Professional Documents
Culture Documents
a) full authority
b) 50% authority
# c) 10% authority
# a) before stall
b) after stall
c) at stall
# a) Hydraulic actuator
b) Air pistons
c) Electrical motors
335. The purpose of a force trim release system in an helicopter is to permit the
# a) pilot to move the cyclic stick to obtain desired new attitude without having to
maintain the opposing forces of the artificial feel system forces
# c) the generator voltages are nearly equal before they are paralleled
Page 38 - Mod 13
a) in the aircraft
a) 70 degrees
# b) 110 degrees
c) 180 degrees
a) a and b
b) c and d
# c) e and f
b) it is important that they are in phase, and can be brought on in either ABC or CBA
# a) after an auto trim, the elevator is moved to align with the stabiliser
b) after a mach trim, the stabiliser is moved to align with the elevator
c) after an auto trim, the stabiliser is moved to align with the elevator
Page 39 - Mod 13
345. An open circuit in the temperature bulb as used in the DC ratiometer would
cause
347. with a constant torque applied to a gyroscope, the rate of precession will
348. A gyroscope with a vertical spin axis has the roll torque motor located about
the gyroscope's
a) lateral axis
# b) longitudinal axis
c) vertical axis
a) HF band
# b) UHF band
c) VHF band
350. The loss of the vertical gyro signal to a flight director system would cause
a) aircraft to underbank
b) aircraft to overbank
351. In a flight director system the radio signal outputs from the navigation receiver
are
# a) DC
b) AC
c) pulsed DC
b) capacitance bridge
c) inductance decade
a) engine parameters
Page 40 - Mod 13
355. An auto land system displays Land 2 another failure will make the system
a) operational
b) passive
# c) simplex
a) FM Modulated
# b) AM Modulated
359. On aircraft an auto land during auto flare the auto throttle will
b) reverse thrust
c) control throttle for a IAS
360. If an FM signal modulated by an audio signal the frequency of the audio would
relate to the
a) amplitude
b) frequency
b) at 90o to the C of G
Page 41 - Mod 13
a) vertically
b) horizontally
a) pilot
# c) manufacture
368. After a change in collective pitch the Rotor rpm will rise and fall. This is called
# a) transient droop
b) static droop
c) under swing
a) 16 KHz
b) 20 Mhz
# c) 100 Khz
Page 42 - Mod 13
372. After a change in pitch of a rotor blade the blade will be at maximum flap at
# a) 90o
b) 180o
c) 0o
# b) JAR (OPS) M
c) BCAR A4-8
376. The aircraft is due north of a VOR station on a heading of 90o What is a RMI
display?
a) 90o
b) 0o
# c) 180o
377. The flight director is on a localizer when the radio deviation signal is lost the
aircraft would
a) Auto throttle disengages at 2000 ft/min rate and wings will level
Page 43 - Mod 13
381. The controlling signal in pitch channel in the Flare mode are
b) disconnect autothrottle
# a) after flare
b) before flare
c) at alert height
a) average
b) removed
c) added
a) voting
# b) signal comparison
c) signal summing
Page 44 - Mod 13
a) AC
b) DC
# a) positive if easterly
b) negative if easterly
c) negative if northerly
Page 45 - Mod 13
c) If P2 is before P1
# a) radio altitude for height hold and barometric altitude for altitude hold
b) barometric altitude for height hold and radio altitude for altitude hold
401. On an ILS approach what will cause the aircraft to fly onto the beam?
a) Height Deviation
b) Radio deviation
# c) Course deviation
402. What of the following modes does a autopilot go through in correct sequence?
403. When can other autopilot modes can be select once Go-Around has been
selected?
404. Once the G/S has been captured what other pitch modes are available?
405. If a helicopter rotor disc is rotating anticlockwise, view from above where
would a pitch input be fed into the disc to move the helicopter backwards, 90
degrees to what?
Page 46 - Mod 13
# a) Provide a structure for mounting the stabiliser and anti torque rotor
408. How long is the time between the start of the P1 pulse and the P3 pulse
ignoring the P2 pulse length?
# a) 21 micro seconds
b) 8 micro seconds
c) 17 micro seconds
410. A radar response takes 329 micro seconds. How far away is the target?
a) 12 miles
# b) 25 miles
c) 40 miles
# a) 50 ohms
b) 20 ohms
415. for a Vertical Gyro which is moved in pitch, which gimble would be moved to
correct the pitch movement?
a) Lateral
b) Longitudinal
c) Normal
Page 47 - Mod 13
# a) Pitch
b) Roll
c) Yaw
# a) Visual inspections
b) Insulation testing
419. an RMI in VOR mode, it's pointer is showing a course of 000. If the course
knob is adjusted to 010 what happens to the pointer?
a) Move left
b) Move right
420. An aircraft flying on a heading of 030 receives an ADF signal 030 relative to
the aircraft, what is the ADF pointer indicating?
a) 030
b) 060
c) 090
a) 12,000ft
b) 5,000ft
# c) 18,000ft
422. If an aircraft is entering a turn to the left, what input would the aileron to
rudder crossfeed be?
# a) Left Rudder
b) Right Rudder
c) No Rudder
423. If a control surface that is fitted with a balance tab is moved, what will happen
to the tab?
Page 48 - Mod 13
# a) Stick Shaker
b) Stick Nudger
c) EICAS warning
a) nose up
c) nose down
427. On a coupled approach what happens to the aircraft if it looses the localiser
signal?
# a) It will fly straight down the original course but will drift
429. What colour are the autoland indication lights next to the pilots instruments
with excess deviation?
a) Red
b) Amber
c) White
# a) FM
b) Pulse
c) FM and Pulse
431. What happens to the F/D command bars if the roll gyro fails in a turn?
a) They stay in the same place as nothing is there to null the input signal
# a) Normal
b) Longitudinal
c) Lateral
Page 49 - Mod 13
a) stabiliser
# b) elevator
c) spoilers
# a) To dump lift
436. If the aircraft is to be rolled to the right where does the pilot feed in this
command?
# a) Control Wheel
b) Control Column
c) Rudder Pedals
# a) 3000 psi
b) 1000 psi
c) 300 psi
438. If a bonding lead is found to be broken and a spare is unavailable you must
# a) replace with a self manufactured cable of the same type but larger
a) 0.5
# b) 1 ohm
# a) Drag Strut
b) Drag Wire
c) Shock Absorber
Page 50 - Mod 13
# a) Increasing in lift
c) Increasing in drag
443. In a series actuator fitted to a helicopter how much authority does it have?
# a) 10% approximately
b) 100%
c) 50%
a) Polarity sensitive AC
# b) Polarity sensitive DC
c) Either
447. On an aircraft fitted with a CMC how do you get to the system pages?
a) 62
# b) 42
c) 20
Page 51 - Mod 13
a) Disturbances
b) Velocity
# c) Pressure changes
453. with a control surface tab in the neutral position, what happens when the
control surface is moved?
454. What should be carried out prior to working on or near control surfaces?
455. Instantaneous Vertical Speed Indicator has instant values of Vertical Speed by
457. What would indicate the state of charge of a lead acid battery?
b) decrease in lift
c) decrease in speed
a) Bell sound
# b) Clacking sound
c) Horn sound
Page 52 - Mod 13
461. ADF is
a) Rho
b) Theta
c) Rho-Theta
# b) absolute pressure
c) horizontal axis
a) 2.3 - 23 Mhz
b) 2 - 6 GHz
# c) 100 KHz
466. What would happen to an aircraft at low speed at high angle of attack had an
aileron going down?
468. What is the major vertical component of an airframe that is a load bearing part
of the structure that can be used as walls or partial walls?
a) Frame
b) Bulkhead
c) Stringer
Page 53 - Mod 13
a) 100
b) 50
c) 20
472. after a roll to the left of a statically unstable helicopter, the helicopter would
a) Spoiler to aileron
b) Spoiler to flap
c) Spoiler to elevator
# a) underswing
b) overswing
c) a hole in one
476. If a QFE is set at an airfield and flown to another airfield at the same level
above sea level then
Page 54 - Mod 13
479. How is the output of a constant speed drive fed AC generator controlled?
c) By a swashplate
c) The rotor goes the opposite direction to the normal direction of rotation
# a) semi rigid
b) rigid
c) fully articulating
483. A thermocouple
b) cannot be shortened
c) can be shortened
485. When installing an aerial ,added support is needed for the structure. This is
achieved by
a) webs
b) outer plate
c) inner plate
486. What is the difference between transmit and receive pulse frequency?
a) 60
b) 63
c) 1000
Page 55 - Mod 13
488. TCAS II is
a) servomotor
b) loop voltage
c) Chinaman
a) A/P actuator
a) certain parameters
b) at higher speeds
495. What should be taken into account when measuring the SG of a battery?
b) Electrolyte temperature
Page 56 - Mod 13
496. What happens when a control stick is pulled back and to the left?
a) Outer gimbal
b) Gyro case
c) Instrument case
c) ground service
a) 1 capsule
# b) 2 capsules
c) 3 capsules
500. If an elevator is fitted with a fixed tab in the down position, the control surface
will
a) move up
b) move down
c) cannot be adjusted
502. Rising gust in front of the leading edge with flaps lowered, AoA will
a) increase
b) decrease
c) remain
a) normal axis
b) lateral axis
# c) longitudinal axis
a) 50 %
# b) 20 %
c) 10 %
Page 57 - Mod 13
505. After a roll to the left of a statically stable helicopter , the helicopter would
a) continue to roll
b) increases roll
506. What instrument uses ram air pressure and atmospheric pressure?
a) ASI
b) Machmeter
c) VSI
a) decrease
# b) increase
509. How does a delta wing aircraft move about the pitch and roll axis?
a) Elevator s
# b) Elevons
c) Ailerons
510. If a roll was commenced, what command would the versine generator give?
# a) Up Elevator
b) Left rudder
c) Down elevator
511. What effect does lowering the flaps for takeoff have?
a) Heading error
b) Course error
c) Radio deviation
Page 58 - Mod 13
a) Maximum deflection
# b) Frequency of deflections
c) Direction of flexing
515. On a Ground Power unit which pins are allocated for interlock circuit?
a) A and B
b) B and C
c) E and F
a) Bellows or diaphragm
# a) Coefficient B
b) Coefficient A
c) Coefficient C
518. If the torque were increased on a vertical gyro, what would happen to the
precession?
a) Increase
b) Remain unaffected
c) Decrease
c) 32 KHz - 64 KHz
a) Roll out
# b) Flare
c) Touchdown
a) DME Freq
b) LNAV
# c) CRZ
Page 59 - Mod 13
a) 21microseconds
b) 12 microseconds
c) 8 microseconds
524. Which would you use to test an aircraft transponder altitude reporting system?
a) climb
b) descent
c) roll
a) AC generators
b) AC and DC Generators
c) DC generators
528. Aircraft normally fitted with 2 central maintenance computers and you only
have one to dispatch the aircraft.
a) LH side
b) RH side
529. If the localiser signal is only applied to the A/P roll channel
a) IDG
b) CSD
c) swash plate
Page 60 - Mod 13
532. Flight director on VOR, course error wash out signal is lost, following the FD
commands. Aircraft will
a) to increase GS signal
b) to decrease GS signal
c) to maintain GS signal
a) a synchro
b) an RVDT
c) an LVDT
536. VHF transmitter output impedance to match with antenna for maximum
power transfer is
a) 50 ohms
b) 25 to 75 ohms
c) 129 ohms
540. DME - how does receiver find the received pulse pairs are valid?
a) Decoder
b) Blocking oscillator
c) Integrator
Page 61 - Mod 13
a) 80 ohms
b) 200 ohms
a) ADI
546. In a large transport aircraft to check VSWR of a HF system with a long aerial
feeder the VSWR meter has to be connected
547. With power applied to the autopilot but not engaged, the trim indicator will
indicate
b) 100%
c) chosen as a compromise
Page 62 - Mod 13
a) +/- 30
b) +/- 42
c) +/- 62
551. Aircraft is north of VOR beacon, course is set to 90 degrees, RMI indicates
a) 90
# b) 180
c) 0
c) flaps extended
553. An aircraft receives a response from a DME station, 1236 microseconds after
transmitting the interrogation. What is the slant range to the station?
# a) 96 nautical miles
554. If the VOR track error is 2 dots, how many degrees off track is the aircraft?
# a) 10
b) 5
c) 2.5
555. What frequency range does ACARS operate in?
a) 2-30 MHz
# b) 118-136 MHz
c) 4-5 GHz
# c) No sidebands present
Page 63 - Mod 13
564. A radar antenna is facing left. On ground test, if you move the vertical gyro to
simulate a right bank, the antenna
a) will move up
Page 64 - Mod 13
566. When more than one D.R. compass is fitted on an aircraft or where a D.R.
compass serves as a standby to a remote reading compass
a) only the master compass readings and adjustments carried out and remaining
compasses are adjusted with master compass
# b) all readings and adjustments for each compass should be made simultaneously
on each heading
c) all readings and adjustments for each compass should be made at any one
heading only
567. Compass error remaining after all the corrections, which is used for entry on
the deviation card should not exceed
a) 2 degrees
# b) 3 degrees
c) 5 degrees
568. Compass error remaining after all corrections are made is called
a) apparent error
# b) residual error
c) index error
569. Instruments used on an aircraft are in some instances fitted with cover glasses
whose surfaces are bloomed to reduce
a) Parallax error
# b) Surface reflection
a) roll
# b) pitch
c) yaw
571. Stick shaker activates at a speed which is above the stalling speed by
a) 4%
# b) 7%
c) 10.321%
572. A D.R. compass fitted on an aircraft. The safe distance for electrical cables
carrying electrical current is
a) 20 inches
# b) 24 inches
c) 28 inches
573. The pitot head is fitted on the aircraft. The alignment of pitot head is carried
out with
a) an inclinometer
b) micrometer
c) spirit level
Page 65 - Mod 13
# a) Tachogenerator
a) down
b) neutral
c) droop
a) range resolution
b) range accuracy
# c) bearing resolution
577. A transformer has a power input of 115V AC. What is the output voltage?
a) 115V
b) 345V
# c) 460V
578. The manufacturer of a pitot head gave a specification indicating 2 inches dia.
This is the
Page 66 - Mod 13
583. Dutch Roll affects
584. A radar antenna is facing left. On ground test, if you move the vertical gyro to
simulate a right bank, the antenna
a) will move up
a) Only the master compass reading and adjustment carried out and remaining
compasses are adjusted with master compass.
c) All reading and adjustment for each compass should be made at any one heading
only.
587. Compass error remaining after all the corrections, which is used for entry on
the deviation card should not exceed
a) 2 Degree
# b) 3 Degree
c) 5 Degree
588. Compass error remaining after all corrections are made is called
a) apparent error
# b) residual error
c) index error
589. Instruments used on an aircraft are in some instances fitted with cover glasses
whose surfaces are bloomed to reduce
a) parallax error.
# b) surface reflection.
a) roll
# b) pitch
c) yaw
Page 67 - Mod 13
a) decreases frequency
b) IDG
c) restriction valve
b) short circuits
596. When resetting the CSD on the ground, the engine should be
# a) stationary
b) rotating at idle
c) rotating at Nsync
599. If voltage and frequency of the generator drop to zero in flight, it would be an
indication that the
Page 68 - Mod 13
600. Assuming all systems are operating normally, as aircraft electrical load
increases, generator output voltage will
a) parallel
b) series
a) Ground or earth
a) 71 degrees F
# b) 144 Degrees F
c) 144 Degrees C
# a) constant voltage
b) constant current
a) Chapter 24 Section 21
# b) Chapter 24 Section 31
c) Chapter 31 Section 21
a) in series with the field and changes resistance with changing length
# b) in series with the field and changes resistance with surface area contact
c) in parallel with the field and changes resistance with changing length
Page 69 - Mod 13
# a) stationary
b) fluctuating
a) voltage coil
b) current coil
b) increases drag
c) increases lift
# a) yaws the aircraft left and possibly the right wing will rise
b) yaws the aircraft left and possibly the left wing will rise
a) Elevators
b) Ailerons
# c) Elevons
# a) an internal doubler
b) external doubler
c) an intercostals
Page 1 - Mod 13
a) 13th orbit
b) 9th orbit
c) 2nd orbit
a) DC bus
b) AC bus
# c) GND services
14. Aircraft is North of VOR beacon on a course of 090 RMI pointer points to
a) 0
b) 090
# c) 180
a) Peak power
b) Pulsed power
c) Average power
16. What frequency increases radar relative range
a) Long
# b) Short
# c) no effect
a) 80 ohm
b) 160 ohm
c) 0 ohm
Page 2 - Mod 13
19. Adding 6 foot of cable to TX RX aerials on rad alt would give you
# a) 3 ft error
b) 6ft error
c) 12 foot error
a) widest width
# b) narrowest width
# a) Left
b) Right
c) In-between legs
# a) Increases lift
b) No effect
c) Increases thrust
b) Swashplate
c) Scissor levers
# a) Weight of blade
c) Fineness ratio
a) Increase
# b) Decrease
c) No effect
a) 8
# b) 4
c) 6 90o apart
Page 3 - Mod 13
28. If on a lead-acid battery, several cell checks of SG read consistently low. Battery
needs
b) replacing
# c) recharging
b) No effect
a) 20 degrees
b) 15 degrees
c) 10 degrees
a) the automatic pilot will automatically disengage whenever any failure is detected
b) the automatic pilot will automatically cause the aircraft to overshoot if any
failure is detected
# c) the aircraft will continue its automatic landing in the event of a single failure
a) QDH
# b) QDM
c) QDR
# b) radio altimeters
c) vertical accelerometers
34. the aircraft decrabbing signal, used during autoland, originates from
a) roll errors
# c) heading errors
c) at any time
Page 4 - Mod 13
37. The wheel height at which the approach path has been visually assessed as
satisfactory to continue the approach to a landing is known as the
# a) decision height
b) intercept height
c) alert height
a) operation down to and along the surface of the runway without external
reference
# c) operation down to and along the surface of the runway with RVR of 200 meters
# b) no decision height
42. in a triplex system, the detection of a failure of one simplex system will
disconnect
a) all channels
44. With autothrottle selected in the SPEED MODE compatible autopilot modes are
Page 5 - Mod 13
autoland
48. On the approach the autopilot loses the LOC signal; the aircraft would
a) fly a circle
49. The Airworthiness requirements for the autopilot / autoland system are laid
down in
# a) JAR AWO
b) CAIPs
c) BCARs
a) a predetermined level of the course error signal away from the selected radial
# b) is computed from the vectorial summation of the course error and radio
deviation signals
c) a predetermined level of the VOR deviation signal away from the selected radial
Page 6 - Mod 13
# b) that the autopilot control circuits are at zero demand conditions engagement
c) that the aircraft will always be returned to straight and level flight when the
autopilot is engaged
55. In the FMS vertical navigation (V NAV) climb mode the throttles are used for
b) the gain remains the same but signals are phase advanced
Page 7 - Mod 13
b) 25 ohms
# c) 50 ohms
63. To improve the image or picture when using the WRX (weather radar receiver)
65. Where does it state what emergency equipment and what levels of emergency
equipment should be carried on an aircraft
b) JAR OPS
c) Maintenance Manual
66. If a section of the emergency floor proximity lights are inoperative
a) the aircraft cannot fly i.e. grounded until the defect is fixed
b) the aircraft can fly but the section with the problem is not used/ shut off
# c) the aircraft is allowed to fly back to base where the defect can be fixed
67. The tail nav light. What angle of divergence should it have?
a) 180 degrees
b) 120 degrees
# c) 140 degrees
68. When changing the brushes on a DC generator the brushes must be bedded first,
this can be done
b) the generator taken off the aircraft and bedding done on the bench
69. What must be taken into account when measuring the SG or relative density of a
lead acid battery?
# a) The temperature
Page 8 - Mod 13
# b) bonding strips
b) only the end cell as all the others will be the same
74. In a RVSM system what is the tolerance level of separation i.e.. + or - feet
a) 400ft
b) 160ft
c) 80ft
75. in a fly by wire system, pitch and roll control positions are known by using
a) LVDTs for roll control surfaces and RVDTs for pitch control surfaces
76. in a CMC aircraft, flight deck indications and warnings are managed and
provided by
a) Volatile
# b) Non-volatile
c) Hard
Page 9 - Mod 13
79. An aircraft in climb maintains the same IAS. What is it's true airspeed?
b) With either the Flight Director or the Digital Control System (DFCS) engaged
85. The wheel height at which the approach path has been visually assessed as
satisfactory to continue the approach to a landing is know as the
# a) decision height
b) intercept height
c) alert height
a) operation down to and along the surface of the runway without external
reference
# c) operation down to and along the surface of the runway with RVR of 200m
Page 10 - Mod 13
# b) 60 m
c) 0 m
c) where the aeroplanes first receives both the localiser and glide path signals
89. The average risk of autoland should not contribute a rate of fatal accidents per
landing greater than
a) 1 x 10-6
# b) 1 x 10-7
c) 1 x 10-8
a) mandatory
a) automatically
a) 300 ft
95. The following modes may be retained when overshoot has been initiated after
the selection of autoland
Page 11 - Mod 13
96. If go-around has been initiated after autoland has been selected, the aeroplane
will
a) increase speed
b) rotate nose up
a) alone
98. If during autoland the LOC signal is lost at 400 ft in final approach
b) autoland is continued
# c) go-around is initiated
a) the automatic pilot will automatically disengage whenever any failure is detected
b) the automatic pilot will automatically cause the aircraft to overshoot if any
failure is detected
c) the aircraft will continue its automatic landing in the event of signal failure
# b) radio altimeters
c) vertical accelerometers
a) fail passive
# b) fail operational
c) fail redundant
Page 12 - Mod 13
a) at D.H.
# b) before D.H.
c) after D.H.
# a) radio altimeter
# b) fail operational
c) fail redundant
a) simplex system
# b) duplex system
c) dual-dual system
a) Decision height
# b) Radio altimeter
c) Glideslope signal
Page 13 - Mod 13
c) approach land and runway guidance with taxing visibility in the order of 50
meters
c) No signal
a) Ailerons
b) Throttles
a) distance to go
119. for a vertical Gyro which is moved in pitch, which gimble would be moved to
correct the pitch movement?
a) Lateral
# b) Longitudinal
c) Normal
# a) Pitch
b) Roll
c) Yaw
121. With airspeed hold engaged whilst flying with Flight Director engaged, a down
command means your speed has
a) increased
# b) decreased
c) is the same
Page 14 - Mod 13
# a) 50 milliohms
b) 1 ohms
c) 1M - 100,000 ohms
b) bedding of brushes
# a) Visual inspections
b) Insulation testing
127. What should be done to a transformer secondary connections which are open
circuit?
128. an RMI in VOR mode, it's Pointer is showing a course of 000, if the course knob
is adjusted to 010 what happens to the pointer?
a) Move left
b) Move right
129. If a fault is detected during an autoland approach the system will totally
disconnect if it is a
a) Triplex system
b) Duplex system
# c) Simplex system
130. A Glass Reinforced Plastic surface on an aircraft, to reduce the risk of high
potential differences would be
# a) 50 ohms
b) 20 ohms
Page 15 - Mod 13
a) On the wing
134. With a trailing edge flap being lowered, due to rising gusts what will happen to
the angle of attack?
# a) Tend to increase
b) Tend to decrease
137. The Ground Proximity Warning Computer in mode 4 would use which inputs to
issue a warning?
c) Crew retraining
140. If a drain trap in a pitot static system is removed but nothing was found
Page 16 - Mod 13
c) 1090 MHz
142. When an aircraft is aligned for a compass swing check to be carried out it will
be aligned with an error of plus or minus
a) 1 degree
# b) 3 degree
c) 5 degree
a) 000
# b) 045
c) 090
a) DC generators
# b) AC generators
c) AC & DC generators
# a) spoiler
a) 10 degree
b) 110 degree
# c) 50 degree
148. when a helicopter lands how does the pilot signal to the ground staff that it is
safe to approach the aircraft?
# a) 1500 ft
b) 2500 ft
c) 3500 ft
Page 17 - Mod 13
# c) both a & b
a) green colour
# b) amber
c) red colour
a) 131.55
# b) 121.5
c) 118.00
a) CAAIPs
b) Maintenance Manual
# c) JAR OPS
Page 18 - Mod 13
159. When an aircraft is at a height of 9500ft and the QNH is 500 ft what is the
distance that VHF Com cover?
a) 100 nm
# b) 120 nm
c) 140 nm
160. When the VOR ref and Vari phase are in phase quadrature, the aircraft is at the
# a) an accelerometer
b) a gyroscope
c) a tachogenerator
a) phons
b) decibels
# c) relative amplitude
c) cannot be adjusted
a) terrain closure
b) rate of ascent
# c) rate of descent
a) 12
b) 24
c) 36
167. The applied pressure to an ASI varies with the
Page 19 - Mod 13
# a) capsule elasticity
b) capsule shape
169. The loss of the vertical gyro signal to the flight director system would cause
a) aircraft to underbank
# b) aircraft to overbank
b) disconnect autothrottle
c)
173. As the rotor head is tilted to travel forward what happens to the reward
travelling blades pitch angle?
# a) Increases
b) Decreases
c) No change
c)
a) 115v ac
b) 200v ac
176. When all three leads of a bonding tester are connected together the output
reading is
# a) zero
c) centre scale
Page 20 - Mod 13
# b) increase capacitance
c) decrease capacitance
c) cannot be adjusted
# a) bulkheads
b) longerons
c) frame
a) This is normal
b) You would change the Tx as the datum is shifted
182. To ensure the compass is serviceable before installation you would carry out
183. The specific gravity readings of a lead-acid cell taken twice after charging
shows substantially lower value.
a) Cell is defective
b) TCAs only
Page 21 - Mod 13
a) 6 satellites in 4 orbits
b) 4 satellites in 6 orbits
c) 7 satellites in 3 orbits
189. A manual trim wheel, when fully moved in the direction of tail
a) the elevator causes tail down movement i.e. increases tail plane down force
Page 22 - Mod 13
a) Door
# b) Left wing
c) Right wing
a) flapping
b) dragging
# c) centrifugal force
206. to transmit position feedback for actuators of roll and pitch control surfaces,
in a fly by wire system
# b) K value of fuel
c) fuel quantity
208. What is the error signal used for in a fixed angle approach in LOC
coupling?entrifugal force
# a) BPCU
c) SPCU
b) lift is reduced
c) thrust is reduced
211. Range resolution is obtained by
a) High PRF
c) Larger frequency
Page 24 - Mod 13
# c) CP move rearward
a) 12 address bits
# b) 24 address bits
c) 36 address bits
217. If an aircraft is on east of VOR beacon, the reference and variable phases are
a) In phase
b) Opposite phase
# c) Phase quadrature
a) 80 ft
b) 300 ft
c) 500 ft
219. In a radio altimeter system if you decide to increase the TX cable and RX cable
each by 3 inch the total correction factor is
a) 3 inch
b) 6 inch
# c) 9 inch
221. for bonding, the two ends of a rubber pipe are joined by
Page 25 - Mod 13
222. What is the minimum resistance between all isolated electrostatic conducting
parts which may be subjected to appreciable charge and main earth system
a) 0.5 ohm
b) 1 ohm
# a) longitudinal stability
b) lateral stability
c) vertical stability
224. In case the airplane is wired for dual installation of the Central Maintenance
Computers and only one computer is to be installed
c)
226. If the static line is disconnected in the cabin, the Mach meter reading would be
c) not effected
228. While carrying out a leak check of the altimeter, if the static is leaking, the VSI
would
a) indicate climb
# b) indicate decent
c) not be affected
229. In a combined pitot-static probe, while carrying out a leak check, which
instrument is most likely to be effected by over pressure?
a) ASI
b) VSI
c) Altimeter
Page 26 - Mod 13
a) is to rotate clockwise
b) is to rotate anticlockwise
232. during compass swing, using a datum compass, the error permitted in aligning
the aircraft is
a) 1 degree
b) 5 degree
c) 10 degree
233. If two aircraft decide to issue the same RA for a potential conflict, which
aircraft changes the decision?
# a) 10%
b) 50%
c) 100%
235. in helicopter autopilots, while operating the actuator, the movement of the
cockpit control is prevented by
a) highly cambered
b) reverse cambered
# c) Symmetrical
a) vertically polarized
b) horizontally polarized
c) lincomp polarization
a) to the left
b) to the right
# c) in the centre
Page 27 - Mod 13
# a) Split flap
b) Fowler flap
c) Plain flap
a) transmit motion
c) adjust friction
242. in an FDS, the attitude gyro is coupled with the FD computer by means of
transformer coupling. The purpose of this arrangement is
243. DH is based on
a) aircraft characteristics
244. In a horizontal gyro the random precession of the inner ring is corrected by
a) coefficient B
b) Coefficient P
a) rigid rotor
Page 28 - Mod 13
b) no signal
c) excess signals
251. When the bank angle limit is applied to the autopilot , it means
# a) transmit pulses of CW
c) series of CW
256. During testing of ATC altitude function the pressure altimeter is set
a) 1013.25 mb
c) prevailing pressure
Page 29 - Mod 13
257. When secondary stops are utilized in control surfaces, they come in contact
# a) positive if easterly
b) negative if easterly
c) negative if northerly
c) If P2 is before P1
c)
# a) radio altitude for height hold and barometric altitude for altitude hold
b) barometric altitude for height hold and radio altitude for altitude hold
265. On an ILS approach what will cause the aircraft to fly onto the beam?
a) Radio deviation
b) Glideslope deviation
# c) Course deviation
Page 30 - Mod 13
266. Which of the following modes does a autopilot go through in correct sequence?
267. When can other autopilot modes be select once Go Around has been selected?
268. Once the G/S has been captured what other pitch modes are available?
a) To prevent corrosion
a) Increase in airspeed
b) Increase in altitude
c) Decrease in altitude
273. If you carry out a VSWR check of a SSB HF system what should you do with the
control switch? Select it to
a) OFF
b) AM
Page 31 - Mod 13
274. How long is the time between the start of the P1 pulse and the P3 pulse ignoring
the P2 pulse length?
a) 21 micro seconds
b) 8 micro seconds
c) 17 micro seconds
275. If a VOR RMI indicates 000 degrees and the course selected is 000 degrees
what will the TO/FROM indicator indicate?
a) TO
b) FROM
# c) Neither
277. A radar response takes 329 micro seconds how far away is the target?
a) 12 miles
b) 25 miles
c) 40 miles
b) Control wheel
a) of any interrogation
c) is insignificant
a) 16ft
b) 12ft
# c) 28ft
Page 32 - Mod 13
b) 64bits
# c) 24bits
a) blade alignment
a) balance
b) restore
# c) align
a) hydraulic damper
c) 'feel' generator
a) the altimeter
a) power requirements
Page 33 - Mod 13
# a) 24 satellites, 6 orbits of 4
b) 24 satellites, 4 orbits of 6
c) 27 satellites, 3 orbits of 9
a) 1575 GHz
# b) 1575 MHz
c) 1525 MHz
# a) systems is disabled
a) F1,F2,F4,F5
# b) s1,p1,p3,p4
c) s1,s2,p1,p2
299. Fluorescent tubes for the cabin lighting are powered from
b) highest blade
Page 34 - Mod 13
301. in air speed hold mode, a down displacement of the flight director pitch
command bar signifies
a) speed increase
# b) speed decrease
c) height decrease
a) the long lead is attached to the aircraft air frame and short lead to item
b) the short lead to the aircraft airframe and long lead to the item
a) higher
b) lower
# c) higher or lower
a) 110 nm
# b) 120 nm
c) 130 nm
c) P code only
Page 35 - Mod 13
# a) control column
a) apparent A
b) real A
c) true A
a) BCARs
c) maintenance manual
# a) DC supply
b) AC supply
c) no supply
a) FM
c) Manchester code
a) flight can continue with serviceable FDR provided they are not combined
a) +/- 35 degrees
# b) +/-40 degrees
c) +/-60 degrees
Page 36 - Mod 13
319. The bearing of a NDB measured by ADF is 060 degrees relative to aircraft
heading of 030 degrees. The RMI pointer indicates
a) 30 degrees
b) 90 degrees
c) 60 degrees
320. Fibre glass parts are protected from lightning strikes and dangerous voltages
by
b) conductive paint
a) the y code
b) the p code
323. The respective band widths for a radar IF amplifier and video amplifier should
be for good pulse shape are
a) pitot only
b) static only
326. When the aircraft nose yaws to the left, the yaw damper will apply corrective
rudder to
# a) the right
b) the left
b) attitude of aircraft
# c) rate of yaw
Page 37 - Mod 13
# a) DC polarity sensitive
b) AC phase sensitive
HF IS 3 30 MHZ
1 NM = 12.36 MICROSECONDS
HF CABLE IMPEDENCE IS 50
ADF IS THETA
MODE A P1 TO P3 = 8 MICROSECONDS
MODE C P1 TO P3 = 21 MICROSECONDS
AN A/C FLYING ON A HEADING OF 030 RECEIVES AN ADF
SIGNAL 030 RELATIVE TO A/C. THE POINTER INDICATES 060
IMPEDENCE OF A HF ARIEL IS 50
EFIS DISPLAY, SG1 & SG2 ARE FOR CAPTAIN & FO DISPLAYS.
PURPOSE OF SG3 IS BACKUP FOR SG1 & SG2
http://www.aircrafttechtrng.com
Module 13 Exam Practice Exam
Module 13
Aircraft Aerodynamics, Structures and Systems
7. The wheel height at which the approach path has been visually
assessed as satisfactory to continue the approach to a landing is known as
the
a) decision height
b)intercept height
c) alert height
Answer:A
1. Versine is generated by
a) torque receiver synchros
b)synchros resolvers
c) control synchro transformers
Answer:B
2. Automatic trim is used to
a) maintain level flight
b)prevents standing loads on the elevator
c) allow full authority to be regained by the aileron
Answer:A
5. In the FMS vertical navigation (V NAV) climb mode the throttles are
used for
a) maintaining a computed EPR
b)controlling to a maximum thrust
c) correction minor speed deviations
Answer:A
Answer:
3. To improve the image or picture when using the WRX (weather radar
receiver)
a) scan at a lower rate
b)use shorter bursts
c) use longer bursts
Answer:B
5. The wheel height at which the approach path has been visually
assessed as satisfactory to continue the approach to a landing is know as
the
a) decision height
b)intercept height
c) alert height
Answer:A
6. If go-around has been initiated after autoland has been selected, the
aeroplane will
a) increase speed
b)rotate nose up
c) increase speed and rotate nose up
Answer:C
5. On touchdown, autopilot
a) remains engaged ready for G/A
b)drives the throttles forward
c) disconnects after a short time
4. CAT-3b allows
a) approach land and runway guidance with zero DH and RVR
b)approach land and RVR in the order of 50 meters
c) approach land and runway guidance with taxing visibility in the
order of 50 meters
.
4. With a trailing edge flap being lowered, due to rising gusts what
will happen to the angle of attack?
a) Tend to increase
b)Tend to decrease
c) Stay the same
10. If a drain trap in a pitot static system is removed but nothing was
found
a) no leak test is required unless the drain trap contains water
b)a leak test must be carried out even if nothing found
c) a leak test is never required
8. when a helicopter lands how does the pilot signal to the ground staff
that it is safe to approach the aircraft?
a) Turning on and off the NAV lights
b)Turning off the anti-collision lights
c) Flashing the landing light
10. When the VOR ref and Vari phase are in phase quadrature , the
aircraft is at the
a) 180 degree radial
b)090 degree radial
c) 275 degree radial
9. The loss of the vertical gyro signal to the flight director system
would cause
a) aircraft to underbank
b)aircraft to overbank
c) aircraft to remain in level flight
6. When all three leads of a bonding tester are connected together the
output reading is
a) zero
b)full scale deflection
c) centre scale
b)increase capacitance
c) decrease capacitance
a) the elevator causes tail down movement i.e. increases tail plane
down force
b)there is an increases tail plane up-force
c) there is an increased tailplane down-force
5. Equivalent airspeed is
a) indicated airspeed corrected for IE and PE
b)rectified airspeed corrected for compressibility
c) calibrated airspeed corrected for compressibility
forceentrifugal force
10. As you approach supersonic speedentrifugal forceentrifugal
forceentrifugal force
a) total drag is increasedentrifugal forceentrifugal forceentrifugal
forceentrifugal force
b)lift is reducedentrifugal forceentrifugal forceentrifugal
forceentrifugal force
c) thrust is reducedentrifugal forceentrifugal forceentrifugal
forceentrifugal force
1.
Rangeiresolutioniisiobtainedibydggfgggdfgdfykmgmnlm;34343fhg87hmb
lhl;.jkn.m,/,.<<m,/.
a) highiPRFdggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.<<m,/.
b)shorteripulseiwidthdggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/
,.<<m,/.
c)
shorteribeamiwidthdggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.
<<m,/.
dggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.<<m,/.dggfgggdfgd
fykmgmnlm;34343fhg8
2.
Iniweatheriradar,ishortirangeitargetsiareimissedibyfykmgmnlm;34343fhg8
7hmblhm,/,.<<m,/.
a)
largeripulseiwidthdggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.<
<m,/.
b)largeribeamiwidthdggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,
.<<m,/.
c)
largerifrequencydggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.<<
m,/.
dggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.<<m,/.dggfgggdfgd
fykmgmnlm;34343fhg87hmb
3.
Whenitheitrailingiedgeiflapiisiextendeddggfgggdfgdfykmgmnlm;34343fh
g87hmblhl;.
a) theiCPimovesiforwardianditheipitchingimomentichangesitoinoseiupiiii
b)theiCPimovesiforwardibutitheiCGidoesinotichangedggfgggdfgdfykmgm
nlm;
c)
CPimoveirearwarddggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.
<<m,/.
dggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.<<m,/.dggfgggdfgd
fykmgmnlm;34343fhg87h
4.
Duringitakeioffiifianiinputitoiautoithrottleiisifailsdggfgggdfgdfykmgmnlm
;34343fhg87hmb
a) autoithrottleidisengages
b)throttleiholdiisiannunciateddggfgggdfgdfykmgmnlm;34343fhg87hmblhl
;.jkn.m,/,.<<m,/.
c)
faililightiilluminatesdggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,
.<<m,/.
dggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.<<m,/.dggfgggdfgd
fykmgmnlm;34343fhg87hmb
5.
Flightidirectoricommandibarsiindicatedggfgggdfgdfykmgmnlm;34343fhg
87hmblhl;.jkn
a)
directioniiniwhichiaircraftiisitoibeimanoeuvreddggfgggdfgdfykmgmnlm;3
4343fhg87hm
b)directioniiniwhichiaircraftiisiflyingdggfgggdfgdfykmgmnlm;34343fhg8
7hmblhl;.jkn.m,/,.<
c)
directioniiniwhichitheibeaconiisdggfgggdfgdfykmgmnlm;34343fhg87hmb
lhl;.jkn.m,/,.<<m,
dggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.<<m,/.dggfgggdfgd
fykmgmnlm;34343fhg87
6. ModeiSihasdggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,
a) 12iaddressibitsdggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,
b)24iaddressibitsdggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.<<
m,
c)
36iaddressibitsdggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.<
dggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.<<m,/.
dggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.<<m,/.7.
Ifianiaircraftiis on east of VOR beacon, the reference and variable
phases are
a) Iniphasedggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.<<m,/.
b)oppositeiphasedggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.<<
m,/.
c)
phaseiquadraturedggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.<<
m,/.
dggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.<<m,/.
dggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.<<m,/.
8. RVSM, Vertical minimum separation error allowed
isdggfgggdfgdfykmgmnlm;34343fhg
a) 80 ftdggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.<<m,/.
b)300 ftdggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.<<m,/.
c) 500 ftdggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.<<m,/.
dggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.<<m,/.dggfgggdfgd
fykmgmnlm;34343fhg87hm
9. In a radio altimeter system if you decide to increase the TX cable
and RX cable each by 3 inch the total correction factor
isdggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.<<m,/.
a) 3iinchdggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.<<m,/.
b)6iinchdggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.<<m,/.
c) 9iinchdggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.<<m,/.
dggfgggdfgdfykmgmnlm;34343fhg87hmblhl;.jkn.m,/,.<<m,/.dggfgggdfgd
fykmgmnlm;34343fhg87hmbl
10. If you momentarily short the two spikes of bonding tester
a) tester reads zero
b)tester reads full scale
c) tester would be zero centred
2.
Duringicompassiswing,iusingiaidatumicompass,itheierroripermittediiniali
gningitheiaircraftiis
a) 1 degreesadfila afu aaifu laoaoloiuf papsd
b)5 degreesadfila afu aaifu laoaoloiuf papsd
c) 10 degreesadfila afu aaifu laoaoloiuf papsd
3. DH is based on
a) aircraft characteristics
b)experience of the crew
c) RVR transmitted by ATC
5. Index error is
a) coefficient B
b)Coefficient P
c) misalignment of compass lubber line
c) excess signals
2. Servo tabs
a) enable the pilot to bring the control surface back to neutral
b)move in such a way as to help move the control surface
c) provide artificial feel
3. Spring Tabs
a) enable the pilot to bring the control surface back to neutral
b)move in such a way as to help move the control surface
c) provide artificial feel
8. EICAS indicates
a) engine performance and aircraft system malfunctions
b)engine performance only
c) engine performance and aircraft status
5. On an ILS approach what will cause the aircraft to fly onto the beam?
a) Radio deviation
b)Glideslope deviation
c) Course deviation
6. Which of the following modes does a autopilot go through in correct
sequence?
a) Flare, attitude, rollout
b)Attitude, flare, rollout
c) Rollout, attitude, flare
7. When can other autopilot modes be select once Go Around has been
selected?
a) When aircraft has reached 5000ft
b)When reached a desired altitude
c) Disengage and reengage the AFCS system
8. Once the G/S has been captured what other pitch modes are available?
a) No other pitch modes are available
b)Only when the aircraft is above the glideslope beam
c) All are continuously available
Answer
1. 2 3 4 5 6 7 8 9 10
B ? ? B B C B C A C
3. If you carry out a VSWR check of a SSB HF system what should you
do
with the control switch? Select it to
a) OFF
b)AM
c) either USB or LSB
4. How long is the time between the start of the P1 pulse and the P3
pulse ignoring the P2 pulse length?
a) 21 micro seconds
b)8 micro seconds
c) 17 micro seconds
5. If a VOR RMI indicates 000 degrees and the course selected is 000
degrees what will the TO/FROM indicator indicate?
a) TO
b)FROM
c) Neither
7. A radar response takes 309 micro seconds. How far away is the
target?
a) 12 miles
b)25 miles
c) 40 miles
c) 'feel' generator
8. A mode C transponder
a) can be used for TCAS
b)cannot be used for TCAS
c) can be used for TCAS on ILS approach only
2. GPS has
a) 24 satellites, 6 orbits of 4
b)24 satellites, 4 orbits of 6
c) 27 satellites, 3 orbits of 9
4. GPS frequency is
a) 1575 GHz
b)1575 MHz
c) 1525 MHz
10. Fibre glass parts are protected from lightning strikes and dangerous
voltages by
a) non conductive paint
b)conductive paint
c) earth primary conductors
6. When the aircraft nose yaws to the left, the yaw damper will apply
corrective rudder to
a) the right
b)the left
c) the left with some aileron assistance
10. The loss of the vertical gyro signal to a flight director system
would cause
a) aircraft to underbank
b)aircraft to overbank
c) aircraft to remain in level flight
5. An auto land system displays Land 2 another failure will make the
system
a) operational
b)passive
c) simplex
9. On aircraft an auto land during auto flare the auto throttle will
a) retard the throttle
b)reverse thrust
c) control throttle for a IAS
8. After a change in collective pitch the Rotor rpm will rise and fall.
This is called
a) transient droop
b)static droop
c) under swing
9. Loran C Uses
a) 16 Khz
b)20 Mhz
c) 100 Khz
1. On an ILS approach what will cause the aircraft to fly onto the beam?
a) Height Deviation
b)Radio deviation
c) Course deviation
3. When can other autopilot modes can be select once Go-Around has
been
selected?
a) When aircraft has reached 5000ft
b)When reached a desired altitude
c) Disengage and reengage the AFCS system
4. Once the G/S has been captured what other pitch modes are available?
8. How long is the time between the start of the P1 pulse and the P3
pulse ignoring the P2 pulse length?
a) 21 microseconds
b)8 microseconds
c) 17 microseconds
9. What colour are the autoland indication lights next to the pilots
instruments with excess deviation?
a) Red
b)Amber
c) White
1. What happens to the F/D command bars if the roll gyro fails in a
turn?
a) They stay in the same place as nothing is there to null the input
signal
b)They return back to neutral when the turn is complete
c) They disappear out of view
9. What is the minimum size cable, which is not likely to carry all the
current from a primary structure?
a) 0.5inch wide by 26AWG cable
b)0.25inch wide by 26AWG cable
c) No smaller than 18AWG
7. On an aircraft fitted with a CMC how do you get to the system pages?
a) Through the ground test function
b)Through the Existing faults function
c) Through the Present Leg faults function
3. With a control surface tab in the neutral position, what happens when
the control surface is moved?
a) It remains in the neutral position
b)It moves in the same direction as the control surface
c) It moves in the opposite direction as the control surface
Answer
1. 2 3 4 5 6 7 8 9 10
B B A B C B A B A C
1. ADF is
a) Rho
b)Theta
c) Rho-Theta
2. Earths atmosphere is
a) 1/5 oxygen, 4/5 nitrogen
b)4/5 oxygen, 1/5 nitrogen
c) 3/5 oxygen, 2/5 nitrogen
3. A thermocouple
a) capacitance and inductance cannot be added
b)cannot be shortened
c) can be shortened
8. TCAS II is
a) 1 aircraft per square nautical mile
b)24 aircraft per 5 nautical mile radius
c) 100 aircraft per 5 miles square
6. What happens when a control stick is pulled back and to the left?
a) Elevator up, left aileron down
b)Elevator down, right aileron down
c) Elevator up, right aileron down
10. If an elevator is fitted with a fixed tab in the down position, the
1. Spring tabs
a) cannot be adjusted in flight
b)can be adjusted in the flight deck
c) cannot be adjusted
2. Rising gust in front of the leading edge with flaps lowered, AoA
will
a) increase
b)decrease
c) remain
3. If an aircraft moves in roll it is moving about the
a) normal axis
b)lateral axis
c) longitudinal axis
9. How does a delta wing aircraft move about the pitch and roll axis?
a) Elevator s
b)Elevons
c) Ailerons
10. If a roll was commenced, what command would the versine generator
give?
a) Up Elevator
b)Left rudder
c) Down elevator
This is exam number 52.
Answer
1. 2 3 4 5 6 7 8 9 10
B A A B C A A A B A
3. Mode C response is
a) 21 microseconds
b)12 microseconds
c) 8 microseconds
8. In audio clipping
a) vowels are strengthened relative to the remaining signal
b)vowels are attenuated relative to the remaining signal
c) there is no change in relative strength of vowels
3. A HUMS in a helicopter is
a) a vibration analysis system
b)a system which monitors time period of components in service and
warns
of a premature failure
c) a system which indicates a crack in the blade
7. With power applied to the autopilot but not engaged, the trim
indicator will indicate
a) a standby electrical signal in the servo loop
b)that the gyro is out of the null and needs aligning
c) the trim system is out of datum
a) 115V
b)345V
c) 460V
2. The short circuit stub that is used for broadbanding a VHF whip must
have a length of about
a) 29cm
b)59cm
c) 70cm
3. An isotropic radiator
a) is an end fed π/2 unipole
b)has a perfectly spherical radiation pattern
c) has a cardiod shaped polar diagram
5. DFDR [digital flight data recorder] ARINC 573 data bus has how
many
sub-frames?
a) 4
b)6
c) 8
9. An accelerometer has
a) low inertia, free suspension
b)high inertia, restrained
c) high inertia, free suspension
2. Bandwidth of HF transmission is
a) 1khz
b)1.5khz
c) 3khz
4. GPS
a) uses 24 satellites equally spaced around 6 orbits
b)uses 18 satellites equally spaced around 6 orbits
c) uses 21 satellites equally spaced around 7 orbits
Answer
1. 2 3 4 5 6 7 8 9 10
C B B A ? A C ? ? A
4. An anti-servo tab
a) assists the pilot to move the controls back to neutral
b)moves in the same direction as the control surface to assist the
pilot
c) moves in the opposite direction to the control surface to assist
the pilot
b)45 Degrees
c) 90 Degrees
9. A plain flap
a) When stowed makes up part of the wing trailing edge lower surface
b)When stowed makes up part of the wing trailing edge upper surface
c) when deployed increases the camber of the wing
2.
a)
b)
c)
3.
a)
b)
c)
4.
a)
b)
c)
5.
a)
b)
c)
6.
a)
b)
c)
7.
a)
b)
c)
8.
a)
b)
c)
9.
a)
b)
c)
10.
a)
b)
c)
MODULE 13 Exam
1. Flaps at landing position
a) decrease take off and landing speed
b) decrease take off speed
# c) decrease landing speed
Page 1 - Mod 13
10. How does a balance tab move?
a) In the same direction proportional to the control surface it is
attached to
b) In the same direction a small amount
# c) In the opposite direction proportional to the control surface it is
attached to
Page 2 - Mod 13
19. Adding 6 foot of cable to TX RX aerials on rad alt would give you
a) 3 ft error
b) 6ft error
# c) 12 foot error
Page 3 - Mod 13
28. If on a lead-acid battery, several cell checks of SG read consistently
low. Battery needs
a) topping up with distilled water
b) replacing
# c) recharging
34. the aircraft decrabbing signal, used during autoland, originates from
a) roll errors
b) localiser deviation errors
# c) heading errors
Page 5 - Mod 13
45. Which modes are incompatible
a) VOR + ALTITUDE HOLD
# b) G/S + ALTITUDE HOLD
c) HDG + V/S HOLD
48. On the approach the autopilot loses the LOC signal; the aircraft
would
a) fly a circle
b) increase its drift angle
# c) fly parallel to the beam
Page 6 - Mod 13
53. An over station sensor (OSS) is triggered by
a) measured radio deviation
# b) rate of change of radio deviation
c) rate of change of course
55. In the FMS vertical navigation (V NAV) climb mode the throttles are
used for
# a) maintaining a computed EPR
b) controlling to a maximum thrust
c) correction minor speed deviations
Page 7 - Mod 13
62. What is the impedance of VOR or HF aerial cables?
a) 75 ohms and 25 ohms
b) 25 ohms
# c) 50 ohms
63. To improve the image or picture when using the WRX (weather radar
receiver)
a) scan at a lower rate
# b) use shorter bursts
c) use longer bursts
65. Where does it state what emergency equipment and what levels of
emergency equipment should be carried on an aircraft
a) BCAR section A4-8 or A8-4
# b) JAR OPS (M)
c) Maintenance Manual
67. The tail nav light. What angle of divergence should it have?
a) 180 degrees
b) 120 degrees
# c) 140 degrees
69. What must be taken into account when measuring the SG or relative
density of a lead acid battery?
# a) The temperature
b) The ambient pressure
c) The ambient humidity
Page 8 - Mod 13
70. The polythene coating on a HF antenna wire is provided
# a) to prevent precipitation static build up
b) to prevent the wire from corroding
c) to prevent the wire from chafing
75. in a fly by wire system, pitch and roll control positions are known by
using
a) LVDTs for roll control surfaces and RVDTs for pitch control
surfaces
# b) LVDTs for roll and pitch control surfaces
c) RVDTs for roll and pitch control surfaces
76. in a CMC aircraft, flight deck indications and warnings are managed
and provided by
a) the central warning computer (CWC)
b) the electronic interface units (EIU)
# c) the engine indicatig and crew alert system (EICAS)
85. The wheel height at which the approach path has been visually
assessed as satisfactory to continue the approach to a landing is know
as the
# a) decision height
b) intercept height
c) alert height
Page 10 - Mod 13
87. A category 11 facility performance ILS has an intercept height of
a) 15 m
# b) 60 m
c) 0 m
89. The average risk of autoland should not contribute a rate of fatal
accidents per landing greater than
a) 1 x 10-6
# b) 1 x 10-7
c) 1 x 10-8
95. The following modes may be retained when overshoot has been
initiated after the selection of autoland
a) ILS localiser an IAS
b) IAS and glide slope
# c) IAS and steering or heading
Page 11 - Mod 13
96. If go-around has been initiated after autoland has been selected, the
aeroplane will
a) increase speed
b) rotate nose up
# c) increase speed and rotate nose up
98. If during autoland the LOC signal is lost at 400 ft in final approach
a) system degrade to CAT II
b) autoland is continued
# c) go-around is initiated
Page 12 - Mod 13
105. on touchdown, auto pilot
a) remains engaged ready for G/A
b) drives the throttles forward
# c) disconnects after a short time
Page 13 - Mod 13
114. CAT-3b allows
a) approach land and runway guidance with zero DH and RVR
# b) approach land and RVR in the order of 50 meters
c) approach land and runway guidance with taxing visibility in the
order of 50 meters
119. for a vertical Gyro which is moved in pitch, which gimble would be
moved to correct the pitch movement?
a) Lateral
# b) Longitudinal
c) Normal
121. With airspeed hold engaged whilst flying with Flight Director
engaged, a down command means your speed has
a) increased
# b) decreased
c) is the same
Page 14 - Mod 13
123. The total static resistance along the length of an aircraft is
# a) 50 milliohms
b) 1 ohms
c) 1M - 100,000 ohms
128. an RMI in VOR mode, it's Pointer is showing a course of 000, if the
course knob is adjusted to 010 what happens to the pointer?
a) Move left
# b) Move right
c) Moves left then hard right
134. With a trailing edge flap being lowered, due to rising gusts what will
happen to the angle of attack?
# a) Tend to increase
b) Tend to decrease
c) Stay the same
140. If a drain trap in a pitot static system is removed but nothing was
found
a) no leak test is required unless the drain trap contains water
# b) a leak test must be carried out even if nothing found
c) a leak test is never required
Page 16 - Mod 13
141. TCAS transmits and receives on a frequency of
# a) 1030 MHz and 1090mhz respectively
b) 1090mhz and 1030mhz respectively
c) 1090 MHz
148. when a helicopter lands how does the pilot signal to the ground
staff that it is safe to approach the aircraft?
a) Turning on and off the NAV lights
# b) Turning off the anti-collision lights
c) Flashing the landing light
Page 17 - Mod 13
150. FADEC system gets its power supply from
a) channel A and B from the same windings of a dedicated
Generator
# b) channel A and B from separate windings of a dedicated
Generator
c) emergency Batt bus
Page 18 - Mod 13
159. When an aircraft is at a height of 9500ft and the QNH is 500 ft what
is the distance that VHF Com cover?
a) 100 nm
# b) 120 nm
c) 140 nm
160. When the VOR ref and Vari phase are in phase quadrature, the
aircraft is at the
a) 180 degree radial
# b) 090 degree radial
c) 275 degree radial
Page 19 - Mod 13
168. Temperature compensation is required on an altimeter because of
# a) capsule elasticity
b) capsule shape
c) non linear pressure/height relationship
169. The loss of the vertical gyro signal to the flight director system
would cause
a) aircraft to underbank
# b) aircraft to overbank
c) aircraft to remain in level flight
173. As the rotor head is tilted to travel forward what happens to the
reward travelling blades pitch angle?
# a) Increases
b) Decreases
c) No change
176. When all three leads of a bonding tester are connected together the
output reading is
# a) zero
b) full scale deflection
c) centre scale
Page 20 - Mod 13
177. in a capacitive fuel gauging system an increase in fuel level would
a) increase capacitive reactance
# b) increase capacitance
c) decrease capacitance
183. The specific gravity readings of a lead-acid cell taken twice after
charging shows substantially lower value.
# a) Cell is defective
b) You top up the cell with distilled water
c) You replace the cell
Page 21 - Mod 13
186. GPS has
a) 6 satellites in 4 orbits
# b) 4 satellites in 6 orbits
c) 7 satellites in 3 orbits
189. A manual trim wheel, when fully moved in the direction of tail
a) the authority of elevators not effected
# b) the up movement authority is effected
c) the down movement authority is effected
Page 22 - Mod 13
194. In the reversed camber horizontal stabilizer as shown
Page 23 - Mod 13
201. Shock stall
a) is a flap down stall
# b) occurs at high speeds
c) occurs at low speeds
206. to transmit position feedback for actuators of roll and pitch control
surfaces, in a fly by wire system
# a) LVDT is used hence ensuring interchangeability
b) LVDT and RVDT are used for pitch and roll
c) Synchros are used
208. What is the error signal used for in a fixed angle approach in LOC
coupling?entrifugal force
a) Heading and Deviation
# b) Course error and Deviation
c) Heading ,Course error and Deviation
Page 24 - Mod 13
210. As you approach supersonic
# a) total drag is increased
b) lift is reduced
c) thrust is reduced
Page 25 - Mod 13
219. In a radio altimeter system if you decide to increase the TX cable
and RX cable each by 3 inch the total correction factor is
a) 3 inch
b) 6 inch
# c) 9 inch
221. for bonding, the two ends of a rubber pipe are joined by
a) a thick metallic bonding strip
# b) a corrugated bonding jumper
c) a wire attached by terminal legs at both ends
224. In case the airplane is wired for dual installation of the Central
Maintenance Computers and only one computer is to be installed
# a) it must be installed on LH side
b) it must be installed on RH side
c) it may be installed either on LH or RH side
226. If the static line is disconnected in the cabin, the Mach meter
reading would be
a) higher mach number
# b) lower mach number
c) not effected
Page 26 - Mod 13
227. in a dual FMC installation, if one FMC is defective
a) one CDU blanks
b) both CDU blanks
# c) not be affected as automatic transfer takes place
228. While carrying out a leak check of the altimeter, if the static is
leaking, the VSI would
a) indicate climb
# b) indicate decent
c) not be affected
232. during compass swing, using a datum compass, the error permitted
in aligning the aircraft is
a) 1 degree
# b) 5 degree
c) 10 degree
233. If two aircraft decide to issue the same RA for a potential conflict,
which aircraft changes the decision?
# a) The one with the higher address
b) The one with the smaller address
c) Neither changes the decision
Page 27 - Mod 13
235. in helicopter autopilots, while operating the actuator, the movement
of the cockpit control is prevented by
a) synchros attached to the control
# b) a compressed spring attached to the cockpit control
c) a lock on the cockpit control
# a) Split flap
b) Fowler flap
c) Plain flap
Page 28 - Mod 13
243. DH is based on
a) aircraft characteristics
b) experience of the crew
# c) RVR transmitted by ATC
251. When the bank angle limit is applied to the autopilot , it means
a) the max aileron angle that can be commanded
# b) the max roll angle that can be demanded by the autopilot
c) maximum rudder deflection
Page 29 - Mod 13
252. Servo tabs
a) enable the pilot to bring the control surface back to neutral
# b) move in such a way as to help move the control surface
c) provide artificial feel
256. During testing of ATC altitude function the pressure altimeter is set
# a) 1013.25 mb
b) sea level pressure
c) prevailing pressure
257. When secondary stops are utilized in control surfaces, they come in
contact
a) before the primary stops
# b) after the primary stops
c) at the same time as the primary stops
Page 30 - Mod 13
261. What will happen with a flux valve in a turn?
a) It moves once the aircraft is established on a new heading
# b) It move as the aircraft moves
c) It stays fixed on magnetic north
265. On an ILS approach what will cause the aircraft to fly onto the
beam?
# a) Radio deviation
b) Glideslope deviation
c) Course deviation
267. When can other autopilot modes be select once Go Around has
been selected?
a) When aircraft has reached 5000ft
# b) When reached a desired altitude
c) Disengage and reengage the AFCS system
268. Once the G/S has been captured what other pitch modes are
available?
# a) No other pitch modes are available
b) Only when the aircraft is above the glideslope beam
c) All are continuously available
Page 31 - Mod 13
269. If a helicopter rotor disc is rotating anticlockwise, viewed from
above where would a pitch input be fed into the disc to move the
helicopter backwards, 90 degrees to what?
a) In front of the lateral axis
# b) Right of the longitudinal axis
c) Left of the longitudinal axis
273. If you carry out a VSWR check of a SSB HF system what should you
do with the control switch? Select it to
a) OFF
# b) AM
c) either USB or LSB
274. How long is the time between the start of the P1 pulse and the P3
pulse ignoring the P2 pulse length?
a) 21 micro seconds
# b) 8 micro seconds
c) 17 micro seconds
275. If a VOR RMI indicates 000 degrees and the course selected is 000
degrees what will the TO/FROM indicator indicate?
a) TO
# b) FROM
c) Neither
Page 32 - Mod 13
277. A radar response takes 329 micro seconds how far away is the
target?
a) 12 miles
# b) 25 miles
c) 40 miles
Page 33 - Mod 13
286. Artificial feel is gained by using a
a) hydraulic damper
# b) spring bias unit
c) 'feel' generator
291. When substituting the radio altimeter antenna cables, you should
consider
a) power requirements
# b) the speed of propagation of rad alt signal
c) the diameter of cables
Page 34 - Mod 13
295. Radio switches are normally
# a) sprung on R/T, latched on I/C
b) latched on R/T, sprung on I/C
c) latched on R/T, latched on I/C
299. Fluorescent tubes for the cabin lighting are powered from
a) 115 volts from ac bus
b) 200 volts from ac bus
# c) high voltage produced by transformer ballast units
301. in air speed hold mode, a down displacement of the flight director
pitch command bar signifies
a) speed increase
# b) speed decrease
c) height decrease
Page 35 - Mod 13
304. DME reply pulses are 63MHZ
a) higher
b) lower
# c) higher or lower
Page 36 - Mod 13
313. Deviation from the HSI lubber line is known as
# a) apparent A
b) real A
c) true A
320. Fibre glass parts are protected from lightning strikes and
dangerous voltages by
a) non conductive paint
b) conductive paint
# c) earth primary conductors
Page 37 - Mod 13
322. The pseudo-random code used by all civilian GPS users is
a) the y code
b) the p code
# c) the c/a code
323. The respective band widths for a radar IF amplifier and video
amplifier should be for good pulse shape are
a) wide and narrow
# b) narrow and wide
c) wide and wide
326. When the aircraft nose yaws to the left, the yaw damper will apply
corrective rudder to
# a) the right
b) the left
c) the left with some aileron assistance
Page 38 - Mod 13
331. A series actuator in a helicopter autopilot system has
a) full authority
b) 50% authority
# c) 10% authority
Page 39 - Mod 13
339. Wing steady light must be visible through
a) 70 degrees
# b) 110 degrees
c) 180 degrees
Page 40 - Mod 13
347. with a constant torque applied to a gyroscope, the rate of
precession will
a) increase with a higher rotor speed
# b) decrease with a higher rotor speed
c) decrease with a lower rotor speed
348. A gyroscope with a vertical spin axis has the roll torque motor
located about the gyroscope's
a) lateral axis
# b) longitudinal axis
c) vertical axis
350. The loss of the vertical gyro signal to a flight director system
would cause
a) aircraft to underbank
# b) aircraft to overbank
c) aircraft to remain in level flight
351. In a flight director system the radio signal outputs from the
navigation receiver are
# a) DC
b) AC
c) pulsed DC
355. An auto land system displays Land 2 another failure will make the
system
a) operational
# b) passive
c) simplex
Page 41 - Mod 13
356. DSR TK (desired track) means
a) the bearing to capture the track
# b) a great circle path on surface of earth connecting two way
points
c) distance left or right from desired track
359. On aircraft an auto land during auto flare the auto throttle will
# a) retard the throttle
b) reverse thrust
c) control throttle for a IAS
Page 42 - Mod 13
365. An O ring in a wave guide is used to
a) correct the VSWR
b) stop arcing between the wave guide
# c) stop moisture entering the wave guide
368. After a change in collective pitch the Rotor rpm will rise and fall.
This is called
# a) transient droop
b) static droop
c) under swing
Page 43 - Mod 13
374. The rotor disc is
# a) the distance between tip to tip
b) the rotor head hub
c) the ground cushion
376. The aircraft is due north of a VOR station on a heading of 90o What
is a RMI display?
a) 90o
b) 0o
# c) 180o
377. The flight director is on a localizer when the radio deviation signal
is lost the aircraft would
a) continue on flying on the localizer
# b) fly parallel to the localizer
c) drift of from the localizer on the same heading
381. The controlling signal in pitch channel in the Flare mode are
# a) integrated pitch and radio altitude.
b) G/S deviation and radio altitude.
c) integrated pitch and G/S deviation
Page 44 - Mod 13
283. During autoland failure of one channel is detected
a) all channels will disconnect in triplex system.
# b) all channels will disconnect in dulpex system.
c) all channels will disconnect in dual-dual system.
Page 45 - Mod 13
292. The aileron/rudder signal is demodulated in the rudder channel
amplifier. This means it is
a) AC
b) DC
# c) DC output whose polarity is related to the phase of AC input
403. When can other autopilot modes can be select once Go-Around has
been selected?
a) When aircraft has reached 5000ft
# b) When reached a desired altitude
c) Disengage and reengage the AFCS system
404. Once the G/S has been captured what other pitch modes are
available?
# a) No other pitch modes are available
b) Only when the aircraft is above the glideslope beam
c) All are continuously available
408. How long is the time between the start of the P1 pulse and the P3
pulse ignoring the P2 pulse length?
a) 21 micro seconds
# b) 8 micro seconds
c) 17 micro seconds
Page 47 - Mod 13
409. What does the Radar contour button do?
a) Alter the beam shape
b) Alter the transmitter power
# c) Alter the video amplifier
410. A radar response takes 329 micro seconds. How far away is the
target?
a) 12 miles
# b) 25 miles
c) 40 miles
415. for a Vertical Gyro which is moved in pitch, which gimble would be
moved to correct the pitch movement?
a) Lateral
# b) Longitudinal
c) Normal
Page 48 - Mod 13
418. Which is the most important part of preventative maintenance on
HIRF installations?
# a) Visual inspections
b) Insulation testing
c) CMC fault indications
419. an RMI in VOR mode, it's pointer is showing a course of 000. If the
course knob is adjusted to 010 what happens to the pointer?
a) Move left
# b) Move right
c) Moves left then hard right
422. If an aircraft is entering a turn to the left, what input would the
aileron to rudder crossfeed be?
# a) Left Rudder
b) Right Rudder
c) No Rudder
423. If a control surface that is fitted with a balance tab is moved, what
will happen to the tab?
a) It is moved manually in the opposite direction to the surface
b) It is moved automatically in the same direction as the surface
# c) It is moved automatically in the opposite direction as the
surface
Page 49 - Mod 13
426. Flap asymmetry causes the aircraft to
a) nose up
# b) go one wing down
c) nose down
429. What colour are the autoland indication lights next to the pilots
instruments with excess deviation?
a) Red
# b) Amber
c) White
431. What happens to the F/D command bars if the roll gyro fails in a
turn?
a) They stay in the same place as nothing is there to null the input
signal
b) They return back to neutral when the turn is complete
# c) They Disappear out of view
436. If the aircraft is to be rolled to the right where does the pilot feed in
this command?
# a) Control Wheel
b) Control Column
c) Rudder Pedals
439. What is the minimum size cable, which is not likely to carry all the
current from a primary structure?
a) 0.5inch wide by 26AWG cable
# b) 0.25inch wide by 26AWG cable
c) No smaller than 18AWG
447. On an aircraft fitted with a CMC how do you get to the system
pages?
# a) Through the ground test function
b) Through the Existing faults function
c) Through the Present Leg faults function
Page 52 - Mod 13
453. with a control surface tab in the neutral position, what happens
when the control surface is moved?
a) It remains in the neutral position
b) It moves in the same direction as the control surface
# c) It moves in the opposite direction as the control surface
457. What would indicate the state of charge of a lead acid battery?
a) Fluctuations in the level of the electrolyte
# b) Fluctuations in the SG of the electrolyte
c) Fluctuations in the terminal voltage
461. ADF is
a) Rho
b) Theta
c) Rho-Theta
Page 53 - Mod 13
462. A Boost Gauge reads
a) above or below ambient atmospheric pressure
# b) absolute pressure
c) above or below ISA atmospheric pressure
Page 54 - Mod 13
471. What is the calibration law of a Ratiometer?
a) Material of the coil
b) Material of the sensing element
# c) Material of the indicator needle
476. If a QFE is set at an airfield and flown to another airfield at the same
level above sea level then
a) it will not need resetting and will read zero
b) it will display the airfield height above sea level
# c) it will probably not need resetting and will read zero
483. A thermocouple
a) capacitance and inductance cannot be added
# b) cannot be shortened
c) can be shortened
488. TCAS II is
a) 10 aircraft per square mile
# b) 25 aircraft per square 5 miles
c) 100 aircraft per 5 miles square
Page 56 - Mod 13
489. RMI in ADF mode, the pointer is moved by a
a) servomotor
# b) loop voltage
c) Chinaman
496. What happens when a control stick is pulled back and to the left?
a) Elevator up, left aileron down
b) Elevator down, right aileron down
# c) Elevator up, right aileron down
Page 53 - Mod 13
498. DC power into the GCU comes from
# a) main battery bus
b) main battery bus and ground service
c) ground service
500. If an elevator is fitted with a fixed tab in the down position, the
control surface will
# a) move up
b) move down
c) remain at the same place
502. Rising gust in front of the leading edge with flaps lowered, AoA will
# a) increase
b) decrease
c) remain
505. After a roll to the left of a statically stable helicopter , the helicopter
would
a) continue to roll
b) increases roll
# c) come back to level flight
506. What instrument uses ram air pressure and atmospheric pressure?
# a) ASI
b) Machmeter
c) VSI
Page 58 - Mod 13
507. If increasing altitude at constant IAS, TAS will
a) decrease
# b) increase
c) remain the same
509. How does a delta wing aircraft move about the pitch and roll axis?
a) Elevator s
# b) Elevons
c) Ailerons
511. What effect does lowering the flaps for takeoff have?
a) Increases lift & reduces drag
# b) Increases lift and drag
c) Increase lift only
515. On a Ground Power unit which pins are allocated for interlock
circuit?
a) A and B
b) B and C
# c) E and F
Page 53 - Mod 13
516. Which is used for compass damping fluid compensation?
# a) Bellows or diaphragm
b) No damping due to alcohol low temperature co-efficient
c) Piston and oil
518. If the torque were increased on a vertical gyro, what would happen
to the precession?
# a) Increase
b) Remain unaffected
c) Decrease
Page 60 - Mod 13
525. An uncorrected ADI is affected by
a) climb
# b) descent
c) roll
529. If the localiser signal is only applied to the A/P roll channel
a) aircraft flies parallel to the runway centre line
b) aircraft flies along the runway centre line
# c) aircraft flies in circles
532. Flight director on VOR, course error wash out signal is lost,
following the FD commands. Aircraft will
a) stay on centre of course
# b) stay parallel to course
c) follow the course with scalloping or bracketing
Page 61 - Mod 13
534. A helicopter needs to re-trim
# a) indication is shown on the API
b) indication is shown on the command bars of the EHSI
c) indication is shown on the command bars of the attitude
indicator
540. DME - how does receiver find the received pulse pairs are valid?
# a) Decoder
b) Blocking oscillator
c) Integrator
Page 62 - Mod 13
543. A HUMS in a helicopter is
a) a vibration analysis system
# b) a system which monitors time period of components in service
and warns of a premature failure
c) a system which indicates a crack in the blade
547. With power applied to the autopilot but not engaged, the trim
indicator will indicate
# a) a standby electrical signal in the servo loop
b) that the gyro is out of the null and needs aligning
c) the trim system is out of datum
Page 63 - Mod 13
552. in an auto trim horizontal stabiliser, 'low' speed mode is when
# a) flaps are retracted
b) landing gear up and locked
c) flaps extended
554. If the VOR track error is 2 dots, how many degrees off track is the
aircraft?
# a) 10
b) 5
c) 2.5
Page 64 - Mod 13
560. On a modern aircraft about to stall
# a) the outboard slats extend automatically
b) engine power increases automatically
c) the flaps retract automatically
564. A radar antenna is facing left. On ground test, if you move the
vertical gyro to simulate a right bank, the antenna
a) will move up
# b) will move down
c) will not move
566. When more than one D.R. compass is fitted on an aircraft or where
a D.R. compass serves as a standby to a remote reading compass
a) only the master compass readings and adjustments carried out
and remaining compasses are adjusted with master compass
# b) all readings and adjustments for each compass should be made
simultaneously on each heading
c) all readings and adjustments for each compass should be made
at any one heading only
567. Compass error remaining after all the corrections, which is used for
entry on the deviation card should not exceed
a) 2 degrees
# b) 3 degrees
c) 5 degrees
Page 65 - Mod 13
568. Compass error remaining after all corrections are made is called
a) apparent error
# b) residual error
c) index error
571. Stick shaker activates at a speed which is above the stalling speed
by
a) 4%
# b) 7%
c) 10.321%
572. A D.R. compass fitted on an aircraft. The safe distance for electrical
cables carrying electrical current is
a) 20 inches
# b) 24 inches
c) 28 inches
573. The pitot head is fitted on the aircraft. The alignment of pitot head is
carried out with
# a) an inclinometer
b) micrometer
c) spirit level
a) 115V
b) 345V
# c) 460V
596. When resetting the CSD on the ground, the engine should be
# a) stationary
b) rotating at idle
c) rotating at Nsync
Page 69 - Mod 13
602. In ADF system, Goniometer
a) combines the signals from fixed loop antenna and sense
antenna
# b) effectively simulates a rotating loop antenna
c) alternately selects signals from loop antenna and sense
antenna
Page 70 - Mod 13
610. Localizer modulation depth is
a) 2%
# b) 20%
c) 50%
612. The short circuit stub that is used for broadbanding a VHF whip
must have a length of about
a) 29 cm
# b) 59 cm
c) 70 cm
614. The VSWR of a VHF system with a forward power of 100W and a
reflected power of 4W will be
# a) 1.5:1
b) 2:1
c) 2.5:1
625. DFDR [digital flight data recorder] ARINC 573 data bus has how
many sub-frames?
# a) 4
b) 6
c) 8
Page 72 - Mod 13
627. What is the millivolt deflection per dot on ILS/VOR?
a) 25/75
b) 25/5
# c) 75/75
634. GPS
# a) uses 24 satellites equally spaced around 6 orbits
b) uses 18 satellites equally spaced around 6 orbits
c) uses 21 satellites equally spaced around 7 orbits
Page 73 - Mod 13
636. What manoeuvre does TCAS II adv
a) TA
# b) RA
c) either RA or
Page 74 - Mod 13
645. Non-essential loads such as galleys and cabin lighting operate from
a) Ground services bus
b) Ground handling bus
# c) Transfer bus
Page 75 - Mod 13
654. An anti-servo tab
# a) assists the pilot to move the controls back to neutral
b) moves in the same direction as the control surface to assist the
pilot
c) moves in the opposite direction to the control surface to assist
the pilot
664. On the ASP how many Rx and Tx can be selected at any one time?
# a) multiple Rx and only one Tx
b) multiple Rx and multiple Tx
c) only one Rx and only one Tx
669. What type of signal is used for trigger height trip signals?
# a) Switchable d.c
b) Switchable a.c
c) variable d.c
Page 77 - Mod 13
672. A typical ratiometer indicating system would use
a) 3-phase AC
# b) single phase AC for indicator and transmitter
c) single phase AC for indicator and dc for transmitter
678. Where is zone 320 on an aircraft according to the ATA 100 system?
# a) Fin
b) Horizontal Stabilizer
c) Fuselage
694. Second channel interference could occur if the I/P frequency was at
twice the
a) L O frequency away from the selected frequency
# b) I F away from the selected frequency
c) I F away from the L O frequency
Page 81 - Mod 13
709. An autoland is carrid out in which sequence
a) GS capture, LOC capture, attitude hold, flare
# b) LOC capture, GS capture, Attitude hold, Flare
c) LOC capture, GS capture, Flare, Attitude hold
Page 82 - Mod 13
718. The speech clipping modulating circuit
a) increases the average depth of modulation
b) clips high amplitude signals
# c) cuts out high tone sounds
720. If the static pressure is varied at too great a rate, the instrument
that s most affected is the
# a) rate of change indicator
b) altimeter
c) airspeed indicator
Page 83 - Mod 13
727. To check side lobe suppression
# a) select ATC on ASP
b) use a ramp test set
c) carry out a self test
734. With an ATC code of 0600 selected, the pulses transmitted are
# a) B 2 and B 4
b) B 1 and B 5
c) B 0 and B 6
Page 84 - Mod 13
736. The relationship between LORAN master and slave transmitters.
Master frequency
a) higher than slave
b) lower than slave
# c) same as slave
740. A radar pulse takes 308 microseconds to return, what is the target
distance
a) 12.5 Nautical miles
# b) 25 Nautical miles
c) 30 Nautical miles
Page 85 - Mod 13
745. Man made noise causes interference
a) mainly above 12 Mhz
b) only in the LF band
# c) mainly below 12 Mhz
750. What is the maximum value of installation tester that may be used
on a fuel contents system?
a) 300 Volt
b) 250 Volt
# c) You cannot use one on the fuel contents system
Page 86 - Mod 13
754. An aircraft landing on QFE the altimeter will
# a) read zero on touchdown
b) read airfield height on landing
c) read local area pressure
756. Using the fast erection switch on a standby horizon prior to the flag
clearing may cause
a) the instrument to erect false datum
# b) application of a large torque to the control phase windings
causing failure
c) You must use the Fast erection switch to clear the flag
Page 87 - Mod 13
763. GPS L 1 and L 2 signals are
# a) Bi phase 50 bit/ sec
b) 10.2 KHZ send rate
c) 1KHz send rate
Page 88 - Mod 13
772. The stall margin mode is controlled by
a) EPR limits
b) Speed bug cursors
# c) A O A and flap position sensors
776. Compass error remaining after all the corrections, which is used for
entry on the deviation
a) 2 degrees
# b) 3 degrees
c) 5 degrees
779. For a Vertical Gyro which is moved in pitch, which gimble would be
moved to correct the pitch movement?
a) Lateral
# b) Longitudinal
c) Normal
783. A Mode S transponder makes a Mode A/C only call, what is the
length of the P 2 pulse?
# a) 0.8 s
b) 1.6 s
c) 2 s
785. What is the time between the F2 framing pulse and the SPI?
a) 1.45 s
b) 2 s
# c) 4.35 s
Page 90 - Mod 13
790. Using the following: FS 345, RWS 45, where is this located?
a) 345" back from the nose, 45" from the longitudinal centre line
of the right wing
b) 345" back from the datum line, 45" from the longitudinal
centre line of the right wing
# c) 345" back from the nose and 45" along the right wing
791. When carrying out an insulation resistance test of a pitot probe you
would expect
a) 1 Megohm when cold
# b) 3 Megohm when hot and when cooled down
c) 5 Megohm
Page 91 - Mod 13
798. The scratch pad in an FMS CDU occupies
a) 24 character spaces of the bottom line
b) the last 12 character spaces of the bottom line
# c) first 12 character spaces of the bottom line
800. The horizontal angle contained between the true and the magnetic
meridian at any place is
a) inclination
# b) declination
c) angle of dip
Page 92 - Mod 13
807. Tripping the GCR will
a) trip the GCB
b) de-excite the generator
# c) both (a) and (b)
811. Airspeeds above the speed of sound, but not exceeding 4 times the
speed of sound are
a) hypersonic
# b) supersonic
c) hyposonic
812. If the pilot reports autoland failure, and no fault found during
ground checks. What action do you take?
a) Sign off as no fault found
$ b) Ask Pilot to carry out CAT 1 autoland
c) Ask pilot to carry out CAT 1 or CAT 2 autoland
Page 93 - Mod 13
816. In an EICAS system, operation of the cancel switch
a) removes all messages from the display
# b) removes caution and advisory messages
c) removes advisory messages
822. JAR OPS states that the time an FDR recording must be kept after
accident or incident
a) 30 days after incident 60 days after accident
# b) 60 days
c) 30 Days
Page 94 - Mod 13
825. Compass compensator units have greatest effect when the
magnets are
a) Parallel
b) 45 degrees
# c) 90 degrees
836. MCDUs
a) are used to transmit dat to ground
# b) enable dialog with cent
c) store fault data
838. If the output of the generator starts to fall, a pulse width modulated
field supply will
# a) increase the mark-to -space ratio
b) decrease the mark-to- space ratio
c) double the mark-to-space ratio
Page 96 - Mod 13
842. The venturi tubes in a vacuum instrument are measured in
a) Millibars
# b) Inches of Mercury
c) PSI
850. In ground mode the FMS uses which of the following for velocity
calculations?
# a) IRS
b) RHO-RHO
c) RHO-THETA
Page 97 - Mod 13
851. Component P relates to
a) coefficient A
# b) coefficient B
c) coefficient C
852. During take off with autothrottle engaged, the autothrottle sensor
fails, THR CLP is annuciated on the mode annunciator panel when
# a) aircraft leaves ground
b) a pre-determined rad alt setting
c) V 2, as determined by the autothrottle computer
Page 98 - Mod 13
860. RNAV uses which inputs?
a) IRS, ADF, VOR, DME
b) ADF, GPS, VOR
# c) IRS, VOR, GPS, DME
864. If radio deviation is fed only to the autopilot roll channel what will
happen?
# a) Aircraft will fly in circles
b) Aircraft will drift from centreline
c) Aircraft will fly parallel to centreline
Page 99 - Mod 13
869. EGPWS mode 2 announces
a) sink rate
# b) whoop whoop pull up
c) too low flaps
873. Leakage of a static line during a pitot static test (altitude increasing)
would be indicated by
$ a) VSI showing rate of climb
b) VSI showing rate of descent
c) VSI remaining in a fixed position
---877. If the static vent is leaking into cabin pressurised space when the
aircraft is at altitude, mach meter will indicate
a) an increase
b) a decrease
c) no change
Page 100 - Mod 13
---878. The FBW system uses two elevator and aileron computers
(ELACs)
a) this is to provide redundancy
b) they provide alternate control of the elevators if spoiler and
elevator computers (SECs) fail
c) each computer achieves control and monitoring of the three
electric motors which power the trimmable horizontal stabiliser (THS)
882. How does a Rx know whether an ILS or a VOR frequency has been
selected?
a) Manually selected by operator
# b) Logic control circuit in control unit
c) A different receiver is used
887. EFIS display ,SG 1 + SG 2 are for captain and FO displays what is
the purpose of SG 3?
# a) Backup for SG 1 and 2
b) ECAM upper display
c) ECAM lower display
---888. The compensator tank unit in a fuel system adjusts fuel readings
for
a) SG of fuel
b) permittivity
c) zero reading
---890. Peak power = 10 kW, duty cycle = 2.4 ms, pulse duration =6
microseconds. What is mean power?
a) Approx .4 W
b) 14 W
c) 24 W
896. The Dutch roll filter used on most yaw damper systems operates
with a demodulator and modulator in series, between which is an
electronic circuit. this circuit is a
a) wide band pass filter featuring an integrated output
b) wide band pass filter featuring a differentiate output
$ c) narrow band filter featuring a differentiate output
897. During tests on the yaw damper servo actuator, the output shaft
constantly over-runs its desired displacement. A probable cause is that
the
a) detent spring has lost its tension
$ b) position LVDT (linear variable differential transformer) is out
of tolerance
c) the rate feedback circuit is open-circuit
902. As part of the checks on the DFDR system, you are required to
carry out a check using the self Start page and Bookshopthe aircraft
integrated data system (AIDS) printer. Actuation of the switch causes
the printer to print in
a) eighty column mode
$ b) sixty six column mode
c) forty column mode
904. In digital flight data recorder (DFDR) system, low speed playback of
currently received data can be achieved at
a) the flight compartment test connector through the digital flight
data acquisition unit (DFDAU)
$ b) the electronic bay test connection at the quick access recorder
(QAR)
c) the DFDAU built in test equipment (BITE)
909. When attaching more than one jumper or ground lead terminal to
structure with a single fastener
a) place the smallest terminal nearest the structure, covered by a
spacer, with the others, to a maximum of six, stacked in increasing size
# b) install the largest terminal nearest the structure, with the
others, to a maximum of four, stacked and fanned in decreasing size
c) connect the largest terminal nearest the structure with the
others, to a total of three, stacked symmetrically in any order
914. A fuselage construction where the skin carries all of the loads is
known as:
a) semi-monocoque
b) semi-stressed
# c) monocoque
915. The purpose of the mercury switch in the rotating platform system
is to
a) always ensure that the platform is maintained level in space
when the autopilot is engaged
$ b) level the platform when the autopilot is disengaged
c) level the platform system when installing
926. In the electro pneumatic servo-motor using dual poppet valves and
dual roll-framcommand output from the autopilot servo amplifier
a) both valves will be closed
$ b) both valves will be open for an equal period of time
c) both roll fram actuators will fully retract
928. The maximum level output of a series limiter using switch diode is
set by
a) voltage of the signal
$ b) the dc bias passing through the diodes
c) diode reverse resistance
Page 107 - Mod 13
929. When DC motors are used as servomotors they are usually
a) high current low voltage type
$ b) split field type
c) high torque heavy armature type