and in a time-bound manner.
also promised to work on counternarcotics action. With the coming year’s Budget exercise under- manufacturers. Currently, most of the unless undertaken in a people-sensi- This would call for a thriving service industry
However, the bonhomie at the meeting did not way, a key question is: Can it traverse the benefits are placed in the hands of the tive manner, could result in the loss to be developed to handhold the ‘prosumers’
entire carbon ‘canvas’ in a more impactful manufacturers. of land, a vital low-cost energy in this transition.
prevent the Chinese from expressing concerns manner? An overarching approach to source, fodder, and security for the The ACPET report has, therefore, proposed
about US support for Taiwan, which Beijing insists A recent publication from the Ashoka Cen- addressing the above challenges lies poor. It could also result in a conflict an Energy Transition Authority that should be
will soon be “reunited” with the mainland. tre for a People-centric Energy Transition in: One, the creation of markets for with food security goals, placing an the recipient of reports from high-level panels
(ACPET) discusses both the challenges and price discovery; two, rationalising and Leena upward price pressure on food items. on rationalising subsidies and on market
As for New Delhi, it has been a default beneficiary opportunities arising from India’s energy tran- streamlining subsidies in the interim; Yet another key energy transition development wherein they have the mandate
Srivastava
of US-China tensions. The standoff at the border sition goals and observes that as much as pol- three, devising adequate payment area that could adversely impact the to provide a clear lens on the impact on peo-
has only brought India and the US closer than ever, icy calibrations are desirable in several ongo- security mechanisms and; four, smaller businesses and masses— ple. Armed with a deeper understanding from
ing schemes to help meet the 2070 goal of strengthening the capacities of vari- both in terms of direct cost increases integrated analyses of these critical subjects,
with Delhi seemingly shedding its initial hesitations achieving net-zero carbon emissions, there is ous institutions/entities/markets to cope with and the cascading effects felt through general the Authority needs to redeploy the saved
about Quad and Indo-Pacific. The cooling relations also an urgent need to squarely address the the preceding changes, among several other consumer prices – is the transportation sector. financial resources to design alternative ways
between the US and China and worries about aspect of ‘just transition’. measures. The rapid electrification of vehicles is likely to support deserving underprivileged popula-
A look at the ongoing ‘green’ electrification The first three of the above, and the totality to make a large part of the automobile indus- tions and incentivise the MSME sector
supply chains have prompted many businesses to of the country’s energy systems reveals that of them, could lead to either an increase in try — currently providing livelihoods to about towards providing energy services to under-
look at India as part of their China-plus-one the effort to fast-track its pace over the past retail prices hurting consumers and/or, 35 million people directly or indirectly — privileged consumers. A well-targeted, digi-
strategy. It remains to be seen how western capitals decade or so has led to around 10 GW of indeed, denying access to swathes of consum- redundant, for lack of requisite skills. For tally enabled system of direct-benefit transfers
renewable electricity being added annually. ers due to poorly designed incentives or miss- long-haul freight-related transition, the gov- aided by the massive financial inclusion
takes to Xi’s outreach. Delhi needs to keep an eye on This needs to go up by a factor of five if we are ing market actors — drawing attention to the ernment would need to make strategic, for- efforts of the government could be one option
the Washington-Beijing dialogue and calibrate its to meet our own defined goals of 500 GW of iniquitous impact of energy transitions on the ward-looking choices on replacement energy to be considered.
policies wisely. Both capital and technology are RE by 2030. Additionally, alternative meas- poor. sources. India runs a real risk of tying itself
ures around liquid/gaseous fuels like hydro- It is well established that not all people in into a high-cost incentive system riddled with Leena Srivastava is director and head, Ashoka
essential for our developmental needs, and Delhi gen and bio-ethanol, and consumption tech- the country can harness the same opportuni- capital subsidies, retail subsidies and stranded Centre for a People-centric Energy Transition.
should do all it can to encourage their inflow. nologies like electric vehicles (EV) would also ties or outcome impacts of such transforma- assets. The views expressed are personal
mercy twice blessed march began, upheld the placard saying “Not
In My Name”. I later spotted hundreds of
similar posters and banners. Multiple itera-
tions of “This Jew Does Not Support Bomb-
trouble. But the marching Jews were unper-
turbed. Jews know all about raising the
strawman. The march steered clear of any
religious iconography or overt religiosity. No
HOW CRICKET BECAME AN ASIAN SPORT
India and Australia are set to clash in the World Cup
think I may well be a Jew.” They know best what it means to be collec- ing Gaza”. Jews know that collective punish- religious slogans, no Muslim-Jewish-Chris- final on Sunday. India, arguably, has never so thor-
“I Same, sister Sylvia Plath, same! If tively dehumanised. Jews understand that
I had any doubt, it was dispelled on faith-based hatred knows no bounds. The
November 11 in London
when the United Kingdom (UK)
saw the second biggest people’s
Jews also realise that silence is not
the answer in the face of injustice.
In the wake of growing anti-Semitic
ment is not only immoral but also ineffec-
tive. It sets off a chain reaction.
Many war-thirsty experts — mostly non-
Jewish — see any Jewish support for a cease-
fire in Palestine as the doing of ‘self-hating’
tian claims and counter-claims. The only
reigning emotion and slogan — “We Are All
Palestinians”. Pure solidarity.
Jews know the pain of losing a home.
Jews know what it is like to never be able to
oughly dominated a World Cup as it has done this
time. However, India faces a formidable foe in Aus-
tralia, which has demonstrated a ruthless winning
streak after two losses initially. Sunday’s final
between a five-time champion and twice-winner is
march ever in its history. I found violence in European cities after the Jews. If self-hate must be defined today as return to one. Jews know what historian likely to be an enthralling match.
myself right at the head of the Pal- escalation of the Israel-Gaza con- empathy for unarmed civilians, mostly chil- Simon Sebag Montefiore says, “Jerusalem This week we recommend ‘War Minus The Shoot-
estine solidarity march as protes- flict, Jews know that the boulder of dren, it is certainly more desirable than mur- was a city of continuity and coexistence, a ing: Journey Through South Asia During Cricket’s
tors gathered demanding an imme- Nishtha hate is almost impossible to control derous self-love. Jews young and old are hybrid metropolis of hybrid buildings and World Cup’ by Mike Marqusee. The author explores
diate ceasefire. Gautam once it rolls down the path of irra- shunning the criminality of the Israeli mili- hybrid people who defy the narrow categori- the chaotic political and social climate of South Asia
One of the first batches to cross tional justifications. It unleashes tary action against Gaza’s civilians. Jews sations that belong in the separate religious in the 90s through the lens of cricket. Documenting
the river towards the American indiscriminate destruction with no know that bloodshed in their name doesn’t legends and nationalist narratives of later his travels across India, Pakistan and Sri Lanka dur-
embassy, the Jewish community of concessions for anyone. Once you keep them safe. Jews know that hate is twice times.” ing the 1996 cricket World Cup, Marqusee dives into
London led the charge against the complicity live by identity, you die by identity. cursed, mercy twice blessed. Jews know. pressing issues such as national identities, ethnic
of the UK government in letting Benjamin Jews know that identity of one kind A sinister triumvirate of identity politics, and communal tensions, cricket board politics, and
Netanyahu continue with his impunity. It doesn’t necessarily preclude other identities. geopolitical machinations, and economic Nishtha Gautam is an author, academic and the power of money which plague modern cricket to Book Name:
does not take much to do the right thing, as Or decency. On November 11, the participat- gains fuels the Israel-Palestine conflict. Jews journalist. She’s the co-editor of In Hard Times, this day. The book serves as an insightful look into War Minus The
the Jews demonstrated by decrying State vio- ing white population of London seemed to understand it all. They have seen it before. a Bloomsbury book on national security. the factors that enabled India’s rise to dominate the Shooting
lence against the civilian population of Gaza. have outnumbered black and brown Lon- Many times across centuries. The ‘gentile The views expressed are personal global cricketing stage. Year: 1998
R. N. I. No. 503/1957 ● Postal Reg. No. DL(ND)-11/6058/2018-19-20 ‘Licensed to post without prepayment’ LICENCE No. U(C)-113/2006-08, AIR SURCHARGE: Raipur and beyond by Rail or Road - Re 5/-, Ahmedabad, Bangalore, Coimbatore, Chennai, Cochin, Goa, Hyderabad, Khajuraho, Mumbai, Trivandrum, Visakhapatnam, Vijayawada and beyond by Rail or Road - Rs. 10/-;
PRINTED
PRINTED && PUBLISHEDBYBYMANHAR
PUBLISHED DINESH KAPOOR
MITTAL for
forand
andon
onbehalf
behalfof
ofHT
HTMedia
MediaLtd.
Ltd.18-20,
18-20,Kasturba
KasturbaGandhi
GandhiMarg,
Marg,New
NewDelhi-110001
Delhi-110001and
andprinted atatHT
printed HTMedia
MediaLtd.
Ltd.Presses
PressesatatPlot
PlotNo.-8,
No.-8,Udyog
UdyogVihar,
Vihar,Greater
GreaterNoida,
Noida,Distt.
Distt.Gautam
GautamBudh
BudhNagar.
Nagar.(UP).
(UP).Pin-201306,
Pin-201306.
BOARD: (011)23361234 ● EDITORIAL: (011)66561234 Extn. 1254, 1268 ● CIRCULATION: (011)66561111 ● ADVERTISING: (011)66561389 ● FAX: (011)66561270.
��
��� ������ �������� ��������� �������� ��� ����
������� ��
��������� ��� ���������
�
�
������� ������
��� � ���������� ������ �� �������� ������� ���������
������� ��� ����� �������� �� ���
�� ���������� �� �������� ������ ���� �� ��� ������
�
������� �� ��� ����������� ��� ������� ��� ��� � ������ ��� ����� � ������ �� ������� �� �� ���� ��� ���� ����������� �������� �� ��� ������
���� ��� ����� ����������� �� �� ����� ��� �� ����� ��� �������� ��������������������������������������� ��� ���������� ��� ������ �� ��������� ��� �� ������� ��������� ������������ ���� ����
�� ������� ����� ���������� ������� ������� ������ �� �� ����� ��� ��������� ��������� ������� ��� ��������� ����������� ���� ������ ������ ����� ���� ����� ��� ��������� �� ��������� ����� ���
��� ��� �������� ��������� ������� ��� ��� �������������������������������������� ���� ���������� ������� �� ��� ������� �����
�� ����� ����� �� ��� ������� ������ ������ ������� �� �� ������ ��
������������ �� ���� ��������� �������� ��� ��������������������������������������� �� ����������������� ������� ��� ���� ��������
�������� ����� ���� ����� ��� �������� �� ����� ������ ����� ��������� �������� ���� ���� ������� �� ���������������������������������������� ���� ��� ���� ������������ ��������� ��� ����
���������������������������������������������������������������������������� ������������ �� ������������ ��������� �� ������ � ������ ����� �� ��������� � ��� ��� ����� ������� ���� ����� ������� ��������� ����
��������������������������������������������������������������������������� ����� ���� ���� ��� ����� ���� �� ���������� ������� ��� ��������� �������� ��� ������� �� ��� ������������ ������ �� ������������
������ ������������� �������� ��� �� ��������� �� ��� �������� ��������� ��������� �� ��� ������������������������������������ �������� ��� ���� �������� ���� ���� ����� ��� ���������� ������������� �������
�������� � ���� ���� ���� ������� ��� ��� ����� �� ���� ������������ �� �� ����� ������� ����� ���� ������ �� ��� ��� �������� ���� ���� ��� ��� ����� ��������� �� �� ��� ������ ���� ��� ���� ��� ��� ��������� �� ���� ���
������ ��� �� ���� �� � ����������� ����� ��� ���� ����������� �� ��� ������ ���� ��� ��� ��������� ��� ��� ��� ������� ��� ������� ���
��������� ��� ���������� ����� � ��� ��� ����� ��� ������� �� ��� �� �� ������� ������ ��
������ ��� ���� �������� ��� ������ ����� ������������������������������������� ��� ������ �������� ���� ����� �����������
����� �������������������������������� ��� ����������������������������� ��������������������������������������� ������������������������������������� ������� ������� �� �� ����� ������� �����
�������� ��� ���� ���������� ���� ���� ��� ����� �� ������������ ��� ��� ���� ���� ���� ����� ��� �������� ����� �� ������������ �� ��� ������� �� ��� ����������� ��� ��� ���� ���� �� ��� ���� ��������� ����� �� ��� ��� ���
����� �� ���������� ��� ������ ��� ���� �� �� ����������� ������ �� ���������� �� �������� ��������� ���� ��� ���� �� ��� ������ ����� ���� �� �
������ ���� ���� ��� ����� ��������� ���� ������ ����� ��� ��� ���� �������� ������� �� ��� �� ��� ����� ����� ������� ���� � ���� ���� �� �� ������� ���� �������� ��� ������� ��������� �� ���� �� ��� �� �����
����������������������������������������������������������������������������� ������� ��� �������� ��������� ��������� ��� ������� ������ �� ��� ��� ��������� �� ��� ����� �� ������������� ��� ��� ���� ��� ������� ����� �� ���������
��������������������������������������������������������������������������� ������� ����� ���� � ������������ �� ��� ���� ����� �� ��� ����������� �� ������ �� ��� ���� ������� �������� �� �������� �� ��� ���� ���� �������� �� ���������
���� �� ���� ������� �� ����� ������ ���� ����������� ���� �������� ���� ������� ������ ��� � ���� ��� ���� ����� ��� �������� ���
��������������������������������������������������������������������������������
���� �� ��� ����� ��� ������ ���� ����� ���� ����� � ������ �� ���������� ��� �� ��� ������� ��������� ����� ��� ������ ���� ���� ���������� ��� ��� ��� ������ ���
�� ��������������������������������������������������� ����������������������� ���� �������� ���� � ������ ������ ���� ���� ����������� �� ����� ������ ����� ������� ��� ������ ���� ��� ������ ���� ��� ������� ��������� �� ���� ��� ��� ���
�������������������������������������������������������������������������������� ���� ���� ��� ��� ������� ���� �������� ���� ����� �������� � ����� �� ��� ������ �������� ��������� ������ �� ��� ������ �������� ���� ����� ��� ����� �� ��� � �����
����� ��� �������� ���� �� ���� ��������� �������� ������� ��� ���� ����������� ��� ��� ��� ��������� ������� �� �� ���� �� ����� ��������� ������� �� ������� �� ���� ���������� ������������������������������ ��� ������� �� ��� ��� �������� �������� �����
��� ������������ ���� ��� ���������� �� ��� ������ ����� �������� ������� ������ ���� �� ���� ���� ������� ����� ����� ��� ��� �� ����� �� ����� �������� ������ �� �������� �� ��� �� ��������� ��������� ���
������ ���� ���� ���� �� ���� ��� ��������� ������� ������� � ����� ��������� �� ������ ����� ������� �����
����������� ������ ��� �������� ���� ��� ���������� ��������� ��� ����������� ����
��� ��� ������� ������� �� ������ ��� ����� ������ ��� ������ ���� ��� ��� ������� ���� ������������� ����� ��� ���� ������ ��������� ����� �������
������� � ���������� ��� �������� ���� �������� ��� ������ ��� ������� � �� ��� ����
�����������������������������������������������������������������������������
���� �� ��� ��������� �� ����������� ���� ������� �������� �� ��� ���� �� ���� �� �� ������������ �������� ������ ��� ������� ��� ��� �������� ���� ����� ���
��� ��� ��� ��������� ������ �� �������� ��� ���� �� ���� ����� ��� ������ ���� �� ���� ���� �������� ���� ��� ����� ����� �� ���
������������������������������������������������������������������������������� ������� �� �� ��� ������
���������� ����� ����� ���� ���� ���� �� ����� ���������� ����� ����� ���� ����� ���� ������ ����������� ����� �������� ����� ����
������������������������������������������������������������������������� ������� ���� ���� ��� ��������� �� ������� ������������ ��������� ��� �������� ������ ��� ���� �� ������� ���� ����� ���� �� ���� ������ ���� ������ �� �������
���� �� ���� ���� �� ���� ��� �������� ���� ��������� ������������� ������ �������� �� ��� ��� � ���� ���� ��� ��������������� ��� ������� � ������������ ���� �������� ������� ��� ������������� ��� ���� ���� ������ ���������� �� ���� �����
��� �������� �� ��� ����������� ������� ����� ��� ����� ��� ���� ���� � ��������� �� ��� ��� ��������� �� ��� �������� ������� ��� ������� ������ �� ����� ������ ���� ������� ��������� ��� ������� ������ �� ��� ������������� �������� �� ����� �������
���� ��� ����� �� ��������� ��������� ��� ����� �� ��� ����������� �� ����� � ������ �� �������� ���������� ��� ���� �� ����� ��
������ ��������� ��� ���� ��� ��� � ��������������� ����� ����������� ����� ��� ����
��� ��������� ������� ���� �� ������� ���
� ��������� �� ��� ���������� ����������� �� ����� ������ ������ � ���� ��������� ���� �������
���� ��������� ��� ���� ���������� ��� ������� ��� ����� ����� ���� �� ������ �� ���� ���� ����� ��� �������� ��� ������ ���������� ���� ��������� ����� �������� � ����� �� ��� ������� �� ���� ���������� �� �������� ������ ��� ��������
��� �������� �� ���� ��� ���� ���� ���������� ������ ����� �� ���� ��� ���� ��������� ����� ���� ������� �� ���� ������ ���� ��� ������ �� ��� ������� ���� �� ��� ���� �� ���� ������� ������� � ����� ������ �� � ����� ��� �� ����� �� ������� ����������
�������� ����� ���� �� ���� �� ����� ��������� ������������ ����������� �������� ������ ��� ������ �� �������� ����� � ���� ��� �������� ����� �� ����� ��� ��� ������ ���� ��� ������� �������� �� ��� ��������� ������ �� ��� ���� ��������� ��
��� ������� ��� ���� ������� ���� ����� �������� �� ��� ���� ��� ������ �� ��� ���� ����� ������ ��� ��� ���� ��� ���� ���� ������� ���� ������� �� �� ��� ������ ������������ ����� ���� ����� ��������� ��� ������������
��� ������� �� ��� �������� �������� �����
����� ���� �� ������ ��� ��������� ��� ������� � ������������ ���� ������� ���� ��� ���������� �� ����� ����
���� ����� ���� ������� ��� ������ �������� ���� ��� ��������� ������� �������� �� ��� ���
�� ����� �� �������� ��� �� ��� ����� ���� ��������� ������������� ��� �� ����� ������ ���� � ��������� �� ��� ��� ���� ���� ����������� �� ������ �� ���
�� ��������� �� ������ ��� ��������� ���� ��� ���� ���������� ����� ���
��� ������ �� ����� ����� �� ��� ������� ��������� �� ����� �� ��� �� ���������� ���� ��������� �� ��� ������� �������� �� �������� �� ��� �������� �� ����
����� �� � ����� ������ ��� ������� �� ����� ����� ������ ����� �� � ���� �� ��� �������� ����� �� ����� ��� ����� ������ �� ������
������ ����� ���� ��������� �� �������� �� ���� �� ������ ��� ��������� ��������
������ �� ������� ���� �
���� ��� ��� ���� ��� ����� ��������� �������� �� ���� �
��������� �������� ���� �� ���� �� �� ����
������� ����������
������������ ������ ��
�������� �� �� ����������
������ ��������� �� ����� �� ��� �� �����
����� ������ ����� �� � ������ �� �������
���� � ������������ ������ �� �������� ��
��� ������ �� � ������ �������� ��
�������� ������� �� ����������� ��������
��� ��������
����� ���� �������� � � ������ ���������� ������� �� �������
����������� �� ��� �������������� ������ �� ��������� ��� ��������
�
� ����� � ����������� ����� �� ��� ������� ������ �� �������� ����� � ����� ��
������� ����� ���� ��� �������� �� � ����� ��� ��� ����� ���� ��� �� ����������
���� ��� ��� ��� ������ �� ����� ���������� ���� �� � ��� ���������� �����������
� ����������� �� ���
��������������������������������������������������������������������������
���� ����� ��������� ���������� ����� ������� ��� �� ���������� ���� ���������� ���� ����
��� �� ��������� �� ��� ���� ���� ���� ��� ��� ������� ���������������� ��� ���� ����� �����
������� ������ �� ����� ������ �� ��� �������� �� �� ������� ��������� ���� ���� ������
�������� � � ������ ������� � �� ��� �������� ������ �� �� ����� ������ �� ��� ����� ���� � � ������� ��������� ��� ����������� �������� ������ ���������
�������� � �������� �� ����������� � �������������� ������ �� ����� ����� ������ ������� ���
���� �� � ������ ������� �� ������� �������������� �� ��� ���� �������������� �������
����� ��� ����� ��������� �� ���� �� ��������� ��������� �� ��� ������� ������ ����� ������ ������� ���������
�������� ��� ����������� �� ��� ���� �� ������� ����������� �� ������ ����� �� �������
�������� ��� ���� ��� ������� ������������ ������������ ��������� �� �������� ����� ���
������ ������ ������� ������� ��� ������ ����� �� ��� ����� �� ����� ��������� ������� �� ����� �������� ��� ������ ��� �� � ����� ����� ���� ����� �������� �� ����� ��� ��� ���� ����������� ����� ��� �� ����������
�� ������� ������������ ��������� � � ����� �������� ��� ���� ������ ���������� ��� ����� �� ������� �� ����� �������� ���
���� ��� ����� ���������� ��� ����� �� ��� ����� ���������� �� ������� ���������� �����
������� ������ �� ������� ��� �������� ���� �� ���� ���� ��� ��� �������� ��� �� ��� ��������� ��� ����������� ��� �� �����������
������������ ����������� �� ������ ��������� ��������������� �������� ��� ����������� �� ��� ����� �� ���� ��� ����� ���� �� ������ ��� ������ �� ���� �� ��� ������������� �� �������� ����� ����
��� ����� ��� �������� ��� ������ � ������� ������� �� �������� �� ���� ����� ����� ������ ���������� �������� ������� ���� ����� �� ���� ������������� ������� �� ���� ����� ��� ����� ��������� �� ��� �� � ����
���� �� ��� ������ ��������� ������� �� ������ ������� ��� ������� ������ ��� ��� �� ��� ����� ��� ���� ���� ���� �� ��� ������ �� ����� ��� ����������� ���� �������� ���� ��� ������ ���� �� ��� ������ �� ���� ������
������� ����������� ������� �� �������� �� ���� ��� ����� �� ��� ������ ��������� ��� ���� ����� ������� �� ��� ����� �� ��� ���� � �������� ���������� ��� ��������� �� ��� ��� ��� �� �� ��� ����� �� ���� ��� ����
��������� ���� �� ��� ������ �� ��� ���� ���������� ����������� ��� �������� �� ��� ���� ������� �� ��������� �� ������� ����������� ����� ��� ��� ����������� ����� ������ ���� �� �� ���� �� ��� ��� ���� �� ���� ���������
�������� ������ ����� �� �������� ��� �� ����� �� ��� ���� ������ �� ��� ������ ���� �������� ���� ������� �� ����������� ��� ���
��� ���� �� ������� ��� ���� ����� �� ���� ���� �� ��������� �������� � ������� ������ �
������ �� ������� ��� �� ������� �� �������� �� �� ��� ��������� ������ �������� ��� ������ ��� �������������� ������ �� ������
� �������� �� ���� ���� ������ ���� ��� ����� ��� ���� ��� ������������ ���� ���� �� ���� ����� ��� ������ �������� ��� ���� ���� ��� ��� ������� ��� ���� ��� ����������� ����� �� ���� ��� ���� �� ���������� ��� ���
��� ���� ������ ������ ��� ������ �� �������� ������ ��� ����� ��������� �� ���� ��� � ����� ������� ��� �� ��� ������� ������ �� ��� ��� ���� ����������� �� �� ��� ����������� ����������� ��������� �� ��������� �����
����������� ����� ��������� � ��������� ���� �� ����� ��������� ��� ��� �������� ������������� ��� ��������� ��������� �� ������ �������� ������ ��������� ���� ��� ������� �����������
�� ����� �� ������ ���� ��� ������ �� �������� ��� ���� ������� �� ������������ ��� �� ��� ���� �� ����� �� ���� ��� ���� ���� ������ �� ��� �������� �� ����� ��� ���� �������� �������� ���� ����
��������������������������������������������������������������������������������� � ������ �������� ��� ������ ����� ������ ��� ���� ����������� �� �� �������� ����� ��� ������� ���� ��� ��� ������ �� ��� ������������� ��������� ������ ��
�� ������ ��������� ��� ��� ����� ������ ���� �� ��������� ��� ����������� �������� ����� ���� ������� ��� ��������� ����� �� ���
���� ���� ����� ���� ������� ������� ������ ������� �� �������� ��� ��� ������ �� ����� ��
��������� �������� ����� ��� ������ �� ��� ��� ��� ����������� ��� ��� �� ��� ��������� ��� �� ��� ������ ������� ���� ������ ���� ��� �������� ������
����� �� ��� ���� �� ���������� ��� ���������� ����� �������� ��� ��� �������������� ������ ������� ���� ��� ��������� ���������� ��������� ��������� �� ���� ���� ������� ��� ����� �� ���������� ����� ������ ������� ��� ����� ��� �� ���
��� ������� �� ���� ����� ��� � ������ ����������� ������ �� ���� ���� ��� ������ �� ��� ����� ���� ������ �������� ��� ������� �� ���� ���� ������ �������� ��� ���� �������� ���������� ��� ������ �� ������� ���� ��������� ���������� �������� �������
��� ������ ������� �� �� ������� ��������� �� ��� ������������ ��� ��� ����� ��� ������ ���� ��� � ��������� �������� ������ ���� �������� ��� ����� ���������� �� ����� �� ����� �� ����������� ��� ������� �����
���� ������ �� ��� ��������
���� ��� �� ��� ���� ������ �� ������� ��� ��������� ������������� ������ ���� � ������ ���� ��������� ��� �������� ��� �������� �������� ������ ��� ������ �������� �� ���������
������ ������� � ������������ ���� ��� ����� �� �������� ����� ��� ������� ��� � ����� �� ����� ��� ���� �� ��������� ������ ��� ��� ������ ����� ���� �������
������ ��� ������� ��� ��� ���� ������ �� ���� ��� ��� ������ �� �� ���� �� �� ��� ���� ��� ��������� �� ����� ��� ��������� �� ��� �������� �����
��� ��� ������� ��������� �� ��� ��������� ��������� ��� ����������� ��� ������ �������� �� ������ ������� ��� ������ ���� ������ ��� ���� �� ������ ��
�
��������� ��� ��� ����� ����������� ��� ��������� ������� �������� ���� � ������ ������ �� ��� ����� �� ��� ��������
����� ��� �� ���� �� ����� �������� �� ���
�������� ���������� ��� ������ ������ ��������� �� ��������� �� ������ �
� �� � ������� ������ ���� ��� ���� ����������� ��� ������������� � ������� �� ��� �� ������� ���� �������� ���
������������ �� ��������� �� ����������� ��������� ������� �� � ��� �� ��� ���� �� ��� ��� ������ �� �� ��� ���������
������������������������������������������������������������������������
���� ����� ����� ����� �� ��� ��� �� ����� ����� ���������� ������� ���� �������� �� ���� ����� ���������� ����� �� ��� �����
���� ��������� ������ �� ��������� ������� ��� ����������� ����� ���� �� ��� �������� ��
������������������������������������������������������������������������
������������������������������������������������������������������������������
�������������������������� ���������������������������������������������������
������ ��� ���� �������� �� ������ ����� �� ����� ����� ������������ ���������
�����������������������������������������������������������������������
������ ���� ���� �� ��� ������ ������� �������� ����� ���������� ����������� ����� ���� �������� ��� ����� ����� ����� ���
�� ����� ������ ��� ������ �� � �������� ���� ������ �� �������� ����� ��� �� ������� ���
� ����� ������� �� ������� ���� �������� �� ��� ��� ��������� ������� ����� ��� ���� �� ��������� ��� ����� ����������������� ����������������������
��������� �� ���� �� � �������������� ���
���������� ������� ��� ������� ��� ����
������� �� ����� ���� �� ������������� ��
���������� �������� ���� ��� �������� ������ ��� ������� �� ���� ��� �� ����� �����
���� �� ������� ��� � ������� ����� ����� ������� ������������ ��� �������� ��������� ������� ����� ����� ���������� ������� ������ � ��� ���� ����� ����� �������� ��� ���������
������������������������������������� ��������������������������������������� ���� ��� ���������� ���� ��� ���� ��� ������
���� ���� �� �� �������� ����� ���� �� ��� ���� ���������� ��������� �� ����� �������
��������� ������������������ ����������� ����� ��� ��� ���� �� ��� ��� ����� ���� ���� ��� ������ ������ �� ���� �����������
������� ��� ���� ��� ����� ������ �� �� �������� ���� ��� ���� �� ������� ��� ��� ���������� ��� ��� ���������� ��� ������ �� ���� � ���� ��� ������ �� ����� ���� ���� ��� ���� �����
� ��� ����� ������ ���� ������ ����� ���� ���� ���� �������� �� ������ ����� �������� �
�� ��� ����� ���������� ����� ���� ������� � ����� �� � ������� ����� ����� ��������� �����
����������������������������������������
���� ���� ��� ��������� ������� ���� �������
����������������������������������������
������� ����
�� � ������� ������� ������� ��� ���� ����� �� �� ���� ��� ����� �� ����� �� ������ �� ������������������������������������������
��� ������ ��������������� ������ ���� ���
������������ ��� ����� ��������� ��� ��������� ���� �����
�������� ��� ���� ��� ������� ��� ����� ��
������� �� ����� �� ���� ����� ���� ������ ��� ���� ��������� ������� ����������
���� ������������ ������ �� ��� ����� ��������� ��� � ���� ��� ������ �� ������ �� ��� ������ ���� ��� ����� ��� ���� �� ������ ���� �������� � � ����� ��� ���� ���� ��� ����������������������������������������
���������� ���� �������� ����������� ��� ���� �� ������ �� ��� ������ ����� �������� ��
������ �� ������� ������ ���� ������ ��� �� ������ ��� �� � ��������� ���� �������� �� �����
������ ��� �������������� �� ������ ������ ���������������� � ����� ��� ���� �� ��� ������ �������� ��� ���� ������ �� ���� ������� ����� ������������
�������� � ���������� ��������� �� ���� ����
�������������������������������������
��� ������ ������������ ���� �������� ��
������ �������� �� ������ �� ��� ��� �� ������� ������� ��� ����� ������ ���� ������� ��� ������� ���������� ����� ������ ��������� �� ��� ����� ����� ������ ����� ������ ��� ������� �� ������ �������������
������� ��� ���� ����������� �������� ���� ���� ��� �� ����� ������ ��� ������ �� � ������ ���������� ����� ������� ��������� ��� ���� ���� ���� ����� � ���� ������ �� ������� ���� ��� ����������� ���������� ��� �������
���������������������
��
���������� ������������������ ����������������� ���� ��� ������ ���
�� ��� �������
��� ������ �������� ��������� �������� ��� ����
�
������������������� ������������������������������������������
��� ��� ����� ��� �� ����� ��� ��� �� ����� ��� �� ����� ����� ����
���������� ���� ������ ��� ��������� ���� �� ��� ��� �� ���
���� ������������� ���� ������� ������ ��� ���� �� ����
���������������������� �������������������������������
��� ����� ���� ����� ��� �����������������������������
������� ��� ���������� � ������� ����� ����� ������� ���������� ����
������� ����� ����� ������ ��� ��� ������ ������ � ������ ���� ��� ������
����� � ��� ���������� ��� �� ��� ���� ��� ��� ����� �� � ����� ����� �����
������������������������������������ ���� ���� ������� �� ���� ��� ��������
������� ��� �������� ���� ������ ����� ��� ��� ��� ��� �������� ��������
�������������������������������� ����� ����� ������� ������ ����� �������
��� ���� ������ �� ���� ��� ���� ��� ����� ����� ������ ����� ��� ���� �����
������ ��� ������ ��� ������ ����� �� ���� ���� ����� ������ ������� �����
��������� ���� ������ �������� ����� � ����� �� ��� ��� ������ �� �������
������ ���� ����� ������ �� ���� ������� �� ��� ������� �� ����� ���� ���
�������� ����������� ����������� ���������� ��������� ��� ����� �� ��� �����
����� ��� ���� � � ������� ���� ���� ����� ���� ����� ������� ���
����� ��� ��� ���� ����� ���� ���� �� ��� �������� �� ��� ��� ����� ������
��������� �� ��� ���� ��� �� � ������� ���� �� ���������� �������� ����� ��
������������������������������������ ����� ��� ������� ����������
�� ���� �� ����� ���� ������ ���� ����� ������ ��� ��� ���������� �����
�� ��� ���� �� � ��������� �������� ���� ����� ��� ���
��� �� ����� ���� � ��� ����� ���� ����� ������ ��� ������ ���� ��� ���
�� ��� ������ �� ��� ����� ����� ��� ���� ����� ����� ����� ������� ���
����� ������������ ������� ���� �� ��� ����� �������� ��� ������ ��� ���
������� �� ���� �� ��� ��� ����� ������� �����������������������������
������ ������������ ��� ���� ��� �� �� ��� ��� ��� ��� ������� ����� �
����� ��������� �� � ���� ������ ��� ��� ��� ����� ������� ��� �� ����
����������� �� ��� ��� ��� ����� ���� ���� ����� ���� ������
�������� ��� �� ���� ������ � ������ ����� ������� ��� ���� � ����
������ ���� ��� ������ ���� ���� ����� ��� ���� ���� �����
��� ������ ���� ��� ��� ���� ��� ���� ����� �����������������
��� ���� ��������� ��� ��� ��� �����
���� ����������� ����� ����� �� �� �������������������
������� �������������� ������ ������� ��������� ��������
�� ����� ���� �� ��� ������� ����� ��� �����������������
��������������������������������� �����
��� ������� ����� ���� �������� �� �� ��� ���� �� �����
������ ���� ��� ����� ���� �� ������� ��� ������������ ���
��������������� ����� ��� ���� ���������� ���� ����
���� ���� ��� ����� ���� ��� ����� ��������� ���� ��� �����
�������������������������������� ������ ������ ��� ����� ��� ���
������� ��� ��� ��������� ��� � ������ ����������� ��� ���� ��� ���
������� �� ����� �� ��� ���� ������ ��������� ���������������� ���� ���� ��������
���������� ��� � ���� �������� ���� �� ���� ���� �� �� ��������� ����
����������������������������� ����� �� ���������� ����� ����� ��� �����
��� �������� ������� ��� �� ��� ������ �������� ��� ����� �������� ��� �����
��� ������ �� ��� ����������� ������� ����� ���� ������� ���� ���� ���
������� ��� �� ��� ������ �������� ��������� ��� ��� ���� �����
������� �������� ��� �� �� ��������� ������� ���� ���� ���
�� ��� ������� ���� �� ���� ������������� ���� ��� ������� ���
������ �� �� ��� ��� ����� �� ������ ����� ��� ��� ���� �� �����
������ �� �������� ���� ��� ��� � �������� �� �����
���� ������ ���� �����
����� ���� �� ��� �����
������ ��� ������ ����
������ ������� ������� ���� �������
�� ��� ���� ����� ��� ��� �� ���� ���� ������� ���� ���
��������� ��� �������� ��� ��� ��� ��� ��������� �� ���
�������� ���� ����� ��� ���� ��� ��� �������� �� ����
������ ������������ ����� ����������������������������
��������� ��� ������������� ������ ��������� � ������� ���� ��
��������� �������� ���� ��� ����� ��� ������� ��� ������ ���������� ��
����� � ������ ������� ������ ��� ���� ������������� ������� ��� ��� ��� � ������ ���� ������ ���� � ���������
������� ����� ����� ��� ���� ��� ������ ���� �� ��� ���� ���� ����� �� ��������
���������������
���� �� ��� ���� ��� �� ��� ������ ��� ����� ��������� ��� ��� ������������ �������
�� ��������� ���������� ��� �� ��� ���� � ������� ����� ���
��� ������ ��� ��� ������ ��������� ��� ��� ������ ������� ����� � ��������� ���
�������������������� ������������������� �������� ������ �� ��� ����������� ������
��� ���� �������������� ��������� ��� ������
������� ������� � ������� ����� ��� ����� ����� ��� ��� ����� �� ���� ������� �� ��
������� ��� ���� ����� ��� ��� ��� �������� ���� ���
������ ������� ���� ����� ��� ������� �������� ��� ���� ������� ��������� ���
�� � ��������� ����� �� ��� ���� � ���� ������ ����� ����������� ��������� ���� ����
���� ����� ������� �� ����� ��������� ��� �������� ����� ��� ������� ������ ����
� ��� ������� �������� ����������������� ����� ������ �������� ���� �� ���� ���
���������������������������
��������������������������� ��� ��� �������� �� �������
��� �������� ����� ��� ������� ��� ���� ���� ��� ���� ����� ���������� ������ ���� �������� ��� ����� ����� �� ��� ������������� ������� ���
����������� ��������� �� ��� ������ �� ��� �������� ��������� �� ��� ����� ����� ��� ���� �� �������� ����
������� ����������������������������������
������� ������ ��������� ������� ���� ������ ����� ��� �������� ����������
��������� �������� �� ����� �������� ��� ���� ������ ��� ������ ���
���� �������� ��� ������� ����������
��� �������� �� �������� ������� �� ��������� �����
����� �������������� �������������������������������������
������� �������� �� ��� ��������� ���� �� ������
�������� �����������������������������������
��������� ����� ������� ���� ������
��� ����� ��� ��� ���� ��������� ���� ������ ����� �� ��� ������ ��������������������������������������
���������������� ������ ������������ ���������� ����� ������������������������������������� ������� ��������� ���������������������������������������
����� ��� ��� �� ���������� ��������� ��������� ����� ���������� � ������� ���� ������� � ��
���� ���������� ���� �������
�������� �� ��� ������ ����� ���� ���� ������������������������ �������������
��� � ������ ����� �� ������� ��� ���� �� ������ ���� ����� �� ��� ������������� ������� ����� ����
�����
������� ������� ������ ���� ������� ��������������������������������������� ���� ����� ���� ��������� ������� ��������� ��� �������
��� ��� ��� ��� ���������� ������� ����� ��� ������� �� ��������� �� ��� ����� ����
������ ������� ��� ��� ����� ��� �� ����� ��������� �������� ���� ��������� ��� �� �������� �������������������������������������
�������
� ��������� ������ ����� ������������� ������ ���� ���������� ������ �������� ����� ���� ���
������ ����� �������� ������ ������ �������� ���������� ������� ������� �������� ������������ ����� ���
�������������������������������������� ������������� ��������
������������������������������������ ����������������������������������������� ���������� ���� ����� �� �� ��������� ��� ������ ������ ���������
����� �������� ����������� �� ������� ������� ����������� �� ����� � �� ���� �� ��� ��������� ���� �� ������������������������������������
��� ������ �������� �� ���� �������� ����� ���� ����� �� �� �� ���� ��� ���� ����� ��� ���������� ������ �� ��������� ������� ��� ���� �� ����� �� ���
�� ���� ����� �������� ���������� ��� � ���� �������� ��� ����� ����� �� ��� ������ ������� ������� ���������
����� ����� �����
����� � ��������� ��������� �� ��������� ������������ ������ �������� ���� �� ���� ���������������������������������������� ������ ��� ��������� ������� ���� �����
��� ����� ���� �� ��� ��������� �� ������ ���� �������� �������� ��� ����� �� ��� ������� ���������� ��� �������� �� ��� �� ��������� �� �������� � ������ �������� ��
����������������������������������� �� � ������ ������ ����� ������ �� ���� ����� �������� ���� �������� ��������� ������������������������������������
������� �� ��������� ������ ����� ���� �� ���� ������ �������� ����� ��� �� � ��� �� ������ ��� ������� ����� ����� �� ��� �������
������ ��� ���� ������ ����� ��� �� ��� �� ����� ���� ���� � ���� ������� ���� ��� ���� ��� ��� ��� ��� ������� ����� �� �������� ����� ������� ���� �������� ������ ����
������������������������������������� �� ����������� �� ����� ���������� ��� ��� �������� ������ ����� ������� ��� ���� ������������ ���������
�� ��� ���� �������� ���� ���� ���� ������� �� ������ ��� ������ ��� ������ �� ����� �� ������� �� ���� �������� ��� �������������������������� �������������
���� ���� �� ������ ��� ������� �� ���� ��� ������� �� ������ ������� ��������� ����� �� ���� ����� �� ����� ������� ����� ������ ��������� ���������� ���������� ���� ���
���� ��� ��� �������� ���� ��� ����� ��� ������ ���� ������ �� ��� ����� ���� ��� ����� ��������� �������� ��� ������ �� ��� ����� ����������� ��������� ���������� �� ��������� � ����� ��� �����
��� �� ��� ������� ��� ���� �������� ��� ������� ��� ���� ���������������������������� ���������� ���������� �� ����� ����������� ��� ����� ��� ����� ��� ����� ����� ��� � ����������� ��� ������
��������� ���� ���� ���� ��� ����������� ������������� ���� ����������� �� ��� ������� �������� ���������� �������� ��� ��������� �� ������������ ������� ���� ��������������������������������������� �������� ��� ������� �� ����� ���������
������������������������������������ �������� ��������� �� ��� ����� ���� �� ���� �������� ��� ������ �������� ������������ ��������������������������� ���� ���� ���� ���� �������� �� �������� ���� �� �� ������ �� ����� ������� �������� ��
������ ������������������������������ ��� ��� ����� ���� ���� �� ������ ��� ���������� ����� ��� ��� ������ ����� ��� ������� ��������� �� ��� ���������� ������ �� ������ ������� �� ��������� �� ��� �������� ������� ��� �������� ���������� ��� �����
�� ���� �� ����� ����� ����� ������� ����������� ������� ������� �� �� ��������� ��� ����� ��������� ����� ����� ���� �� ��� �������� ��������� �� ��� ����� ���� �������� �� �������� ���� �� ������� ����� ������ ����� ���� ������ ������
���� ������� ��� ��� �� ������� ������ ��� ���� �� ����� �� ��� ��������� ����� ��� ���� ���� ���� ��� ��� � ���� ���� ������������� ������ ��� ��� ���� ��� ���������������������������������������
��� �������� ����� ���������������������������������� ������������������������������������ ����� ���� ���� �� ��� ��� ��������� ������� �������� ������ �� ���� �� ������ �� ��� ������� ����� �������
��������������������������������� ��� ��� ������ ������ �� ������ ��������� ������� ���� ���� ��� �������� �������� �� ����� ����� ��� ���� �� ������� ����� ��� ������ �� ��� ����� ��� ���� ��� ���� �� ������� ��� ��������� ��������� �� ��� �����
������� ������� �� ��������� ��� ������ �������� ��� �� �� ��� ������ � ��� ���� ���� ����� ��� ������ ������� �� ������� ���� ��������� ��� �������� �� ���� ��������� ��� ��������� ���� ���� �� ����� ������ ������� ������� ��������� �� ����� ���������� ����� ��
����� ���� ��� � ��� ����� �� ��� ����� ���������������������������������� ��� ����� ��� ������������ ��������� ��������������� ����������������� ���� ���� ����������� ������� � ������� ������ ������� �� ��� ������ ���� ������
��������������������������������� ��� �� �� ��� ��� ��� ���� �� ��� �� ������ ������������ � �������� ����� �� ��� ������ ������������������������������������� ��������� �����
��� ����� �� ��������� �� ����� �� �� � ����������������������������������� ������������������������������������ ���� �� ��� ����� ������ ���� ����������� ���� ���� ���� ��������� ���� ��� ������
������������� � ������� ����� ��� �� ��� ���� ��� ����� ��������� ���� ����� ������� ������ �� ������� ��� ��� ������ ��� ���������� ���� �� ��� ���� �� � ������ �� ��� ������� ����� ��� �� ��� ������ � ���� ���� ���
�������������������������������������� ����������������������������� �� �� ������ ��� ���������� ������� �������� ��� ����� ���� ��������� �� ��� ����� �������� ���� ��������� ���� ����� ����� ���������� ������� �� ��� ����������
��������������������������������� ��� �������� ������� �� ���� ������� ������ ������� ����� ��������������������������������������� �� � ����� ��������� ������ �� ������� ��� ����� �� ��������� �� �������� ��� ������
��� ����� ��� ���� ������ ��� ���� ���� ��� �������� �� �������� �� ���� ��������� �������������������������������������� ��� ���� ��� ����� �� ������� ��� ������
����� �������� ���� ��� ��� ���������� ���� ��� ����������� ������������ ��� ���������� �������� ������ ����������� �� ��� ������� ���������� ��� ���
������� ���
�������� ��� ���� ������ ��� ��������� ������ ��� ��������� ��������� �� ��� ���� �������� � ������ ���������� �� ��� ������ ������� ������� ��� ����� �� ��� ������ ��
�� ��� �������� ��� �� ������� ����� ���������� ��� ������� ��� ������� ���� �� ����� ���� ���� ������� ���������� ����� �� �� ������ ��� ���������� ��������� �� ��� ������ ������
������ � �� ��� ������� ����� �� ���� ���� ������� ��� ������������� �������� �� ��� �������� �� �����������������������������������
�������� ����� ����� �� ���������� ��������� ���������� �� ��������� ������ ��� ����� ������� �� ������� �� ��� �� ������� ������� ���������
������� ������� ���������� ����� �������� ������� ������ �� ����� ����
������������������������������������
������ ���� ��� ������ ��� ������ ��������
����� ��� ����� �� �������� ���� ����
����� ��������� �� ������� ��������
����� ���� ������������ ������������
��� ���������� ������ ���� �������� ���
�������������������������������������
�������� � ������ �� ���� ������� ��������� �������� ������������� ��� ������� ��������� �� ��� ��� ����� ���������� �� ��� ��� ����� ���� �� ��� �������� ������ ������� ������� ��� �����
������ ���� ���� ������ ��������� ������������������ �������������������� �������������������������������������� ��������������������������������������
��� �� ��� ������� ��������� ��������� ������� ����� ������� ��� ��� ��������� �� ��� ���� �� ��� ����� ��� �������� ��� ���� �� ������������������������������������
������ ����� ���������� ���� ���� ��� �������� ��� �������� �� ��� ���� �������� �� ����� �� �������� ��������� ��� �������� ����� ���� �� ���� ��� ����� �� ��������� ������������� ����������������
��� ������ ����� �� ��� ����� ���� ���� ����� ������ � ���� ��� ������� ���� ��� ���� �� ��� ��� �� �������������������������������������
�
���
���
���
���
����
���
���
���
���
� ��
������
���
���
���
�����
���
��
������� � ������ ��������� ������� ��� ������ ����������� ������ ��� ��� ����� ������ ��� ��� ������� ��� ��������� ��� ��� ��� ������� ������� ��������
�������� �������� ���� ��� ��������� ��� ��� ��� �� ��� ������� ����
��� ����� ���������� ��� ���������� �� ������� �� ������ ����� ��� ����� �� ��� ���� ����������� ���� ���� ������ �������� ������������� ���� ������ �������� ����
���� ����� ������ �������������������������������������� � ����� ���� ���� ����� �� ������� ��� ��� ���� �� ����������� ��� ������ ������� ��� �������� ��� ������� ������ �� ����� ��� ���� ��������� ����� �� ���������� �������
��� ������ �������� �� ��������������������������������������� �� �� ��� ������ ������������� ���� � ����� ������ �������� ��� ������� ���������� ��� ������������������������������������ ����� ��� ��������� �������������
�������� �� ����� ����� ��� ������������ ���� ���� ������ �� � ������ ���� �������� ����� ������� ������ �� ����� �� ����� ��������
�������������������������������������� ��� ����� ������ ������� ��� ���� ��� ������ �� � ������ ��� ���� ������ �� ������ �������� ����� ��� ��� ���� ��� �� �� ����� ����� �� ������ ���
������ ��� �������� ���� ����� ��������� ������������������������������������ ��� �� �� �������� �� ����� ���� ������� �� ����� ����� ������ �� ����� ��������� ���������������������������������
���������������������������������������� ���������������������������������� ������ ������� ������ ������� ��������� ���� �� ���������� �������� ������������������������������������
�������������������������������������
������������������������������������
���� ��� ����� �� ��������������� �� ������
��� ��� ���� ��� � ����������� ���� �������
����� ������������������
���� ��� ��������� �� ���
��������� ����������� ������������������������ ����������
���������������������������������������
��������������������������������������
�������������������������������������
���� ��� ��� ��� ����� ���� ��� ����� �� ����������� �������� ���� ������ ����� ������������������������� ��������� ������� �� ��� �� ���������� �������� ������ ���� ���� �������� �� ��� �� ���� �� ����� ���� ����������� ���
�������������������������������������� ������������������������������������� ��� �� ���������� ��� ��� ���� ����� ���� ����� ��� ���������������������������������������� ��������������������������������������
������������������������������������� �������� ��������� � ���� ��� � ����� ���� ������ �������������������������������� ��� ����� ��������� ���� ����� ���� ��� ������������������������������������� ������������� ������������������������
����������������������������������������� ���� ������ ������� ������� ������� ��� ����������� �� ���� ���� ��� ������������� �� ������������ ���������� �������� ���������� ���� �� ������� ������ ��������
���������������������������������� ����� ��� ������ �� ��� ����������� ������ ����� �� �������� ��������������������������������������� ����� �� ����������� ���������� ���� ��� ����������������������������������
�� � �������� ��� �� ��������� ���� ������� ������ ����� ������� ��� ��������������� ������� ���������������� ������� ���� �� ������������������������������������� ������������������������������������� ������������������������������������
�������������� ����� �������� ��� �������� ������������������������������������� ������� ��� ���� ��� ��������� ���� ���� ������������������������������������������ ������������������������������������ �� ������� ���������� ������ ���� ��� ������
����� ����� �������� ���� ��� ���� ���� ���� ���� ������� ��� ���� ������� �� ����� ����� � ����� ������� �� ������ ����� ���� ��� ���� ������ ������� ��� ������ ���� ������������ ����� ��������� ����� ���� ������ ������ ��� ����������� ������� ���������������������
��� ��� ����� ����� ����� ��� ��� ���� ��� ���� ��� ��� ���������� ��� �� ���� ����� ��� ���� ������ ������ ������� ������� ���� ������� ����������������������������������������� ������������������������������������ ����� ��� ����� ��������� ������������ ���
�������� �������� ���� ������ ����� ������ ���������������������������������������� ����� �� ���� �� ��� �� ��� ��� � ����� ���� ����� ���� ����������� ����� ���� ������ ��� ��� ����� ������������ �� ���� �������� �� ����� �����������
� ��������� �������
�������
������������������������
�������� ��� �����
����� �������� ��� �������� � �������� ������ �����
� �� ���������� �� �������� �������� ��� �����
��� ��� ������� ���� �� ��� ���� ��� ����� ��
������� �� �� ����� �� �� ������ ��� ������
����������
��������� �������� ��� ����
�
�������������������������������������������������
������������� ��� ����������������������� ��� �������� ����
�
���������������������������������������������������������
������������������������������������������������������ � ��� ���� � ���� ���� ��� ������� ������������������������������������
���������������������������������������������������������������� ����� ������� ��� ������ ����� ������������������������������������
������ �������������� ��� ���� ��������� ��� ���������� ������� ������ ��
������ ������ ��� ������� ��� ��� ������� ����� �� ���� ������ ��� ���������
����������������������������������
������������������������������ ������� ���������������������������������������
������ ����� ������ ��� �������� ��� ����
������������������������������������������������������������������
�������������������������������
��� ����� ��� ������� ��� ������� �����
�������������� ������ �������
��� ����� ���� ��������� �� �� ��� ����
����������������������������������������������������������������� ������������������������������������ �������� �������� ����� ���������������������������������������
��������������������������������������������������������������� ��������� ������ ������������������ ����� ��� ��������
������ ������������ ����� ������� ����
������������� ��������� ��� ������ ������ ������� ����� ������������� �������� �� ���� ��� ���������� �������� ����� ��� ��������� ������ �����������
���� �������������� �� ������� ���������������� �� ����� ������� �� � ���� ����������� �� ����� ������������� ������ ��� ����������
������� ������ ������� ������ �� �������� ����� ����� �� ��� ��������� ����������������������������������� ���������� ������� �� ����� ������ ������� ������� ������������ ������������ �� ��� ������� ������ ����� ��������� ����
�������������������������������������� ���� ���� ���� ��� �������� ���� ����� �� ��� ��� ��� ���� ������ ��������� �� ���� ���� �� ��� ���������������� ���
������������������������������������������������������������������� ������ �� ���������� ������� ��� ��� ���� ������������ ������� ��� �������� ��� ���� �� ����� �������� ���� � ��� ��������� �����
������������������������������������������������������������� ��������������������������������� ��������������������������������� ����� ������������ ��� ������� ����� ����� ��������� ��� ������� ��� ����
������� �� ����� �� ������� �������� �� ��� ���� �� ������ ������ �������� ���������������������������������� ������������������������������������� ������������������������������������ ���� �� ������� ����� ���������� �� ����
��������������������������������������������������������������� �� ���� �� �� �������������� �� ��� ���� ���� �� ������ ��� �������������� ���� �� ����������� ������������� ������������� ���� ��������� ������� ��� ���� �����
�������� ���� �� ������� ��� ������ �������������� �� ������� ����������� �� ������������ ������������������������������������ ����� �� �� �������� �� ��������� ���� ���� ����� �������� ������������� ���
�� �� �������� ���� ���� ���������� ��� ���������� ����������� �� ���� ���������������� �� �������������� �� ���� ��������� ��� �� ���� �� �������� ����� ������� ���� ��� ���� ��������� ������� ���� �� ���� � ���� ��� �� ���
������������������������������������ � ���������� ������ ��������� ������ ������ ��� ��������� ����������� ��� ������������� ��� ����� ������ ��������
������� �������� �� ����� ������� �� ���������� �� �� ���� ���� ���� ������
������ ������������� �� ���� ����� ������� ��� ����� ���� ���������� ��� �������� ����������� ����������� �������������� ������ �� ������ ����� �������� ��� ���
��� ���� ������ ����������� ���������� ��� ������ ������������� �������� ���������������� ���� ���� ������ ���� �������� ������������� �� �������� ���� ��� ��������� �� ����� ���� ������� ��� ������ ��� ������� �� ��� �������� �����
������ ������ �� ���������� �� ����� �� ��������� �� ��� ���� ���� �� ������� ����� ���� �������� ��� ������� ������ �������� ������������ ������������� �� ���� ���� ���������� ��� ���������� �����
��� ��������� ��������� ���������� ���� �� ��� ����� ������������ � ������������������������������������� ����� ������������ ������ ������� ��� �������������������
������� ��������������� ��� ��������� ��� ��������� ��� ���� �� ���� �� ��� ������ �������� ����� ��� �� ����� ������� ������� ������� ������������ ����� ����� �������� ������� ��������� ���������� �����
����� ������ �� ���� ���� ������ ��������� ��� ����� �������� ������� �� ���� �������� �������� ��������������� ��� �������������������� �������� ���� �� ��� �� ������ �� �� ��������� �� ������� ������ �� ���������� ��� ����
���� ������ �������� ��� ���� ����� �� ��� ���� ���� ��������� �� ����� ������ ������������ ������� ��� ������ ������ �� � ������� �� ��������� �� ����� ���������� ���� ����� ������������ ��
��������������������������������������� ������ ������������ ��� ��� ��� ��� ���� ������ ���� ��� ������������� ������� ����� ���� �������� �����������
��� �� ��� ��������� �� ������ ����� ��� �� ������� ������ ������ �� ��� ���������� ���������� ������� �� ���� �������������������� ��������� �� ������� ��� ���������� ��� ����� ���� ��� ���� �� ���������� ���������
�������������������������������������������������������������� ������������������������������������ �������������� ���� �������� ��� ���� �� ����� ���������� ����������� ������� ������� ���� �� ������������
������ �� ������ ������� ���� ������������������� ��� ������� ��� ������ ������������ ��� ������������ ������� ����������� �������� ������ ����� ������ ���������� ������� ����� ��� �������
�������� ���� ���
������ ������� �������� ������� �� ���� �������� ��� �������� ����� ������ ���� ��� ��� �� ��������� ��� ������������ ��� ������ ���� ������� �������������� ��� ������������ ���� ���
������� ���� ��������� ��� ��������� �� ������������ ������������ �������������� ����������� ��� ������ ������� ����������� ������� ����� ��� ������� ��������� �������� ���������� ��� ������� ��� ���������
������ ��� �������� ������� ������ ��� ���� ������ �� � ���� ������ ��� ����������������� ������������������� ���� ��������� �� ���� ��� ��� �������� ������ ��� ������ ������������ ��� ��������
������ ��������� ������� ���� ���� ����� ������������� �� ������� ������������ �� �������� ��� ����� ������� ����������� ��� �� ������
��������������� �� � ������ ��������� ������� ���� ���������� ����� ����� ������������������������������������� ������������������� �������� ��������� ����� ���������� ����� ��� ������� ����
���� ����� ���� �� ������ ��� ����� ���� ��� ������� ����������� ���� ��� ���� �������� �� �������� ����� ������������������� ������� ��������������� ����� �� �����������
������� �� ��� �������� ���������� ����� �������� ��� ������ �������� ������������������������������������ ������������������� ���� ��� ���� ����� ��� ���������� ��� ��� ���� �� ��
���� ���� ���� ������ ������������ ������� �������� �������� ������� ���� �� ������� ��� ������� ��� ������ ������������������������������������� �������� ������� �� �������������� ���� ����� ��� �� ��������� ������� ���
���� ��� ������� ������ ���� �� ��� ��������� ����� �� ��� ������ �� ��� ������� ��� ������ �� ������������ ��� ������� ���� ����� ���������� �������� ������������ ��� �������� ���� ����������������������������������
��� ������������������ �������������������� ������ ���������������������������������� �������� �� ����������� ��� ����� �� ����� ���� ��� ��������������� �� ������� ����� ����� ��������
������ �� ��� ������� ������� �������������������������������������� ��� ��� ����������� �� ����� ��������� ����� �� ��� ��� �� ��� ����� ��� ����
���������� ���� ����� ���� �������� ������ ��������� ������ ���������
���������������������������������� ��� ���� ���� �������� �������� ��� ���� ���� ��� ������������ ������������ ������ ������ ���� ���� ����� ��� �����
������� �� ��������� ��������� �� ������������ ����� ���� ����� �� ��� ����� ������ ���� ��� �������� ������� �� ���� ������ ���� ���������� ��� ��������� ���� ������������� ��������� �������� ��� ��� ������ �� ���������� ����������� ���
�� ���� ����������� �������� �� ��� �������������� ������������� ��� ������ ������������������������������������ ���� �������������� �� �������� ����� ���� ������������������������������������ �������� �������� ���������� ���������
������������������������������������������������������������� �������������������������������� ������������������������������������� ����������������������������������� ��������������� ���� ��������� ���������
������������������������������������������������������������������ ������������������������������������ ����� �������� ����������� ����������� ��� �� ������ �� ����� ��������������� �������������������������������������
����������������������������������������������������������������� ������������������������������������� ��������������������� ���� ������������� ��� ������� �� ����������� ��� ���������� �� � ����
����� ��� ��������� ����� ���������� �� ��������������� ��������� �������� ����� ������� �� �������� �� ��� ��� ������� ����������� ������ ���� ���� �������������������������������� ������������������������������������
��������� �������� �� ��������� ��������� ������������������������������������� ��� ����� �� ����� �������������� �� ���� ���������������������������������
����������� ���� ���� �� � ������� ������� ���� �������� �� �� ��������� ��� �������������� �������������������� ��� �� � ��������� �� ��� ����������� �� ������ ���������� ��� �������� �������� ���� �� ����� �������� �� ��� ���� ���
����������������������������������������������������������������������� ������������ ��� ��������� �������� �� ������ ��� ������� ��� ����� �������� �������� �������������� ������ ���� ����� ������������
������������ ���� ������ ������ �� ��� ������� ��� ����� ������ �� ���� ����
������������������������������������������������������������������
���������� ������ ������� ��� ����� �� ������������� �������
����� ��� �� ������������� ������ ������������ ������� ��� ��������� �� ���� �������� �� ������ �� ��� ������ ������� ��� ��� ��� ������� �� ��� ������ ������� ��� ��� ������ ���� ��������� ����� � ������ ��� ��������� �� ��� ������ ������� ��� ���� ��������� ������ ������� ��������� � � ��� ������� ���� �����
����� ��� ������������� ������ ������������� ������ ������ ������ ������� ���� ��� � ��� ���� ������� ������� ���� ��� � ��� ���� �������� �� ��� ������ ������ ������� ������� ������� ��������� ������ ������� �������� ������������ ������������� ��� ��������� �� ���� ����� ��� ��� ���� ����������� ���
������ ������� ��� ��� ��� ������ ��������� ������������ �� ��� ������� ���������� �� ���������� �� ����� �� �� ����� ������� ����� ������� ���������� �� ����������� ��� ��������� ��������
��� �����
My greatest strength is the love for
my people, my greatest weakness is Sheikh
Mujibur
that I love them too much Rahman
C
ONNECTIVITY and energy secu- New infrastructure projects between the neighbours will Bangladesh have been imposed on Paki-
rity have occupied centre-stage stan, though it is common knowledge that
INDIAN EXPRESS IS NOT AN in India-Bangladesh bilateral ties reduce costs and delays. But a cloud hangs over how the Pakistan army remains the de facto rul-
INDUSTRY. IT IS A MISSION. over the last two decades. On Bangladesh conducts its elections in January er of its country. The US still designates
— Ramnath Goenka November 1, Indian Prime Min- Pakistan as a non-Nato ally, supplies arma-
INDIA-BANGLADESH
ister Narendra Modi and Bangla- ment spares and provides support for the
desh Prime Minister Sheikh F-16 fighter aircraft it had sold to Pakistan.
Hasina jointly inaugurated via video con- Western double standards in geopolitics
TAMING INFLATION WITH link and the start of the second unit of the
Maitree Super thermal power plant. The
BLESSING FOR BOTH
permission for a US military facility on
St Martin’s Island and has also refused to
O
Most bilateral connectivity projects have ments. The US is also wary of Bangladesh
CTOBER’S headline inflation print of 4.9 percent—the been implemented with the help of India’s getting sucked into China’s orbit with its
second decline in two months—suggests that this round concessional lines of credit and grants. massive Belt and Road Initiative-linked
of our fight against inflation might be nearly over. But The Agartala-Akhaura link and Maitri PINAK RANJAN Former Secretary in the foreign ministry and projects and loans. The US’s role in oppos-
the country’s designated inflation fighter, the Reserve bridge over river Feni will improve connec- CHAKRAVARTY former High Commissioner to Bangladesh. ing the birth of Bangladesh and its alleged
tivity between India’s northeastern states. Founding Director of DeepStrat, a think tank complicity in the assassination of Sheikh
Bank of India, believes this is not the endgame and
warned of further food and energy price shocks. Led by an These projects mark another phase in im- Mujibur Rahman and his family members
plementing the strategic decision to will be dredged up during the election cam-
almost 2 percentage point fall in core inflation that touched a
integrate bilateral transport and power paigns. Nationalist sentiments will be
43-month low in October, the headline inflation rate fell to connectivity. The Padma bridge is a phe- aroused to accuse the US of supporting the
5 percent and 4.9 percent in September and October, respec- nomenal achievement in domestic connec- BNP-Jamaat-e-Islami alliance.
tively, down from 6.7 percent in 2022-23 and 7.1 percent in July- tivity and will reduce time and cost for A Western campaign against Hasina has
August 2023. But the RBI sees this as a fleeting reprieve, fearing exports and imports. Another project that been launched by the BNP and Islamist or-
the one element that has pushed prices higher this fiscal—food was inaugurated virtually by the two prime ganisations, ably supported by Pakistan
ministers earlier this year was the Maitri and the pan-Islamist network of which the
inflation. Sadly, elevated food prices continue to be a risk to
pipeline, a transborder pipeline funded by Jamaat is a part. Hasina has been in power
inflation expectations and as some high-frequency data indi- India to transport around 1 million metric for 14 years, winning three elections in a
cates, cereal and pulse prices are climbing, threatening the tonnes of high-speed diesel every year from row. The BNP boycotted the 2014 election
central bank’s 4 percent inflation mandate. the Numaligarh refinery in Assam to and fared very poorly in the 2018 one,
The last year, too, saw a similar price reprieve around this northern Bangladesh. promptly alleging that there was massive
time, when headline inflation fell into RBI’s tolerance band of Diversified connectivity links have facili- rigging and other malpractices.
2-6 percent for the first time in a while in November 2022. The tated trade and passenger traffic. Bilateral Both AL and BNP have committed vot-
trade increased substantially to $18 billion ers, with AL having a marginal lead. The
joy was short-lived as the headline inflation soared later, forcing in 2021-22, with Bangladesh becoming the main swing vote comes from uncommitted
the central bank to channel the story of Arjuna’s eye on price fourth-biggest export destination for India. voters, many of whom are 18-25 years of
rise. No wonder the RBI is now unwilling to drop its guard, Connectivity has boosted trade-related lo- age. A determining factor will be the econ-
given that several items within the food basket including gistics and reduced costs. Robust economic omy. While Bangladesh has achieved re-
onions, tomatoes, cereal, pulses and sugar are firming up once growth in both countries has increased markable progress, the pandemic, the
again. Inflation is falling globally too, but not at the speed gov- merchandise trade in both directions, SOUMYADIP SINHA Ukraine war and the Israel-Hamas war
though Bangladesh has concerns about have resulted in higher energy costs and
ernments desire and the headline numbers may remain uncom-
the adverse trade imbalance. Talks on a elections, since it does not have confidence ously, the US administration under Presi- rising inflation. Foreign reserves have fall-
fortably above targets in many countries for the third year in a Comprehensive Economic Partnership in the government and the Bangladesh dent Joe Biden has been proactive in en from a high of $45 billion to around
row. Helpfully, economies are seeing some relief from crude oil Agreement are going on. Election Commission to conduct free and demanding free and fair elections. The US $22 billion. Bangladesh, like Pakistan and
prices that recently touched $74 a barrel (Brent futures), offer- There is, however, the looming shadow fair elections. Such allegations have been has imposed sanctions on officers of the Sri Lanka, has reached out to the IMF for
ing hope for a sustained decline in fuel inflation. of Bangladesh’s next general election in levelled in the past against both the AL and Rapid Action Battalion (RAB)—Bangla- loans. Garment workers have demonstrated
Even though oil prices have been declining for four consecu- January 2024. India, too, will have its gen- BNP. The arrests and detentions of several desh’s anti-terrorist force which has done for higher wages to meet the rising costs.
eral election in May 2024. Election season in BNP leaders have further inflamed pas- a commendable job in curbing terrorism— The readymade garments sector is the
tive months, central banks are in no mood to let go. They
Bangladesh is not about polite debates on sions. The caretaker government system and denied them visas on human rights mainstay of the country’s economy, com-
are instead arguing for a higher-for-longer interest rate regime TV and peaceful rallies with speeches. was expunged from the Constitution in 2011 grounds. The RAB has been accused of prising 80 percent of exports. Uncommitted
to crush the threat for now. But there is another narrative tak- It continues to be about strikes, disruptions after Hasina assumed power in 2009. BNP extra-judicial killings. voters in the working age population are
ing centre-stage: how inflation may go up again if central banks and street battles between protesters chief Khaleda Zia is incapacitated by ill- The US has also announced it will be de- very sensitive to the rise in living costs.
do not begin cutting rates now. It points to evidence that and the police. The ruling Awami League ness and her heir apparent, son Tarique nying visas to anyone undermining fair India will prefer to have Hasina back in
rate rises are often followed by higher inflation—precisely (AL) and the opposition Bangladesh Na- Rehman, remains in exile in London. He elections. These measures have incensed power to ensure continuity. She enjoys
the opposite of what monetary policymakers have been trying tionalist Party (BNP) are both adept at these cannot return because of convictions and Hasina, which has led to a cooling of rela- widespread support despite the allegations
methods. Street demonstrations have be- prison verdicts in several cases of corrup- tions with the US. The US believes it has a of corruption and authoritarian actions.
to tackle. While the RBI is rightly emphasising the need for gun and clashes with the police have al- tion. He was also given the death sentence divine right to promote and protect democ- Another BNP-Jamaat government in Dha-
continued vigilance, it must be cognisant that it is the dose ready left eight dead and dozens injured. for his part in the conspiracy for a 2004 gre- racy everywhere, except where it thinks it ka will have to prove its credentials and
that makes the poison. Both sides have accused the other of insti- nade attack on Hasina’s political rally. is not in its own interests, though the rea- commit that it will not adopt anti-India poli-
gating the violence. Western embassies in Dhaka issue regu- sons are geopolitical. Bangladeshis angrily cies again. The AL has the potential of re-
The BNP has again demanded Hasina’s lar statements urging caution, while China point out that the US invited Pakistan but turning to power but it will be tougher than
SABARIMALA SEASON
T
About 75 lakh pilgrims are expected to visit the hill shrine
HERE’S something rotten in the Ref: Law and awareness only ways to keep
this season, a considerable increase from last season’s state of global opinion, because public places clean (Nov 17). As the edit has
56 lakh. It must be said that the Kerala government, the Travan- it’s become impossible to criti- pointed out, a lack of public conscience and
core Devaswom Board and the temple administrator controlled cise either the October 7 Hamas an overpowering indifference are the main
by it have made extra efforts this time around. While a dynamic attack or Israel’s dilapidation of PRATIK Editor of The India Cable villains that encourage littering. In Japanese
queue control system has been introduced for better regulation Gaza without being press-ganged KANJILAL schools, students keep classrooms and
of movement, pilgrims themselves can monitor the crowd at the into the ranks of the supporter facilities clean. This is a habit in adulthood
of the other side. If you criticise the arbi- too. Let’s take a leaf out of the Japanese book.
shrine through video walls set up at three places. A hospital with
ICU facilities and 64 beds has been set up at Pamba and a 15-bed
trary violence of Israel’s invasion of Gaza, SPEAKEASY N Rama Rao, Chennai
then, of course, you must be a Holocaust-
facility has been installed at the temple. Transport, hygiene and denier. And if you criticise Hamas for hi- Electoral bonds
lodging have also been spruced up ahead of the season. jacking the Palestinians’ right to resist be- are being rounded up and herded off to movement was framed as a reaction to the Ref: Electoral bonds go against political
While it is commendable that efforts are being taken to im- ing corralled in an open-air human zoo, police stations. These restraints on the right original sin of the emperor Babur, whose equality (Nov 17). It would be no exaggeration
prove the pilgrims’ experience, a lot needs to be done if the then you must be a terrorist. to protest have no legal basis. They can be general Mir Baqi built the mosque on the to say the huge amounts the BJP receives
The struggle between Zionists and Pales- justified only by the polarising logic cited site of Rama’s birthplace. through electoral bonds are its main source
temple has to be equipped to handle the inflow that is increas-
tine has run for so long and has featured so above: anyone who sticks up for Palestinian The Baburnama, an unnervingly honest of funds. Though the SC has ordered the EC
ing season after season. Many of the projects envisaged as much violence that no party can claim to be civilians’ right to life must be a terrorist. autobiography, has accounts from the em- to collect all the details of electoral bond
part of the Sabarimala master plan are yet to take off and in the right anymore. Everyone is sort of And anyway, critics of the use of state force peror’s first foray into India, where his donations to parties, there is no chance of the
some are stuck mid-way. A recent meeting chaired by Chief wrong, all the way back to the colonial-era must have sedition on the mind. band encountered native Indians on their information being released into the public
Minister Pinarayi Vijayan decided to set up a Sabarimala mandates in the Middle East when there travels and dispatched them without a domain. The bond system should be scrapped
Development Authority to coordinate and implement the works. were no formal nations in the region. qualm amid scenes of hunting, feasting and in toto or become totally transparent.
Sabarimala certainly needs better facilities, including roads, What’s rotten about the majority discourse poetry competitions. This was not unusual C V Aravind, Bengaluru
backing Israel is that it suggests that the by the reckoning of the times and the soci-
but the development must be carried out keeping in mind curtain went up on October 7, when Hamas ety in which Babur grew up, and, though Timely intervention
the fragility of the area. committed the original sin of attacking ci- later generations of Muslim rulers caused Ref: Guv returns pending bills, state calls spl
The Kerala government, on its part, must be hoping that the vilians. Hamas did attack civilians on that anxieties by inflicting taxes rather than house session to re-adopt them (Nov 17).
season passes off incident-free, given that the controversial Su- day, and that is a war crime, but it wasn’t the death, the theory of bloodthirsty Muslim The SC’s timely intervention advising
preme Court order allowing women in the 10-50 age group entry original sin. There’s no point looking for an invaders has flourished in modern times. governors against inordinately delaying
into the shrine is still hanging over its head; petitions challeng- original sin because such a thing does not Last week a Pakistani cabbie in Brooklyn, assent to bills has helped the TN government
exist in history which, in the case of Pales- from a family who were caretakers of a Sufi pass the pending bills—this is laudable. A
AP
ing it have been referred to a larger bench. Last year, the govern- tine, rolls back to remote antiquity. shrine near Peshawar before they were cordial relationship between governor and
ment issued a handbook that said all have the right to entry, but Worse, the story that Hamas started it all, Israel is driving out millions of forced to take the wheel, told me, “Look at government is the need of the hour.
withdrew it hastily following protests. The government will do which is like the complaint that teachers Palestinians from Gaza. An Israeli the American and Australian populations. P Victor Selvaraj, Tirunelveli
well to avoid such missteps. It must wait till the court decides field after schoolyard brawls, is being used politician has suggested nuking How many aboriginal Americans and Aus-
and do nothing that could be seen as violating age-old traditions. to justify the indiscriminate punishment of tralians do you see? That’s what happens Dynasty politics
the whole Palestinian community, includ- the enclave. It is not easy to agree when a bloodthirsty invader visits your When it comes to vote bank politics and caste,
It must also be prepared to deal with efforts by some elements
ing its children, using military weapons. on an original sin in old conflicts, country. And how many original Indians do BJP is no better than other regional parties
seeking to foment trouble in the guise of enforcing the court
order. An adequate number of police personnel, suitably in-
The attack on the Al Buraq school and Al- but the stupidity of seeking mass you see in the subcontinent? What does it and the Congress which have been attacked
Shifa Hospital, the biggest in Gaza, where extinction could be it say about the theory of Muslim invasion?” for dynasty politics. With the appointment of
formed, must be deployed to sensibly deal with situations. The displaced people were sheltering, was justi- That’s anecdotal, of course. More plausi- Yediyurappa’s son as party head in Karnataka,
season will test the government’s ability to ensure peace. fied by the claim that Hamas operates from bly, entrants into India understood that the BJP has lost the moral high ground.
the facility. The argument of an original sin The Semitic idea of original sin, whose they could not possibly erase prior popula- N Nagarajan, Secunderabad
which started it all can be used to justify philosophy was defined by St Augustine of tions because size matters. Present advo-
Q U I C K TA K E any attack on civilians and their refuges, Hippo, speaks of an innate sin implicit in cates of cleansing, who have been increas- Winning streak
and even to urge them to flee to Egypt, to birth itself. The prospect that everyone ingly voluble over the last decade, don’t Ref: Shami-final: India’s perfect 10 in
SHAME ON SHAMI TROLLS which a border crossing is pointedly held
open. Depopulating a nation is also a sin.
must spend their lives working towards re-
demption is pretty bleak, but seeking the
appreciate this dreary practical problem
standing in the way of their desires. In com-
Mumbai, over to Ahmedabad now (Nov 16).
The Indian team has been on a winning
O
NE heart-stopping moment in the World Cup semi-final on Sin is the concern of religion and culture, origins of violence in one group is even mon with Zionists, they have fantastical streak. Virat Kohli has scored another hundred
which are built on traditions of storytelling more depressing. Because typically, it’s dreams of the mass extinction of the other. and Mohammed Shami has taken a five-for.
Wednesday came during the 29th over of the New Zealand
and mythmaking which contrast good and hopeless to seek the first wrong. In Israel, former heritage minister Am- They have hardly made mistakes and have
innings. Mohammed Shami dropped a regulation catch of evil, light and darkness, angel and demon. This idea of an original sin, which ichay Eliyahu had said that dropping a nu- been playing some exceptional cricket.
the Kiwis’ captain Kane Williamson. Vile communal abuse But history rests on facts, without moral brought violence into a prehistoric idyll, clear bomb on Gaza was an option, unaware Mathews Varghese, Kochi
poured forth online against India’s top pacer. Shami ended with reasoning. It is complicated and messy, and has been visible in Indian politics from the that it would erase Israel, too. In Modi’s first
7/57 and was adjudged man of the match. What is it about our original sins are not notable in its annals. earliest days of the mandir-masjid dispute. term in office, eager voters had seriously Brotherly peace
country that makes so many of us so itchy to see everything Mixing the two makes bad medicine. Four years before the rising of 1857, sadhus expected the PM to nuke Pakistan and were The descendants of Abraham’s sons, Ishmael
along communal lines? When Shami faced similar abuse two The Western discourse on the Middle of the Nimrohi Akhara claimed ownership uncaring about the implications for their and Isaac, are bitter enemies today. They
East conflict is instructive for people in oth- of the Babri Masjid site and the administra- own lives. If there is an original sin at all, it should realise that it would be good for
years ago, then captain Virat Kohli stoutly supported his bowler, er polarised nations. The phenomenon it- tion divided the property in response, is probably stupidity. Sadly, that’s in surplus everyone if they lived as brothers. More can be
saying, “Attacking someone over religion is the most pathetic self is visible in India, where protesters agi- awarding one part to Muslims and the in majoritarian politics across the world. achieved through peace than war.
thing.” It is a shame that nothing much has changed since. tating against the Israeli onslaught on Gaza other to Hindus. Over time, the Hindu (Tweets @pratik_k) Elizabeth Koshy, Pathanamthitta
English Newspapers»»
Indian Express, Financial Express, The Hindu, Business Line, The Times of India, The Economic Times,
Hindustan Times, ET wealth, Business Standard, First India, Mint, Greater Kashmir, Greater Jammu, The
Himalayan, The Tribune, Brill Express, The Sikh Times, Avenue Mail, Western Times, Millennium Post, The
Statesman, State Times, The Pioneer, Hans India, Free Press, Orissa Post, Mumbai Mirror, Mid-Day, Deccan
Chronicle, Deccan Herald, Telangana Today, Financial Times, The Asian Age, The Telegraph, Oheraldo, Gulf of
Times, The New York Times, The Washington Post, Los Angeles Times, USA Today, The Wall Street Journal,
The Guardian, The Times
Hindi Newspapers»»
दै �नक जागरण, राजस्थान प�त्रका, दै �नक भास्कर, �दव्यभास्कर, �हंदस्
ु तान, नवभारत टाइम्स, �बज़नस स्ट�डडर्,
Others»»
Hindi & English Editorial, Employment News, Malayalam Newspapers, Tamil, Telugu, Urdu, Gujarati
THE TRIBUNE
established in 1881 A predator & conspiracy of silence
As a society, we can’t fail children by letting patriarchy shut them up and acquit the monster
Supply chain pact which they are not.
Opportunity for India to maximise economic gains Take the example of the
recent Yamunanagar incident.
T
HE signing of the Supply Chain Resilience The prime accused, most prob-
ably a benami fronting for the
Agreement by India and 13 other member
Opposition and ruling party
countries of the Indo-Pacific Economic
politicians, had 22 licensed
Framework (IPEF) underlines the impor- vends to sell liquor. And he was
tance of multilateral cooperation amid openly selling a mixture of
geopolitical rivalries and tensions. The pact is expected extra neutral alcohol (ENA),
A
to make IPEF supply chains more resilient, robust and which the gang was procuring
well-integrated, and contribute towards economic devel- glimpse of the rotten from wherever it was available.
opment and progress of the region. The IPEF includes underbelly of our When methyl alcohol or dena-
India’s Quad partners (the US, Australia and Japan), society was revealed tured spirit is procured instead
South Korea, New Zealand, Fiji and ASEAN members in all its ugliness of ENA, the deaths occur. As
Brunei, Indonesia, Malaysia, Philippines, Singapore, recently. Rather, the simple as that. So, an excise
Thailand and Vietnam. Together, these countries sight is getting worse every pass- scam involving distilleries,
account for around 40 per cent of the world’s GDP, mak- ing day. About 50 children of a licensed vends, excise officials
ing IPEF a formidable economic bloc. Notably, some of senior secondary school for girls and corrupt politicians conve-
in Jind, Haryana, were sexually niently becomes a hooch
these nations are also part of the Regional Comprehen-
harassed; some of them were tragedy, only to be blamed on
sive Economic Partnership (RCEP), the China-spear-
assaulted and a few allegedly families distilling local drinks
headed trade initiative that India had opted out of four raped by their own school princi- JIND HORROR: The school management committee, the district child welfare committee, the commission for the for generations.
years ago. Launched in May 2022, the IPEF is widely pal. He was arrested under the protection of child rights and all other departmental and statutory bodies have failed. PTI But the fate of those 50 chil-
seen as a US-led counter to the RCEP, which is touted as provisions of the Protection of dren of Jind cannot be left to a
the world’s biggest trade agreement. Children from Sexual Offences the accused was sent to judicial league, claiming that there was compromised probe. This case
Supply chains suffered worldwide disruptions (POCSO) Act on the charges of custody, more and more accusa- once a complaint against him as becomes singularly important
during the Covid-19 pandemic, laying bare the vul- sexual assault and aggravated tions poured in. Janwadi Mahila well, but nothing came of it. Inci- not just for all the serious accusa-
nerabilities of the global economy. The Russia- sexual assault, and also under Samiti and Samyukt Kisan Mor- dentally, there were reports that tions up in the air — rape and
Ukraine war and the Israel-Hamas conflict have sections of the Indian Penal cha are the only ones spearhead- the accused principal had a his- suicide of children — but also for
made things worse. Moreover, manufacturers and Code involving assault to out- ing protests, conducting their tory of complaints of sexual the complete collapse of the sys-
suppliers find themselves constantly exposed to rage the modesty of a woman own investigations into this hor- It seems complaints of harassment even before he tem that should have prevented
financial risks due to climate change-induced natural and wrongful confinement. rific incident. A local activist, sexual harassment are joined the Jind school. It seems these incidents. Obviously, the
The story is so bizarre that it Sikkim Nain, has accused the complaints of sexual harass- school management committee,
disasters. The IPEF needs to ensure uninterrupted par for the course in
needs to be recalled in detail. principal of having “physical ment are par for the course in the district child welfare com-
trade engagement among its members.
Initially, a letter was written relations” with 30 children. Haryana schools and Haryana schools and that such mittee, the commission for the
New Delhi’s interests are best served if the IPEF purportedly by a few students of There can be no “physical rela- complaints do not deter the protection of child rights and all
helps it emerge as an attractive investment destina- the school to the National Com- tions” of a sexual nature with a that such complaints department from posting taint- other departmental and statuto-
tion and a bigger player on the export front. The major mission for Women. But the minor other than rape. So, if the ed teachers to all-girls schools. ry bodies have failed.
challenges for India are to improve ease of doing busi- names of students were obvi- activist is pointing to rape com-
do not deter the It is not as if only the educa- If there is a systemic collapse
ness, make the regulatory system transparent and ously fictitious. The letter was mitted by the principal, the department from tion department or the school at Jind, how different can it be
spur sustainable growth. The onus is on the IPEF, probably written on August 31. whole case ought to take a differ- should bear the entire responsi- in other government schools?
which is built on four pillars — trade, supply chains, The district authorities started ent turn because he has so far posting tainted teachers bility. Not a single local politi- Another sad fact about govern-
clean economy and fair economy — to bring about an inquiry on October 25 — on not been charged with rape. Nor to all-girls schools. cian has dared to open his ment schools is that they cater
seamless integration of economies and guard against that very day, without seeking has a rape investigation begun mouth about the case. Neither only to the most backward sec-
becoming a US-centric initiative. the permission of the district by the local police. the local minister nor even the tions of society — economically
education office, the accused Worse, a child of Class XI had put out a timeline or a detailed Opposition leader. The conspir- and socially. When such unfor-
principal took 50 students on a died of suicide on September report of all the strange occur- acy of silence is all-pervasive. tunate students are forced to
three-day trip to Amritsar. In 30. The hapless student, who rences, neither the police nor Then there is a special bon- suffer these ignominies, their
hindsight, the trip is being sur- belonged to a weaker section, the local administration or the homie between the ruling and parents remain helpless. Like
Gaza needs aid mised by the media as a dam-
age-control exercise. On his
had attended school when she
was driven by despair to end
school. Every attempt to
knock at these doors has only
the Opposition combines in
Haryana. Even in the case of a
their children, they too become
victims of social opprobrium,
Truce a must even as UNSC adopts resolution return, the principal was sus- her life. No post-mortem was elicited cryptic replies. liquor tragedy that took the making them cower in despair.
pended by the Additional Chief conducted; nor have the police, The Tribune has been trying to lives of 20 people recently, the They will not complain, fearing
T
Secretary, who smelt a rat. even now, initiated an inquiry get to the bottom of this seem- alleged culprits include an the stigma of the cops ques-
HE UN Security Council, in its fifth
A subsequent inquiry by a sex- on allegations by local activists ingly scary story of a teacher Opposition party leader and the tioning their children, thus
attempt, has on Thursday managed to
ual harassment committee set of abetment to suicide. Along turning predator against his own son of a ruling party bigwig. making a cover-up easy for
adopt a resolution that gives hope for much- up by the Deputy Commissioner with this case of suicide, there students. But to no great avail. The liquor tragedies that occur everyone. But as a society, we
needed humanitarian pauses and safe cor- found the accusations prima are reports of death of two The successor principal-in- in Punjab and Haryana at an cannot fail these children by
ridors in Gaza amid the Israel-Hamas war. facie credible. The principal was more children of this school in charge of the school pooh-poohs alarming periodicity are often letting patriarchy shut them up
However, what is needed is a humanitarian ceasefire. arrested on November 4. Once the recent past. Nobody has the accusations against his col- dismissed as ‘hooch deaths’, and acquit the predator.
For, the war, going on relentlessly since the October 7
Hamas attack, has already inflicted untold damage. thought for the day
Over 12,000 people, including civilians, children, jour-
nalists and UN workers, have been killed and lakhs of There can be no keener revelation of a society’s soul than the way in which it treats its children. — Nelson Mandela
people displaced in the Gaza Strip.
Truce is essential to avert a humanitarian catastro-
phe. The Israeli army has raided the Al Shifa Hospital
in its bid to zero in on the Hamas leaders and unearth
tunnels that it claims lie under the hospital, even as
Hamas and hospital staff are in the denial mode. The
The art and soul Manipulative diplomacy
letters to the editor
Immigration to Canada
Hamas chief has affirmed that the Palestinians can
withstand the Israeli onslaught. Israel, too, is unwilling
to relent unless the Israelis held hostage by Hamas are
of culture Apropos of ‘Biden-Xi meeting’; the manipula-
tive diplomacy demonstrated by Xi Jinping
and Joe Biden to safeguard their respective
It is no secret that immigration to Canada is
popular because it is easier to get into Ameri-
ca from Canada than from most other places.
released. Sadly, Israel — backed by its ally US — is hell- Rajan Kashyap interests is noteworthy. Recognising that Unlike India, Canada doesn’t seem too con-
bent on defying international humanitarian law. healthy competition is inevitable and even nec- cerned about demographic changes. Current-
L
The worsening situation is crying for an immediate OVERS of art and literature are devastated at the pass- essary, the global community, including India, ly, the relations between the two nations have
de-escalation of tensions. An extended pause or truce ing of Prof BN Goswamy, a doyen of culture and refine- aspires for peace between these two superpow- soured, but there is no reason to believe that
is needed to let in aid and attend to those injured in the ment and one of the country’s foremost art connois- ers. It is crucial to note that neither country has this will last long. Once the Khalistani irritant
combat as also the patients in hospitals. Refugee seurs and men of letters. In the field of art appreciation, BNG deviated from their stated positions. This meet- is removed, it will likely become business as
camps in Gaza, too, have been attacked and are calling was a recognised face in India and abroad. ing should serve as an encouragement for usual for the people of both countries. The
out for help. Threatening to exacerbate the crisis is the At Panjab University, Chandigarh, he established from India to engage with China in similar diplomat- ever-increasing number of Indians in Canada
fact that the supplies of food, potable water, medicines scratch the Department of Fine Arts, inspiring and nur- ic ways, protecting its interests for the sake of a must be seen in the perspective of limited
turing many generations of scholars and teachers. His stable and peaceful South Asia. opportunities in India, prompting young peo-
and fuel in the war zones are fast running out. The
acceptance of the position of Professor Emeritus was an DEEPAK TAAK, PANCHKULA ple to opt for greener pastures.
Human Rights Watch fears an outbreak of cholera and
honour for the university. ANTHONY HENRIQUES, MUMBAI
typhoid if aid is not quickly received. Global pressure BNG’s brilliant books on art, especially his treatises on Lack of washrooms
must nudge Hamas to free the hostages and make Kangra paintings, were widely acclaimed. He is credited Refer to ‘Toilets in schools’; menstruation is Poor air quality
both warring groups declare a ceasefire. with having introduced traditional Indian painting to con- a biological process, and every girl/woman Refer to ‘Centre, states working at cross-pur-
noisseurs worldwide. He was valued as a visiting professor has the right to menstrual hygiene. poses’; the Commission for Air Quality Man-
in many universities of Europe and the US. When I hap- Research indicates that at least 71 per cent agement in National Capital Region and
on this day...100 years ago pened to visit the Getty Museum in Los Angeles some years of the girls in India lack knowledge of men- Adjoining Areas has failed to produce tangi-
ago, I dropped the name of Prof Goswamy as a close friend. struation before their first period. Mothers ble results. People traveling on NCR roads,
All at once, my stock with the museum rose, for BNG hap- and teachers should educate girls to manage especially asthma patients, bear the brunt of
pened to be its standing art consultant. menstruation sensibly and in a healthy man- poor air quality. Vote-bank politics has ren-
Over the years, many honours were bestowed on BNG, ner. A survey has revealed that 30 per cent of dered parties in power ineffective when it
lahore, sunday, november 18, 1923 including the Padma Shri and Padma Bhushan. But these the girls drop out of school after they start comes to implementing decisions. Stubble
awards weighed lightly on him. His feet remained firmly on menstruating. Despite the apex court’s rul- was not burnt two decades ago and was
THE INDIAN BAR the ground. As a fresher, I was privileged to know BNG in the ing, a sad state of affairs persists as schools instead used as fodder for animals. The prob-
THE ability of the Indian to hold his own against the British, pro- university, which he had just joined as a teacher of history. His lack adequate toilet facilities for girls and lem emerged with the introduction of com-
vided equal opportunities are offered to him, is nowhere more wife Karuna, who was several years younger than him, was my boys. Various school authorities must bines for harvesting. Stubble has various
clearly demonstrated than in the case of the Bench and Bar in contemporary. Brijinder and Karuna made an elegant and upgrade sanitation infrastructure. practical uses, such as fertiliser, fuel for elec-
India. During the last 40 years or so, India has produced scores of imposing couple. In society, they came to be esteemed as an RAJ KUMAR KAPOOR, ROPAR tricity generation and biofuel.
well-known lawyers who have adorned the highest courts with epitome of learning and sophistication. WG CDR JS MINHAS (RETD), MOHALI
their erudition and impartiality, and have greatly increased the As students in the 1960s, some of us were preparing to take Sanitation infrastructure crucial
prestige and dignity of the Bar by their eminent attainments, and a written examination for entry to the civil services. We were Apropos of ‘Toilets in schools’; sanitation Fatal mishap
this in spite of the fact that the Indian vakils have always been in awe of the formidable professor for an unusual reason. infrastructure is crucial for maintaining a Apropos of ‘39 dead, 17 injured as bus rolls
greatly handicapped as against the barristers. According to the law On the campus, it was known that BNG had been selected conducive environment in educational insti- down 300-foot gorge in Doda’; India is grap-
governing the conduct and status of lawyers practising in Indian to the Indian Administrative Service and had served the tutions, particularly for girls. The Supreme pling with a high number of road accidents.
courts, the barristers are given a privileged position in various mat- government for a couple of years. His image in our eyes was Court’s directive aligns with the right According to the World Health Organisation, at
ters of everyday interest as against the vakils. The most unfair of that of an intellectual who spurned the prestige of India’s approach regarding the draft national policy least one out of every 10 people killed in road
these invidious distinctions is that no vakil can appear in a High top service to join the noble profession of a teacher. It was on menstrual hygiene. These provisions accidents worldwide is from India. The hilly
Court on the original side. Under this rule, men like Justice with some hesitation that I made bold to approach him for were already mandated by the SC, incorpo- regions of northern India, in particular, are
Ranade, Sir NG Chandavarkar, Sir Rash Behari Ghosh, Sir guidance on tackling the subject of history. My apprehen- rating them into the Right to Education Act. prone to road accidents due to poorly main-
Bhashyam Iyengar and a host of other eminent vakils were sion in meeting BNG was unfounded. For him, in the words Numerous institutional-level studies empha- tained roads, inadequate infrastructure, unat-
debarred from appearing in cases heard by High Courts in their of Rabindranath Tagore, knowledge was free. BNG dis- sise that there is enhanced resource develop- tended hazard zones with no means to prevent
original jurisdiction, while the junior-most barristers can claim that armed me; he spent considerable time and took pains to ment when schools ensure proper toilet and vehicles from falling into gorges, heavy traffic,
privilege. Another unjust distinction that the present legal practi- determine a chart of action that helped me succeed. drinking water facilities. Maintaining these the prevalence of unfit vehicles and unsafe
tioners’ law prescribes is that while barristers can practise in the Recently, I requested BNG to write a foreword for my book. facilities requires careful policy planning driving habits such as overspeeding. It is
High Courts from the very start of their career, the law graduates of He had just suffered a tragedy — the demise of his wife Karuna and implementation with sincere commit- imperative to address these issues seriously,
Indian universities are not allowed to do so until after they have and their son — but he bore it with rare fortitude. BNG obliged, ment from every stakeholder. giving top priority to safety.
been in the profession for a number of years. That there is no justi- as he had done for me 60 years ago. His words added lustre to SHUBHAM, JAMMU O PRASADA RAO, HYDERABAD
fication for this differential treatment is absolutely clear, because the publication. Like the Oxford scholar in Chaucer’s Canter-
while a barrister fresh from England is ignorant of Indian law and bury Tales, ‘Gladly would he learn, and gladly teach’. BNG Letters to the Editor, typed in double space, should not exceed the 200-word limit.
practice, the Indian pleader has a thorough knowledge of both. was forever a teacher and equally a student. These should be cogently written and can be sent by e-mail to: Letters@tribunemail.com
THE TRIBUNE CHANDIGARH | SATURDAY | 18 NOVEMBER 2023
OPED 13
A
the US” (as the dominant exchange of views between of periodic tensions between
FTER dithering global power) and the US the leaders on the “strategic, them. These include Chi-
for several should drop the idea of com- overarching and directional na’s desire to displace the
weeks, China’s petition with China. issues” in their bilateral US from the global number
President Xi Jin- Biden rejected Xi’s insin- relationship. China knew one position, reshape the
ping agreed to a uations, saying that the US very well that the US would existing international order
summit meeting with US and China were in competi- not change its position on to its liking and force the US
President Joe Biden in San tion, that the US would any of the critical issues to exit Asia in the future.
Francisco on November 15. invest in American between them. It is Bei- China will continue to sup-
They held a dialogue on sev- strengths and prevent Chi- jing’s hope that after this ply weapons to Ukraine and
eral issues which the US was na’s use of advanced US meeting, the US may delay threaten US allies and part-
pushing for, such as resum- technologies to undermine the imposition of more sanc- ners whenever it deems nec-
ing communication between its national security. He KEY TAKEAWAY: The US and China have decided to resume military-to-military communication. REUTERS tions on the export of tech- essary; the US would be
the militaries, climate raised concerns about Chi- nologies and allow Ameri- obliged to come to their
change, arms control and na’s unfair trade policies, not to interfere in Taiwan’s tion talks and the US-China can companies to make assistance in pursuance of
nuclear non-proliferation. non-market economic prac- presidential elections in Military Maritime Consulta- more investments and do its treaty obligations.
This sudden change in Chi- tices and punitive action January 2024. tive Agreement meetings. greater trade with China. Similarly, the US is equal-
na’s position was the out- against US companies. Biden reiterated US sup- The two countries agreed to Similarly, the US is hoping ly determined to weaken
come of a shift in its econom- The second issue of inter- port for a “free and open the resumption of bilateral that China will be less con- China, deny investments
ic power (vis-a-vis the US) in est to Xi, as expected, was Indo-Pacific (IP) which is cooperation to combat glob- frontational in countering US and technologies in sensi-
recent months. As per a Taiwan. Xi asked Biden “to connected, prosperous, al illicit drug manufactur- military aircraft and war- tive fields, maintain tariffs
study, China’s GDP, which implement its stance of not secure and resilient” and its ing, trafficking, including of ships participating in the on sensitive imports and
was about 75 per cent of the supporting Taiwan’s inde- “ironclad commitment to synthetic drugs like fen- freedom of navigation opera- undermine her global stand-
US’s in 2021, declined to pendence through concrete defending our IP allies” tanyl, and coordination on tions in the South China Sea, ing with the help of its allies.
about 64 per cent in the third actions, stop arming Tai- (important in context of the narcotics issues. They wel- Taiwan Strait and interna- The differences over Taiwan
quarter of 2023 due to mount- wan and support China’s China-Philippines con- comed the progress on tional airspace. Also, if some are equally unbridgeable as
ing local government debt, a peaceful reunification”. frontation to defend the lat-
The differences national actions to reduce incident takes place, the the US and its allies do not
housing bubble, declining Biden reiterated that there ter’s resupply to the Second over Taiwan are emissions in the 2020s and political leadership and the want it to be annexed by
foreign trade and lesser con- had been no change in the Thomas Shoal). Biden also operationalising the work- militaries of the two coun- China; they will continue to
fidence in its economy. US position. The US has raised concerns about unbridgeable as ing group on enhancing cli- tries would be able to estab- arm Taiwan to obviate that
In his discussions with opposed unilateral changes alleged human rights abuse the US and its allies mate actions. lish quick communication to possibility. The fragile rela-
Biden, Xi complained that to the status quo on either by China, including in Xin- Both sides agreed on fur- avoid a conflict. With the US tions between the US and
the US implementation of the side. It expects cross-strait jiang, Tibet and Hong Kong. don’t want it to be ther discussions to address already involved to some China could be tested any-
export control measures (e.g. differences to be resolved Among the summit’s annexed by China; various global challenges, extent in wars in Ukraine and time in case of provocation
sanctions on the export of by peaceful means. Biden achievements were the including health, security, West Asia, it does not want a by various actors as the US
semiconductors, microchips), called for restraint in Chi- resumption of high-level they will continue debt and climate finance in conflict with China. Greater and Taiwan go for the presi-
investment reviews and tar- na’s military activity in military-to-military com- to arm Taiwan. developing countries, arms transparency and dialogue dential elections and Chi-
iffs had harmed China’s and around the Taiwan munication, the US-China control and non-prolifera- on critical technologies like na’s economy witnesses
legitimate interests, includ- Strait and asked Beijing Defence Policy Coordina- tion and economic, commer- artificial intelligence, arms greater strain in 2024.
S
inflation rate is cooling off, answer blamed inflation for Republicans are four times
URENDER, the and unemployment is at the feel-bad factor in the US. more partisan in their stated
man who cleans record low levels. People, he says, don’t care beliefs than the Democrats,
the motel room I Right now, consumer sen- that the inflation rate has and that is what is turning a
was staying in last timent should have been slowed down. They expect good economic situation into
week, told me that between 85 and 90 compared prices to be back where they a ‘feel-bad’ economy.
he was going home to his to the baseline. Instead, it is were when they first began Krugman’s thesis holds
village for Diwali. I asked hovering between 60 and 65. to spiral out of control. By true for India as well, but in
him how much money he The reverse was true during this logic, India too should the opposite direction. Indi-
made every month. Barely the Trump years. Krug- have been afflicted by the an media, by and large,
enough, he said, to cover his man’s math suggests con- feel-bad sentiment. After all, tends to praise the govern-
costs in the city. And almost sumer sentiments ought to average retail prices have ment for even the smallest
nothing left to send home. have been between 85 and gone up by 14 per cent in the good news on the economy,
The job market is tough, I 90 at that time, but past two years, while food while it goes silent whenever
said. No, it isn’t, was his observed consumer senti- MOTIVATION: The feel-good factor encourages entrepreneurship and risk-taking. TRIBUNE PHOTO prices are up by nearly 17 there is any negative news.
response. Then why was he ment was close to 100. per cent. This has made no Those who back the govern-
not getting a good salary? Consider India now. The middle class, the trend is data tells us that consumer difference to consumer sen- ment are much more vocal
He wasn’t, he said, but oth- Centre for Monitoring Indian more or less similar. The pro- sentiment, among those timents in India. and powerful on social
ers were. I asked him Economy’s (CMIE) data tells duction of key consumer who earn between Rs 5 lakh Krugman’s second expla- media as well, which helps
whether he meant his us that the employment rate durables, which are mostly and Rs 10 lakh a year, has nation for the feel-bad senti- amplify the Modi sarkar’s
friends were doing better — or the number of working- bought by the middle and risen from 54 in the July- ment in the US probably also message on the economy,
than him. Again, the answer age people who have work — affluent classes, fell sharply September quarter of 2021 explains the feel-good senti- while stamping down any
was in the negative. He had has been stuck at 37 per cent in September this year. If to 98 now — back to almost ment in India. He says that counter-narrative.
heard on TV and read on for the past eight quarters, or India produced five passen- where it was before Covid consumer sentiment is often Is that necessarily a bad
WhatsApp that people were two years. Yet, consumer ger cars last September, only Consumer sentiment hit us. The Index of Con- based not on their actual thing? Both yes and no. It is
making a lot of money. sentiment has jumped from four were produced this sumer Expectations for the experience but on what the bad because it stops people
In the old days, we used to less than 60 to 97 in the same time. If we produced 100 is often based not on next one year has risen from media and pundits have to from having a say in eco-
call this the ‘feel-good’ factor. period. The Index of Con- units of apparel in Septem- their actual 53 to 96, again close to what say about the economy. To nomic policies because they
It is the exact opposite in sumer Expectations, which ber 2022, production it was in March 2020. this one can add what they do not get correct informa-
the US. At least, that is what gives a snapshot of what peo- dropped to just 82 units this experience but on The feel-good sentiment imbibe from social media. tion on their impact. On the
the Nobel Prize-winning ple feel their next year is time. Middle-class jobs have what the media and that Surender expressed to Krugman claims that the other hand, the feel-good
economist Paul Krugman going to be like, has jumped taken a hit as well over the me, despite his low income, media in the US finds it very factor encourages entrepre-
believes. He says America is from 57 in the July-Septem- past year or so, as employ- pundits have to say wasn’t just an isolated case. difficult to praise the Biden neurship and risk-taking,
a ‘feel-bad economy’ right ber quarter of 2021 to 97 in ment in startups and legacy about the economy. The data I have quoted above administration for beating which keeps the ‘animal
now, where consumers September 2023. IT companies has dried up. shows that it is widespread. down inflation, creating more spirits’ flowing through the
believe that the economy is Even if you take the urban Despite that, the CMIE’s What explains this diver- jobs and maintaining a high economic system.
%
gggTQY\i`Y_^UUbS_]
&KLQHVHDUHVDYLQJ
UPRTQ^^ZR^\SPX[h_X^]TTak /CWT3PX[h?X^]TTak X]bcPVaP\R^\SPX[h_X^]TTa
A2A6CH:E9A2DD:@?
?RefcVTR_\Z]]
:K\XQGHUWDNHKHDY\GXW\µGHYHORSPHQW¶SURMHFWV
WKDWWKHIUDJLOH+LPDOD\DQUDQJHFDQQRWFRSHZLWK"
7LPHDQGDJDLQ1DWXUHKDVLQGLFDWHGVRPHWLPHVHYHQVHYHUHO\WKDWWKH+LPDOD\DV
DUHDIUDJLOHHFRV\VWHP'HVSLWHHDUOLHUZDUQLQJVLQ+LPDFKDO3UDGHVK6LNNLPDQG
IRUWKHUDLQ\GD\ 28?@9>45BB8=67
8WWDUDNKDQGLWVHOIZHGRQRWOHDUQDQ\OHVVRQVDQGNHHSPHGGOLQJZLWKLW1RZWKH CWTDBX]cTaeT]cX^]bWPeT]³c_PXSSXeXST]SbX]\^bc_[PRTbfWTaTPbcWT2WX]TbT
OLYHVRIFRQVWUXFWLRQZRUNHUVWUDSSHGLQVLGHDFROODSVHGWXQQHOLQ8WWDUNDVKLKDQJ
LQEDODQFHHYHQDVPDVVLYHPDFKLQHVDUHSUHVVHGLQWRVHUYLFHWRFOHDUWKHGHEULV PaTWP__hc^_[PhcWTbTR^]SUXSS[TP]SfPXcU^aP]^__^acd]TcX\Tc^aTPRc
7KHFRQVWUXFWLRQLVPHDQWWRLPSURYHDFFHVVWRWKHIRXUPDMRUVKULQHVZKLFKDWWUDFW s per Brown
A
ODNKVHYHU\\HDU+RZHYHUWKHLPSDFWRIVXFKSURMHFWVRQWKHIUDJLOHHFRV\VWHPKDV University’s Institute
EHHQDVXEMHFWRIPXFKFRQWURYHUV\*ODFLDOPHOWLQJOHDGLQJWRIORRGRXWEXUVWVDQG of International and
PRUHFDVHVRIODQGVOLGHH[DFHUEDWHGE\KHDY\UDLQVKDYHDODUPHGHQYLURQPHQWDO Public Affairs, the
LVWVDQGFRXUWDSSRLQWHGH[SHUWV7KHXUJHQF\RIWKH8WWDUNDVKLVLWXDWLRQKDVKHLJKW United States is
believed to have incurred $2.3 tril-
HQHGDVWKHZRUNHUV IDPLOLHVDQGFROOHDJXHVDUHSURWHVWLQJIRUVZLIWDFWLRQ6LQFH lion and 6247 war deaths (includ-
6XQGD\WKHZRUNHUVKDYHEHHQVWUDQGHGIWIURPWKHWXQQHO VHQWUDQFHUHO\LQJ ing Military, Contractors, and
RQO\ RQ WKH IRRG ZDWHU DQG R[\JHQ VHQW WKURXJK Civilians) in the ill-fated War in
SLSHV,QLWLDOUHVFXHDWWHPSWVLQYROYLQJGULOOLQJHTXLS Afghanistan (2001-2021). This
bill does not include future inter-
PHQWDQGH[FDYDWRUVZHUHDEDQGRQHGDIWHUDKHDY\ est payments on borrowings
PDFKLQHFDXVHGPRUHGHEULVWREORFNWKHZD\DQG made to fund this war or the asso-
LQMXUHG UHVFXH ZRUNHUV 7KH DXWKRULWLHV KDYH QRZ ciated Veteran care that will be
GHSOR\HGDPRUHVRSKLVWLFDWHGPDFKLQHFDSDEOHRI required in the future. The net
result of this war is that ultimate-
GULOOLQJWKURXJKWKHGHEULV7KHSODQLQYROYHVFUHDW ly the US had to negotiate with the
LQJDSDVVDJHZLWKVWHHOSLSHVWRIDFLOLWDWHWKHZRUN same group for its own exit from
HUV HVFDSHZLWKRXWWKHULVNRIIDOOLQJGHEULV Afghanistan, which it had origi-
,QWHUQDWLRQDOH[SHUWVLQFOXGLQJIURPD7KDLFRPSD nally come to defeat in
Afghanistan i.e., the Taliban. The
Q\ WKDW DVVLVWHG LQ WKH FDYH UHVFXH DQG WKH actual superpower with which
1RUZHJLDQ *HRWHFKQLFDO ,QVWLWXWH KDYH DOVR EHHQ Afghanistan ought to have con-
UXVKHG LQ WR HYDFXDWH WKH WUDSSHG ZRUNHUV 7KH cerns given the contiguity of a
+LPDOD\DQ6WDWHVDQG8WWDUDNKDQGLQSDUWLFXODUKDYHH[SHULHQFHGDUHFXUULQJSDW shared land border i.e., China,
stayed peacefully out of the con-
WHUQRIQDWXUDOGLVDVWHUVLQFOXGLQJHDUWKTXDNHVODQGVOLGHVDQGJODFLDOIORRGV7KH flict for twenty years and has gin- any case. And I want to believe ship in technology forays), Given that the Chinese have
8WWDUNDVKLHDUWKTXDNHWKH0DOSDODQGVOLGHWKH&KDPROLHDUWKTXDNHWKH gerly walked in as the only super- that China will not pursue even as it had maintained a very little to lose and much to
&KDPROLJODFLHUIORRGDQGWKH.HGDUQDWKIORRGGHYDVWDWLRQDUHDOOFDVHV power to have a real equation with another policy. We are satisfied rare semblance of a relation- gain at the expense of the exist-
LQSRLQW7KLVUHFXUULQJF\FOHRIGHVWUXFWLRQDQGGHDWKKDVWKHORFDOSRSXODWLRQLQD the government in Afghanistan, with this status quo, to be hon- ship with the likes of Hamas, ing American global footprint
today. All without incurring any est.” Again, without investing Hezbollah et al, earlier. This and perceptions, it plays a
GLOHPPDDVWKH\ZLWQHVVPDVVLYHLQIUDVWUXFWXUHSURMHFWVODEHOOHGGHYHORSPHQWZKLOH money or firing a single shot! any resources, firing a shot or guarded approach may not snake-like baiting game of
VLPXOWDQHRXVO\ EHDULQJ WKH EUXQW RI FOLPDWHUHODWHG GLVDVWHUV 6LQNLQJ LQFHVVDQWO\ German research institute, Kiel, committing to a meaningful endear Beijing to either of the ‘wait and watch’, and then
-RVKLPDWKFRQWLQXHVWREHDWLFNLQJWLPHERPE<HWDYLFLRXVF\FOHRIFRQVWUXFWLRQ has estimated that the United stand, the Chinese have sides in the Israel-Hamas con- strikes when the opportunity
DQGGHVWUXFWLRQFRQWLQXHVWRWDNHDKHDY\WROORQKXPDQOLIH$VWKHUHVFXHRSHUDWLRQ States has directed more than $75 retained a favourable posi- flict immediately, but it does offers itself with minimal effort
billion in assistance to Ukraine in tion with Ukrainians (and save China from burning pre- or fuss. The already battered
XQIROGVLQ8WWDUNDVKLWKHLQFLGHQWRQFHDJDLQVKHGVOLJKWRQWKHQHHGIRUFDUHIXOFRQ the form of military, financial and obviously with the Russians), cious money from its treasury global economy post-pandem-
VLGHUDWLRQEHIRUHXQGHUWDNLQJDQ\PDMRUGHYHORSPHQWSURMHFWLQHFRORJLFDOO\VHQVL humanitarian aid. This makes even though it is the US that and then deciding as to which ic had led to credible talks of
WLYHDUHDVDFURVVWKHQDWLRQEHLWGHQVHIRUHVWVLQWKHKLQWHUODQGRUWKH:HVWHUQ*KDWV Ukraine the top aid recipient of is picking up the tab! side to tilt as the dust starts set- an impending recession in
RUWKH+LPDOD\DQUDQJH7KHSULRULW\IRUQRZLVWKHVDIHW\RIWKHWUDSSHGZRUNHUVEXW US foreign aid – a first-time sta- The latest global war that has tling in the Gaza Strip. the US, yet it continues sink-
tus for a European country since drawn the United States into its C74278=4B470E4 Irrespective of the outcome of ing its fast-depleting resources
EURDGHULPSOLFDWLRQVXQGHUVFRUHWKHLPSRUWDQFHRIEDODQFLQJGHYHORSPHQWZLWKHQYL the Harry Truman Government ambit is the Israel-Hamas war the war, the US will have under the pretext of ensuring
URQPHQWDOSUHVHUYDWLRQ7KHGHOLFDWHHFRV\VWHPRIORZHU+LPDOD\DVUHTXLUHVDZHOO had sanctioned the rebuilding of which has resulted in E4AH;8CC;4C> more enemies than it had “American security for gener-
FRQVLGHUHGDSSURDFKWRHQVXUHWKHZHOOEHLQJRIERWKWKHORFDOVDQGWKHUHJLRQ the European continent after
World War 2. The list includes
Washington DC giving at least
$14 billion (traditionally the
;>B40=3<D27 before the war started and it
would have sunk huge
ations”. Biden is feeding the
fear of abstaining from inter-
cutting-edge technology like US was providing up to $3 bil- C>608=0CC74 amounts in a war that was ventions by suggesting that the
?82D1<; Abram tanks, coastal defence
ships, anti-aircraft missiles, and
lion worth in military assis-
tance, annually) to Israel to 4G?4=B4>5
essentially, someone else’s.
The above examples of the US’s
“outcome of these fights for
democracy against terrorism
advanced surveillance and radar
systems, yet the Russian-Ukraine
spruce up its air and missile
systems, including the much-
C744G8BC8=6 global military intervention do
not include the rather substan-
and tyranny are vital to the
safety of the American people”.
war is a stalemate, at best. bandied Iron Dome, amongst 0<4A820=6;>10; tial ‘investments’ that it is So far, the US interventions
China which has a 4210 km long other security wherewithal. already committed to in the haven’t paid dividends in most
land border with Russia and its As the Israeli offensive in the 5>>C?A8=C0=3 war-torn Middle Eastern the- places whereas the Chinese are
own axe to grind with the United
States thought it best to offer plat-
Gaza Strip continues relent-
lessly at a very steep human
?4A24?C8>=B8C atre, restive Sub-Saharan
Africa etc., Yet nowhere is the
happy to play the second fid-
dle with only accusatory state-
itudes that seem to blame the US and financial cost, it is the US ?;0HB0B=0:4 US intervention leading to ments and saving its resources
or NATO more than the Russians, that will pick up a sizeable part any tangible or long-term for the rainy day. Something is
yet the Ukrainians strangely seem of the bill. Yet the Chinese have ;8:4108C8=660<4 improvements in its sover- clearly wrong in the American
satisfied with the Chinese indif-
ference. Zelensky, who is propped
decided to stay out of the con-
flict discourse, including tak-
>5²F08C0=3 eign perceptions or relations –
whereas the fleet-footed
admixture of diplomacy as it
is fast ceding ground to the
by the US largesse said incredu- ing clear sides. Perhaps it has F0C27³ Chinese who despite all accu- penny-pinching Chinese.
lously, “China has chosen the pol- something to do with the sations of ‘debt-traps’, inconsis- (The writer, a military veter-
icy of staying away. At the quixotic approach of having tent or amoral stands are an, is a former Lt Governor
moment, Ukraine is satisfied robust relations with Israel increasingly getting afforded of Andaman & Nicobar
with this policy. It is better than (including thriving trade and the sort of expansionism that Islands and Puducherry. The
helping the Russian Federation in commerce and grantsman- Beijing desperately seeks. views expressed are personal)
g_b[V_bSU_`dY]YcQdY_^
government. Setting a clear timeframe for
the governors to go through the bills, cWTUX]P[]^fR^bcAb $BTRdaX]VPRR^\
address their doubts, or approve them is \^SPcX^] P]S cXRZTcb WPb QTR^\T P WTaRd[TP]
CE:9D:0A?4 crucial. This measure aims to alleviate the RWP[[T]VT 5^[[^fX]V cWT P]]^d]RT\T]c ^U cWT
logjam between the Chief Minister's F^a[S2d_bRWTSd[TUP]bfTaT\TcfXcWPbdaVT
7KHµVNLOOVILUVW¶PRGHORIWDOHQWDFTXLVLWLRQDQGPDQDJHPHQWLVWKHNH\ office, the government, and the X]U[XVWcR^bcbP]SP]Tg^aQXcP]cW^cT[cPaXUUCWT
bXcdPcX^]f^abT]TSPb8]SXPbTRdaTScWTXab_^cX]
Governor's office in any given state.
WRWKULYHLQWKHHYROYLQJODQGVFDSHIRUWHFKGULYHQHQWHUSULVHV Additionally, it is proposed that only indi- cWTUX]P[fXcWW^cT[_aXRTbX]0W\TSPQPSbZha^RZ
viduals with a non-controversial and non- TcX]V >][X]T _[PcU^a\b [XZT 1^^ZX]VR^\
hen times change, landscape has changed. One assessment journey for new political background be appointed to the <PZT<hCaX_P]S0V^SPWPeTfXc]TbbTSPbXV]XU
W innovation and
revamping opera-
tional procedures comes
can no longer acquire skills
that guarantee a lifetime of
employment especially in the
hires, even before the start of
the formal recruitment
process. There are world-
governor's office, ensuring a harmonious
and expedited administration. This
approach promotes all-round harmony
C
WTUTae^dabdaa^d]SX]VcWTd_R^\X]V822>38
F^a[S2d_UX]P[QTcfTT]8]SXPP]S0dbcaP[XP
XRP]cb_XZTX]bTPaRWTbU^abcPhbX]0W\TSPQPS
\Xaa^aX]VcWTST\P]Sc^bTTP]8]SXP0dbcaP[XP
R[PbWCWTUX]P[QPcRW^U\PcRWcXRZTcbfWXRWfT]c
across as the best way to field of technology. Skills class, AI-powered skills intel- and contributes to a more efficient gov- PccWT=PaT]SaP<^SXBcPSXd\X]0W\TSPQPS ^]bP[T^]=^eT\QTa "b^[S^dcaP_XS[hCWT
ensure resilience and main- have become fluid and it is ligence tools to ensure there ernance process, benefitting all political ^]=^eT\QTa (7^fTeTaUP]bUPRTd]Tg_TRc RWTP_TbccXRZTcPePX[PQ[T^]1^^Z<hBW^ffPb
tain performance levels in an not uncommon to see them is no inherent bias in the parties regardless of their positions in dif- TSWdaS[TbX]cWTXaTUU^acbc^QT_Pac^UcWXbWXb _aXRTSPcAb 6XeT]cWTaT\PaZPQ[Td]QTPc
organisation. Of late, the agility and adaptability. become outdated in a time process, no error or inconsis- ferent states. c^aXR\^\T]c0b_TacWTaT_^acTeT]QPbXRPRR^\ T]bcaTPZ^UcWT\T]X]Q[dTX]cWTc^da]P\T]c
dynamic changes in employ- Technologies are changing frame shorter than what it tency of judgment and a As management literature often high- \^SPcX^]X]cWTRXch]^fR^\TbfXcWPWTUch_aXRT cWTUX]P[R[PbWWPb^][hPSSTSc^cWTP]cXRX_PcX^]
ment and head-hunting, and rapidly, and change-resis- takes to obtain a graduate focus on the skills that candi- lights, "individuals may come and go, but cPV^UAb _Ta]XVWcfWX[T[dgdahW^cT[b P\^]VUP]bcda]X]VXcX]c^P^]RTX]P[XUTcX\T
the rising emphasis on tance can be the biggest detri- degree or a PG diploma dates possess instead of the the focus should remain on efficient PaT RWPaVX]V R[^bT c^ Ab [PZW U^a P ]XVWcb TeT]cU^aRaXRZTcfPcRWTab]PcX^]fXST
employee engagement, and ment to an individual’s nowadays. Even though the job titles they hold. administration and constructive, happy bcPh5[XVWc _aXRTb WPeT P[b^ b^PaTS bW^fX]V P Bhagwan Thadani | Mumbai
retention has significantly growth and capability of con- job titles remain the same, the Organisations are using smart development management for peace,
changed workforce manage- tributing to the organisation’s roles and the execution strate- skills cloud and skills-driven prosperity, progress, and the eradication
ment. Today, the key to opti- growth as well. Therefore, it gies are constantly changing. hiring processes to continu- of poverty." Summit. Furthermore, initiatives like the to a significant decline in Israel's influ-
misation of the human is important to foster a work- For instance, we still have ously gain insights into their PV Rao Sreelekha | Secunderabad Bio-fuel Alliance for net zero emissions, ence worldwide.
resources available lies in force that is ready to take up computer programmers, but internal talent pool’s skill a digital public infrastructure (DPI) sys- The recent UN votes on Gaza indicate
understanding skills and skill new roles and acquire skills what a programmer does assessment, and use this skills F?7CC*9>3<EC9?>1>4CECD5>1>35 tem for hand-to-hand delivery, and the growing isolation for Tel Aviv. Notably,
adjacencies. Companies are that prepare them for those today is vastly different from intelligence to determine Sir— the recent inauguration of the LIFE program (Lifestyles for Sustainable the vote to condemn Israel saw only 120
paying more attention to roles. what he did 15 years ago. learning programmes as well Voice of Global South Summit (VOGSS), Environment) have been recommended countries in favor, with 45, including
internal relocation of This kind of approach can be There are also new roles that as the hiring strategies. All this conducted virtually with participants for sustainable development, aiming to India, choosing to remain absent.
resources and creating precise successful only when it is ade- are emerging with the change is being done automatically from 125 countries. Under the motto achieve the 17 Sustainable Development Subsequent resolutions gained more
learning and skill develop- quately backed by transparent in tech landscape, and they without manual inputs from "Together for Everyone's Growth, with Goals by 2030. The summit stands as a support, with 151 countries in favor,
ment strategies to get better internal mobility and recruit- need to be catered to. For the employees. Everyone's Trust," VOGSS focuses on fos- testament to inclusivity and better suste- indicating a shift in global opinion
outcomes. ment focus. Companies that instance, nobody worked as a Conclusion tering collaboration on crucial global nance, promising significant benefits against Israel.
In this scenario, it is very clear put in place tools and systems ‘Full Stack Developer’ at the Companies that proactively issues. The summit addresses environ- for global south nations. The recent Security Council resolution
that skills-based hiring that empower employees to start of the millennium, but embrace the new approach mental sustainability, climate resilience Dimple Wadhwa | Kanpur for a 'humanitarian pause' in Gaza,
processes are far more effec- express their expectations, today it is a key role in almost and adopt the right AI-pow- and finance, sustainable foreign direct where 12 out of 15 members voted in
tive compared to the conven- future growth aspirations and every tech organisation. Thus, ered skills intelligence tool will investment (FDI), affordable energy CD1D5D5BB?B9C= favor, further emphasises the changing
tional job titles-driven recruit- share opportunities with it is important to understand edge out those that continue transitions, and supply chain productiv- Sir— Israel's recent actions and the tide. The absence of any veto suggests
ment. There is a paradigm them that can take them that new skills are emerging to rely on traditional and ity. impact on its global standing.The cru- challenging times for Israel. I hope that
shift that is based on identi- closer to their goals, are also and they are necessitating time-consuming methodolo- India, a prominent member, is actively elty and brutality displayed towards the diplomatic solutions can be explored to
fying an individual’s ability to the ones that will perform creation of new roles as well gies, and achieve superior working to bridge the untapped poten- citizens of the Gaza Strip have raised bring about positive change in the
perform, adapt to the better in the years ahead. as redefining existing or con- growth as well as talent reten- tial of global south countries with grow- questions about Israel's conduct. After region.
demands of the role, and Why change to ‘Skills-First’ ventional job titles. tion outcomes! ing world economies. India has proposed the October 7 incident, countries and Jang Bahadur Singh | Jamshedpur
capacity for growth. There is The shift to a Skills-First This skills-driven strategy (The writer is Co- Founder strategies to combat the rising technical people who initially stood with the Jews
much greater emphasis now approach is directly reflective has led to most prominent & CTO, iMocha. The views challenges of artificial intelligence against the Palestinians are now becom- BT]Shh^daUUTTSQPRZcc^)
on soft skills such as learning of the way the operational employers starting their skill expressed are personal)) through the AI Global Partnership ing disillusioned with Israel. This has led [TccTabc^_X^]TTa/V\PX[R^\
=4F34;78kB0CDA30H k=>E4<14A '!!"
&
gggTQY\i`Y_^UUbS_] UPRTQ^^ZR^\SPX[h_X^]TTak /CWT3PX[h?X^]TTak X]bcPVaP\R^\SPX[h_X^]TTa
FIRSTCOLUMN
@FCD24C653@?5
13$V6HWWLQJWKH
H:E9?2EFC6
0]RXT]c8]SXP]cTgcb_PhcaXQdcTbc^=PcdaT
P]ST\_WPbXbTcWTX]cTaST_T]ST]RT
UHFRUGVWUDLJKW EDD1=6D?C0
7KH0RGL*RYHUQPHQWKDVPDGHXQVWLQWHGHIIRUWVWRPDNHWKH
GHIDXOWHUVSD\XSDQGDOVRHQVXUHGWKDWQRQHZ13$VDUHFUHDWHG
s per the information shared
,
CG1=9270A0=0B7A8C
QGLDDODQGRIGLYHUVHFXOWXUHVDQGULFKWUDGLWLRQVKDVDSURIRXQGFRQ
QHFWLRQZLWKQDWXUHWKDWWUDQVFHQGVWLPH7KH,QGLDQVFULSWXUHVFRP
SULVLQJDYDVWERG\RIUHOLJLRXVDQGSKLORVRSKLFDOWH[WVHFKRDGHHS
FRQFHUQ IRU WKH HQYLURQPHQW DQG DGYRFDWH D KDUPRQLRXV UHODWLRQVKLS
A by the Reserve Bank of India
(RBI) in reply to the RTI
question, scheduled commer-
cial banks (SCBs) had written
off non-performing assets (NPAs) - an
acronym for loans that have gone bad -
worth over Rs 10,57,000 crore in the last
EHWZHHQKXPDQVDQGQDWXUH7KLVDUWLFOHH[SORUHVWKHWKHPHVRIHQYL five years. This amount is often cited by
the opposition in particular, the grand old
URQPHQWDOFRQVFLRXVQHVVDQGUHYHUHQFHIRUQDWXUHHPEHGGHGLQWKHIDE party (GOP) to lambast Modi – govern-
ULFRI,QGLDQVFULSWXUHV ment for having given what they term as
9HGLF:LVGRP ‘loan waiver’ to big industrialists and busi-
7KH5LJYHGDRQHRIWKHROGHVWVDFUHGWH[WVLQ+LQGXLVPDFNQRZOHGJHV nessmen.
WKHGLYLQHHVVHQFHZLWKLQQDWXUH,WGHVFULEHVYDULRXVHOHPHQWVRIQDWXUH Has Modi granted favours to the big-
VXFKDVULYHUVPRXQWDLQVDQGSODQWVDVGHLWLHVZRUWK\RIZRUVKLS7KH wigs?
K\PQVLQWKH5LJYHGDHPSKDVLVHWKHLQWHUFRQQHFWHGQHVVRIDOOOLYLQJEHLQJV To address this, we need to answer two
fundamental questions. When does a loan
DQGVWUHVVWKHLPSRUWDQFHRISUHVHUYLQJWKHEDODQFHLQWKHQDWXUDORUGHU become an NPA? How does the bank deal
8SDQLVKDGLF3KLORVRSK\ with it? A loan account becomes an NPA
7KH8SDQLVKDGVSKLORVRSKLFDOWUHDWLVHVWKDWIRUPWKHEDVLVRI9HGDQWD when interest and/or instalment of prin-
GHOYHGHHSHULQWRWKHXQGHUVWDQGLQJRIWKHVHOIDQGLWVUHODWLRQVKLSZLWK cipal remain overdue for a period of more
WKHFRVPRV7KH\DGYRFDWHWKHFRQFHSWRI%UDKPDQDQXOWLPDWHUHDO than 90 days. The borrower could land in
LW\WKDWHQFRPSDVVHVHYHU\WKLQJLQWKHXQLYHUVH7KLVLQWHUFRQQHFWHGZRUOG such a predicament under three different
YLHZSURPRWHVDVHQVHRIUHVSRQVLELOLW\WRZDUGVQDWXUHYLHZLQJLWDVDQ scenarios:
First, the bank officials have conducted
H[WHQVLRQRIWKHGLYLQH due diligence, carefully assessed the via-
%KDJDYDG*LWD bility of the project or venture for which
,QWKH%KDJDYDG*LWDDUHYHUHGVFULSWXUHZLWKLQWKH,QGLDQHSLF0DKDEKDUDWD the loan is considered, convinced them-
/RUG.ULVKQDLPSDUWVVSLULWXDOZLVGRPWR$UMXQD7KH*LWDHPSKDVLVHV selves about the credibility of the borrow-
WKHFRQFHSWRIGKDUPDRUULJKWHRXVGXW\LQFOXGLQJWKHVWHZDUGVKLSRI er and kept track of the utilization of the
WKHHQYLURQPHQW.ULVKQDXQGHUVFRUHVWKHVDFUHGQHVVRIQDWXUHXUJLQJ funds, functioning of the enterprise, its
LQGLYLGXDOVWRDFWUHVSRQVLEO\DQGZLWKUHVSHFWIRUWKHGHOLFDWHEDODQFH profitability, generation of cash and so on.
The chances of such a loan account
RIWKHHFRV\VWHP becoming NPA are minimal; if at all it
happens it could be due to circumstances
totally beyond the control of the borrow-
er say, for instance, the impact of the at 22 per cent during 2021-22. It Regulation Act (BRA) giving RBI decisions of the National Company
Covid pandemic. clearly demonstrates that under the the power to force banks to act if Law Tribunal (NCLT) – the des-
Second, the officials have granted loans in Modi – regime, banks in particu- they don’t do it on their own. On ignated authority for such matters
a cavalier fashion without conducting due lar, PSBs were more careful in giv- February 12, 2018, RBI issued a - are subject to appeal in the
diligence or assessing the project/venture’s ing loans (category 1) resulting in circular containing the specifics of National Company Law Appellate
viability and haven’t put in place mecha- a much lower ratio. how it was to be done. Tribunal (NCLAT), the High
nisms to track the utilisation of funds, There is another point of differen- The government has made life for Court and the Supreme Court (SC)
functioning of the enterprise and so on. tiation between the UPA – regime willful defaulters (borrowers who which leads to delays as big
There is a greater chance of such a loan (2008-2014) and Modi (2014 can pay back yet decide not to) defaulters invariably go for appeal.
turning into an NPA. onward). Whereas, under the for- pretty tough. They are not sanc- That apart, following a bunch of
Third, the bank’s top brass in utter disre- mer, banks kept NPAs under the tioned any additional facilities by petitions by defaulting borrowers,
-DLQLVPDQG(FRORJ\ gard for due diligence acts with mala fide carpet by using techniques such as banks or other FIs, and their unit in April 2019, the SC declared the
intent under what is termed a “quid pro ‘evergreening’ of loans - fancy is debarred from floating new RBI circular dated February 12,
-DLQLVPDQDQFLHQW,QGLDQUHOLJLRQSODFHVDVWURQJHPSKDVLVRQQRQ quo” arrangement. Put simply, it approves nomenclature for the bank giving ventures for five years. 2018 – this was the cornerstone of
YLROHQFH DKLPVD DQGFRPSDVVLRQWRZDUGVDOOOLYLQJEHLQJV-DLQVFULS and disburses loans in exchange for more loans to enable the borrow- Additionally, they and companies the insolvency process shepherd-
WXUHVDGYRFDWHDOLIHVW\OHWKDWPLQLPLVHVKDUPWRQDWXUHSURPRWLQJYHJ bribes. In this scenario, it is almost cer- er to service the previous loan – that have them as promoters/direc- ed by the banking regulator -
HWDULDQLVPDQGHQYLURQPHQWDOFRQVHUYDWLRQ7KHLGHDRILQWHUFRQQHFWHG
QHVVLVFHQWUDOWR-DLQ VSKLORVRSK\HPSKDVLVLQJWKHLQWHUGHSHQGHQFHRI
tain that the loan would become NPA as
it was taken with the sole intention of not 5>;;>F8=6 thus making the loan account
look normal, under the latter they
tors are debarred from accessing
capital markets to raise funds.
unconstitutional.
As a result, the RBI was forced to
DOOOLIHIRUPV returning it. ?AD34=C80; were forced to ‘truthfully’ reflect Furthermore, under IBC, such come up with a revised circular
Replying to the debate on the President’s NPAs in the balance sheet (BS). promoters can’t remain in control dated June 7, 2019, that gave too
%XGGKLVPDQG(QYLURQPHQWDO(WKLFV
7KHWHDFKLQJVRI6LGGKDUWKD*DXWDPDWKH%XGGKDLQFOXGHSULQFLSOHVWKDW
address during the opening of the budget 022>D=C8=6 Modi got it done even for the loans of the entity. much leverage to the
DOLJQZLWKHQYLURQPHQWDOHWKLFV%XGGKLVPHPSKDVLVHVPLQGIXOQHVVDQG
session of the parliament in February
2018, Prime Minister, Narendra Modi stat- ?A02C8240=3 given under UPA by asking the
RBI in 2015 to conduct an asset
As per the information given by
the Ministry of Finance (MoF) in
lenders/banks. It has created a sce-
nario where they are neither under
DZDUHQHVVHQFRXUDJLQJLQGLYLGXDOVWRFXOWLYDWHDGHHSFRQQHFWLRQZLWK ed that there had been a massive prolif- 0B?4AA18 quality review (AQR) of all SCBs Parliament, during the last nine any compulsion nor have any
WKHQDWXUDOZRUOG7KHFRQFHSWRILQWHUGHSHQGHQFH SUDWLW\DVDPXWSDGD eration of loans given by the banks on the to identify NPAs. As a result, years, SCBs have undertaken an interest in referring the NPA for
LQ%XGGKLVPUHFRJQLVHVWKHLQWULFDWHZHERIUHODWLRQVKLSVEHWZHHQDOOHOH directions of the ruling political establish- 6D834;8=4B their gross NPAs scaled to a high aggregate recovery of Rs 10,16,617 resolution under IBC.
PHQWVRIH[LVWHQFHSURPRWLQJDVHQVHRIUHVSRQVLELOLW\WRZDUGVWKHHQYL ment to favoured industrialists and busi-
nessmen. During 2008-2014, loans worth C74HFA>C4 of Rs 1036,000 crore as of March
31, 2018.
crore of NPAs. Out of this, the
Central government gave around
Still, the IBC framework has
brought about a fundamental
URQPHQW
+LQGXLVPDQGWKH:RUVKLSRI1DWXUH
Rs 3500,000 crore were given. The bulk >55C74B4 How did the banks deal with Rs 300,000 crore as budgetary sup- change in the behaviour of the bor-
of these loans were given in the second these NPAs? port to shore up the capital of PSBs rower.
6HYHUDO+LQGXIHVWLYDOVDQGULWXDOVDUHGHGLFDWHGWRQDWXUHZRUVKLS)RU and third categories. Therefore, it was ;>0=B8C8B0 Following prudential accounting during 2016 - 2021. Furthermore, By instilling a sense of fear that
H[DPSOHIHVWLYDOVOLNH1DYUDWULFHOHEUDWHWKHGLYLQHIHPLQLQHHQHUJ\SUH
VHQWLQQDWXUHDQGULWXDOVOLNHSULWKYLSXMD ZRUVKLSRIWKH(DUWK XQGHU
quite likely these would become NPA.
This is corroborated by the RBI data on <0=30C>AH practice and as per RBI guidelines,
they wrote off these loans. It is a
in the budget for 2021-22, it com-
mitted another Rs 200,000 crore by
continuing default could result in
his losing control over the firm, it
OLQHWKHVDFUHGQHVVRIWKHHQYLURQPHQW7KHVHSUDFWLFHVIRVWHUDVHQVH the addition of new NPAs as a percent- A4@D8A4<4=C mandatory requirement to reflect way of a sovereign guarantee for has forced a large number of them
RIUHYHUHQFHDQGUHVSRQVLELOLW\HQFRXUDJLQJIROORZHUVWRSURWHFWDQGSUH age of the opening balance of NPAs in that on a bank’s true financial health. the security receipts (SRs) to be to clear all their dues. Besides, a
VHUYHWKH(DUWK
year between 2009-10 and 2015-16. In C>A45;42C>= It isn’t a loan waiver (the opposi- issued by NARCL where the series of governance reforms
7KHFRQFHUQIRUQDWXUHLQ,QGLDQVFULSWXUHVLVQRWMXVWDFXOWXUDORUUHOL
2009-10, 2011-12 and 2015-16, the addi-
tion of new NPAs was higher than their C7410=:³B tion/GOP want the public to
believe that it is) as the bank con-
majority shareholding is vested in
PSBs.
implemented in PSBs have galva-
nized banks to promptly recognize
JLRXVWHQHWEXWDSURIRXQGSKLORVRSK\WKDWXQGHUVFRUHVWKHLQWULQVLFFRQ
QHFWLRQEHWZHHQKXPDQVDQGWKHHQYLURQPHQW7KHDQFLHQWZLVGRPHQFDS
opening balance. In the remaining years CAD458=0=280; tinues to chase the defaulter After adjusting for Rs 500,000 and report stressed assets and
2010-11, 2012-13, 2013-14 and 2014-15, including legal courses to recover crore being the contribution of the take stringent measures for their
VXODWHGLQWKHVHVFULSWXUHVSURYLGHVDWLPHOHVVJXLGHIRUIRVWHULQJDVXV the addition of new NPAs was at least 90 740;C7 it. government, banks still recovered recovery. To conclude, far from let-
WDLQDEOHDQGKDUPRQLRXVUHODWLRQVKLSZLWKQDWXUH$VWKHZRUOGJUDSSOHV percent of the opening balance. To enable banks to pursue their a substantial amount of Rs 516,617 ting defaulting industrialists and
ZLWKHQYLURQPHQWDOFKDOOHQJHVWKHWHDFKLQJVRI,QGLDQVFULSWXUHVRIIHU After 2015-16, this ratio has consistently efforts on the fast track, in 2016, crore from the defaulters. The businessmen go off the hook, the
fallen and it was around 1/3rd in 2020-21 the government enacted the recovery would have been much Modi – government has made
YDOXDEOHLQVLJKWVUHPLQGLQJXVRIWKHVDFUHGERQGWKDWXQLWHVDOOOLYLQJ and 2021-22. The impact in the case of (The writer is a policy Insolvency and Bankruptcy Code more but for the judicial bottle- unstinted efforts to make them pay
EHLQJVZLWKWKH(DUWK public sector banks (PSBs) was more pro- analyst, views are (IBC) superseding subsisting laws. necks in the insolvency proceed- up and also ensure that no new
7KHZULWHULVDVSLULWXDOJXLGHYLHZVDUHSHUVRQDO nounced where the ratio was even lower personal) In 2017, it amended the Banking ings under the IBC. As such the NPAs are created.
(PSRZHULQJZRPHQWREHKDUELQJHURIFOLPDWHFKDQJH
:XGOTOTMULX[XGR]USKTGYKTZXKVXKTK[XYGTJOSVGXZOTMZNKS]OZNZNKQTU]RKJMKZUGJGVZZUGINGTMOTMKT\OXUTSKTZOYIX[IOGRLUXIROSGZKGIZOUT
ith floods, cyclones tions on the critical role com- gramme, aided by multi-sec- “Empowering and creating the objective of promoting homes and communities more induction cook stoves, and bio