#TNR Stage 4 Construction Environmental Management Plan

Construction
Environmental
Management Plan
The Northern Road Upgrade
between Mersey Road and Eaton Road
November 2018
4/11/2018 4/11/2018
Contacts
Position Name Phone
GEJV Project Manager
Adam Boyd 0419 501 731
(24 hour contact)
GEJV Health and Safety Manager Jerry Cockburn 0437 403 821
GEJV Environmental Manager

Peter Sheehan 0437 397 005
(ESR)
GEJV Superintendent
Jamie Barry 0447 805 181
(24 hour contact)
GEJV Community Relations
Robert Parker (02) 8072 3600
Manager
Roads and Maritime between
Mersey Road and Eaton Road – Easwaran Veeragathipillai 0400 561 753
Project Manager
Roads and Maritime Senior
Owen Clark 0476 837 960
Environmental Officer
Roads and Maritime On-Site
Jim Steen 0439 439 570
Environment Officer
EPA pollution hotline NA 131 555

Roads and Maritime Senior
Project Manager Jeff Gilham 0455 068 886
(24 hour contact)
Roads and Maritime
Anthony Eland 0476 813 083
Environmental Manager
Roads and Maritime Community
and Stakeholder Engagement Kamini Parashar 0431 113 068
Advisor
Water NSW ~ 1300 662 077
Liverpool City Council ~ 1300 362 170
SafeWork NSW ~ 131 050

Wollongong Hospital
The Ministry of Health 252 Loftus Street, (02) 4222 5000
Wollongong
000
(for pollution incidents that present
an immediate threat to human
health or property)
Fire and Rescue NSW ~
1300 729 579
(for pollution incidents that do not
present an immediate threat to
human health or property)
NSW Police
Sergeant Matt Shirvington (02) 4721 9415
Penrith Local Area Command
0428 271 496
Cameron Weller
Cam@hutchisonweller.com
Environmental Representative
0414 860 356
Peter Morrall (alt)
peter@hutchisonweller.com
The Northern Road Upgrade between Mersey Road and Eaton Road
Construction Environmental Management Plan ii
Contents
1 Introduction ................................................................................................................. 1
Background .......................................................................................................... 1
Purpose of this CEMP .......................................................................................... 2
Consultation ......................................................................................................... 3
Certification and approval ..................................................................................... 3
Distribution ........................................................................................................... 3
Revision ............................................................................................................... 4
2 Project description ...................................................................................................... 5
Project overview ................................................................................................... 5
Construction activities and sequence ................................................................... 6
Compounds and ancillary facilities ..................................................................... 13
3 Environmental Management System Overview ...................................................... 16
Georgiou Environmental Management System .................................................. 16
Environmental Policy and Procedures ................................................................ 16
CEMP ................................................................................................................ 16
4 Planning ..................................................................................................................... 22
Project environmental obligations ....................................................................... 22
Legal and other requirements............................................................................. 22
Environmental aspects and impacts ................................................................... 23
Environmental objectives and targets ................................................................. 25
5 Implementation and operation ................................................................................. 27
Resources, roles, responsibilities and authority .................................................. 27
Sub-contractor management .............................................................................. 34
Competence, training and awareness ................................................................ 35
Working hours .................................................................................................... 39
Communication .................................................................................................. 40
Emergency and incident planning, management and reporting .......................... 44
6 Inspections, Monitoring and Review........................................................................ 49
Environmental inspections ................................................................................. 49
Environmental monitoring ................................................................................... 50
Compliance ........................................................................................................ 51
Auditing .............................................................................................................. 53
Reporting ........................................................................................................... 54
Environmental non-conformity, corrective and preventative actions ................... 58
Construction Environmental Management Plan iii
Records of environmental activities .................................................................... 60
Environmental management system review ....................................................... 61
Appendices ......................................................................................................................... 63
Section A: EMS Documentation ........................................................................................ 64
Appendix A1 ................................................................................................................ 65
Appendix A2 ................................................................................................................ 67
Appendix A3 ................................................................................................................ 75
Appendix A4 ................................................................................................................ 77
Appendix A5 ................................................................................................................ 78
Appendix A6 ................................................................................................................ 81
Appendix A7 ................................................................................................................ 95
Appendix A8 ................................................................................................................ 96
Appendix A9 ................................................................................................................ 99
Appendix A10 ............................................................................................................ 101
Appendix A11 ............................................................................................................ 102
Section B: Supporting Management Plans ..................................................................... 103
Appendix B1 .............................................................................................................. 104
Appendix B2 .............................................................................................................. 105
Appendix B3 .............................................................................................................. 106
Appendix B4 .............................................................................................................. 107
Appendix B5 .............................................................................................................. 108
Appendix B6 .............................................................................................................. 109
Appendix B7 .............................................................................................................. 110
Appendix B8 .............................................................................................................. 111
Appendix B9 .............................................................................................................. 112
Appendix B10 ............................................................................................................ 113
Appendix B11 ............................................................................................................ 114
Tables
Table 2-1: Construction activities and sequencing ......................................................... 9
Table 3-1: Environmental Management Sub-plans and Strategies ...............................18
Table 4-1: Licenses, Permits and Approvals ................................................................22
Table 4-2: Environmental objectives and targets ..........................................................25
Table 5-1: Environmental Awareness Training .............................................................38
Table 5-2: Summary of requirements for incident notification and reporting .................47
Table 6-1: Summary of environmental monitoring requirements ...................................50
Construction Environmental Management Plan iv
Table 6-2: Compliance reporting ..................................................................................51
Table 6-3: Audit requirements ......................................................................................53
Table 6-4: Reporting requirements ...............................................................................54
Figures
Figure 2-1: Project location and Key Features (only Stage 4 is relevant to this CEMP) ......... 5
Figure 2-2: Proposed compound and ancillary areas for the Project (excludes (C1, C2) ......14
Figure 3-1: Project environmental management document system overview ........................17
Figure 5-1: Management structure between GEJV and Roads and Maritime ........................28
Construction Environmental Management Plan v
Appendices
Section A
Appendix A1 Legal and Contractual requirements
Appendix A2 Environmental aspects and impacts
Appendix A3 Environmental policy
Appendix A4 Ancillary Facility Management Plan
Appendix A5 Document register
Appendix A6 Sensitive area plans
Appendix A7 Environmental incident classification and reporting procedure
Appendix A8 Environmental work method statement register
Appendix A9 Georgiou Nonconformity and corrective and preventative action procedure
Appendix A10 Georgiou auditing, review and inspection standard
Appendix A11 ISO 14001 Certification
Section B Supporting management plans
Appendix B1 Construction Traffic Management Plan
Appendix B2 Construction Flora and Fauna Management Sub Plan
Appendix B3 Construction Noise and Vibration Management Sub Plan
Appendix B4 Construction Soil and Water Management Sub Plan
Appendix B5 Construction Cultural Heritage Management Sub Plan
Appendix B6 Construction Air Quality Management Sub Plan
Appendix B7 Construction Waste and Energy Management Sub Plan
Appendix B8 Construction Contaminated Land Management Sub Plan
Appendix B9 Other Management Measures Management Plan
Appendix B10 Construction Sustainability Management Plan
Appendix B11 Pollution Incident Response Management Plan
Appendix B12 Construction Community Liaison Plan
Construction Environmental Management Plan vi
Glossary / Abbreviations
Term Expanded Text
ARI Average recurrence interval
ASS Acid sulfate soils
CEMP Construction Environmental Management Plan
CEMS Contractors environmental management systems
CCLP Construction Community Liaison Plan
CNVMP Construction Noise and Vibration Management sub Plan
Compliance audit Verification of how implementation is proceeding with respect to
a construction environmental management plan (CEMP) (which
incorporates the relevant approval conditions).
CRAW Construction Risk Assessment Workshop
DIPNR NSW Department of Planning, Infrastructure and Natural
Resources
DP&E NSW Department of Planning and Environment
Ecological sustainable Using, conserving and enhancing the community’s resources so
development that the ecological processes on which life depends are
maintained and the total quality of life now and in the future, can
be increased (Council of Australian Governments, 1992).
EIS Environmental Impact Assessment
EMS Environmental management system
Environmental aspect Defined by AS/NZS ISO 14001:2004 as an element of an
organisation’s activities, products or services that can interact
with the environment.
Environmental impact Defined by AS/NZS ISO 14001:2004 as any change to the
environment, whether adverse or beneficial, wholly or partially
resulting from an organisation’s environmental aspects.
Environmental incident An unexpected event that has, or has the potential to, cause
harm to the environment and requires some action to minimise
the impact or restore the environment.
Environmental objective Defined by AS/NZS ISO 14001:2004 as an overall
environmental goal, consistent with the environmental policy,
that an organisation sets itself to achieve.
Environmental policy Statement by an organisation of its intention and principles for
environmental performance.
Environmental target Defined by AS/NZS ISO 14001:2004 as a detailed performance
requirement, applicable to the organisation or parts thereof, that
arises from the environmental objectives and that needs to be
set and met in order to achieve those objectives.
EP&A Act Environmental Planning and Assessment Act 1979 (NSW)
EPA NSW Environment Protection Authority
EPBC Act Environment Protection and Biodiversity Conservation Act 1999
(Cmth)
EPL Environment protection licence
GEJV ESR Georgiou Ertech Joint Venture Environment Site Representative
Construction Environmental Management Plan vii
Term Expanded Text
ER Independent Environmental Representative
EWMS Environmental work method statement
GMS Georgiou management system
GEJV Georgiou Ertech Joint Venture
Heritage Act Heritage Act 1977 (NSW)
HSE Health, safety and environment
HSEQ Health, Safety, Environment and Quality
ITS Intelligent Transport Systems
KPI Key performance indicator
MNES Matters of national environmental significance under the EPBC
Act
NEPM National environmental protection measures
Non-compliance Failure to comply with the requirements of the Project approval
or any applicable license, permit or legal requirements.
Non-conformance Failure to conform to the requirements of Project system
documentation including this CEMP or supporting
documentation.
NPW Act National Parks and Wildlife Act 1974 (NSW)
NSW New South Wales
OEH Office of Environment and Heritage
PESCP Progressive erosion and sediment control plan
POEO Act Protection of the Environment Operations Act 1997 (NSW)
Principal, the Roads and Maritime
Project, the The Northern Road Upgrade between Mersey Road and Eaton
Road
QHEST Quality, health, environment and safety tool
RAP Remediation action plan
RMS Roads and Maritime Services
SPIR Submissions and Preferred Infrastructure Report
SWMS Safe work method statement
Construction Environmental Management Plan viii
1 Introduction
Background
The Northern Road Upgrade – Mersey Road, Bringelly to Glenmore Parkway, Glenmore
Park Project (the TNR Upgrade Project) comprises the upgrade of 16 km of The Northern
Road (TNR) as part of the broader Western Sydney Infrastructure Plan. The TNR Upgrade
Project will be constructed in three separate stages under three separate Construction
contracts. The first stage is contractually known as Stage 4 – between Mersey Road and
Eaton Road (the Project). The Project involves the realignment of 5.7km of The Northern
Road around the Western Sydney Airport site with the construction of a four lane divided
road and the adjustment of public utilities. The Project will be delivered by Georgiou Ertech
Joint Venture (GEJV), comprising Georgiou Group Pty Ltd and Ertech Pty Ltd.
The TNR Upgrade Project was assessed under both State and Federal planning approval
pathways. The TNR Upgrade Project was declared by the NSW Minister for Planning to be
critical State significant infrastructure (CSSI) development under Schedule 5 of the State
Environmental Planning Policy (State and Regional Development) 2011 and was assessed
under Part 5.1 of the Environmental Planning and Assessment Act 1979 (NSW) (EP&A Act).
The TNR Upgrade Project was also subject to approval under the Commonwealth
Environment Protection and Biodiversity Conservation Act 1999 (EPBC Act) due to potential
impacts on Matters of National Environmental Significance (MNES) and Commonwealth
land. It was declared in 2016 by the Federal Minister for the Environment and Energy to be a
‘controlled action’ under the EPBC Act. In addition, the TNR Upgrade Project has been
determined a ‘controlled action’ under the EPBC Act due to potential impact on
Commonwealth land and Commonwealth listed endangered ecological communities. The
TNR Upgrade project was also subject to approval under the Commonwealth Environment
Protection and Biodiversity Conservation Act 1999 (EPBC Act) due to potential impacts on
Matters of National Environmental Significance (MNES) and Commonwealth land. It was
declared in 2016 by the Federal Minister for the Environment and Energy to be a ‘controlled
action’ under the EPBC Act.
A single Environmental Impact Statement (EIS / Draft EIS) was prepared for the TNR
Upgrade Project to satisfy the environmental assessment requirements of both Part 5.1 of
the EP&A Act and Part 8 of the EPBC Act. Following public display of the EIS, a
Submissions and Preferred Infrastructure Report (SPIR) was prepared to respond to issues
raised, propose design refinements and provide revised environmental management
measures (REMMs). The SPIR was submitted to the NSW Minister for Planning. A Final EIS
satisfying the requirements of the EPBC Act was submitted to the Federal Minister for the
Environment and Energy in December 2017.
Approval under the EP&A Act was granted by the Minister for Planning on 30 May 2018.
Approval under the EPBC Act was granted by the Federal Minister for the Environment and
Energy on 15 June 2018.
An Overarching Construction Environmental Management Plan (OACEMP) has been

developed by Roads and Maritime to address the NSW and Federal conditions of approval
and the management measures presented in the EIS and SPIR, Roads and Maritime
specifications and all applicable legislation.
Construction Environmental Management Plan 1
Purpose of this CEMP
This Construction Environmental Management Plan (CEMP) and sub plans have been
developed in accordance with the Overarching Construction Environmental Management
Plan (OACEMP), conditions of approval (CoA), management measures detailed in the EIS,
SPIR, relevant Roads and Maritime QA Specifications and the Guideline for the Preparation
of Environmental Management Plans (DIPNR, 2004). This CEMP is consistent with AS/NZS
ISO 14001: Environmental Management Systems, ISO 9001: Quality Management System
and AS/NZS 4801: Safety Management Systems.
This CEMP has been prepared to outline and describe how the NSW Minister for Planning’s
Conditions of Approval (NSW-CoA) and the Federal Minister for the Environment and
Energy’s Conditions of Approval (Federal-CoA) will be complied with during the Construction
of the Project.
The purpose of this CEMP is to provide a structured approach to the management of

environmental issues during Construction of the Project. Implementing this CEMP effectively
will ensure that the Project Team meets regulatory and contract requirements in a systematic
manner and continually improves its environmental performance.
In particular, this CEMP provides:

 A schedule for compliance auditing
 A program for analysis of the key environmental risks arising from the Construction of
the Project
 Procedures for rectifying non-compliances
 A list of the Sub-plans prepared under this CEMP
 Details of training, inductions and awareness programs for Construction personnel
 A mechanism for periodic review and update of the CEMP and associated plans and
programs
 A description of the Project in detail including activities to be undertaken and relative
timing
 Specific mitigation measures and controls that can be applied on-site to avoid or
minimise negative environmental impacts
 Specific mechanisms for compliance with applicable policies, approvals, licences,
permits, consultation agreements and legislation
 A description of the environmental management related roles and responsibilities of
personnel
 Objectives and targets for issues that are important to the environmental performance
of the Project
 An outline of a monitoring regime to check the adequacy of controls as they are
implemented during Construction.
This CEMP is the overarching document in the environmental management system for the
Project that includes a number of management documents. These are described in Section
3. It is applicable to all staff and sub-contractors associated with the Construction of the
Project.
This CEMP will be available to all personnel and sub-contractors via the Project document
control management system and onsite. This CEMP will be made available for public
inspection on the Project website. Confidential information, which may include the location of
threatened species, Aboriginal objects or places and personnel contact details, will be
removed from all documents provided or made available to the public.
1.2.1 Conditions of approval

This CEMP and its sub-plans (see Appendices, Section B) have been prepared in
accordance with the OACEMP and relevant CoAs. This CEMP meets the requirements of the
NSW and Federal conditions relating to the preparation of a CEMP.
Issue-specific sub-plans have been prepared to address CoAs relevant to specific

environmental aspects and issues and to meet environmental objectives and targets
throughout Construction. The issue-specific sub-plans also address how the revised
environmental management measures detailed in the SPIR will be implemented during
Construction. The issue-specific sub-plans are provided as appendices to this CEMP. A list
of the sub-plans and their associated procedures and plans required under the NSW and
Federal CoA is provided in Appendix A5.
Other relevant management measures to be addressed in Construction (including socio-

economic and land use, urban design and visual impact, hydrology and flooding, hazards
and risks, pesticides, fire management and cumulative impacts) which have not been
addressed in the sub-plans are provided in Appendix B9.
1.2.2 Ecologically Sustainable Development

This CEMP incorporates the principles of ecologically sustainable development. This is
further reflected in the Construction Sustainability Management Plan (Appendix B10), which
outlines the management measures to be implemented by GEJV during Construction to
achieve the sustainability measures identified in the EIS and SPIR.
Consultation
Consultation with the community, relevant stakeholders and agencies by GEJV will occur
throughout the Construction of the Project. The approach to community consultation is
documented in the Community Communication Strategy (CCS) and the GEJV Construction
Community Liaison Plan, described in Section 5.5.3 of the CEMP. GEJV will undertake
consultation activities in accordance with the principles and processes outlined in the CCS.
Certification and approval

This CEMP will be approved by the GEJV Project Manager and a Representative from the
Georgiou Health Safety and Environment (HSE) Department. This CEMP has been reviewed
by the Roads and Maritime Environmental Manager (or delegate) and the ER to ensure
consistency with the approved OACEMP.
Distribution
This CEMP applies, and is available to all personnel and sub-contractors associated with the
Construction of the Project via the Project document control management system.
This document is uncontrolled when printed. One controlled hard copy of the CEMP and
supporting documentation will be maintained at the Project office. The CEMP will also be
available in electronic form on the Project website.
Registered copies of this CEMP will be distributed to:
 GEJV Project Manager
 GEJV ESR
 Roads and Maritime Representative
 Roads and Maritime between Mersey Road and Eaton Road Project Manager
 Roads and Maritime Community and Stakeholder Engagement Advisor
 Environmental Representative (ER).
Revision
This CEMP and other related documents will be reviewed at least annually during the
Executive Review, and as a result of:
 Changes to Georgiou procedures or processes
 Changes to key personnel or resources
 Changes in legal and other obligations
 The continuous improvement process
 Instructions from Roads and Maritime.
This CEMP will be reviewed within one month (or as otherwise agreed with the Secretary) of
any of the following occurrences:
 Identification of matters that require attention following an environmental audit
 A reportable environmental incident or near miss
 Significant changes to site conditions and/or work methods
 Identification of new risks, including risks identified during risk register updates
 Identification of non-compliances
Should the review process identify any issues or items within the environmental
documentation that are in need of updating, the Environmental Site Representative will
update the CEMP. Revisions to this CEMP will be approved by the GEJV Project Manager.
Any revisions to this CEMP will be issued to the Roads and Maritime Environmental Manager
(or delegate) for review.
Revised versions of this CEMP will be made available through the document control process
described in Section 6.7.2.
Reviews will be undertaken in consultation with key stakeholders to ensure all

locations/functions are considered. A record of the date and comments relating to any
revisions of this CEMP will be included in the revision table.
2 Project description
Project overview
Roads and Maritime proposes to realign 5.7 km of The Northern Road around the Western
Sydney Airport site with the construction of a four lane divided road and the adjustment of
public utilities (the Project). An overview of the key features of the Project is provided in
Figure 2-1.
The Project will improve traffic flow and connectivity in the western Sydney region and
facilitate the construction of the Western Sydney Airport.
The Project extends from Mersey Road, Bringelly to Eaton Road, Luddenham and traverses
the local government area of Liverpool, approximately 45 km west of the Sydney central
business district.
Figure 2-1: Project location and key features
Construction activities and sequence
Key features of the Project works include:
 Construction of approximately 5.7 km of The Northern Road including clearing and
grubbing, earthworks, stormwater drainage, subsurface drainage and pavement
 Construction of three-way traffic light intersection at Leppington Pastoral Company,
Airport access and tie-in at new and existing The Northern Road
 Construction of approximately 300 m of The Northern Road (East) connecting to
existing The Northern Road
 Construction of three drainage culverts and two stock underpasses
 Construction of and switching traffic onto interim southbound carriageway from
Leppington Pastoral Company and Eaton Road
 Construction of footpaths and shared pedestrian/cycle paths
 Adjustment of utilities and construction of Intelligent Transport Systems (ITS)
 Landscaping
 Property adjustment.
The proposed sequence of Construction activities for the Project is as follows below.
A detailed Construction staging plan and Construction program will be developed prior to
commencement of Construction in consultation with Roads and Maritime.
Early works
 Aboriginal and non-aboriginal heritage salvage works
 Building and structure condition surveys of all buildings and structures within the
distances listed in Annexure E of Specification G36
 Establishment of no-go areas and site boundary
 Construction of ancillary facilities
 Property adjustments, including fencing
 Installation of erosion and sediment controls
 Installation of noise mitigation measures
 Clearing and grubbing activities, including removal of vegetation for compound site
and ancillary facilities
 Establishment of stockpile and compound sites
 Notification of residents of Construction work
 Installation of Construction signage and advisory signs
 Relocation of utilities and services
 Preparation of building condition surveys.
Earthworks
 Stripping, stockpiling and management of topsoil and unsuitable material
 Vegetation clearing
 Installation of further environmental controls
 Excavation and fill to road formation levels, including excavations for embankments
and cuttings and boxing out the new pavement
 Importation of fill material
 Disposal of unsuitable and/or surplus excavated material to other project sites or a
licensed facility
 Construction of retaining walls
 Installation of road drainage infrastructure.
Road work
 Construction of temporary haul roads
 Importation, placement and compaction of fill material
 Placing, compacting and finishing of road surface sub-base and base layers
 Placing, compacting and finishing of asphalt road surface base layers
 Construction drainage
 Modification of existing stormwater systems including water management ponds and
culverts
 Installation of kerbing and barriers
 Road widening
 Intersection works
 Finishing work, such as line marking; kerb and gutter construction; installation of
safety barriers, street lighting and sign posting; and landscaping
 Decommissioning and rehabilitation of temporary ancillary facilities and temporary
works
 Implementation of traffic management and access measures, including speed
reduction, temporary traffic controls and signs
 Clearing and grubbing activities, including removal of vegetation for access roads and
bridge piers
 Removal and stockpiling of topsoil
 Dam dewatering
 Longitudinal and transverse drainage work
 Earthworks involving excavation and fill, including stockpiling of material
 Hauling, spreading and placing of select material for road construction
 Building of road surfaces consisting of bound and unbound granular material such as
aggregates, lean mix concrete and bitumen seals
 Building of kerbs and shoulders
 Construction of pavements
 Placement of asphaltic concrete
 Building of roadside furniture, including safety barriers and fencing
 Installing signs and line marking
 Topsoiling and landscaping
 Decommissioning of stockpiles and compound site
 Revegetation of all ancillary areas.
Post-Construction
 Condition surveys of all buildings and structures for which pre-Construction condition
surveys were undertaken
 Maintenance of landscaped areas.
Construction activities, plant and equipment and approximate duration of activities are
provided in Table 2-1.
Table 2-1: Construction activities and sequencing
Construction Proposed work Plant and equipment Approximate

activity duration
Early works  Notification of residents of Construction work  Trucks 6 months

 Leasing or acquisition of land  Light vehicles
 Installation of Construction signage and advisory signs  Generators
 Installation of environmental controls  Crane
 Preparation of dilapidation and building condition surveys  Bobcat
 Adjustment, relocation and protection of public utilities and services  Excavator
 Site establishment activities, such as:
- establishment of temporary ancillary facilities
- establishment of Construction site fencing, signage and lighting
- establishment of Construction site access points, traffic management
measures, alternative public access routes, diversions and minor road
modifications if required
- demolition of redundant structures on acquired/leased land
- relocation and/or removal of farm infrastructure
 Activities prior to vegetation clearing, including:
- pre-clearing surveys
- marking out ‘no go’ zones
- identifying fauna habitat trees and fauna release areas
 Establishment of temporary drainage
 Aboriginal heritage salvage
 Non-Aboriginal heritage salvage
 Contamination investigations
 Construction of temporary sediment basins
Earthworks  Stripping, stockpiling and management of topsoil and unsuitable material  Light vehicles 18 months
 Vegetation clearing  Excavator
activity duration
 Installation of further environmental controls  Dump trucks
 Excavation and fill to road formation levels, including excavations for  Compactors
embankments and cuttings and boxing out the new pavement  Bulldozers
 Importation of fill material  Graders
 Disposal of unsuitable and/or surplus excavated material to other project  Water carts
sites or a licensed facility
 Bobcat
 Construction of retaining walls
 Installation of road drainage infrastructure
Road work  Construction of temporary haul roads  Excavators 4 months
(widening and  Minor demolition of kerbs, other road elements and other structures  Bulldozers
new roads) and
intersections  Removal and stockpiling of topsoil  Water carts
 Excavation of any excess or geotechnically unsuitable subsoils  Graders
 Cut to fill operations including the removal of spoil  Dump trucks
 Importation, placement and compaction of fill material  Vibrating rollers
 Placing, compacting and finishing of road surface sub-base and base  Spray sealing
layers equipment
 Placing, compacting and finishing of asphalt road surface base layers  Asphalt paving
 Installation of new drainage infrastructure and any other services machines
 Modification of existing stormwater systems including water management  Concrete saws
ponds and culverts  Compactors
 Installation of traffic lights  Cranes
 Installation of kerbing and barriers  Slip-forming machines
 Finishing work, such as line marking; kerb and gutter construction;  Concrete pumps
installation of safety barriers, street lighting and sign posting; and  Concrete trucks
landscaping
 Decommissioning and rehabilitation of temporary ancillary facilities and
temporary works
Drainage work  Excavation, compaction and installation of drainage pipes and pits  Light vehicles 15 months
activity duration
 Construction of table drains  Excavators
 Installation of culverts and other drainage structures  Generators
 Construction of temporary diversion channels  Jackhammers
 Construction of temporary watercourse crossings such as causeways  Concrete pumps
 Dewatering of farm dams, if required  Concrete trucks
 Removal of temporary drainage structures  Cranes
 Compactors
 Boring machines
 Bobcats
Pavements  Placing select material (usually crushed rock, natural gravels or suitable  Light vehicles 18 months
soils)  Excavators
 Placing, compacting and finishing concrete to form sub-base pavements  Generators
 Placing, compacting and finishing the open grade or dense grade asphalt  Asphalt paving
wearing course machines
 Widening, changes in configuration, removal, milling and pavement build-  Concrete trucks
up and resurfacing
 Cranes
 Pavement marking
 Concrete saws
 Compactors
 Slip-forming machines
 Concrete pumps
 Generators
Utility relocation  Relocation of transmission lines, low voltage cables, gas mains, optic  Light vehicles 15 months
fibre and coaxial cables  Excavators
 Construction of new driveway access points  Generators
 Adjustments to street lighting  Boring machines
 Piling machines
activity duration
 Cranes
 Generators
 Dump trucks
 Plate compactors
 Concrete pumps
 Concrete truck
Finishing work  Line marking  Light vehicles 9 months
 Installation of directional signage and roadside furniture, such as street  Excavators
lighting  Generators
 Landscaping  Dump trucks
 Site demobilisation and rehabilitation of temporary Construction  Concrete trucks
compound sites and other areas of Construction disturbance
 Hydro-mulching
equipment
 Cranes
 Water cart
 Compactor
 Bobcats
 Road marking machine
 Welding equipment
Compounds and ancillary facilities
Ancillary facilities are defined in the Infrastructure Approval as a “temporary facility for
Construction of the Project including an office and amenities compound, Construction
compound, material crushing and screening plant, materials storage compound,
maintenance workshop and testing laboratory”. Any temporary material stockpile areas
located within the Construction footprint are not considered to be an ancillary facility, in
accordance with the Infrastructure Approval definition. Any stockpile area located outside the
Construction footprint will be classified as an ancillary facility and will be required to comply
with the requirements for ancillary facilities. GEJV has developed an Ancillary Facility
Management Plan (AFMP) (Appendix A4). The development of the AFMP requires
consultation with the EPA and Liverpool City Council. The AFMP will be submitted to the
Secretary at least one month prior to the commencement of Construction.
A range of Construction related facilities will be required to build the Project, including site
compounds, site offices, ancillary facilities, stockpile areas and laydown areas. The EIS and
SPIR identified and assessed ancillary facilities for the Project. The locations of ancillary
facilities for the Project, identified as C3-C8, are shown in Figure 2-2. Areas C1 and C2 will
not be used by GEJV..
The main compound facility will be situated at location C8 and will include:
 Office facilities
 Car park for light vehicles and heavy vehicles
 Ablution facilities
 Chemical storage
 Material stockpiles and storage
 Erosion and sediment controls
 Boundary fencing
 Temporary storage and stockpiling of earthworks and pavement material
Other ancillary facilities for the Project will primarily be used for sediment basins, stockpiling
and laydown of materials or minor ancillary facilities. Minor ancillary facilities include sheds,
offices and staff amenities.
Compounds and ancillary facilities will comprise:
 Hardstand parking areas with capacity for all Construction workers
 Materials laydown and storage areas, including purpose-built temporary structures as
required
 Perimeter fencing, including visual screening where necessary
 Temporary acoustic barriers.
Figure 2-2: Proposed compound and ancillary areas for the Project (excludes (C1, C2)
Any additional ancillary facilities identified for the Project that have not been assessed in the
EIS will be assessed in accordance with the criteria in NSW-CoA A15 and NSW-CoA A17,
using the ancillary facilities assessment which is in Appendix A4 of the CEMP. The
assessment will be included in the AFMP and approved by the Secretary. The Environmental
Representative (ER) can assess and approve minor ancillary facilities which include offices,
sheds and staff amenities.
Prior to taking any land for the purposes of ancillary facilities including, Construction
materials and stockpiling a pre-Construction land condition assessment must be conducted.
This must be conducted by an independent environmental consultant with experience in site
environmental inspections and Construction waste management. To satisfy a G36 hold point,
this report must be submitted to the Roads and Maritime Environmental Manager (or
delegate) with any necessary statutory and environmental approvals prior to establishment of
the ancillary facility.
2.3.1 Stockpile locality assessment
Temporary stockpile sites will be required during Construction to store materials for
Construction or materials generated from within the Construction site. The stockpile sites
may be required to store material including, but not limited to:
 Excavated materials to be used in fill embankments and other design features.
 Excavated material unsuitable for reuse in the formation.
 Excess concrete, pavement, rock, steel and other material stored for either future use
in the Project or prior to removal from site.
 Topsoil, mulch, excess timber for landscaping and revegetation works.
Stockpile sites will be established and managed in accordance with the Roads and Maritime
Stockpile Site Management Guideline (Roads and Maritime, 2011) and the Stockpile
Management Protocol (refer to the Construction Soil and Water Management Plan (Appendix
B4)).
3 Environmental Management System Overview
Georgiou Environmental Management System
GEJV will be working under the Georgiou management system (GMS). The GMS provides
an integrated HSEQ framework that manages legal compliance and risks and opportunities
at all levels of the business consistently and effectively. The system comprises elements of
policy, planning, implementation and operation, checking and review and is aligned with the
annual business planning cycle. Georgiou maintains documented policies and procedures to
ensure Georgiou’s aims, priorities and overall objectives are clearly articulated,
communicated and understood at all levels of the organisation.
Georgiou’s Environmental Management System (EMS) is a component of the GMS. It is ISO
14001 certified and meets the requirements of the NSW Government Environmental
Management Guidelines (see Appendix A11).
Environmental Policy and Procedures

Georgiou’s environmental policy describes GEJV’s commitment to continual improvement in
environmental performance and compliance with applicable legal requirements and has been
developed in accordance with requirements outlined in Section 4.2 of ISO 14001.
The environmental policy is displayed on the Project website and at the site office, and
communicated to staff and other interested parties via inductions and ongoing awareness
programs.
A copy of the environmental policy is provided in Appendix A3 of this CEMP.
Relevant EMS procedures for the effective implementation of this CEMP and as detailed in
G36 clause 3.1 are provided with this CEMP. These include:
 Appendix A7 – Roads and Maritime Environmental incident classification and
reporting procedure
 Appendix A9 -Georgiou Nonconformity and corrective and preventative action
procedure
 Appendix A10 - Georgiou auditing, review and inspection standard
CEMP
This CEMP is the overarching management plan for a suite of environmental management
documents including specific sub plans, method statements and procedures. It provides a
structured and systematic approach to environmental management for the Project. The
primary purpose of the system of documentation is to ensure compliance with the OACEMP,
all applicable environmental laws, obligations and approvals specific to the Project and to
minimise potential environmental impacts associated with the .
An overview of the environmental management document system for the Project is shown in
Figure 3-1.The components that combine to from the Project CEMP are shown below.
Draft EIS/EIS (as
State and Federal
exhibited), SPIR and Relevant legislation
Approval
Final EIS
Other environmental OACEMP and

plans and sub-plans
documentation
required under the
Infrastructure Approval
CEMP and sub-plans for
the Project
GEJV EWMS
continuous improvement
Corrective action and
GEJV system
procedures and forms
Monitoring and
inspection
Compliance tracking
Auditing and reporting
Management review
Figure 3-1: Project environmental management document system overview
This CEMP provides the system to manage and control the environmental aspects of the
Project during pre-Construction and Construction. It identifies all requirements applicable to
activities described in Section 2. It also provides the overall framework for the system and
procedures to ensure environmental impacts are minimised and legislative and other
requirements are fulfilled. The strategies defined in this CEMP have been developed with
consideration of the OACEMP developed by Roads and Maritime, the Project conditions of
approval requirements, safeguards and mitigation measures presented in the EIS, SPIR and
Roads and Maritime Specifications. This CEMP establishes the system for implementation,
monitoring and continuous improvement to minimise impacts from the Project on the
environment.
3.3.1 Environmental management sub-plans and strategies
A number of environmental management sub-plans support the CEMP. These documents
are prepared to identify requirements and processes applicable to specific impacts or
aspects of the activities described in Section 4.3. They address requirements of the
conditions of approval, Environment Protection Licence (EPL) conditions, Roads and
Maritime specifications and mitigation measures identified in the environment assessment
documentation.
A list of Construction sub-plans and procedures for the Project, are provided in the table
below.
Table 3-1: Environmental Management Sub-plans and Strategies

Document
Document name Reference/
Location
Construction Traffic Management Plan Appendix B1
Construction Flora and Fauna Management Sub Plan Appendix B2
(includes clearing and grubbing and weed management procedure)
Construction Noise and Vibration Management Sub Plan Appendix B3
Construction Soil and Water Management Sub Plan Appendix B4
Construction Cultural Heritage Management Sub Plan Appendix B5
Construction Air Quality Management Sub Plan Appendix B6
Construction Waste and Energy Management Sub Plan Appendix B7
Construction Contaminated Land Management Sub Plan Appendix B8
Other Management Measures Appendix B9
Construction Sustainability Management Plan Appendix B10
Pollution Incident Response Management Plan (includes emergency Appendix B11
spill procedure)
Construction Community Liaison Plan Appendix B12
3.3.2 Environmental Work Method Statements

Environmental work method statements (EWMS) are prepared to manage and control
activities identified as having high environmental risk. EWMS will be prepared prior to the
commencement of these activities and will incorporate relevant mitigation measures and
controls from management sub plans. EWMS are specifically designed to communicate
requirements, actions, processes and controls to Construction personnel using plans,
diagrams and simply written instructions.
EWMS will be reviewed by the Roads and Maritime Project Manager, Roads and Maritime
Environmental Manager (or delegate) and ER prior to the commencement of the
Construction activities to which they apply. For EWMS of activities identified as having high
environmental risk, GEJV will consult with stakeholders and authorities prior to approval.
GEJV will provide a list of upcoming/future EWMS to the Environmental Review Group
(ERG) participants during regular meetings for consultation.
The activities which require an EWMS to be developed include:
 Activities assessed as having high environmental risk in the Construction Risk
Assessment Workshop, these include
 Erosion and Sediment Management
 Dewatering
 Clearing and Grubbing
 Out of Hours Work (OOHW)
 Asbestos Containing Material Management
 Activities that impact on or are in proximity to environmentally sensitive areas and
Aboriginal and non-Aboriginal heritage sites, including Lawson’s Inn and Miss
Lawson’s Guest House archaeological sites
 Activities that impact on or are in proximity to waterways including Badgerys Creek
 Pre-Construction activities including (as relevant):
 delineation of sensitive areas
 installation of erosion and sedimentation controls
 heritage excavation and salvage
 treatment of contaminated sites.
 Topsoil stripping including temporary stockpiling and disposal of excavated material
and protocols for the management of materials containing asbestos
 Utilities relocation
 Compound and ancillary facility establishment and use
 Contaminated land
 Activities that involve work in waterways or that pose a risk to receiving water quality,
for example
 Construction and operation of sediment basins and/or buffer swales and
connecting drainage for the associated catchment area
 Construction of culverts, including associated staging, flow diversions, any
dewatering, short and long term stabilisation and removal of existing structures
 Vegetation clearing and grubbing
 Activities where construction water may be discharged into natural waterways
 Construction and operation of concrete wash out areas.
 Activities that generate high levels of noise and/or vibration (where there are nearby
receptors)
 All works associated with rehabilitation of farm dams including but not limited to
dewatering and filling.
The Construction Risk Assessment Workshop (CRAW) has been used to develop risk
mitigation and management strategies to eliminate or reduce the exposure of risk. These risk
mitigation strategies will be integrated in the relevant EWMS in further detail. The proposed
mitigation measures will be consistent with the environmental safeguards and management
measures listed in the EIS and SPIR, and all relevant Roads and Maritime Specifications and
guidelines. All Construction personnel and sub-contractors undertaking a task governed by a
EWMS must participate in training on the EWMS, and acknowledge that they have read and
understood their obligations prior to commencing work. An EWMS register and EWMS
training register are located at Appendix A8 of this CEMP.
Regular monitoring, inspections and auditing against compliance with the EWMS will be
undertaken by Project management, quality, and environmental personnel to ensure that all
controls are being followed and that any non-conformances are recorded and corrective
actions implemented.
3.3.3 Progressive Erosion and Sediment Control Plans
Progressive Erosion and Sediment Control Plans (PESCPs) are planning documents that
clearly show the site layout and the approximate location of erosion and sediment control
structures onsite. They cover all Construction stages from initial vegetation clearing through
to rehabilitation when erosion and sediment control are no longer required and are removed.
PESCPs will be developed and implemented across the Project where there is a risk of
erosion and sediment loss.
PESCPs may be produced in conjunction with EWMS to provide more detailed site-specific
environmental mitigation measures.
PESCPs will be developed by personnel who have completed a training course in Blue
Books I & 2D and Erosion and Sedimentation Control and who have suitable experience in
preparing these plans. PESCPs will be reviewed by the Project Soil Conservationist (whom is
CPESC Certified) prior to installation.
Drawings for PESCPs will be prepared progressively for sections of the site where work is to
commence and will be submitted at least ten days prior to the disturbance of the surface of
the section of the site as per Roads and Maritime Specification G38 Hold Point 3.1.1.
As per Roads and Maritime Specification G38 Witness Point 3.1.1, GEJV will prepare written
advice, including signed approval by the GEJV ESR and Superintendent, that the measures
described in the PESCP and included on the drawing submitted progressively for that section
of the Site, including sediment basins and other water quality structures together with
associated temporary or permanent connecting stormwater drainage lines and/or catch
drains, have been implemented or the date by which implementation will be completed. The
advice must be forwarded at least five working days before the works are to commence.
3.3.4 Sensitive area maps

To assist Pre-Construction planning and on-site Construction management, the
environmental site constraints are consolidated on a series of map-based sheets that extend
the length of the Project. Sensitive area maps include information pertaining, but not limited
to:
 Noise and vibration sensitive receivers e.g. residential dwellings
 Flora features, including threatened species and endangered ecological communities
 Aboriginal and non-Aboriginal heritage sites, including items, places, objects, sites
and exclusion zones
 Local waterways
 Recorded threatened fauna sightings
 National Parks / Nature Reserves
 Actual and potential habitat for Cumberland Plain Land Snail
 Areas of vegetation to be retained
 Potential or actual acid sulphate soil areas
 Contaminated sites
 Monitoring locations for groundwater, surface water and dust.
The sensitive area maps are presented in Appendix A6. They are a working element of the
CEMP and will be revised throughout Construction to reflect true ground conditions and the
most up-to-date information available on sensitive sites. Sensitive area maps will be used in
conjunction with EWMS to help identify key risk areas and to promote ongoing
communication to Construction personnel during the Project.
3.3.5 Ancillary Facilities Management Plan
A separate Ancillary Facility Management Plan (AFMP) has been developed by GEJV in
consultation with Liverpool City Council and the EPA, which details the management of the
ancillary facilities. This AFMP is to be approved by the Secretary prior to establishment of the
proposed ancillary facilities onsite. Information on ancillary facilities assessment is provided
in Appendix A4.
3.3.6 Environmental system procedures, forms and other documents

The Project EMS procedures, forms and other documents provide instructions and records
related to both environmental and non-environmental activities throughout Construction.
GEJV has developed Project specific procedures in accordance with the requirements for the
Project. Where applicable, existing procedures and work instructions will be applied or
amended during the Project.
GEJV has prepared and will maintain a register of relevant environmental procedures and
forms in Appendix A5 of this CEMP.
4 Planning
Project environmental obligations
All Construction personnel working on the Project have the following general obligations:
 Minimise pollution of land, air and water
 Use pollution control equipment and keep it in proper working order
 Preserve the natural and cultural heritage environment
 Give notice to Roads and Maritime and relevant authorities of a non-Aboriginal or
Aboriginal heritage discovery
 Minimise the occurrence of offensive noise. Where a noise management level has
been exceeded, undertake review and investigate what reasonable and feasible
actions can be implemented
 Minimise intrusion and disruption to agricultural operations/activities in surrounding
properties (e.g. stock access, access to farm dams, etc.), unless otherwise agreed by
the landowner
 Keep the community informed of Project milestones, upcoming activities and duration
of relevant aspects of the works
 Use equipment with noise control features where available and ensure that it is
properly maintained
 Take all feasible and reasonable steps to ensure compliance with the requirements of
this CEMP.
Legal and other requirements

4.2.1 Legislation
A register of legal and contractual requirements for the Project is contained in Appendix A1.
GEJV will maintain this register. GEJV will review the register at regular intervals, such as
during management reviews (refer Section 6.8), and update with any applicable changes.
Any changes made to the legal requirements register will be communicated to the wider
Project Team, including sub-contractors where necessary, through toolbox talks, specific
training and other methods detailed in Section 5.3.2 of this CEMP.
4.2.2 Approvals, Permits and Licensing

Table 4-1 sets out the approvals and licences that have been or will be obtained for the
Project:
Table 4-1: Licenses, Permits and Approvals

Approval/Permit/License Responsibility Status
Infrastructure Approval under Part Roads and Approval dated 30 May 2018
5.1 of the EP&A Act – SSI 7127 Maritime
granted by the Minister for
Planning
Commonwealth controlled action Roads and Approval dated 15 June 2018
approval from the Department of Maritime
the Environment and Energy under
Part 8 of the EPBC Act
Approval/Permit/License Responsibility Status
Environmental protection licence Roads and Roads and Maritime Roads and
(EPL) under the Protection of the Maritime /GEJV Maritime has obtained EPL 21121
Environment Operations Act 1997 and has transferred it to GEJV. . As
for the extraction of more than GEJV will be operating under the
30,000 tonnes per year of Georgiou EMS, Georgiou will hold
extractive materials and road the EPL.
construction
Water Access Licence for the GEJV Roads and Maritime projects are
Project under the Water exempt from obtaining an approval
Management Act 2000 for access for water used for road construction
to surface or ground water during and maintenance
Construction
Water Supply Works Approval GEJV GEJV will need to obtain water
under section 92 of the Water supply works approvals for the set
Management Act 2000 up and use of any water extraction
infrastructure, including, bores,
pumps and standpipes
Road Occupancy Licences GEJV To be applied for as required.
An aquifer interference approval GEJV To be applied for as required.
under the Water Management Act
2000 if Construction requires
intersection of a groundwater
source.
At least five days prior to the activity, the Roads and Maritime Project Manager will be
provided with evidence of the receipt of approval, licenses and or permit from the relevant
authority as per Hold Point G36 Cl 3.2.2.
Pre-Construction land condition assessment reports will be provided for each area GEJV
intends to use for site facilities and evidence of any necessary statutory and environmental
approvals as per Hold Point G36 Cl 4.15.2. All necessary licences, permits and approvals
required for the Project will be obtained and maintained as required throughout the life of the
Project.
Environmental aspects and impacts

A risk management approach will be used to determine the severity and likelihood of an
activity’s impact on the environment and to prioritise its significance. This process considers
potential regulatory and legal risks as well as taking into consideration the concerns of
community and other key stakeholders.
The objectives of risk assessment are to:
 Identify activities, events or outcomes that have the potential to adversely affect the
local environment and/or human health/property.
 Qualitatively evaluate and categorise each risk item.
 Assess whether risk issues can be managed by environmental protection measures.
 Qualitatively evaluate residual risk with implementation of measures.
Risk assessments for the Project are based on AS/NZS 4360:1999, the Australian standard
for risk assessments.
Each specified sub-plan includes a section on environmental aspects and impacts which list
the activities associated with the Project, related aspects and corresponding risks.
Appendix A2 contains a list of overall Project environmental aspects and impacts. GEJV has
updated and developed the aspects and impacts listed in Appendix A2 based on the
outcomes of the risk assessment workshop (Section 4.3.1).
Where relevant, the requirements from the Roads and Maritime Environmental
Specifications, CoA and Revised Environmental Management Measures (REMMS) will be
incorporated into the environmental risk assessment, particularly in developing the agreed
activity specific site controls.
4.3.1 Environmental risk assessment workshop

An Environmental risk assessment workshop was held (as part of the Construction Risk
Assessment Workshop (CRAW)) by GEJV as per specification G36, clause
3.2.1.Participants included; the Roads and Maritime Representative, GEJV’s site
management and environmental personnel, the ER and other relevant personnel including
subcontractors who will be performing work on the Project.
The risk workshop identified high risk activities. Each activity was assessed to identify the
relevant steps in the activity and the associated environmental hazards, initial risk levels,
mitigation measures and to avoid, manage and/or minimise the risks and residual risks. Each
of these items is documented in the Aspects and Impacts Register (Appendix A2). Where
residual risks were assessed as high, or if required under the Contract Specification, GEJV
will develop an EWMS for that activity.
The workshop was also used to raise general awareness of good environmental
management practices among GEJV’s staff and subcontractors working on the Project, as
well as to develop ideas and actions to improve environmental practices.
Following the CRAW the CEMP was updated with the identified significant Environmental
risks and the agreed mitigation measures. The CEMP will be reviewed during the monthly
risk register reviews where new risks are identified. Where required, the CEMP will be
updated and submitted to Roads and Maritime and the ER for approval.
4.3.2 Ongoing risk analysis

Works on site will be undertaken in accordance with the HSE Risk Register. The HSE Risk
Register will be made available to workers.
Review and, if necessary, update of the Project risk register is an ongoing process which will
occur, as a minimum:
 When a risk has been identified
 Where there is a change in work systems, materials, equipment, practices or
procedures on site
 In response to incidents
 Where new information about an environmental risk becomes available or where
personnel raise concerns about an environmental risk.
 At regularly scheduled times, including during reviews of the Project risk register at
the Project meetings and the quarterly management review meetings (refer Table 6-
5).
Where new risks are identified, GEJV will include these in the risk register, assess the risks
and implement control measures to eliminate or minimise the level of risk. Monitoring and
review of the effectiveness of control measures will be carried out during weekly
environmental inspections and may include consultation with site personnel involved in
managing the identified risks.
Environmental objectives and targets

As a means of assessing environmental performance during Construction of the Project,
environmental objectives and targets have been established. These objectives and targets
have been developed with consideration of key issues identified through the environmental
assessment and risk assessment process. The objectives and targets are consistent with
Georgiou’s environmental policy and will assist in monitoring whether the commitments of the
policy are being met.
The targets are incorporated into relevant environmental management sub-plans.
The performance of the Project against the objectives and targets will be documented in the
GEJV’s monthly reports, the six monthly Construction compliance reports and on a quarterly
basis as part of the management review.
Environmental objectives and targets for the Project are provided in the table below.
Table 4-2: Environmental objectives and targets
Objective Target Measurement tool

Construction of the Project in  Full compliance with statutory Audits, construction
accordance with approvals compliance reporting,
environmental approvals management reviews
Compliance with all legal  No regulatory infringements (PINs Audits, construction
requirements or prosecutions) compliance reporting,
management reviews
 No formal regulatory warning
Implement a rigorous and  Address non-conformances and Audits, management
comprehensive EMS that corrective actions within specific reviews
meets the requirements of timeframes
AS/NZS ISO 14001
Engage with the effected and  Disseminate regular Project Review complaints
broader community, minimise updates and other information register, construction
complaints and respond to through the Project website and compliance report,
any complaints within a other tools identified in the audits
suitable timeframe Community Communication
Strategy and Construction
Community Liaison Plan
 Record and respond to complaints
within the timeframe specified in
the Community Communication
Strategy and Construction
Community Liaison Plan.
Objective Target Measurement tool
Continuously improve  Develop and maintain a program of Construction compliance
environmental performance ongoing environmental training report, training needs
analysis,
 Capture lessons learnt from
environmental incidents to Environmental
minimise repeat issues management reviews
 Regular review and update of the Revisions of
aspects and impacts register, legal management plans in
register and environmental response to incidents or
induction NCRs
Audits, reporting,
management reviews
Revisions of
management plans in
response to incidents or
NCRs
Risk register
Implement sustainability  Enhance positive environmental, Measure, monitor and

initiatives on the Project social and economic outcomes report on the
wherever possible, while implementation of the
minimising adverse impacts, sustainability initiatives
resource use and embodied identified in the
impacts Construction
 Adopt sustainability leadership and Sustainability
continual improvement Management Plan
(Appendix B10)
 Integrate governance,
environmental, social and
economic considerations into
decision-making processes within
the Project
5 Implementation and operation
Resources, roles, responsibilities and authority
The key environmental management roles and responsibilities for the Construction phase of
the Project are described below. The structure of these roles is shown in Figure 5-1.
5.1.1 Environmental Representative (ER)

The environmental responsibilities of the ER are detailed in NSW-CoA A24 and include:
 Receive and respond to communication from the Secretary in relation to the
environmental performance of the Project
 Consider and inform the Secretary on matters specified in the terms of the
Infrastructure Approval
 Consider and recommend to Roads and Maritime and GEJV any improvements that
may be made to work practices to avoid or minimise adverse impact to the
environment and to the community
 Review documents identified in NSW-CoAs C1, C4 and C9 and any other documents
that are identified by the Secretary, to ensure they are consistent with requirements in
or under the Infrastructure Approval and if so:
– Make a written statement to this effect before submission of such documents to
the Secretary (if those documents are required to be approved by the
Secretary) or
– Make a written statement to this effect before the implementation of such
documents (if those documents are required to be submitted to the Secretary /
Department for information or are not required to be submitted to the
Secretary/Department)
 Regularly monitor the implementation of the documents listed in NSW-CoAs C1, C4
and C9 to ensure implementation is being carried out in accordance with the
document and the terms of the Infrastructure Approval
 As may be requested by the Secretary, help plan, attend or undertake audits of the
development commissioned by the Department including scoping audits,
programming audits, briefings and site visits, but not independent environmental
audits required under NSW-CoA A35
 As may be requested by the Secretary, assist the Department in the resolution of
community complaints
 Assess the impacts of minor ancillary facilities comprising lunch sheds, office sheds
and portable toilet facilities as required by NSW-CoA A17 and
 Prepare and submit to the Secretary and other relevant regulatory agencies, for
information, an Environmental Representative Monthly Report providing the
information set out in the Environmental Representative Protocol (DP&E, 2017) under
the heading "Environmental Representative Monthly Reports." The Environmental
Representative Monthly Report must be submitted within seven calendar days
following the end of each month for the duration of the ER's engagement for the
Project, or as otherwise agreed with the Secretary in accordance with NSW-CoA A26,
facilitate and assist the Secretary in any audit of the ER’s exercise of its functions
under NSW-CoA A24.
Roads and Maritime Project Director
John Navamani
Roads and Maritime Senior Environmental Environmental Review Group

Project Manager Representative (ER) (ERG)
Jeff Gilham Cameron Weller Reps from DP&E, OEH, EPA,
(alt Peter Morrall) DPI, RMS ER
Roads and Maritime Project Construction Project Roads and Maritime

Manager Manager Community and Stakeholder
Engagement Advisor
Easwaran Veeragathipillai Adam Boyd
Kamini Parashar
Roads and Maritime Construction Manager Roads and Maritime

Environmental Manager Sustainability Coordinator
Shane Cahill
Anthony Eland Mark Gethings
Owen Clarke and Jim Steen
(delegates)
Environmental Site Community Relations

Representative Superintendent
Manager
Peter Sheehan Jamie Barry
Robert Parker
Legend
*Other roles: Senior Project Engineers
Sustainability Manager Richard Kelly, Karl Reusche Roads and Maritime personnel
Traffic Manager
Utilities Coordinator
GEJV personnel
Ecologist
Supervisor / Foreman
Soil Conservationist
Environmental Scientist/ Independent
Engineer
Project Team
*Information describing the

environmental responsibilities of other
roles is provided in the relevant sub-
plan.
Figure 5-1: Management structure between GEJV and Roads and Maritime
5.1.2 Environmental Review Group (ERG)
The purpose of the ERG is to ensure prompt and effective consultation and resolution of
environmental issues raised by or affecting Government agencies, Council, Roads and
Maritime, the community and the Contractors.
The ERG comprises the ER and representatives of Roads and Maritime, the Project Team,
regulatory authorities (EPA, NRAR, OEH) and local councils (Penrith City Council, Liverpool
City Council).
The ERG will be maintained for the duration of the Project and will meet monthly (or as
otherwise agreed by the regulatory agencies and Roads and Maritime) and undertake
environmental inspections.
The Project Manager and Environmental Site Representative will attend the ERG meetings.
Roads and Maritime roles
5.1.3 Roads and Maritime Project Director

The environmental responsibilities of the Roads and Maritime Project Director include (but
are not limited to):
 Evaluate and advise on high risk compliance issues relating to GEJV and Roads and
Maritime environmental requirements
 Provide GEJV management with environmental advice and/or directions, in
consultation with Roads and Maritime environmental staff.
5.1.4 Roads and Maritime Senior Project Manager

The environmental responsibilities of the Roads and Maritime Senior Project Manager
include (but are not limited to):
 Evaluate and advise on high risk compliance issues relating to GEJV and Roads and
Maritime environmental requirements
 Review and endorse documentation to be submitted to the Secretary of DP&E and the
Federal Minister of DoEE for approval
 Have oversight of the review and approve any environmental management plans for
the Project or related activities that are not required to be approved by the Secretary
of DP&E in consultation with Roads and Maritime environmental staff and the ER.
 Provide GEJV management with environmental advice and/or directions, in
consultation with Roads and Maritime environmental staff.
5.1.5 Roads and Maritime Project Managers

The environmental responsibilities of the Roads and Maritime Project Mangers include (but
are not limited to):
 Evaluate and advise on compliance with Roads and Maritime environmental
requirements
 Review and approve any environmental management plans for the Project or related
activities that are not required to be approved by the Secretary of DP&E
 Provide GEJV staff with environmental advice and/or directions, in consultation with
Roads and Maritime environmental staff.
5.1.6 Roads and Maritime Environmental Manager (or delegate)

The environmental responsibilities of the Roads and Maritime Environmental Manager (or
delegate) include (but are not limited to):
 Review any environmental management plans and related documents prepared for
the Project
 Review and consider minor project refinements that are consistent with the Project
environmental assessment in accordance with the Roads and Maritime Part 5.1
environmental assessment procedure
 Monitor the environmental performance of the Project in relation to Roads and
Maritime requirements
 Provide guidance and where appropriate, monitor compliance with DP&E post
approval document submission requirements.
GEJV Roles
5.1.7 Project Manager

The environmental responsibilities of the Project Manager include (but are not limited to):
 Ensure all works comply with relevant regulatory and Project requirements, including
compliance with the approvals, EPL, REMMs, Roads and Maritime specifications
 Ensure the requirements of the OACEMP and this CEMP are fully implemented, and
in particular, that environmental requirements are not secondary to other Construction
requirements
 Endorse and support the Roads and Maritime and Georgiou environmental policy
attached at Appendix A3
 Liaise with Roads and Maritime, ER and other government authorities as required
 Participate and provide guidance in the regular review of the OACEMP and this
CEMP and supporting documentation
 Provide adequate resources (personnel, financial and technological) to ensure
effective development, implementation and maintenance of the OACEMP and this
CEMP
 Ensure that all personnel receive appropriate induction training, including details of
the environmental and community requirements
 Ensure that complaints are investigated to ensure effective resolution
 Stop work immediately if an unacceptable impact on the environment is likely to occur
 Hold monthly HSEQ management meetings to review environmental performance and
monitor implementation and effectiveness of the management system
 Ensure their direct reports fulfil their environmental responsibilities and achievement
of Key Performance Indicators (KPI)
 Support workers to immediately stop any ‘at risk behaviour’ identified during their work
activities.
5.1.8 Construction Manager
The environmental responsibilities of the Construction Manager include (but are not limited
to):
 Plan Construction works in a manner that avoids or minimises impact to environment
 Ensure the requirements of the OACEMP and this CEMP are fully implemented
 Ensure Construction personnel manage Construction works in accordance with
statutory and approval requirements
 Support the Environmental Site Representative in achieving the Project environmental
objectives
 Ensure environmental management procedures and protection measures are
implemented
 Ensure all Project personnel attend an induction prior to commencing works
 Liaise with Roads and Maritime, the ER and government authorities as required
 Stop work immediately if an unacceptable impact on the environment is likely to occur.
5.1.9 Superintendent
The environmental responsibilities of the Superintendent include (but are not limited to):
 Communicate with all personnel and sub-contractors regarding compliance with the
OACEMP, this CEMP and site-specific environmental issues
 Ensure all site workers attend an environmental induction prior to the commencement
of works
 Co-ordinate the implementation of the OACEMP and this CEMP
 Develop EWMS in consultation with the Environmental Site Representative
 Co-ordinate the implementation and maintenance of pollution control measures
 Identify resources required for implementation of the OACEMP and this CEMP
 Support the Environmental Site Representative in achieving the Project environmental
objectives, including on ground implementation of the EWMS and PESCP
 Report any activity that has resulted, or has the potential to result, in an environmental
incident immediately to the Environmental Site Representative
 Co-ordinate action in emergency situations and allocate required resources
 Stop activities where there is an actual or immediate risk of harm to the environment
and advise the Construction Manager and Environmental Site Representative.
5.1.10 Environmental Site Representative

The Environmental Site Representative will be based on site for the duration of Construction.
The administration of the Project’s environmental management function will be performed by
the Environmental Site Representative with onsite support from the Project and site
engineers. The environmental responsibilities of the Environmental Site Representative
 Overall responsibility for the implementation of environmental matters on the Project
 Review and updating of the CEMP and sub plans in accordance with ISO14001
 Ensure management reviews of the CEMP are undertaken, documented and actions
implemented
 Obtain and update all environmental licences, approvals and permits as required
 Lead liaison with authorities where required in relation to environmental matters
 Manage environmental document control, reporting, inductions and training
 Manage environmental reporting within the Project Team and to Roads and Maritime
and regulatory authorities
 Preparing reports on a monthly basis outlining the Project Works undertaken and the
achievements that have been met, as well as identifying those areas where
improvements were made
 Prepare and/or distribute environment awareness notes
 Develop and review PESCPs
 Monitoring of the CEMP and sub plans in accordance with ISO14001
 Report to Project Manager and other senior managers on the performance and
implementation of the CEMP
 Ensure environmental risks of the Project are identified and appropriate mitigation
measures implemented
 Identify where environmental measures are not meeting the targets set and where
improvement can be achieved
 Ensure environmental protocols are in place and managed
 Ensure environmental compliance
 Oversee site monitoring, inspections and audits
 Notify Roads and Maritime and relevant authorities in the event of an environmental
incident and manage close-out of these
 Stop activities where there is an actual or immediate risk of harm to the environment,
or to prevent environmental non-conformities, and advise the Project Manager,
Construction Manager and Supervisor
 Assist the Project Manager to resolve environment-related complaints
 Advising on environmental matters specified in Roads and Maritime Specifications.
5.1.11 Communications Relations Manager

The environmental responsibilities of the Communications Relations Manager (CRM) include
(but are not limited to):
 Ensure that all community consultation activities are carried out in accordance with
the Community Communication Strategy (CCS) and GEJV’s CCLP.
 Report any environmental issues to the GEJV Environmental Site Representative
raised by stakeholders or members of the community
 Communicate general Project progress, performance and issues to stakeholders
including the community
 Maintain the 24 hour complaints hotline
 Maintain the complaints register in accordance with the Complaints Management
System.
Further details of the CRM’s responsibilities are provided in the CCS.
5.1.12 Project/Site Engineers
The environmental responsibilities of the Project/Site Engineers include (but are not limited
to):
 Provide input into the preparation of environmental planning documents as required
 Ensure that instructions are issued and adequate information provided to employees
that relate to environmental risks on-site
 Ensure that the works are carried out in accordance with the requirements of the
OACEMP and this CEMP and supporting documentation, including the
implementation of all environmental controls
 Identify any environmental risks
 Identify resource needs for implementation of CEMP requirements and related
documents
 Ensure that complaints are investigated to ensure effective resolution
 Take action in the event of an emergency and allocate the required resources to
minimise the environmental impact
incident immediately to the Supervisor and Environmental Site Representative.
5.1.13 Supervisor
The environmental responsibilities of the Supervisor include (but are not limited to):
 Undertake any environmental duties as defined by the GEJV Superintendent or GEJV
Project/Site Engineers
 Control field works and implement/maintain effective environmental controls
 Where required, undertake environmental risk assessment of works prior to
commencement
 Ensure site activities comply with EWMS and relevant records are kept
 Ensure all site workers are site inducted prior to commencement of works
 Attend to any spills or environmental incidents that may occur on-site
incident immediately to the Contractor Superintendent
and advise the GEJV Project Manager, GEJV Construction Manager, GEJV
Superintendent or GEJV Environmental Site Representative.
5.1.14 Wider Project team (including sub-contractors)

The environmental responsibilities of the wider Project Team (including sub–contractors)
 Comply with the relevant requirements of the OACEMP and this CEMP, or other
environmental management guidance as instructed by a member of the Project’s
management
 Participate in the mandatory Project/site induction program
 Report any environmental incidents to the GEJV Supervisor immediately or as soon
as practicable if reasonable steps can be adopted to control the incident
 Undertake remedial action as required to ensure environmental controls are
maintained in good working order
and advise the GEJV Project Manager, GEJV Construction Manager, GEJV
Superintendent or GEJV Environmental Site Representative.
Sub-contractor management
Environmental requirements and responsibilities are to be specified to sub-contractors in the
contract documentation. As part of the selection process, consideration will also to be given
to their past environmental performance. The Environmental Site Representative, or
delegate, will participate in the tender assessment and selection process where it is deemed
necessary due to associated environmental risks. All sub-contractors will be required to
complete a sub-contractor questionnaire or similar.
All sub-contractors are required to work in accordance with the approved OACEMP and
CEMP and will be required to:
 Attend environmental inductions, environmental toolbox talks and all environmental
training relevant to their scope of works
 Attend Project and/or site inductions where the requirements and obligations of the
OACEMP and the CEMP are communicated
 Be involved in the development of EWMS’s and relevant Job Hazard Assessments
(JHA’s) relevant to their scope of work. GEJV will regularly monitor and inspect the
implementation of site compliance of EWMS and JHA’s for compliance with the CEMP
 Maintain any waste disposal, fuel use, water use records and submit to GEJV on a
monthly basis
 Comply with all GEJV permit and procedures that form a part of the CEMP or SMP.
These include; clearing and grubbing permits, dewatering permits, EWMSs etc.
GEJV will as a minimum conduct weekly environmental inspections that cover subcontractor
work areas and ensure any deficiencies in environmental safeguards are rectified by the
subcontractor.
Records of all subcontractors' work practices, effectiveness of environmental protection

measures and compliance with the CEMP will be maintained. GEJV will review all
environmental documentation submitted by sub-contractors before works can begin.
GEJV will regularly review and keep a record of:

 The sub-contractor’s general work practices
 The effectiveness of the sub-contractor’s environmental protection measures
 The sub-contractor’s compliance with the requirements of the OACEMP and this
CEMP
 The maintenance of environmental measures.
All environmental documentation submitted by sub-contractors will be subject to review and

approval by the GEJV to ensure compliance with Roads and Maritime contract requirements
and the CoA, EPL, REMMs and Roads and Maritime specifications before works may begin.
Competence, training and awareness
To ensure that this CEMP is effectively implemented, each level of management is
responsible for ensuring that all personnel reporting to them are aware of the requirements of
this CEMP. The Environmental Site Representative will coordinate the environmental training
in conjunction with other training and development activities (e.g. safety).
A register of all environmental training conducted will be established and maintained on site.
This register will include the specific training conducted, dates, and names of personnel in
attendance and trainer details.
5.3.1 Environmental induction

All personnel (including sub-contractors) are required to attend a compulsory site induction
that includes an environmental component before commencing work onsite. This is done to
ensure all personnel involved in the Project are aware of the requirements of the CEMP and
to ensure the implementation of environmental management measures.
Temporary visitors to site undertaking inspections / entering the site (such as regulators) will
be required to undertake a visitor’s induction and be accompanied by inducted personnel at
all times.
Temporary visitors to site for purposes such as deliveries will be required to be accompanied
by inducted personnel at all times.
The Environmental Site Representative (or delegate) will conduct the environmental
component of the site inductions.
The environmental component will include (but not be limited to) an overview of:
 Relevant details of the OACEMP, this CEMP, including all sub-plans, procedures and
strategies, their purpose and objectives
 Requirements of due diligence and duty of care
 Relevant legislation, and conditions of environmental licences, permits and approvals
 Potential environmental emergencies on-site and the emergency response
procedures
 The PIRMP
 Reporting and notification requirements for pollution and other environmental
incidents
 Key environmental issues
 Mitigation measures for the control of environmental issues
 Complaints response and reporting
 High risk activities and associated environmental safeguards and EWMS
 Site specific environmental management requirements and responsibilities
 Incident and emergency response and reporting requirements
 Information relating to the location of environmental constraints
 Sensitive area plans
 Environmentally sensitive locations and no-go/exclusion zones
 Site flagging protocol
 Erosion and sediment controls, water quality controls and sediment basin
management
 Management of contaminated material (including asbestos impacted material)
 Location of identified potential contaminated land sites
 Signs of contaminated soil, including visual asbestos identification protocols
 Procedure for unexpected finds of contaminated land, asbestos or UXO
 Groundwater and surface water
 Mulch and tannin management
 Stockpile location criteria
 Working near or in drainage lines and creeks
 The location of acid sulfate soils or potential acid sulfate soils
 Water quality management and protection measures
 Groundwater issues
 Obligation to report and the process for reporting environmental issues on-site
including damaged environmental controls
 Obligations under the Biosecurity Act 2015 to prevent the spread of weeds during
Construction
 Responsibilities under the National Parks and Wildlife Act 1974 (NPW Act), including
the need to cease work immediately and report any object of potential Aboriginal
heritage unearthed during clearing, grubbing and earthworks operations
 Responsibilities under the Heritage Act 1977 if an object of potential Non-Aboriginal
heritage is uncovered during Construction
 Location of identified Aboriginal and non-Aboriginal archaeological heritage sites,
areas of cultural sensitivity and areas of archaeological potential and the kinds of
historical relics, structures or deposits which may be encountered during the
Construction works
 Responsibilities under the Contaminated Land Management Act 1997
 Noise, vibration and air quality management controls
 Standard Construction hours and the process for seeking approval for out of hours
works, including consultation
 Noise management measures during night works
 Location of noise, vibration and air quality sensitive receivers
 Road safety
 Road occupancy and other temporary and interim traffic arrangements
 Response procedure for dealing with traffic incidents
 The requirement to maintain surrounding property access for residences, business
owners, and their visitors, and to minimise disruptions to these properties for the
duration of Construction
 The location of refuse bins, washing, refuelling and maintenance of vehicles, plant
and equipment
 Waste minimisation principles, waste reporting and waste / recycle storage
requirements
 Best practice energy efficiency
 Equipment start up and shut down procedures
 Sustainability management measures and initiatives
 Boundaries for vegetation clearing, fauna and fauna habitat management, including
awareness of threatened fauna species and fauna rescue
 Weed control measures
 Specific species likely to be affected by the Construction works and how these
species can be recognised
 Specific responsibilities for the protection of flora and fauna.
A record of all environment inductions will be maintained in a Project induction and training
Register and kept on-site. The training register will identify who is trained, when trained, the
trainer and what they were trained in.
GEJV will provide refresher environmental awareness training as required, but at not less
than six monthly intervals, based on the environmental risk assessment and turnover of
project personnel. Refresher environmental awareness training will be included on the
register of environmental training.
The GEJV ESR may authorise amendments to the induction where required to address
Project modifications, legislative changes or amendments to this CEMP or related
documentation.
The ER will review and approve GEJV’s induction and training program prior to the
commencement of Construction and monitor implementation.
5.3.2 Toolbox talks, training and awareness

Toolbox talks will be one method of raising awareness and educating personnel on issues
related to all aspects of Construction including environmental issues. The toolbox talks are
used to ensure environmental awareness continues throughout Construction.
Toolbox talks will include details of EWMS for relevant personnel. Toolbox talks will also be
tailored to specific environmental issues relevant to upcoming works.
Relevant environmental issues may include (but are not limited to):
 Erosion and sedimentation control
 Environmentally Sensitive Areas - Threatened species and ecologically endangered
communities
 Aboriginal and non-Aboriginal heritage
 Clearing controls and vegetation protection
 Noise and vibration control
 Community management
 Emergency and spill response
 Weed management
 Dust control
 Dewatering
 Out of hours work
Toolbox talk attendance is mandatory, and attendees of toolbox talks are required to sign an
attendance form and the records maintained.
Targeted environmental awareness training will be provided to individuals or groups of

workers with a specific authority or responsibility for environmental management or those
undertaking an activity with a high risk of environmental impact. As a minimum, the
awareness training that will be provided over the course of the program will include the items
identified in Table 5-1:
Table 5-1: Environmental Awareness Training

Training Target attendees Timing (based on risk)
General All workers During the induction and
Environmental 6 monthly refreshers
Awareness
Erosion and Earthworks Supervisors, Engineers, During earthworks phase
Sediment Control plant operators, Labourers
(Basic Blue Book)
Spill response Supervisors, plant operators, labourers During earthworks phase
5.3.3 Daily pre-start meetings

The pre-start meeting is a tool for informing the workforce of the day’s activities, safe work
practices, environmental protection practices, work area restrictions, activities that may affect
the works, coordination issues with other trades, hazards and other information that may be
relevant to the day’s work.
The Superintendent will conduct a daily pre-start meeting with the site workforce before the
commencement of work each day (or shift) or where changes occur during a shift. Daily pre-
start meetings are generally succinct in nature and take approximately 10-15 minutes.
The environmental component of pre-starts will be determined by the Superintendent and

GEJV Environmental Site Representative and will include any environmental issues that
could potentially be impacted by, or impact on, the day’s activities. All attendees will be
required to sign on to the pre-start and acknowledge their understanding of the issues
explained.
Pre-start topics, dates delivered and a register of attendees will be recorded.
5.3.4 Communications Training

All staff (including plant operators and truck drivers) and subcontractor personnel working on
the delivery of the Project will behave in a courteous and professional manner when in
dialogue with any community member.
GEJV will provide all staff, personnel and subcontractors with training and awareness on:
 How to respond to community queries
 Requirements for the release of information
 Identity of the community within which they are working prior to their involvement in
the Construction works.
Community involvement obligations will be included in the site induction of all personnel
working on the Project.
Working hours
5.4.1 Hours of work
In accordance with NSW-CoA E23 and the EPL, work will be undertaken during standard
Construction working hours:
 7:00 am to 6:00 pm Monday to Friday
 8:00 am to 1:00 pm Saturday
 at no time on Sunday or public holidays.
As required by NSW-CoA E24, activities, except as permitted by an EPL, highly noise

intensive works that result in an exceedance of the applicable noise management level at the
relevant receiver must only be undertaken:
 between 8:00 am to 6:00 pm Monday to Friday
 between 8:00 am to 1:00 pm Saturday
 in continuous blocks not exceeding three hours each with a minimum respite from
those activities and works of not less than one hour between each block.
'Continuous' includes any period during which there is less than a one-hour respite between
ceasing and recommencing the work.
All conditions relating to Construction hours outlined in the Project EPL will be complied with.
In accordance with NSW-CoA E25, GEJV will identify and consult with receivers identified as
being subject to levels that exceed the Highly Noise Affected criteria with the objective of
determining appropriate hours of respite unless an agreement is reached with those
receivers.
5.4.2 Variation to hours of work

Works associated with the delivery of the Project may be undertaken outside the hours of
work identified in Section 5.4.1 in the following circumstances:
 for the delivery of materials required by the NSW Police Force or other authority for
safety reasons or
 where it is required in an emergency to avoid injury or the loss of life, to avoid damage
or loss of property or to prevent material environmental harm or
 where it causes LAeq(15 minute) noise levels:
 no more than 5 dB(A) above the day, evening and night rating background level at
any residence in accordance with the Interim Construction Noise Guideline
(DECC, 2009) and
 no more than the noise management levels specified in Table 3 of the Interim
Construction Noise Guideline (DECC, 2009) at other sensitive land uses and
 continuous or impulsive vibration values, measured at the most affected residence
are no more than those for human exposure to vibration, specified in Table 2.2 of
Assessing Vibration: a technical guideline (DEC, 2006) and
 intermittent vibration values measured at the most affected residence are no more
than those for human exposure to vibration, specified in Table 2.4 of Assessing
Vibration: a technical guideline (DEC, 2006) or
 no more than 15 dB(A) above the night time rating background level at any residence
during the night time period, when measured using the LAeq(1 minute) noise
descriptor or
 where different hours are permitted or required under an EPL in force in respect of the
works, in which case those hours must be complied with.
On becoming aware of the need for emergency works in accordance with the above, GEJV
will notify the Roads and Maritime Project Manager, the ER and the EPA’s Environment Line
of the need for those works. GEJV will submit a report to the EPA by 2 pm on the next
business day after the emergency works commenced that describes:
 the cause, time and duration of the emergency
 action taken by or on behalf of the licensee in relation to the emergency
 details of any measures taken or proposed to be taken by GEJV to prevent or mitigate
against a recurrence of the emergency.
GEJV will use its best endeavours to notify all affected sensitive receivers of the likely impact
and duration of those works.
GEJV will prepare a procedure for out of hours work, prepared in accordance with the
Construction Noise and Vibration Guidelines (Roads and Maritime, 2016). The procedure will
be prepared to address the requirements of NSW-CoA E26 and E27 and the EPL relating to
out of hours works (OOHW). The Procedure is provided in the Construction Noise and
Vibration Management sub plan (CNVMP) (Appendix B3)..
Approvals for any changes to the Construction hours outlined in Section 5.4.1 above will be
attached to this CEMP.
5.4.3 Community agreements for works outside of standard Construction hours

Works outside of standard Construction hours that do not meet the circumstances listed in
Section 5.4.2 above may be undertaken if agreement between the GEJV and a substantial
majority of noise sensitive receivers has been reached, where approved under the EPL, for
OOHW not approved by other EPL conditions. Further details of the requirements, including
community consultation, relating to community agreements are provided in the CNVMP.
Communication
5.5.1 Internal communication
Clear lines of communication throughout all levels and functions (e.g. management, staff and
sub-contracted service providers), is key to minimising environmental impacts and achieving
continual improvements in environmental performance.
The Project Team will meet monthly to discuss any issues with environmental management
on-site, any amendments to plans that might be required or any new / changes to
Construction activities.
Regular meetings will also be scheduled with the ER and relevant Roads and Maritime
environmental staff. The purpose of these meetings is to communicate ongoing
environmental performance and to identify any issues to be addressed.
In addition, environmental content will be included in toolbox talks on at least a weekly basis.
This forum will provide an opportunity for the GEJV ESR to communicate on environmental
performance, to advise on any upcoming sensitive environmental matters for future work
areas and to receive feedback from on-site personnel.
All staff and contractors working on the Site will be made aware of the communications
procedures and will be properly trained in its application as per section 5.3.
Further internal communications regarding environmental issues are described below.
5.5.2 External and Government Authority Consultation

The personnel that will be available to be contacted by the EPA and/ or other government
agencies on a 24 hour basis and who have authority to take immediate action to shut down
any activity are:
 Adam Boyd (Project Manager): 0419 501 731
 Jamie Barry (Superintendent): 0447 805 181
The Environmental Site Representative is responsible to report on the ongoing
environmental performance of the Project to Roads and Maritime and EPA. The
Environmental Site Representative will report regularly to Roads and Maritime on progress
and any key environmental matters and to the EPA through EPL reporting requirements.
Roads and Maritime will be immediately notified of any visit to the Site by the EPA or other
Government Agencies. A report will be prepared for each occasion when the Site is visited
by the EPA or other Government Agencies, notifying the Roads and Maritime Project
Manager of the purpose and outcome of the visit, and of all actions taken by GEJV in
response to the visit. This report will be submitted to Roads and Maritime within one (1)
working day of the EPA or other government agency site visit.
5.5.3 Community liaison and notification

5.5.3.1 Community Communication Strategy
A Community Communication Strategy (CCS) and complaints management system (CMS)
has been prepared to document the approach to stakeholder and community
communications and complaints management for the Project. GEJV will support the delivery
of the CCS and CMS.
All community enquiries and complaints related to the Construction activities will be referred
to the 24-hour toll free community information line (1800 703 457). The Project postal
address (Western Sydney Infrastructure Plan, PO Box 973 Parramatta CBD NSW 2124) and
email address (thenorthernroad@rms.nsw.gov.au) are also available for receipt of enquiries
and complaints.
The Construction Community Liaison Plan complements and supports the CCS and CMS.
The Construction Community Liaison Plan (Appendix B12) provides detailed strategies on
liaising with the community and other relevant stakeholders. GEJV is committed to
establishing a good relationship with the community and key stakeholders by:
 Providing a Project Infoline and email for enquiries and feedback, and a 24 hour
construction response line for urgent enquiries
 Communicating upfront and openly with the community and key stakeholders
 Notify local residents and businesses in writing about any new or changed
Construction activities which will affect access to their properties or otherwise disrupt
the residents’ use of their premises, at least seven (7) calendar days before
commencing work affecting residents
 Minimising disruption to the community by maintaining works during the Construction
hours, 7.00am to 6.00pm Monday to Friday and, 8.00am to 1.00pm on Saturday, with
no work on Sunday or Public Holidays
 Getting an agreement from potentially affected noise sensitive receivers for any works
outside the standard Construction hours which will generate noise levels greater than
the noise management levels (NMLs) detailed in the CNVMP
 The only exception is the delivery of oversized plant or structures has been
determined by police or other authorised authorities to require special arrangements
to transport along public roads; or emergency work is required to avoid the loss of
lives or property, or to prevent environmental harm
 Providing up to date information to the community through construction updates,
information sessions and advertisements.
5.5.3.2 Complaints management
Complaints and enquiries management is detailed in the Construction Community Liaison
Plan (Appendix B12) and will be undertaken in accordance with the Complaints Management
System (CMS) for the Northern Road Upgrade Project.
In responding to an enquiry GEJV will:
 Provide an oral response to the enquirer within 1 working day from the time of the
enquiry Record the details in Georgiou’s QHEST database
 Make a record in Roads and Maritime’s community contacts database (Consultation
Manager TM), within 48 hours of the interaction taking place
 Forward on any information regarding the enquiry onto Roads and Maritime.
In responding to a complaint GEJV will:
 Record the details in Georgiou’s QHEST database, including how it was managed
and closed out
 Investigate and determine the source of the complaint, including contacting the
complainant immediately to determine the nature of the complaint (if the complaint is
not related to the Project Roads and Maritime Communication and Stakeholder
Engagement Advisor will be notified)
 Provide an oral response to the complainant within 2 hours when received by phone,
or an initial written response within 24 hours (or during the next business day if
received out-of-hours) when received by email
 Forward on any information regarding the complaint, in writing, to Roads and Maritime
each business day, including response times and the details of any actions taken
 Submit a final report with proposed measures to prevent the recurrence of such
incidents to Roads and Maritime Project Manager within 5 working days.
A complaints register will be maintained in Georgiou’s QHEST database which will contain:
 Date and time of complaint
 Method by which the complaint was made (telephone, letter, meeting, etc)
 Name, address, contact telephone number of complainant (if no such details were
provided, a note to that effect)
 Number of people affected in relation to a complaint
 The status of resolution of the complaint
 Nature of complaint
 Action taken in response including follow up contact with the complainant
 Any monitoring to confirm that the complaint has been satisfactorily resolved
 If no action was taken, the reasons why no action was taken.
The Environmental Site Representative will submit a report to the EPA each business day
that provides details of all complaints received in relation to Construction activities regulated
by the EPL. The report will be prepared in accordance with the requirements of the EPL. No
report is required for any reporting period during which no complaints have been received.
GEJV will apply an adaptive approach to ensure that corrective actions are applied in
consultation with the appropriate Construction staff to allow improvements in the
management of issues resulting in community complaints.
5.5.4 Project website

A website has been established for the Project (www.rms.nsw.gov.au/thenorthernroad) and
will be regularly maintained during Construction of the Project. The website will be kept up to
date with the latest Project information, environmental assessments, and will include all
community updates. It will also publish methods to communicate feedback, enquiries and
complaints related to the Project.
In accordance with NSW-CoA B11, the following information will be maintained on the
Project website:
 Information on the current implementation status of the Project
 The EIS, the SPIR and any documentation relating to any modifications made to the
Project
 A copy of the Infrastructure Approval in its original form, a current consolidated copy
of the Approval (including any approved modifications to its terms), and copies of any
approval granted by the Minister to a modification of the terms of the Approval;
 A copy of each statutory approval, licence or permit required and obtained in relation
to the Project
 A current copy of each document required under the terms of the Approval and any
endorsements, approvals or requirements from the ER and Secretary, published prior
to the commencement of any works to which they relate or before their
implementation
 Any community agreement(s) between GEJV and noise sensitive receivers under the
EPL to undertake works outside of standard Construction hours (refer Section 5.4.3)
(personal details of residents to be omitted)
 Information on how the public can make a complaint on the telephone complaints line
and how complaints will be processed.
Relevant Project information will be published on the website throughout the duration of
Construction.
Confidential information, which may include the location of threatened species, Aboriginal
objects or places and personnel contact details, will be removed from all documents provided
or made available to the public. In accordance with EPL Condition A2.5, premises maps are
available for public viewing on Georgiou’s website / Roads and Maritime’s Project website.
Monitoring data required under the EPL will be made available on the Georgiou website and
published monthly by Georgiou in accordance with the EPA Guide for publishing Pollution
Monitoring Data.
Emergency and incident planning, management and reporting
5.6.1 Emergency and incident management
An incident is defined under the NSW Infrastructure Approval as:
 an occurrence or set of circumstances that causes, or threatens to cause, material
harm to the environment, community or any member of the community, being actual
or potential harm to the health or safety of human beings or to threatened species,
endangered ecological communities or ecosystems that is not trivial or
 an occurrence which results in non-compliance with the Infrastructure approval
where the meaning of “material harm” applies for the purpose of the NSW Infrastructure
approval only.
In the event of an environmental incident, the Pollution Incident Response Management Plan
(PIRMP) (Appendix B11) and Road and Maritime s Environmental Incident Classification and
Reporting Procedure (Appendix A7) will be implemented.
The PIRMP and Procedure provide references to:

 Types of incidents and required responses
 Criteria for classifying of environmental incidents
 Processes for systematically responding to and managing emergency situations
 Processes, and legal requirements (e.g. Acts, Regulations, EPL) for the reporting and
notification of an environmental incident.
During the personnel training and induction program, GEJV emphasises to all personnel
working on the site that all events must be immediately reported, documented and
investigated accordingly.
All incident investigations shall include the following basic elements:
 Identify the cause of the incident
 Identify the necessary corrective action(s)
 Identify personnel responsible for carrying out corrective action(s)
 Implement or modifying controls necessary to avoid repetition
 Record any changes in written procedures required.
GEJV will immediately notify the EPA of any pollution incidents on or around the site via the
EPA Environment Line (telephone 131 555) in accordance with Part 5.7 of the Protection of
the Environment Operations Act 1997 (NSW) (POEO Act) and the EPL. The circumstances
where this will take place include:
 If actual or potential harm to the health or safety of human beings or to ecosystems
that is not trivial
 If it results in actual or potential loss or property damage of an amount, or amounts in
aggregate, exceeding $10,000 (or such other amount as is prescribed by the
regulations).
Where an incident involves a potential impact to an Aboriginal site, Roads and Maritime will
liaise with NPWS, OEH and relevant Registered Aboriginal Parties and their input sought in
closing out the incident.
In accordance with NSW-CoA A42, GEJV will meet the requirements of the Secretary or
relevant government authority to address the cause or impact of any incident reported in
accordance with NSW-CoA A40, within such period as the Secretary may require.
All other environmental incidents, reportable events and regulatory action will be reported to
Roads and Maritime as outlined in the Procedure.
The requirements for incident reporting under the POEO Act, Roads and Maritime Procedure
and the Infrastructure Approval are summarised in Table 5-2.
. GEJV will provide all records of incidents and regulatory action to the Roads and Maritime
Project Team. Roads and Maritime Environment Branch will maintain records relating to
environmental incidents.
Pollution incidents will be managed in accordance with the PIRMP. The PIRMP documents
the procedures to be followed in the event of an environmental emergency and includes
contact details for GEJV’s emergency response personnel. The PIRMP has been prepared
and tested in accordance with Environmental guidelines: Preparation of pollution incident
response management plans (EPA, 2012).
The PIRMP documents the procedures to be followed in the event of an environmental
emergency including:
 The names and contact details (including all-hours telephone numbers) for emergency
response personnel
 Response personnel responsibilities
 Contact details for emergency services (ambulance, fire brigade, spill clean-up
services)
 The location of on-site information on hazardous materials, including Material Safety
Data Sheets and spill containment materials
 Steps to following to minimise damage and control and environmental emergency
 Instructions and contact details for notifying relevant government agencies, local
councils and, if necessary, nearby residents
 Include measures to avoid spillages of fuels, chemicals, and fluids onto any surfaces
or into any adjacent waterways.
All necessary contact numbers will be identified in advance and stored for immediate access
should a pollution incident need to be notified. These contact numbers are also identified in
the PIRMP in accordance with the EPL.
The responsibilities for incident management are provided in Section 5.1. GEJV’s
Environmental Site Representative is responsible for:
 Notifying Roads and Maritime and relevant authorities in the event of an
environmental incident, reporting on the incidents and managing the close-out of
incidents
 Stopping activities where there is an actual or immediate risk of harm to the
environment, or to prevent environmental non-conformities, and advising the Project
Manager, Construction Manager and Superintendent.
Emergency planning and awareness training will be undertaken for the Project and will
include, but not be limited to, PIRMP training, development of internal and external
communication protocols during emergencies, identified potential environmental
emergencies that may occur on the Project, the response procedures for these emergencies
and tests of the emergency response procedures.
The PIRMP includes details on the nature and objectives of the PIRMP training program.
Details of the training program will include frequency of training and how the records of any
training are kept. Training may include toolbox talks, formal staff training on incident
management and simulated incident exercises, including with emergency services. The
training will be suitable for the level of risk and likelihood of incidents for the Project.
5.6.2 Incident investigation and reporting

GEJV will undertake reporting of environmental incidents in accordance with the Roads and
Maritime Environmental Incident Classification and Reporting Procedure (Appendix A7). The
Environmental Site Representative is responsible for reporting on incidents.
Where there are lessons learnt from the investigation or current procedures are identified as
being ineffective, this CEMP will be revised to include the improved procedures or
requirement.
Table 5-2: Summary of requirements for incident notification and reporting
Incident type Notify Notification Notification Written report Written report Written report
timeframe responsibility timeframe responsibility
 EPA environment Immediately GEJV In accordance with Within 7 days of the GEJV
line S5.1.4 of the date on which the
 Fire and Rescue Roads and Maritime incident occurred
NSW Procedure
Regulatory action (material  Ministry of health

harm under the POEO Act)  SafeWork NSW
 Local council
 Secretary of DP&E Within 24 hours of Roads and In accordance with Roads and Maritime
 Minister for DoEE notification given to Maritime CoA A41 /GEJV
EPA
Regulatory action (other than
material harm under the POEO
Act):
 discovery of Aboriginal Minister of DoEE GEJV/ Roads and GEJV/ Roads and
remains Maritime Maritime
 if Roads and Maritime EPA GEJV/ Roads and GEJV/ Roads and
activities have Maritime Maritime
contaminated land or if
Roads and Maritime owns
land that has been
contaminated
 the location of a relic once a OEH (Heritage Council) GEJV/ Roads and GEJV/ Roads and
relic has been discovered Maritime Maritime
or located
 the inability to extinguish An appropriate officer of GEJV/ Roads and GEJV/ Roads and
any fire burning during a the NSW Rural Fire Maritime Maritime
bush fire danger period Service
applicable to the land
 environmental incident with Local water supply GEJV/ Roads and GEJV/ Roads and
the potential for unapproved authority Maritime Maritime
Incident type Notify Notification Notification Written report Written report Written report
timeframe responsibility timeframe responsibility
impacts on a drinking water
supply
Roads and Maritime Category 1  Roads and Maritime Immediately GEJV Incident form Within 3 business GEJV/ Roads and
Incident (excluding material Project Manager and days of the incident Maritime
harm) Environmental
Manager (or
delegate)
Critical Incident - Category 1  Roads and Maritime Roads and
incidents with potential for: Director Environment Maritime Director
 regulatory action (e.g. EPA  Roads and Maritime Environment
Penalty Infringement Chief Executive and
Notice) and/or
Operation
relevant Executive
 reputational damage (e.g. Director
media coverage) and/or
 significant environmental
harm.
Roads and Maritime Category 2 Roads and Maritime PM Day of incident GEJV Incident form Within 3 business GEJV
Incident / Reportable Events and Environmental days of the incident
Manager (or delegate)
Any incident (as defined in the Secretary DP&E ASAP, at least Roads and In accordance with Roads and Maritime
Infrastructure approval) Minister for DoEE within 24 hours of Maritime CoA A41 /GEJV
the incident
Any incident that affects or Water NSW ASAP, at least Roads and Roads and Maritime
could affect the Warragamba within 24 hours of Maritime
Pipelines, including the pipeline the incident
corridor
6 Inspections, Monitoring and Review
Environmental inspections
The purpose of the inspections is to identify and minimise environmental risk. A summary of
the overarching approach to inspections are provided in the sections below.
6.1.1 Weekly and post rainfall site inspections

GEJV ESR will undertake weekly and post rainfall inspections of the work sites to evaluate
the effectiveness of environmental controls. Weekly inspections will also inspect work
adjacent to or within sensitive areas and high risk activities. The inspection findings will be
recorded on an inspection checklist form. Additional inspections will be completed in
accordance with the supporting sub plans.
If any maintenance and/or deficiencies in environmental controls or in the standard of

environmental performance are observed, they will be recorded on the checklist form.
Records will also include details of any maintenance required, the nature of the deficiency,
any actions required and an implementation priority. Actions will be closed out in accordance
with the identified priority and evidence of close out will be kept on file.
6.1.2 Environmental Representative and Roads and Maritime inspections

The ER and Roads and Maritime Project Managers (or delegates) and Roads and Maritime
Environmental Manager (or delegate) will undertake regular inspections of works sites, and
in particular critical activities throughout Construction of the Project. Inspections by the ER
and Roads and Maritime Project staff would typically occur on a weekly or fortnightly basis
depending on the stage of Construction.
The GEJV Environmental Site Representative will participate in all ER and Roads and
Maritime inspections, and maintain records for all inspections. Deficiencies and required
actions will be analysed and prioritised at the completion of the inspection and timeframes for
implementation of corrective actions agreed. Timeframes for GEJV to close out issues will
be nominated on the inspection form.
6.1.3 Environmental Review Group (ERG) inspections

ERG inspections will typically occur on monthly timeframe or as otherwise required
depending on the Construction staging of the Project. The GEJV Environmental Site
Representative will also participate in all ERG inspections to maintain appropriate records,
identify required actions and timeframes for implementation of corrective actions.
6.1.4 Inspections by EPA and other agencies

GEJV will prepare a report on each occasion that the site is visited by the EPA and/ or other
relevant agencies. The report will advise Roads and Maritime of the purpose and outcome of
the EPA and/ or other relevant agencies visit, and of all actions taken in response to the EPA
visit and/ or other relevant agencies. The report will be provided to Roads and Maritime
within one working day of the visit.
6.1.5 Pre-work inspections

Prior to the commencement of works on each shift, an inspection will be carried out and will
include a check of relevant environmental controls and resources required to ensure effective
operation and maintenance. Works are not to commence unless inspections are found to be
satisfactory. The Supervisor will undertake these inspections.
6.1.6 Roads and Maritime approved soil conservationist inspections

At least monthly the Roads and Maritime approved soil conservationist will inspect the site to
review onsite ERSED controls and provide written recommendations on the PESCP
drawings and the effectiveness of controls in place. A copy of the report will be provided to
Roads and Maritime Project Manager within five working days.
Environmental monitoring
Monitoring will be undertaken to validate the impacts predicted the Project, to measure the
effectiveness of environmental controls and implementation of this CEMP and to address
approval requirements. The monitoring requirements for required aspects are included in the
relevant issue-specific environmental management plans and summarised in Table 6-1.
Table 6-1: Summary of environmental monitoring requirements

Reporting
NSW-CoA Description Relevant plan
requirements
CoA A16 Measures to monitor impacts Ancillary Facilities Refer to Section 2.3
associated with the Management Plan and Appendix A4
Construction and operation of
ancillary facilities
CoA C9(a) Air quality monitoring of dust Construction Air Quality Refer to Appendix B6
and other emissions Monitoring Program
CoA C9(b), Noise and vibration monitoring Construction Noise and Refer to Appendix B3
E32 and E33 Vibration Monitoring
Program
CoA C9(c) Water, soil and contamination Construction Water, Refer to Appendix B4
monitoring Soil and Contamination
Monitoring Program
The ER and the Roads and Maritime Project Manager and Environmental Manager (or
delegate) will be advised of any non-conformances from monitoring and details reported in
the Monthly Environmental Reports and six monthly Monitoring Reports..
Where a non-conformance is detected or monitoring results that exceed the target set in the
monitoring programs are outside of the expected range and are directly attributable to the
Project (i.e. are influenced by factors under the direct control of the Project e.g. noise from
Construction equipment), the process described in Section 5.4 will be implemented. Steps in
the process will typically include:
 An analysis of the results by the Environmental Site Representative in more detail with
a view of determining possible causes for the non-conformance
 A site inspection by the Environmental Site Representative or delegate
 Advising relevant personnel of the problem
 Identifying and agreeing on actions to resolve or mitigate the non-conformance
 Implementing actions to rectify or mitigate the non-conformance.
A non-conformance Environmental Incident Report and/or Environmental Improvement
Notice may be issued by the Roads and Maritime Environmental Manager (or delegate) or
the Roads and Maritime Project Manager in response to the non-conformance if it is found to
be Construction related. The timing for any improvement will be agreed between the relevant
Engineer/Supervisor, Environmental Site Representative and Roads and Maritime
Environmental Manager (or delegate) based on the level of risk (e.g. a significant risk will
require immediate action).
All environmental monitoring equipment shall be maintained and calibrated according to

manufacturer’s specifications and appropriate records kept.
Compliance
An overarching Compliance Tracking Program (CTP) has been developed by Roads and
Maritime for the Project in accordance with NSW-CoA A27. The Compliance Tracking
Program describes the approach to be taken to monitor compliance with the terms of the
Approval.
The CTP will be implemented for the duration of Construction and for a minimum of one year
following commencement of Operation, or for a longer period as determined by the Secretary
based on the outcomes of independent environmental audits, ER Reports and regular
compliance reviews submitted through Compliance Reports.
The CTP describes how the requirements of NSW-CoA A27 will be met and sets out a
program and frequency for compliance reporting as summarised in Table 6-2.
Table 6-2: Compliance reporting
Report and
Requirement Timing Responsibility Recipient
CoA no.
Compliance Describes how the Prior to Roads and Secretary,
tracking requirements of NSW- commencement of Maritime to DP&E (for
program CoA A27 will be met and Construction and prepare information)
NSW-CoA sets out an overarching continuing for a ER to endorse Minister for
A27 program and frequency minimum of 1 year DoEE
for compliance reporting following
Federal-CoA
for the Project commencement of
13
Project Operation
Pre- Review of compliance 1 month prior to GEJV/ Roads Secretary,
Construction status of the Project Construction and Maritime to DP&E (for
Compliance against the requirements commencing prepare, Roads information)
Report of the Project approval and Maritime to Minister for
NSW-CoA prior to Construction of review and DoEE
A30 each Project stage submit
Federal-CoA
12, 13
Construction Periodic review of 6 monthly during GEJV/ Roads Secretary,

Compliance compliance status of the Construction and Maritime to DP&E (for
reporting Project against the prepare, Roads information)
NSW-CoA requirements of the and Maritime to Minister for
A32 Project approval during review and DoEE
Construction for each submit
Federal-CoA
stage of the Project
13
Report and
Requirement Timing Responsibility Recipient
CoA no.
Pre-Operation Review of compliance 1 month prior to GEJV/ Roads Secretary,
Compliance status of the Project Operation and Maritime to DP&E (for
Report against the requirements commencing prepare, Roads information)
NSW-CoA of the Project approval and Maritime to Minister for
A33 prior to Operation of each review and DoEE
Project stage submit
Federal-CoA
13
Pre-Construction, Construction and Pre-Operation Compliance Reporting required under the

CTP provides evidence of compliance with the applicable conditions of approval.
The Pre-Construction Compliance Reporting provides details of how the CoA that must be
addressed before the commencement of Construction have been complied with and
identifies the proposed commencement date for Construction. A separate Pre-Construction
Compliance Report will be prepared prior to the commencement of Construction.
Construction will not commence until the Pre-Construction Compliance Report has been
submitted to the Secretary for information. The Pre-Construction and Construction
Compliance reporting will also be provided to the Minister for the DoEE.
The Construction Compliance Reports will include:

 A results summary and analysis of environmental monitoring
 The number of any complaints received, including a summary of main areas of
complaint, action taken, response given and proposed strategies for reducing the
recurrence of such complaints
 Details of any review of, and minor amendments made to, the OACEMP or the CEMP
as a result of Construction carried out during the reporting period
 A register of any consistency assessments undertaken and their status
 Results of any environmental audits and details of any actions taken in response to
the recommendations of an audit
 A summary of all incidents notified in accordance with NSW-CoA A40 and NSW-CoA
A43
 Any other matter relating to compliance with the approval or as requested by the
Secretary.
The DoEE requires that the compliance reporting for the preceding 12 months be published
on the Project website. Non-compliance with any of the Federal CoA will be reported to the
DoEE at the same time as the compliance report is published.
The Pre-Operation Compliance reporting details how the CoA that must be addressed before
the commencement of Operation have been complied with and identifies the proposed
commencement date for Operation. A separate Pre-Operation Compliance Report will be
prepared prior to the commencement of Operation. Operation will not commence until the
Pre-Operation Compliance Report has been submitted to the Secretary for information. The
Pre-Operation Compliance reporting will also be provided to the Minister for the DoEE.
Auditing
6.4.1 Independent external audits
External auditing will occur as part of the ongoing systems certification verification process
and will be undertaken by an environment auditor in accordance with AS/NZS ISO
19011:2014 - Guidelines for Auditing Management Systems.
GEJV will maintain accurate records substantiating all activities associated with or relevant to
the Federal CoA, including measures taken to implement all management plans required by
the Federal CoAs, and make them available upon request to the DoEE. Records may be
subject to audit in accordance with section 458 of the EPBC Act, or used to verify compliance
with the Federal CoA.
6.4.2 Internal audits

Internal auditing will be undertaken generally on a six monthly basis throughout the Project.
The purpose of auditing is to verify compliance with:
 The OACEMP, this CEMP and Sub-Plans
 Approval requirements and contractual requirements (Specifications)
 Any relevant legal and other requirements (e.g. licenses, permits, regulations).
An audit checklist will be developed and amended as necessary to reflect changes to this
CEMP, subsequent approvals and changes to Acts, regulations or guidelines.
Table 6-3 summarises the auditing to be undertaken for the Project.
Table 6-3: Audit requirements

Audit/Review Purpose Timing On-going
requirement
Internal HSE Review achievement towards site start-up Within 8 weeks after
N/A
Mobilisation Audit activities mobilisation
Verify compliance to the management systems The first within three
and an assessment of the effectiveness of those months of the
requirements to meet legal and other obligations commencement of
Construction and then
Internal
at six monthly intervals
environmental Six monthly
thereafter. The final
audit
submitted within five
working days of
contract completion
date.
 Assesses whether the Project is complying

with the NSW and Federal CoA, REMMS
 Assess the environmental performance of the
External Project
Within 12 months of
Independent  Review adequacy of documents required Construction Annually
Environmental under the Approval commencing
Audit
 Verify compliance with OACEMP, CEMP and
sub-plans
 Verify compliance with legal and other
requirements
Audit/Review Purpose Timing On-going
requirement
 Recommend measures to improve the
environmental performance and
documentation
Determine compliance to the client management
Client Audit TBA TBA
systems and contract obligations
Risk register Identify new scope of work or scope change and
review planning verify current risks and controls identified on Monthly Monthly
workshop register
 Identify areas of opportunity for improved

environmental performance
 Analysis of the causes of non-conformities
CEMP, CEMS and deficiencies 6 months after project
6 monthly
review commencement
 Verification of the effectiveness of corrective
and preventative actions
 Identifying any changes in procedures
resulting from process improvement
 Site inspections ensure environmental risks

of the Project are identified and appropriate Weekly and post rainfall Weekly and post
Environmental
mitigation measures implemented. >10mm rainfall >10mm
inspections and
audits  Soil conservationist inspections to review Fortnightly Fortnightly
onsite ERSED controls and provide written
recommendations on the PESCP drawings
Reporting
Prior to and during Construction, various reports will be prepared to fulfil internal Roads and
Maritime and GEJV reporting needs, and requirements under the Project approval. Table 6-4
sets out the reporting requirement applicable to the Project, timing of the reporting, who is
responsible for managing preparation of the reports and the intended recipient(s).
Additional reporting may be necessary as the works progress. In such a circumstance,
Section 6.4 of this CEMP will be amended to reflect these changes.
Table 6-4: Reporting requirements

No. Report Requirement Timing Responsibility Recipient
Prior to Construction
Conducted for each
during development
Environmental risk Construction stage, GEJV ESR, GEJV Roads and
1 of CEMP and
assessment Project changes and Project Manager Maritime, ER
reviewed monthly
significant issues.
thereafter
Details of how the
CoA that must be
addressed before the
GEJV/ Roads and Secretary, DP&E
commencement of
1 month prior to Maritime to
Pre-Construction Construction have
2 Construction prepare, Roads and (for information)
compliance report been complied with
commencing Maritime to review
and identifies the Minister for DoEE
and submit
proposed
commencement date
for Construction
For incorporation in
Monthly Project Monthly Roads and
3 environmental Reports including Monthly GEJV ESR
Maritime, ER
report environmental
statistics (i.e.
incidents, regulatory
action, complaints on
environmental
issues), regulatory
and authority
considerations,
monitoring program
performance and key
environmental issues
Periodic review of
GEJV/ Roads and
compliance status of Secretary, DP&E
Construction Maritime to
the Project against 6 monthly during (for information)
4 Compliance
the requirements of Construction
prepare, Roads and
Reports Maritime to review Minister for DoEE
the Project approval
and submit
during Construction
Review of
Pre-Operation compliance status of GEJV/ Roads and
Compliance the Project against 1 month prior to Maritime to Secretary, DP&E
5 Report the requirements of Operation prepare, Roads and (for information)
NSW-CoA A33 the Project approval commencing Maritime to review Minister for DoEE
prior to Operation of and submit
Federal-CoA 13
each Project stage
Ancillary Facilities Refer Section 3.3.5 One month prior the

6 Management Plan of the CEMP and installation of any GEJV Secretary (for
Appendix A4 ancillary facilities Approval)
NSW-CoA A16
Notification of As early as possible
Refer Section 5.6 of Roads and Secretary (for
7 incident and within 24 hours
the CEMP Maritime / GEJV information)
NSW-CoA A40, of the incident Minister for DoEE
A41
Notification of Secretary (for

information)
Incident notified to Refer Section 5.6 of Within 24 hours of
8 the EPA under the the CEMP notifying the EPA
GEJV ESR Roads and Maritime
POEO Act
Relevant authorities
NSW-CoA A43
Minister for DoEE
Details of all non-
Within 10 working
compliances with
EPL monthly days of the end of
9 conditions of EPL,
each calendar
GEJV ESR EPA
report measures taken to
month.
prevent recurrence
Report on
compliance with EPL
including:
 statement of
Compliance
 monitoring and
Complaints
Summary, Within 60 days of
10 EPL annual the anniversary of GEJV ESR
returns  statement of EPA
Compliance for: the EPL
- licence
conditions
- load based
fee
- requirement
to prepare
PIRMP
- publish
pollution
monitoring
data
environmental
management
systems and
practices
Roads and
Community Maritime
One month prior to
Communication Community and Secretary (for
11 Refer Section 5.5.3 commencement of
Stakeholder
Strategy Construction Approval)
Engagement
NSW-CoA B1
Advisor
Construction Roads and

complaints Maritime
management One month prior to
Community and Secretary (for
12 system including Refer Section 5.5 commencement of
Stakeholder
Complaints Construction information)
Engagement
Register Advisor
NSW-CoA B6
Complaints On request during Secretary (for
13 Register Refer Section 5.5.3 Construction
GEJV ESR information)
NSW-CoA B7, B8 Roads and Maritime
Report of site Monthly, and
environmental submitted within Secretary and other
14 ER reports performance seven days ER regulatory agencies
NSW-CoA A24(l) following routine following the end of
inspections Roads and Maritime
each month
Refer Section 5.1.1
The report will detail
the purpose, Within one working
EPA or any other day of the EPA or
outcome and actions
Agency inspection any other Authority
15 pertaining to the visit GEJV ESR
report, other than visit, other than for Roads and Maritime
and will be submitted
16for arranged arranged
to the Roads and
inspections inspections
Maritime Project
Manager
Prior to the
commencement of
Urban Design
Urban Design and works for which the Secretary (for
and Landscape Roads and
16 Plan
Landscape UDLP requires
Maritime / GEJV
information)
Plan community
NSW-CoA E62 consultation under
the Plan
As required.
Roads and Response to matters Typically every two
Maritime and/or raised in Roads and weeks for Roads
17 Maritime and/or EPA and Maritime GEJV ESR Roads and Maritime
EPA
site inspections inspection reports / EPA
environmental
inspection reports and monthly for EPA
Refer Section 6.1.2
inspection reports
Sustainability Refer Appendix B10 Prior to the

18 commencement of GEJV ESR Roads and
Strategy – Sustainability
Management Plan Construction Maritime, ER
NSW-CoA E51
Road Dilapidation Within 3 weeks of
19 Report Road dilapidation completing the GEJV Report to Liverpool City
report for local roads surveys and no later be prepared by a Council
NSW-CoA E55 than 1 month before
outside the Project the use of local suitably qualified
boundary roads by project person
vehicles
Roads and
Community Maritime
One month prior to
Communication Community and Secretary (for
20 Refer Section 5.5.3 co22mmencement
Strategy Stakeholder Approval)
of Co23nstruction
NSW-CoA B1 Engagement
Advisor
Construction Roads and

complaints Maritime
management One month prior to
Community and Secretary (for
21 system including Refer Section 5.5 commen25cement
Stakeholder
Complaints of Construction information)
Engagement
Register Advisor
NSW-CoA B6
Complaints On request during Secretary (for
22 Register Refer Section 5.5 Construction
GEJV ESR information)
NSW-CoA B7, B8 Roads and Maritime
This document One month prior to
23 CEMP commencement of GEJV ESR Roads and
NSW-CoA C1 Refer Sections 1.2 Maritime, ER
Construction
and 1.4
One month prior to
CEMP Sub-plans commencement of Roads and
24 Refer Section 3.3.1 Construction of
GEJV ESR
NSW-CoA C4 Maritime, ER
Project
Refer Section 6 One month prior to

Construction Appendix B3 commencement of
Monitoring CNVMP, Construction or Roads and
25 within another
GEJV ESR
Programs Appendix B4 Maritime, ER
NSW-CoA C9 CSWMP, timeframe agreed
with the Secretary
Appendix B6 CAQMP
Report on monitoring
Construction Secretary and
data recorded and As required in
26 monitoring report GEJV ESR relevant regulatory
potential CEMP sub-plans agencies (for
NSW-CoA C15 exceedances against
information)
criteria
Unexpected One month prior to
Heritage Finds Refer Appendix B5 Roads and Secretary (for
27 commencement of
Maritime
Procedure CCHMP Construction information)
NSW-CoA E16
Confirm the
operational noise Prior to
Operational noise predictions of the commencement of
Project, review noise Roads and Secretary (for
28 mitigation report Construction which
Maritime
mitigation measures would affect approval)
NSW-CoA E36 and investigate identified receivers
alternative measures,
if required
Report justifying why Prior to
Implementation of commencement of
noise mitigation early implementation Roads and
29 Construction which Secretary (for
measures report of noise mitigation Maritime
would affect the approval)
measures is not
NSW-CoA E37 proposed identified receivers
Documents
outcomes of
Site contamination Suitably qualified
Contamination assessments of land and experienced Secretary (for
30 person under the
Report on which the Project information)
NSW-CoA E46 is located CLM Act
Refer Appendix B8
CCLMP
Documents approach Suitably qualified
to remediation of and experienced
Remedial Action Approval by a NSW
31 specified person under the
Plan EPA accredited Site
contaminated land CLM Act and
NSW-CoA E45 Auditor
Refer Appendix B8 approved by
CCLMP
Verifies land is
Site Audit 1 month prior to
suitable for intended EPA Accredited Secretary and the
32 Statement and commencement of
land use Site Auditor relevant local
Site Audit Report Operation
Refer Appendix B8 Council(s)
NSW-CoA E48
CCLMP
Unexpected
Contaminated
Land and Refer Appendix B8 Implement during
33 Construction
GEJV ESR Roads and Maritime
Asbestos Finds CCLMP
Procedure
NSW-CoA E49
Environmental non-conformity, corrective and preventative

actions
6.6.1 Environmental non-conformity, corrective and preventative actions
A non-conformance is the failure or refusal to comply with the requirements of project system
documentation including this CEMP and supporting documentation.
A non-compliance is the failure to comply with the requirements of the Infrastructure

Approval or any applicable licence, permit or legal requirements. Under the Infrastructure
Approval, a non-compliance with a condition of the Approval is classified as an incident and
therefore should be managed in accordance with Section 5.6. Non-conformances may be
identified through the review of compliance (Section 6.3) environmental auditing (Section 6.4)
or incident management (Section 5.6).
GEJV has provided the procedure (Appendix A9) for dealing with non-compliance with
environmental management controls, environmental incidents and emergencies. These
procedures define who is responsible and has the authority for handling and investigating
non-compliance, taking action and completing corrective and preventative action.
When a non-conformity occurs, GEJV will:

 React to the non-conformity and, as applicable:
 Take action to control and correct it
 Deal with the consequences, including mitigating adverse environmental impacts
 Evaluate the need for action to eliminate the causes of the nonconformity in order that
it does not recur or occur elsewhere by:
 Reviewing the non-conformity
 Determining the causes of the non-conformity
 Determining if similar non-conformities exist or could potentially occur
 Implement any action needed
 Review the effectiveness of any corrective action taken and
 Make changes to the environmental management system if necessary.
Corrective actions will be appropriate to the significance of the effects of the non-conformities
encountered, including the environmental impacts.
GEJV will retain documented information as evidence of:

 The nature of the non-conformities and any subsequent actions taken and
 The results of any corrective action.
6.6.2 Non-conformances
Any member of GEJV's Project Team may raise a non-conformance or improvement
opportunity. GEJV’s Quality Plan describes the process for managing non-conforming work
practices and initiating corrective/preventative actions or system improvements. The ER,
Roads and Maritime Senior Project Manager, Project Manager, Environmental Manager (or
delegate) or a representative of a public authority may also raise a non-conformance or
improvement opportunity using the same process.
Non-conforming activities may be stopped, if necessary, by the GEJV Environmental Site

Representative or GEJV Project / Site Engineers following consultation with the GEJV
Construction Manager or delegate. The ER may also stop works in these circumstances, in
which case a non-conformance report will be prepared by GEJV in accordance with the
Quality Plan. The works will not recommence until corrective/ preventative actions have
been closed out.
6.6.3 Corrective action

For each non-conformance identified, GEJV will implement corrective / preventative actions.
In addition, any environmental management improvement opportunities can be initiated as a
result of incidents or emergencies, monitoring and measurement, review of compliance, audit
findings or other reviews. Improvement opportunities may also result in the implementation of
corrective/preventative actions. GEJV will provide this information to Roads and Maritime in
monthly reports.
Corrective/preventative actions and improvement opportunities will be entered into GEJV’s

quality system database and include detail of the issue, action required and timing and
responsibilities. The record will be updated with date of close out and any necessary notes.
The database will be reviewed regularly to ensure actions are closed out as required.
Procedures for corrective actions will include a process for verification of how the non-
conformance has been closed out and to confirm that it is effective in addressing the non-
conformance.
Records of environmental activities
6.7.1 Environmental records
GEJV’s Health, Safety and Environment Policies, Standards, Procedures, Safe Work
Instructions, References, Guidelines, Forms, Templates are all accessible via Georgiou’s
Intranet - GENIE. GENIE will maintain the current and only authorised versions for use.
Environment management documentation that has been specifically developed for the
Project will be controlled on site and recorded in the sites document management system.
The GEJV ESR is responsible for maintaining all environmental management documents as
current at the point of use. Types of records include:
 All monitoring, inspection and compliance reports/records
 Correspondence with public authorities
 Induction and training records
 Reports on environmental incidents, other environmental non-conformances,
complaints and follow-up action
 Community engagement information
 Minutes of CEMP and construction environmental management system review
meetings and evidence of any action taken
 All identified records listed in G36 Annexure C
 Internal audit reports.
All environmental management documents are subject to ongoing review and continual
improvement. This includes times of change to scheduled activities or to legislative or
licensing requirements.
Only the GEJV ESR has the authority to change any of the environmental management
documentation.
6.7.2 Document control

The GEJV ESR will coordinate the preparation, review and distribution of the environmental
documents and records listed in Section 6.7.1.
Table 6-4 identifies the recipients for the overarching Project documentation. During the
Project, the environmental documents will be stored at the main site compound.
The documents required to be prepared under the Infrastructure Approval will be made
available on the Project website (refer Section 5.5.4).
GEJV will implement a document control procedure to control the flow of documents within
and between GEJV, Roads and Maritime, stakeholders and sub-contractors. The procedure
will ensure that documentation is:
 developed, reviewed and approved prior to issue
 issued for use
 controlled and stored for the legally required timeframe
 removed from use when superseded or obsolete
 archived.
A register and distribution list will identify the current documents, records or data. The
Document Register is maintained in Appendix A5.
Environmental management system review

As a minimum the CEMP will be reviewed annually by the GEJV ESR. At any other time the
GEJV ESR may propose that the CEMP requires updating. If the revision of the CEMP
results in changes to the document, the amended CEMP will be sent to Roads and Maritime.
All staff will be educated in the relevant CEMP amendments through the induction process
and toolbox talks.
Management reviews will also be undertaken as part of the continual improvement process.
They will occur as a minimum quarterly and will include the participation of the ERG and
Roads and Maritime. The management reviews will focus on:
 A review of the aspects and impacts register, legal register and environmental
induction
 Analysis of the causes of non-conformities and deficiencies, including those identified
in environmental inspections and audits
 Consideration of incidents and any lessons learnt
 Consideration of any new regulatory issues
 A review of the effectiveness of erosion and sediment controls
 Highlighting any changes in procedures resulting from process improvement
 Consideration of changes in operational needs such as resourcing
 Feedback from other management reviews
 Verification of the effectiveness of corrective and preventative actions
 Identification of areas for improvements in environmental performance.
The outcomes of the management reviews could include amendments to this CEMP and
related documentation, revision to the Project’s environmental management system, risk
assessment review, re-evaluation of the Project objectives and targets as well as feeding into
other Project documents.
GEJV’s ESR will also attend Environment group meetings quarterly and Executive review
meetings annually.
6.8.1 Project Refinements

Refinements to the Project may result from detailed design refinement or changed
circumstances throughout Construction. Roads and Maritime is responsible for formally
seeking approval for any Project modifications and for documenting refinements that are
consistent with the approved Project.
The Roads and Maritime Environmental Manager (or delegate) is responsible for the
assessment of Project refinements and management of the consistency assessment
process. The GEJV ESR is responsible for assessing any new environmental impacts and/or
new statutory approval requirements and incorporating the required changes into the
appropriate environmental management documentation as directed by the Roads and
Maritime Project Manager.
Any design changes or changes in scope of works will be communicated to the GEJV ESR.
GEJV's ESR will undertake an environmental assessment and consistency review for the
proposed changes in consultation with the Roads and Maritime Environmental Manager (or
delegate) to determine if a Project modification may be required.
Should the consistency review determine that a Project modification may be required i.e. the
impacts are of a nature and scale that it is not considered consistent with the Project
approval, the ER will be informed immediately and a modification application under Section
115ZI of the EP&A Act will be prepared and submitted to the Secretary for determination.
The Roads and Maritime Senior Project Manager and Roads and Maritime Environmental
Manager (or delegate) will approve all refinements that are deemed consistent with the
Infrastructure Approval. Endorsement will be sought from the ER.
Appendices
Section A: EMS Documentation
Appendix A1
Legal and Contractual Requirements
This Construction Environmental Management Plan (CEMP) and sub plans have been developed in accordance with the Overarching
Construction Environmental Management Plan (OACEMP), conditions of approval (CoA), management measures detailed in the EIS, SPIR,
relevant Roads and Maritime QA Specifications and the Guideline for the Preparation of Environmental Management Plans (DIPNR, 2004).
Relevent Legislation - Compliance Tracking Matrix
This table should be reviewed regularly to reflect current legislation and the legislative requirements specific to the project
Act Aspect Requirement Division 5.2 applicability Phase
General
All Comply with the terms Minister for Planning’s approval for the project. Yes
Obtain the Minister’s approval for any project modifications that are not
Environmental Planning and consistent with the planning approval.
Assessment Act, 1979 All To examine and take into account to the fullest extent possible all Yes
matters affecting or likely to affect the environment by reason of the
activity.
Site licensing Do not carry out or allow an activity listed in Schedule 1, or carry out Yes (an EPL will be required for road
work to enable such an activity, unless the premises are licensed by the construction)
EPA. This applies to
• ‘road construction’ meaning the construction, widening or re-routing
of roads if it results in the existence of 4 or more traffic lanes (other
Protection of the Environment
than bicycle lanes or lanes used for entry or exit) for 1 km of their
Operations Act 1997
length in the metropolitan area, or 5 km in length in any other area,
where the road is classified, or proposed to be classified, as a freeway
or tollway under the Roads Act 1993
• ‘crushing, grinding and separating’ and ‘extractive activities’. (and
any other scheduled activity undertaken for the Project).
Land Acquisition (Just Terms Property acquisition Applies to the acquisition of any land required for the project. Yes
Compensation) Act 1991
N/a Prior to construction, a notice must be placed in the local newspaper Yes
Roads Act 1993
allowing for any submissions to be made by any person.
Pollution
Harming the environment Do not risk harming the environment by wilfully or negligently: Yes
• disposing of waste unlawfully.
• causing any substance to leak, spill or otherwise escape (whether or
not from a container); or
Protection of the Environment
• emitting an ozone depleting substance
Operations Act 1997
Control equipment Properly and efficiently maintain and operate any installed pollution Yes
control equipment (including monitoring devices).
Notification of pollution incidents Notify the EPA immediately of pollution incidents where material harm Yes
to the environment is caused or threatened.
Water
Water access and use. Do not take water from a water source (a lake, river or estuary or place No
where water occurs naturally on or below the surface of the ground, and
includes coastal waters) without an access licence. Do not use of water
on land (unless supplied by a water utility, irrigation corporation etc. or
in accordance with basic landholder rights) without a water use
approval.
Water Management Act 2000
Water Management Act 2000 Water management works Do not construct/use a water supply work, drainage work or flood work No
without the appropriate approval.
Waterfront land Do not deposit material, excavate, or remove material within a No
watercourse bank, shore or bed, or on land 40 metres inland, or
interfere
with the likely flow of water to such a body, without a controlled
activity approval.
Surface water Obtain a licence or permit for construction or use of ‘work’ for purposes Yes
including the taking and using of water
Groundwater Obtain a licence where interference with groundwater is likely to occur. N/A
Roads and Maritime being a department of NSW government and as
defined within the Water Act 1912 as the Crown is exempt from the
Water Act 1912 prevision of obtaining a licence.
Floodplains Obtain an approval for controlled works. These include works which N/A
occur on a designated floodplain, which can prevent land from being
flooded or which can affect water flow to or from a river or lake.
Water pollution Do not cause water pollution (other than to a sewer), except in Yes
accordance with the conditions of any EPA licence.
Noise
Plant maintenance and operation Do not operate plant if it emits noise caused by poor maintenance or Yes
Protection of the Environment operation.
Operations Act 1997 Materials management Do not cause noise by failing to properly and efficiently deal with Yes
materials.
Contaminated material
Land pollution Do not cause or permit land pollution other than under authority of a Yes
licence or regulation. (However it is not a land pollution offence to
Protection of the Environment place virgin excavated natural material or lawful pesticides and
Operations Act 1997 fertilisers on land, or by placing matter on land that has been notified
to the EPA as an unlicensed landfill and which is operated in accordance
with the regulations.)
Reporting Notify the EPA if:
contamination • Contaminants exceed thresholds contained in guidelines or the
regulations where contamination has entered or will foreseeably enter
Contaminated Land Management Act neighbouring land, the atmosphere, groundwater or surface water.
1997 • Contaminants in soil are equal to or exceed guideline levels with
respect to the current or approved use of the land.
• Contamination meets other criteria that may be prescribed by the
regulations.
Biodiversity
Weed control As a public authority occupier of land, control noxious weeds on the Yes
land as required under the control category or categories specified in
relation to the weeds concerned.
Noxious Weeds Act 1993 Notify relevant control authority within 3 days of becoming aware that a
notifiable weed (W1 weed) is on land. (or ought reasonably to have
known).
Must not scatter or cause to scatter notifiable weed material.
Native fauna Do not harm any animal that is of a threatened species population or Yes
ecological community, or its habitat except in accordance with a
planning approval.
National Parks and Wildlife
Do not harm critical habitat except as in accordance with a planning Yes
Act 1974
approval.
Do not harm native fauna (other than listed unprotected fauna) except Yes
in accordance with a planning approval or licence.
Biodiversity Do not cause a significant impact to listed threatened species, Yes
Biodiversity Conservation Act 2016
Conservation populations or ecological communities, or their habitats.
Threatened Species Conservation Act Flora and fauna Do not cause a significant impact to listed threatened species, No
1995 conservation populations or ecological communities, or their habitats.
(repealed)
Flora and native Only clear native vegetation in accordance with a planning approval or No
Native Vegetation Act 2003 vegetation property vegetation plan.
conservation
Flora and native vegetation Do not pick protected native plants without a licence No
National Parks and Wildlife Act 1974
conservation
Dredging or A permit to authorise dredging or reclamation work must be obtained No
reclamation from the Minister
Mangroves, Do not harm any mangroves, seagrasses or other marine vegetation on No
Fisheries Management Act 1994
seagrasses and public water land protected by the regulations without a permit
marine vegetation
Fish passage Do not block fish passage without a permit No
Flora and fauna Do not undertake an action that will or is likely to have a significant Yes
conservation impact on a listed threatened species or threatened ecological
Environment Protection Biodiversity community
Conservation Act, 1999 Do not undertake an action that will or is likely to have a significant Yes
(Commonwealth) impact on the environment on Commonwealth land
Compliance Do not take any action to contravene any conditions of approval Yes
attached to the project approval
Waste
Littering Do not litter in a public place or an open private place. Do not litter Yes
from a vehicle.
Only deposit advertising material in receptacles provided for mail or
newspapers or under the door of the premises.
Do not deposit advertising material on or in vehicles.
Waste and Do not undertake a scheduled waste activity unless in accordance with Yes
transportation an
environmental protection licence.
A licence must be obtained when construction and demolition wastes
are applied to land under certain circumstances. This includes the
reincorporation of crushed road base material back into roads and the
placing of excess fill material onto properties. A licence is not required
Protection of the Environment if the material:
Operations Act 1997 • Is VENM.
• Does not exceed 200 tonnes in the Sydney, Newcastle and Wollongong
areas, or 20,000 tonnes outside these areas.
• Is covered by a “general exemption”. Current exempted materials are
ENM, recycled aggregates and raw mulch. These exemptions are
conditional and require some chemical testing of materials before they
are placed onto land.
A licence must be obtained if more than 2,500 tonnes (or cubic metres)
is stored on a stockpile site at any one time, or more than 30,000 tonnes
of waste is received per year from off site.
Only transport waste to a facility that can lawfully accept the waste. Yes
Do not dispose of waste in a manner that harms or is likely to harm the Yes
environment.
Waste and transportation Comply with general requirements for the transport of waste. For Yes
example, any vehicle used by the person to transport waste must be
Protection of the Environment kept in a clean condition and be maintained so as to prevent spillage of
Operations (Waste) Regulation 2005 waste. For some wastes, only licensed transporters can be used.
Comply with record keeping requirements in relation to the transport of Yes
certain types of waste.
Heritage
National heritage Do not take an action that will or is likely to have a significant impact on Yes
the National Heritage values of a National Heritage place
Environment Protection
National heritage Do not undertake an action that will or is likely to have a significant Yes
Biodiversity Conservation Act,
impact on the environment on Commonwealth land
1999 (Commonwealth)
Compliance Do not take any action to contravene any conditions of approval Yes
attached to the project approval
Heritage Do not undertake an activity that will affect a place, building, work, No
relic, moveable object or precinct which is subject to an Interim
Heritage Order or is listed on the State Heritage Register without
approval from the Heritage Council.
Do not disturb or excavate land with knowledge or reasonable cause to No
Heritage Act 1977
suspect that the disturbance or excavation will or is likely to result in a
relic being discovered, exposed, moved, damaged or destroyed; or
Do not disturb or excavate land on where a relic has been discovered or
exposed.
Heritage Act 1977
Notify the heritage Council on discovery of a relic Yes

Aboriginal places Do not harm or desecrate an Aboriginal object or Aboriginal place No
National Parks and Wildlife and objects without consent.
Act 1974 Notify the NPWS within reasonable time of becoming aware of the Yes
location or discovery of certain Aboriginal objects.
National Parks and Wildlife Aboriginal Consult with Aboriginal parties on the methodology and draft cultural Yes
Regulation 2009 consultation heritage assessment report
Protection of Report any discovery of Aboriginal remains to the Federal Minister for Yes
Aboriginal and Torres Strait
areas and objects the Environment and Heritage.
Islander Heritage Protection
Comply with the provisions of any declaration in relation to a significant Yes
Act 1984 (Commonwealth)
Aboriginal area or object
Hazards and risks
Environmentally Hazardous Hazards and Obtain a licence to undertake prescribed activities involving Yes
Chemicals Act, 1985 risks environmentally hazardous chemicals or declared chemical wastes.
Dangerous Goods (Road and Hazards and Ensure that dangerous goods are transported in a safe manner. Yes
Rail Transport) Act 2008 risks
Hazards and Use pesticides in an environmentally sensitive manner. Yes
risks Do not use an unregistered pesticide without a permit.
Read the label or permit for the pesticide.
Pesticides Act 1999 Use registered pesticides in accordance with instructions on the label.
Do not use any restricted pesticide unless authorised by a certificate of
competency or a pesticide control order under the Act.
Compliance with pesticide codes of practice is required.
Greenhouse gas emissions
National Greenhouse and Energy Greenhouse gas Accounting and reporting of greenhouse gases produced and energy Yes (applicability dependant on
Reporting Act, 2007 and Regulations emissions consumed during construction. Applicability dependent on thresholds. thresholds)
2008
Conditions of Approval - Compliance Tracking Matrix
PART A - ADMINISTATIVE CONDITIONS
Reference Sub Ref. Comment/Obligation Responsibility Phase Compliance Status Comment/Evidence
General
The CSSI must be carried out in accordance with the terms of this approval and generally in
A1 accordance with the description of the CSSI in the EIS as amended by the SPIR.
The CSSI must be carried out generally in accordance with all procedures, commitments,
A2 preventative actions, performance criteria and mitigation measures set out in the EIS as
amended by the SPIR unless otherwise specified in, or required under, this approval.
In the event of an inconsistency between the documents listed in Condition A1 and any
other
A3 document required under this approval, the terms of this approval prevail to the extent of
the
inconsistency.
The Proponent must comply with all requirements of the Secretary in relation to:
a the environmental performance of the CSSI;
b any document under this approval or correspondence to the Secretary;
c any notification given to the Secretary under the terms of this approval;
A4
d any audit of the Construction or Operation of the CSSI;
e compliance with the terms of this approval (including anything required to be done under
this approval); and
f the carrying out of any additional monitoring or mitigation measures.
In the event that there are differing interpretations of the terms of this approval, including
A5
in relation to a condition of this approval, the Secretary’s interpretation is final.
Where the terms of this approval require a document to be prepared or a review to be
undertaken in consultation with identified parties, evidence of the consultation undertaken
must be submitted to the Secretary with the document. The evidence must include:
a documentation of the engagement with the party(ies) identified in the condition of approval
that has occurred prior to submitting the document for approval;
b log of the points of engagement or attempted engagement with the identified party(ies)
and a summary of the issues raised by them;
A6
c documentation of the follow-up with the identified party(ies) where feedback has not been
provided to confirm that they have none or have failed to provide feedback after repeated
requests;
d outline of the issues raised by the identified party(ies) and how they have been addressed;
and
e a description of the outstanding issues raised by the identified party(ies) and the reasons
why they have not been addressed.
Without limitation, all strategies, plans, programs, reviews, audits, report
recommendations, protocols and the like required by the conditions of this approval must
A7 be implemented by the Proponent in accordance with all requirements issued by the
Secretary from time to time in
respect of them.
Where the conditions of this approval require consultation with identified parties, details of
the consultation undertaken, matters raised by the parties, and how the matters were
A8
considered must accompany the strategies, plans, programs, reviews, audits, protocols and
the like submitted to the Secretary.
This approval lapses five (5) years after the date on which it is granted, unless works for the
A9
purpose of the CSSI are physically commenced on or before that date.
The Proponent is responsible for any breaches of the conditions of this approval resulting
A10 from the actions of all persons that it invites onto any site, including contractors, sub-
contractors and visitors.
Staging
The CSSI may be delivered and operated in stages. Where staged delivery or Operation is
proposed, a Staging Report (for either or both delivery and Operation as the case requires)
must be prepared and submitted to the Secretary for information. The Staging Report must
A11 be submitted to the Secretary no later than one month prior to the commencement of
Construction of the first of the proposed stages of Construction (or if only staged Operation
is proposed, one month prior to the commencement of Operation of the first of the
proposed stages of Operation), or within another timeframe agreed with the Secretary.
The Staging Report must:
a if staged delivery is proposed, set out how the delivery of the whole of the CSSI will be
staged, including general details of work and other activities to be carried out in each stage
and the general timing of when Construction of each stage will commence;
b if staged operation is proposed, set out how the operation of the whole of the CSSI will be
staged, including general details of work and other activities to be carried out in each stage
A12
and the general timing of when operation of each stage will commence;
c specify the relevant conditions of approval that apply to each stage and how compliance
with those conditions will be achieved across and between each of the stages of the CSSI;
and
d set out mechanisms for managing any cumulative impacts arising from the proposed
staging.
The CSSI must be staged in accordance with the Staging Report, as submitted to the
A13
Secretary.
Where staging is proposed, the terms of this approval that apply or are relevant to the
A14 works or activities to be carried out in a specific stage must be complied with at the
relevant time for that stage.
Ancillary facilities
Ancillary facilities that are not identified by description and location in the documents
listed in Condition A1 must meet the following criteria, unless otherwise approved by the
Secretary:
a the facility is development of a type that would, if it were not for the purpose of the CSSI, Pre-construction
otherwise be exempt or complying development; or
b the facility is located as follows:
i. at least 50 metres from any waterway unless an erosion and sediment control plan is Pre-construction
prepared and implemented so as not to adversely affect water quality in the waterway in
accordance with Managing Urban Stormwater series;
ii. within or adjacent to land upon which the CSSI is being carried out; Pre-construction
iii. with ready access to a road network; Pre-construction
A15
b
iv. to prevent heavy vehicles travelling on local streets or through residential areas in order Pre-construction
to access the facility, except as identified in the documents listed in Condition A1;
v. so as to be in accordance with the Interim Construction Noise Guideline (DECC 2009) or Pre-construction
A15 as otherwise agreed in writing with affected landowners and occupiers;
vi. so as not to require vegetation clearing beyond the extent of clearing approved under Pre-construction
other terms of this approval except as approved by the ER as minor clearing;
vii. so as not to have any impact on heritage items (including areas of archaeological Pre-construction
sensitivity) beyond the impacts identified, assessed and approved under other terms of
this approval;
viii. so as not to unreasonably interfere with lawful uses of adjacent properties that are Pre-construction
being carried out at the date upon which construction or establishment of the facility is to
commence;
ix. to enable operation of the ancillary facility during flood events and to avoid or minimise, Pre-construction
to the greatest extent practicable, adverse flood impacts on the surrounding environment
and other properties and infrastructure; and
x. so as to have sufficient area for the storage of raw materials to minimise, to the greatest Pre-construction
extent practicable, the number of deliveries required outside standard construction hours.
Before establishment of any ancillary facility (other than minor ancillary facilities described
in Condition A17), the Proponent must prepare an Ancillary Facilities Management Plan
which details the management of the ancillary facilities. The Ancillary Facilities
Management Plan must be prepared in consultation with the EPA and the relevant council(s)
and submitted to the Secretary for approval one month prior to installation of ancillary
facilities. The Ancillary Facilities Management Plan must detail the management of the
ancillary facilities and include:
a a description of activities to be undertaken during Construction (including scheduling of Pre-construction
A16 construction);
b a program for ongoing analysis of the key environmental risks arising from the activities Pre-construction
described in subsection (a) of this condition, including an initial risk assessment undertaken
prior to the commencement of Construction of the CSSI; and
c details of how the activities described in subsection (a) of this condition will be carried out Pre-construction
to:
i. meet the performance outcomes stated in the documents listed in Condition A1; and
ii. manage the risks identified in the risk analysis undertaken in subsection (b) of this
condition.
Minor ancillary facilities comprising lunch sheds, office sheds, and portable toilet facilities,
that are not identified in the documents listed in Condition A1 and which do not satisfy the
criteria set out in Condition A15 of this approval must satisfy the following criteria:
a have no greater environmental and amenity impacts than those that can be managed Pre-construction
through the implementation of environmental measures detailed in the CEMP required
under
A17
A17 b have been assessed by the ER to have: Pre-construction
i. minimal amenity impacts to surrounding residences and businesses, after consideration of
matters such as compliance with the ICNG, traffic and access impacts, dust and odour
impacts, and visual (including light spill) impacts;
ii. minimal environmental impact with respect to waste management and flooding; and
iii. no impacts on biodiversity, soil and water, and heritage items beyond those already
approved under other terms of this approval.
Boundary fencing must be erected around all ancillary facilities that are adjacent to Pre-construction
sensitive
A18
receivers for the duration of Construction unless otherwise agreed with the affected
receivers(s).
Boundary fencing required under Condition A18 of this approval must minimise visual, noise Pre-construction
A19
and air quality impacts on adjacent sensitive receivers.
Environment Representative
Works must not commence until an ER has been approved by the Secretary and engaged by Pre-construction
A20
the Proponent.
The Secretary’s approval of an ER must be sought no later than one (1) month before the Pre-construction
A21
commencement of Works, or within another timeframe agreed with the Secretary.
The proposed ER must be a suitably qualified and experienced person who was not involved Pre-construction
in
A22
the preparation of the EIS or SPIR, and is independent from the design and construction
personnel for the CSSI.
The Proponent may engage more than one ER for the CSSI, in which case the functions to be Pre-construction
A23 exercised by an ER under the terms of this approval may be carried out by any ER that is
approved by the Secretary for the purposes of the CSSI.
For the duration of the Works until the completion of Construction, the approved ER must:
a receive and respond to communication from the Secretary in relation to the environmental Construction
performance of the CSSI;
b consider and inform the Secretary on matters specified in the terms of this approval; Construction
c consider and recommend to the Proponent any improvements that may be made to work Construction
practices to avoid or minimise adverse impact to the environment and to the community;
d review documents identified in Conditions C1, C4 and C9 and any other documents that Construction
are identified by the Secretary, to ensure they are consistent with requirements in or under
this approval and if so:
i. make a written statement to this effect before submission of such documents to the
Secretary (if those documents are required to be approved by the Secretary); or
ii. make a written statement to this effect before the implementation of such documents
(if those documents are required to be submitted to the Secretary / Department for
information or are not required to be submitted to the Secretary/Department);
e regularly monitor the implementation of the documents listed in Conditions C1, C4 and C9 Construction
to ensure implementation is being carried out in accordance with the document and the
terms of this approval;
f as may be requested by the Secretary, help plan, attend or undertake audits of the Construction
A24 development commissioned by the Department including scoping audits, programming
audits, briefings and site visits, but not independent environmental audits required under
Condition A35 of this approval;
A24
g as may be requested by the Secretary, assist the Department in the resolution of community Construction
complaints;
h review the assessment of the impacts of minor ancillary facilities comprising lunch sheds, Construction
office sheds and portable toilet facilities as required by Condition A17 of this approval;
i consider any minor amendments to be made to the CEMP, CEMP sub-plans and monitoring Construction
programs that comprise updating or are of an administrative nature, and area consistent
with the terms of this approval and the CEMP, CEMP sub-plans and monitoring programs
approved by the Secretary and, if satisfied such amendment is necessary, approve the
amendment. This does not include any modifications to the terms of this approval; and
j prepare and submit to the Secretary and other relevant regulatory agencies, for Construction
information,
an Environmental Representative Monthly Report providing the information set out in the
Environmental Representative Protocol under the heading “Environmental Representative
Monthly Reports.” The Environmental Representative Monthly Report must be submitted
within seven (7) calendar days following the end of each month for the duration of the ER’s
engagement for the CSSI, or as otherwise agreed with the Secretary.
The Proponent must provide the ER with all documentation requested by the ER in order for
the ER to perform their functions specified in Condition A24 (including preparation of the ER
monthly report), as well as:
A25 a the complaints register (to be provided on a daily basis); and
b a copy of any assessment carried out by the Proponent of whether proposed work is
consistent with the approval (which must be provided to the ER before the commencement
of the subject work).
The Secretary may at any time commission an audit of an ER’s exercise of its functions
under
Condition A24. The Proponent must:
A26
a facilitate and assist the Secretary in any such audit; and
b make it a term of their engagement of an ER that the ER facilitate and assist the Secretary
in any such audit.
Compliance tracking program
A Compliance Tracking Program to monitor compliance with the terms of this approval must Pre-construction
A27 be prepared, taking into consideration any staging of the CSSI that is proposed in a Staging
Report submitted in accordance with Condition A11 and Condition A12 of this approval.
The Compliance Tracking Program must be endorsed by the ER and then submitted to the Pre-construction
A28 Secretary for information prior to the commencement of Construction or within another
timeframe agreed with the Secretary.
The Compliance Tracking Program in the form required under Condition A27 of this approval Constructiion
must be implemented for the duration of Construction and for a minimum of one (1) year
following commencement of Operation, or for a longer period as determined by the
Secretary based on the outcomes of independent environmental audits, Environmental
A29
Representative Reports and regular compliance reviews submitted through Compliance
Reports. If staged operation is proposed, or operation is commenced of part of the CSSI, the
Compliance Tracking Program must be implemented for the relevant period for each stage
or part of the CSSI.
Construction compliance reporting
A Pre-Construction Compliance Report must be prepared and submitted to the Secretary for
information no later than one month before the commencement of Construction or within
another timeframe agreed with the Secretary. The Pre-Construction Compliance Report
A30 must include:
a details of how the terms of this approval that must be addressed before the commencement Pre-construction
of Construction have been complied with; and
b the proposed commencement date for Construction. Pre-construction
Construction must not commence until the Pre-Construction Compliance Report has been
A31
submitted for information to the Secretary.
Construction Compliance Reports must be prepared and submitted to the Secretary for
information every six (6) months from the date of the commencement of Construction or
within another timeframe agreed with the Secretary, for the duration of Construction. The
Construction Compliance Reports must include (as applicable):
a a results summary and analysis of environmental monitoring; Construction
b the number of any complaints received, including a summary of main areas of complaint, Construction
action taken, response given and proposed strategies for reducing the recurrence of such
complaints;
A32 c details of any review of, and minor amendments made to, the CEMP as a result of Construction
construction carried out during the reporting period;
d a register of any consistency assessments undertaken and their status; Construction
e results of any environmental audits and details of any actions taken in response to the Construction
recommendations of an audit;
f a summary of all incidents notified in accordance with Condition A40 and Condition A43 Construction
of this approval; and
g any other matter relating to compliance with the terms of this approval or as requested by Construction
the Secretary.
Pre-operation compliance report
A Pre-Operation Compliance Report must be prepared and submitted to the Secretary for
information no later than one month before the commencement of operation or within
another timeframe agreed with the Secretary. The Pre-Operation Compliance Report must
A33 include:
a details of how the terms of this approval that must be addressed before the commencement Pre-construction
of Operation have been complied with; and
b the commencement date for Operation. Pre-construction
Operation must not commence until the Pre-Operation Compliance Report has been Pre-construction
A34
submitted for information to the Secretary.
Auditing
An Environmental Audit Program for independent environmental auditing against the terms Pre-construction
of this approval must be prepared in accordance with AS/NZS ISO 19011:2014 - Guidelines
A35 for Auditing Management Systems and submitted to the Secretary for information no later
than one month before the commencement of works or within another timeframe agreed
with the Secretary.
The Environmental Audit Program, as submitted to the Secretary, must be implemented for Construction
A36
the duration of Construction
All independent environmental audits of the CSSI must be conducted by a suitably qualified,
experienced and independent team of experts in auditing and be documented in an
Environmental Audit Report which:
A37
a assesses the environmental performance of the CSSI, and its effects on the surrounding Construction
A37 environment;
b assesses whether the project is complying with the terms of this approval; Construction
c reviews the adequacy of any document required under this approval; and Construction
d recommends measures or actions to improve the environmental performance of the CSSI, Construction
and improvements to any document required under this approval.
The Environmental Audit must be carried out within 12 months of works commencing and Construction
A38 annually thereafter during the delivery of the CSSI, and within 12 months of the
commencement of Operations and then as required by the Secretary.
The Proponent must submit a copy of the Environmental Audit Report to the Secretary with Post-
A39 a response to any recommendations contained in the audit report within six (6) weeks of construction
completingthe audit, or within another timeframe agreed with the Secretary.
Incident notification
The Secretary must be notified as soon as possible and in any event within 24 hours of any Pre-construction,
A40
Incident associated with the delivery of the CSSI. Construction
Notification of an incident under Condition A40 of this approval must include the time and Pre-construction,
date Construction
A41
of the Incident, details of the Incident and must identify any non-compliance with this
approval.
Any requirements of the Secretary or relevant government authority (as determined by the Pre-construction,
Secretary) to address the cause or impact of an Incident reported in accordance with Construction
A42 Condition A40 of this approval, must be met within the timeframe determined by the
Secretary
or relevant government authority.
If statutory notification is given to the EPA as required under the POEO Act in relation to Pre-construction,
the Construction
A43
CSSI, such notification must also be provided to the Secretary within 24 hours after the
notification was given to the EPA.
PART B - COMMUNITY INFORMATION AND REPORTING
Community information, consultation and involvement
A Community Communication Strategy must be prepared to facilitate All phases
communication between the Proponent, and the community (including relevant
B1 Council(s), adjoining affected landowners and businesses, and others directly
impacted by the CSSI), during the design and Construction of the CSSI and for a
minimum of 12 months following the completion of the CSSI.
The Community Communication Strategy must:
a identify people or organisations to be consulted during the delivery of the Pre-construction
b set out procedures and mechanisms for the regular distribution of accessible Pre-construction
information about or relevant to the CSSI;
c identify opportunities to provide accessible information regarding regularly Pre-construction
updated site construction activities, schedules and milestones at each
construction site
d identify opportunities for the community to visit construction sites (taking into Pre-construction
consideration workplace, health and safety requirements);
e involve construction personnel from each construction site in engaging with the Pre-construction
B2
local community;
f provide for the formation of issue or location-based -based community forums Pre-construction
that focus on key environmental management issues of concern to the relevant
community(ies) for the CSSI; and
g set out procedures and mechanisms: Pre-construction
i. through which the community can discuss or provide feedback to the
Proponent;
ii. through which the Proponent will respond to enquiries or feedback from the
community; and
iii. to resolve any issues and mediate any disputes that may arise in relation to
The Community Communication Strategy must be submitted to the Secretary for Pre-construction
B3 approval no later than one (1) month before commencement of any works, or
within another timeframe agreed with the Secretary.
Work for the purposes of the CSSI must not commence until the Community Pre-construction
B4 Communication Strategy has been approved by the Secretary, or within another
timeframe agreed with the Secretary.
The Community Communication Strategy, as approved by the Secretary, must be Construction,
B5 implemented for the duration of the works and for 12 months following the Post-construction
completion of Construction.
Complaints Management System
A Complaints Management System must be prepared and submitted to the All phases
Secretary for information prior to the commencement of any works in respect of
B6 the CSSI and be implemented and must be maintained for the duration of works
and for a minimum for 12 months following completion of Construction of the
CSSI.
The Complaints Management System must include a Complaints Register to be
maintained recording information on all complaints received about the CSSI
during the carrying out of any works associated with the CSSI and for a minimum
of 12 months following the completion of Construction.
B7 The Complaints Register must record the:
a number of complaints received; All phases
b number of people affected in relation to a complaint; and All phases
c nature of the complaint and means by which the complaint was addressed and All phases
whether resolution was reached, with or without mediation.
The Complaints Register must be provided to the Secretary upon request, within All phases
B8
the timeframe stated in the request.
The following must be available within one (1) month from the date of this
approval, or within another timeframe agreed with the Secretary, and for 12
months following the completion of Construction:
a a 24 hour telephone number for the registration of complaints and enquiries All phases
B9 about the CSSI;
b a postal address to which written complaints and enquires may be sent; All phases
c an email address to which electronic complaints and enquiries may be All phases
transmitted; and
d a mediation system for complaints unable to be resolved. All phases
The telephone number, postal address and email address required under Pre-construction,
Condition B9 of this approval must be published in a newspaper circulating in the Post-construction
local area and on site hoarding at each Construction site before commencement
B10
of Construction and published in the same way again prior to the commencement
of operation. This information must also be provided on the website required
under Condition B11 of this approval.
Provision of electronic information
A website providing information in relation to the CSSI must be established
before
commencement of works and maintained during the delivery of the CSSI, and for
a minimum of 12 months following the completion of Construction or within
another timeframe as agreed with the Secretary. The following up-to-date
information (excluding confidential, private and commercial information) must
be published and maintained on the website or dedicated pages:
a information on the current implementation status of the CSSI; All phases
b a copy of the documents listed in Condition A1 of this approval, and any All phases
documentation relating to any modifications made to the CSSI or the terms of
B11 this approval;
B11
c a copy of this approval in its original form, a current consolidated copy of this All phases
approval (that is, including any approved modifications to its terms), and copies
of any approval granted by the Minister to a modification of the terms of this
approval;
d a copy of each statutory approval, licence or permit required and obtained in All phases
relation to the CSSI; and
e a current copy of each document required under the terms of this approval and All phases
any endorsements, approvals or requirements from the ER and Secretary, all of
which must be published prior to the commencement of any works to which they
relate or before their implementation as the case may be.
PART C - CONSTRUCTION ENVIRONMENTAL MANAGEMENT
Construction environmental management plan

A Construction Environmental Management Plan (CEMP) must be prepared in accordance Pre-construction
with the Department of Infrastructure, Planning and Natural Resources Guideline for the
C1 Preparation of Environmental Management Plans (DIPNR; 2004) to detail how the performance
outcomes, commitments and mitigation measures specified in the documents listed in
Condition A1 will be implemented and achieved during all stages of Construction.
The CEMP must provide
a a description of activities to be undertaken during Construction (including the scheduling of Pre-construction
construction);
b details of environmental policies, guidelines and principles to be followed in the Construction Pre-construction
of the CSSI;
c a schedule for compliance auditing; Pre-construction
d a program for ongoing analysis of the key environmental risks arising from the activities Pre-construction
described in subsection (a) of this condition, including an initial risk assessment undertaken
before the commencement of Construction of the CSSI;
e details of how the activities described in subsection (a) of this condition will be carried out Pre-construction
to:
i. meet the performance outcomes stated in the the documents listed in Condition A1;
and
ii. manage the risks identified in the risk analysis undertaken in subsection (d) of this
condition;
f an inspection program detailing the activities to be inspected and frequency of inspections; Pre-construction
C2 g a protocol for managing and reporting any: Pre-construction
i. Incidents; and
ii. non-compliances with this approval and with statutory requirements;
h procedures for rectifying any non-compliance with this approval identified during compliance Pre-construction
auditing, incident management or at any time during Construction;
i a list of all the CEMP Sub-plans required in respect of Construction, as set out in Pre-construction
Condition C4. Where staged Construction of the CSSI is proposed, the CEMP must also
identify which CEMP Sub-plan applies to each of the proposed stages of Construction;
j a description of the roles and environmental responsibilities for relevant employees and their Pre-construction
relationship with the ER;
k for training and induction for employees, including contractors and sub-contractors, in Pre-construction
relation to environmental and compliance obligations under the terms of this approval; and
l for periodic review and update of the CEMP and all associated plans and programs. Pre-construction
The CEMP must be endorsed by the ER and then submitted to the Secretary for approval no Pre-construction
later than one (1) month before the commencement of Construction or within another
C3
timeframe
agreed with the Secretary.
The following CEMP Sub-plans must be prepared in consultation with the relevant government
agencies identified for each CEMP Sub-plan and be consistent with the CEMP referred to in
Condition C1:
(** Required CEMP Sub-plan > Relevant government agencies to be consulted for each
CEMP sub-plan)
C4
a Traffic and transport > Relevant Councils Pre-construction
b Noise and vibration > Relevant Councils Pre-construction
c Biodiversity > OEH and DPI Fisheries Pre-construction
d Water, soil and contamination > DoI Water, DPI Fisheries and relevant Councils Pre-construction
e Heritage > OEH, relevant Councils, RAPs Pre-construction
The CEMP Sub-plans must state how:
a the environmental performance outcomes identified in the documents listed in Pre-construction
Condition A1, as modified by these conditions, will be achieved;
b the mitigation measures identified in the documents listed in Condition A1 as modified by Pre-construction
these conditions will be implemented;
C5
c the relevant terms of this approval will be complied with; Pre-construction
d the identification of the relevant environmental specific training and induction processes for Pre-construction
construction personnel; and
e issues requiring management during Construction, as identified through ongoing Pre-construction
environmental risk analysis, will be managed.
The CEMP Sub-plans must be developed in consultation with relevant government agencies Pre-construction
identified in Table 3 of Condition C4 Where an agency(ies) request(s) is not included, the
Proponent must provide the Secretary justification as to why. Details of all information
C6
requested
by an agency to be included in a CEMP Sub-plan as a result of consultation, including copies of
all correspondence from those agencies, must be provided with the relevant CEMP Sub-Plan.
Any of the CEMP Sub-plans may be submitted to the Secretary along with, or subsequent to, Pre-construction
the submission of the CEMP but in any event, no later than one (1) month before
C7
commencement
of Construction.
Subject to the provisions in this condition relating to staging Construction must not commence Pre-construction
until the CEMP and all CEMP Sub-plans have been approved by the Secretary. The CEMP and
CEMP Sub-plans, as approved by the Secretary, including any minor amendments approved by
C8 the ER must be implemented for the duration of Construction. Unless otherwise agreed by the
Secretary where the CSSI is being staged, Construction of a stage is not to commence unless
the CEMP and the CEMP Sub-plans referred to above cover those stages or the Secretary has
approved a specific CEMP and sub-plans for that stage.
Construction monitoring programs
The following Construction Monitoring Programs must be prepared in consultation with the
relevant government agencies identified for each Construction Monitoring Program to
compare actual performance of construction of the CSSI against performance predicted
performance.
C9 (** Required Construction Monitoring Programs > Relevant government agencies to be
consulted for each Construction Monitoring Program)
a Air quality > … Pre-construction
b Noise and vibration > … Pre-construction
c Water, soil and contamination > DPI, DoI and relevant Councils Pre-construction
Each Construction Monitoring Program must provide:
a details of baseline data available;
b details of baseline data to be obtained and when;
c details of all monitoring of the project to be undertaken;
d the parameters of the project to be monitored;
C10 e the frequency of monitoring to be undertaken;
f the location of monitoring;
g the reporting of monitoring results;
h procedures to identify and implement additional mitigation measures where results of
monitoring are unsatisfactory; and
i any consultation to be undertaken in relation to the monitoring programs.
The Construction Monitoring Programs must be developed in consultation with relevant
government agencies as identified in Condition C9 of this approval and must include, to the
written satisfaction of the Secretary, information requested by an agency to be included in a
C11
Construction Monitoring Programs during such consultation. Details of all information
requested by an agency including copies of all correspondence from those agencies, must be
provided with the relevant Construction Monitoring Program.
The Construction Monitoring Programs must be endorsed by the ER and then submitted to Pre-construction
the Secretary for approval at least one (1) month before commencement of Construction or
C12
within
another timeframe agreed with the Secretary.
Construction must not commence until the Secretary has approved all of the required Pre-construction
C13 Construction Monitoring Programs, and all relevant baseline data for the specific construction
activity has been collected.
The Construction Monitoring Programs, as approved by the Secretary including any minor Construction,
amendments approved by the ER, must be implemented for the duration of Construction and Post-construction
C14 for
any longer period set out in the monitoring program or specified by the Secretary, whichever
is
The results of the Construction Monitoring Programs must be submitted to the Secretary, and Post-construction
C15 relevant regulatory agencies, for information in the form of a Construction Monitoring Report
at the frequency identified in the relevant Construction Monitoring Program.
Where a relevant CEMP Sub-plan exists, the relevant Construction Monitoring Program may Pre-construction
C16
be incorporated into that CEMP Sub-plan.
PART D - OPERATIONAL ENVIRONMENTAL MANAGEMENT
Operational environmental management
An Operational Management Plan (OEMP) must be prepared in accordance with
the Department’s Guideline for the Preparation of Environmental Management
Plans to detail how the performance outcomes, commitments and mitigation
D1
measures made and identified in the documents listed in Condition A1 will be
implemented and achieved during Operation. This condition (Condition D1)
does not apply if Condition D2 of this approval applies.
An OEMP is not required for the CSSI if the Proponent has an Environmental
Management System (EMS) or equivalent as agreed with the Secretary, and can
demonstrate, to the written satisfaction of the Secretary, that through the
EMS:
a the performance outcomes, commitments and mitigation measures, made and
D2 identified in the documents listed in Condition A1, and these conditions of
approval can be achieved;
b issues identified through ongoing risk analysis can be managed; and
c procedures are in place for rectifying any non-compliance with this approval
identified during compliance auditing, incident management or any other time
during operation.
The OEMP or EMS or equivalent as agreed with the Secretary, must be
submitted to the Secretary for information no later than one (1) month before
D3
the commencement of operation unless another timeframe is agreed with the
Secretary.
Where an OEMP is required, the Proponent must include the following OEMP
Sub-plans in the OEMP:
(** Required OEMP Sub-plan > Relevant government agencies to be
D4
consulted for each OEMP sub-plan)
a Flooding, water quality and drainage > Directly affected landowners, OEH, DoI
Water, SES and relevant Councils
Each of the OEMP Sub-plans must include the information set out in Condition
D5
D2 of this approval.
The OEMP Sub-plans must be developed in consultation with relevant Pre-
government agencies as identified in Condition D4. Where an agency(ies) construction
request(s) is not included in an OEMP subplan, the Proponent must provide to
D6 the Secretary justification as to why. Details of all information requested by
an agency to be included in an OEMP Sub-plan as a result of consultation,
including copies of all correspondence from those agencies, must be provided
with the relevant OEMP Sub-Plan.
D7 The OEMP Sub-plans must be submitted to the Secretary as part of the OEMP.
The OEMP or EMS or equivalent as agreed with the Secretary, as submitted to Construction
the Secretary and amended from time to time, must be implemented for the
D8
duration of operation and the OEMP or EMS must be made publicly available
prior to the commencement of operation.
Operational noise monitoring program
Within 12 months of the commencement of Operation of the CSSI, or as The Operational Noise
otherwise agreed by the Secretary, the Proponent must undertake monitoring Report must be
of operational noise to compare actual noise performance of the CSSI against submitted to the
the noise performance predicted in the review of noise mitigation measures Secretary and the EPA
required by Condition E36. The Proponent must prepare an Operational Noise within 60 days of
Compliance Report to document this monitoring. The Report must include, but completing the
not necessarily be limited to: perational noise
monitoring or within
another timeframe
agreed by the
Secretary, and made
publicly available.
a noise monitoring to assess compliance with the operational noise levels Pre-
predicted in the review of operational noise mitigation measures required construction
under Condition E36
b a review of the operational noise levels in terms of criteria and noise goals Pre-
established in the NSW Road Noise Policy 2011; construction
D9
c methodology, location and frequency of noise monitoring undertaken, Pre-
including monitoring sites at which CSSI noise levels are ascertained, with construction
specific reference to locations indicative of impacts on sensitive receivers;
d details of any complaints and enquiries received in relation to operational Pre-
noise generated by the CSSI between the date of commencement of operation construction
and the date the report was prepared;
e any required recalibrations of the noise model taking into consideration Pre-
factors such as noise monitoring and actual traffic numbers and proportions; construction
f an assessment of the performance and effectiveness of applied noise Pre-
mitigation measures together with a review and if necessary, reassessment of construction
feasible and reasonable mitigation measures; and
g identification of additional feasible and reasonable measures to those Pre-
identified in the review of noise mitigation measures required by Condition construction
E36, that would be implemented with the objective of meeting the criteria
outlined in the NSW Road Noise Policy 2011, when these measures would be
implemented and how their effectiveness would be measured and reported to
the Secretary and the EPA.
PART E - KEY ISSUE CONDITIONS
Air Quality
In addition to the performance outcomes, commitments and mitigation Construction
measures specified in the documents listed in Condition A1, all reasonably
E1
practicable measures must be implemented to minimise the emission of dust
and other air pollutants during the Construction and operation of the CSSI.
Biodiversity
The Proponent must develop a Biodiversity Offset Strategy (BOS) to outline how Pre-construction
the ecological values impacted by the CSSI will be offset in perpetuity. The BOS
must be developed from the draft BOS detailed in the documents listed in
Condition A1 and include the threatened ecological communities identified in
E2 The Northern Road, Submissions and Preferred Infrastructure, Biodiversity
Addendum technical memo (Jacobs, 26 October 2017). The BOS must be
submitted for the pproval of the Secretary within 12 months of the
commencement of Construction or within another timeframe agreed with the
Secretary.
Within 12 months of the approval of the BOS or within another timeframe
agreed with the Secretary, the Proponent must develop and submit to the
Secretary for approval, a Biodiversity Offset Package, consistent with the BOS
approved under condition E2. The Package must be prepared in consultation
with OEH and confirm how the impacts of the CSSI will be offset. The Package
must be consistent with the biodiversity offset strategy requirements of the
NSW Biodiversity Offsets Policy for Major Projects (OEH, 2014), unless
otherwise agreed by OEH. The Package must include, but not necessarily be
limited to:
a identification of the number of biodiversity credits required to offset the Pre-construction
impacts of the CSSI;
b details on the biodiversity credits identified to offset the impacts of the CSSI Pre-construction
E3
and evidence that they can be attained and secured in accordance with the
NSW Biodiversity Offsets Policy for Major Projects; and
c for offsets not secured through the retirement of biodiversity credits, details Pre-construction
on the supplementary measures that would be implemented to offset the
residual impacts, in accordance with Appendix B of the NSW Biodiversity
Offsets Policy for Major Projects and the Framework for Biodiversity
Assessment (OEH, 2014).
d should supplementary biodiversity offset measures be proposed, the Pre-construction
Biodiversity Offset Package must also provide details on the management and
monitoring requirements for compensatory habitat works and other biodiversity
offset supplementary measures proposed to ensure that outcomes of the
package are achieved.
All required offsets must be secured, in consultation with the OEH, within 12 Pre-construction
months of the approval of the Biodiversity Offset Package or within another
E4 timeframe agreed with the Secretary. The Proponent must submit to the
Secretary a copy of the Credit Retirement Report issued by the OEH once the
offsets are secured, within one month of receiving the report.
During vegetation clearing, timber and root balls must be retained where Construction
practicable for reuse in habitat enhancement and rehabilitation work. The
retained timber and root balls may be used on or off the CSSI site. Prior to the
E5 commencement of vegetation clearing, the Proponent must consult with
community groups, the Mulgoa Valley Landcare Group and relevant government
agencies to determine if retained timber and root balls could be used for
environmental rehabilitation projects, before pursuing other disposal options.
Flooding and hydrology
Measures identified in the documents listed in Condition A1 to maintain or
improve flood characteristics must be incorporated into the detailed design of
E6 the CSSI following consultation with adversely affected landowners and
businesses, DoI Water, DPI Fisheries, SES and relevant Councils. These
measures must be reviewed and endorsed by a suitably qualified person.
Flood information including flood reports, models and geographic information Post-
system outputs, and work as executed information from a registered surveyor construction
certifying finished ground levels and the dimensions and finished levels of all
structures within the flood prone land, must be provided to the relevant
E7 Council and the SES. The relevant Council and the SES must be notified in
writing that the information is available no later than one month following the
completion of Construction. Information requested by the relevant Council or
the SES must be provided no later than six months following the completion of
Construction or within another timeframe agreed with the relevant Council and
For property/ies where modelling in the documents listed in Condition A1 The agreed measures must be
predicts that the CSSI will potentially reduce the available stormwater runoff implemented before and during
yield to a farm dam, the Proponent must, in consultation with the affected Construction of any works that may
landowner: potentially affect the flow of water
into the farm dams. ln the event that
E8
a calculate the nature and extent of impacts on water supply; Pre-construction the Proponent and the relevant
b determine what measures may be implemented to prevent, mitigate or offset a Pre-construction property owner cannot agree on the
loss in water supply; and measures to mitigate the impact, the
c implement the measures agreed with the potentially affected landowner at no Pre-construction Proponent shall engage a suitably
cost to the landowner. qualified and experienced independent
Heritage
Impacts to heritage, unless approved, must be avoided and minimised. Where All phases
E9 impacts are unavoidable, works must be undertaken in accordance with the
Construction Heritage Management Sub-plan required by Condition C4(e).
This approval does not allow the Proponent to harm, modify, or otherwise Construction
E10 impact human remains uncovered during Construction and operation of the
CSSI.
The Proponent must implement the mitigation measures described in:
a Table 6-1 of the SPIR; All phases
E11
b Appendix D of the SPIR – Item 9, Miss Lawson’s Guesthouse Archaeological Site, All phases
Research Design and Excavation Methods dated 9 October 2017, prepared by
E11 EMM; and
c Appendix D of the SPIR – Item 10, Lawson’s Thistle Inn and Store Archaeological All phases
Site, Archaeological Assessment Research Design dated 16 October 2017,
prepared by EMM,
* except as required by this approval
Non-Indigenous Heritage
A detailed Historical Archaeological Salvage Strategy must be prepared before Pre-construction
any Historical archaeological salvage is undertaken within the CSSI boundary, if
not already included within the EIS or SPIR. Any Salvage Strategy not included
E12
in the EIS or SPIR, must be prepared in consultation with the Heritage Council
of NSW and submitted to the Secretary for information at least one month prior
to the commencement of excavation and salvage works.
Following completion of all salvage works associated with heritage items, a
Historical Archaeological Excavation Report must be prepared in accordance
with any guidelines and standards required by the Heritage Council of NSW. The
E13 Report must provide details of any archival recording, further historical
research undertaken, and archaeological excavations (which incorporates
artefact analysis, includes archaeological site records and identification of a
final repository for finds) carried out for the CSSI.
The Historical Archaeological Excavation Report must be submitted to the Post-
Secretary, the Heritage Council of NSW, the relevant Council Local Studies construction
E14 Library, for information no later than 12 months after the completion of the
work referred to in Conditions E9 to E13 or within another timeframe agreed by
the Secretary.
Prior to conducting acoustic treatment at any heritage item, the advice of a
suitably qualified and experienced built heritage expert must be obtained and
E15
implemented, to ensure any such work does not have an adverse impact on the
heritage significance of the item.
An Unexpected Heritage Finds Procedure must be prepared to manage Pre-construction
unexpected NonIndigenous heritage finds in accordance with any guidelines and
standards prepared by the Heritage Council of NSW. The Procedure must be
E16 prepared by a suitably qualified and experienced heritage specialist in
consultation the Heritage Council of NSW and submitted to the Secretary for
information no later than one month prior to the commencement of
Construction or within another timeframe agreed by the Secretary.
The Unexpected Heritage Finds Procedure, as submitted to the Secretary, must Construction
E17
be implemented for the duration of works.
Aboriginal Cultural Heritage
A detailed Aboriginal Cultural Salvage Strategy must be prepared before any Pre-construction
Aboriginal cultural salvage is undertaken within the CSSI boundary, if not
already included within the EIS. Any Salvage Strategy not included in the EIS or
E18
SPIR, must be prepared in consultation with OEH and RAPs (as relevant) and
submitted to the Secretary for information at least one month prior to the
commencement of excavation and salvage works.
Following completion of all salvage works associated with Aboriginal heritage
items, an Aboriginal Cultural Heritage Report must be prepared in accordance
with any guidelines and standards required by the OEH or RAPs (as relevant).
E19
The Report must provide details of any cultural heritage investigations either
undertaken or to be carried out including analysis of artefacts from excavations
and identification of a final repository for finds carried out for the CSSI.
The Aboriginal Cultural Heritage Report must be submitted to the RAPs for
endorsement, and Secretary for information no later than 12 months after the
E20
completion of the work referred to in Conditions E9 to E11 and E18 to E19 or
within another timeframe agreed by the Secretary.
An Unexpected Human Remains Procedure must be prepared to manage Pre-construction
unexpected human remains finds in accordance with NSW statutory
requirements, any guidelines and standards prepared by the OEH. The
Procedure must outline the process for consulting with the RAPs in the event
E21 that previously unidentified Aboriginal heritage is discovered.
The Procedure must be prepared by a suitably qualified and experienced
heritage specialist in consultation with OEH and submitted to the Secretary for
information no later than one month prior to the commencement of
Construction or within another timeframe agreed by the Secretary.
The Unexpected Human Remains Procedure, as submitted to the Secretary, Construction Note: Human remains that are found
must be implemented for the duration of works. unexpectedly during works are under
E22 the jurisdiction of the
NSW State Coroner and must be
reported to the NSW Police
Noise and vibration
Hours of work
Works must only be undertaken during the following standard construction Construction
hours:
E23 a 7:00 am to 6:00 pm Mondays to Fridays, inclusive;
b 8:00 am to 1:00 pm Saturdays; and
c at no time on Sundays or public holidays.
Except as permitted by an EPL, highly noise intensive works that result in an Construction For the purposes of this condition,
exceedance of the applicable noise management level at the same receiver 'continuous' includes any period during
must only be undertaken: which there is less than a one hour
E24 a between the hours of 8:00 am to 6:00 pm Monday to Friday; respite between ceasing and
b between the hours of 8:00 am to 1:00 pm Saturday; and recommencing any of the work the
c in continuous blocks not exceeding three hours each with a minimum respite subject of this condition.
from those activities and works of not less than one hour between each block.
The Proponent must identify and consult with receivers identified as being
subject to levels that exceed the Highly Noise Affected criteria with the
E25
objective of determining appropriate hours of respite unless an agreement is
reached with those receivers.
Variation to hours of work
Notwithstanding Condition E23 works associated with the CSSI may be
undertaken outside the specified hours in the following circumstances:
a for the delivery of materials required by the NSW Police Force or other
authority for safety reasons; or
b where it is required in an emergency to avoid injury or the loss of life, to avoid
damage or loss of property or to prevent environmental harm; or
c where it causes LAeq(15 minute) noise levels:
i. no more than 5 dB(A) above the rating background level at any residence in
accordance with the Interim Construction Noise Guideline (DECC, 2009), and
ii. no more than the noise management levels specified in Table 3 of the
Interim
Construction Noise Guideline (DECC, 2009) at other sensitive land uses, and
E26 iii. continuous or impulsive vibration values, measured at the most affected
residence are no more than those for human exposure to vibration, specified in
Table 2.2 of Assessing Vibration: a technical guideline (DEC, 2006), and
iv. intermittent vibration values measured at the most affected residence are
no more than those for human exposure to vibration, specified in Table 2.4 of
Assessing Vibration: a technical guideline (DEC, 2006); or
d no more than 15 dB(A) above the night time rating background level at any
residence during
the night time period, when measured using the LAeq (1 minute) noise
descriptor; or
e where different hours are permitted or required under an EPL in force in
respect of the works,
in which case those hours must be complied with.
On becoming aware of the need for emergency works in accordance with
Condition E26 the Proponent must notify the ER and the EPA (if an EPL applies)
E27 of the need for those works. The Proponent must also use its best endeavours
to notify all affected sensitive receivers of the likely impact and duration of
those works.
Queuing and idling construction vehicles
Construction vehicles arriving at the project site and construction compounds Construction
E28 outside the standard construction hours described in Condition E23 must not
queue with idling engines.
Respite
The Proponent must consult with potentially affected community, religious, Construction
educational institutions and noise and vibration-sensitive businesses to identify
periods during which they would be adversely affected by noise generating
E29 works, and must not schedule those works during those periods unless the
Proponent and the potentially affected institution or business have made other
arrangements (at no cost to the affected receiver), or the Secretary has
otherwise approved the works.
Cumulative construction noise impacts
The Proponent must ensure that all works for the delivery of the CSSI are Construction
coordinated with utility works, including those works undertaken by third
E30
parties, to minimise cumulative impacts of noise and vibration and to maximise
respite for affected sensitive receivers.
Ancillary facility acoustic barriers
Temporary acoustic barriers (2.4 metres high) are to be installed as soon as site Pre-construction,
establishment works at the ancillary facility are completed and before Construction
undertaking any works which are required to be conducted at the facility. The
schedule for installing and removing the acoustic barriers, and justification for
E31
not installing acoustic barriers in certain locations, must be described in the
Ancillary Facilities Management Plan for the project prepared in accordance
with Condition A16. Acoustic barriers must be inspected and maintained to
remain effective throughout the use of the construction compound.
Construction vibration
The CSSI must be constructed with the aim of achieving the following
construction vibration goals:
a for structural damage to heritage structures, the vibration limits set out in the
German Standard DIN 4150-3: Structural Vibration – Part 3 Effects of vibration
on structures;
b for damage to other buildings and/or structures, the vibration limits set out in
E32 the British Standard BS 7385-1:1990 – Evaluation and measurement of vibration
in buildings—Guide for measurement of vibration and evaluation of their effects
on buildings (and referenced in Australian Standard 2187.2 – 2006 Explosives –
Storage and use – Use of explosives); and
c for human exposure, the acceptable vibration values set out in Assessing
Vibration: A Technical Guideline (Department of Environment and
Conservation, 2006).
The Proponent must ensure that vibration from construction activities does not Construction
exceed the vibration limits set out in the British Standard BS 7385-2:1993
E33
Evaluation and measurement for vibration in buildings. Guide to damage levels
from groundborne vibration.
The Proponent must conduct vibration testing before and during vibration Pre-construction,
generating activities that have the potential to impact on heritage items to Construction
identify minimum working distances to prevent cosmetic damage. ln the event
E34
that the vibration testing and monitoring shows that the preferred values for
vibration are likely to be exceeded, the Proponent must review the
construction methodology and, if necessary, implement additional mitigation
The Proponent must seek the advice of a heritage specialist on methods and Pre-construction
E35 locations for installing equipment used for vibration, movement and noise
monitoring of heritage-listed structures.
Operational noise mitigation report
A review of the proposed operational noise mitigation measures for the CSSI
must be undertaken by the Proponent. The review must be submitted to the
Secretary for approval prior to commencing Construction which would affect
the identified receivers, or within another timeframe agreed by the Secretary.
The review must:
a confirm the operational noise predictions of the CSSI based on detailed design. Pre-construction
The operational noise assessment shall be based on an appropriately calibrated
noise model (which has incorporated additional noise monitoring, where
necessary for calibration purposes);
E36
E36
b review the suitability of the operational noise mitigation measures identified in Pre-construction
the documents listed in Condition A1. The review must take into account the
detailed design of the CSSI and where necessary, refine the proposed measures
with the objective of meeting the criteria outlined in the NSW Road Noise
Policy (DECCW 2011), based on the operational noise performance of the CSSI
predicted under (a) above; and
c where necessary, investigate additional or alternative noise mitigation Pre-construction
measures to achieve the criteria outlined in the NSW Road Noise Policy
(DECCW, 2011).
Operational noise mitigation measures as identified in Condition E36 (such as at- Construction
property architectural treatments), that will not be damaged or compromised
by construction works, must be implemented within six (6) months of the
commencement of Construction which would affect the identified receivers or
within another timeframe agreed with the Secretary. These measures, and a
schedule that outlines the timing for their delivery, must be detailed in the
Noise and Vibration CEMP Sub-plan for the CSSI required by Condition C4(b).
E37
Where early implementation of noise mitigation measures is not proposed, the
Proponent must submit to the Secretary a report providing justification as to
why, along with details of temporary measures that would be implemented to
reduce construction noise impacts, until such time that the operational noise
mitigation measures identified in Condition E36 are implemented. The report
must be provided to the Secretary for approval prior to the commencement of
Construction which would affect the identified receivers.
All operational noise mitigation measures identified in Condition E36 must be
E38
implemented prior to Operation.
Property and land use
Agricultural and other land
The CSSI must be constructed in a manner that minimises intrusion and Construction
disruption to agricultural operations/activities in surrounding properties (e.g.
E39
stock access, access to farm dams, etc.), unless otherwise agreed by the
landowner.
Where the viability of existing agricultural operations are identified to be
impacted by the land requirements of the CSSI, the Proponent must, at the
request of the landowner(s), employ a suitably qualified and experienced
E40 independent agricultural expert, to assist in identifying management measures
to address the identified impacts. Where the Proponent has commenced the
requirements of this condition prior to the date of this Approval, the Proponent
may rely on these activities to fulfil the requirement.
Unencumbered access to private property must be maintained during
Construction unless otherwise agreed with the landowner in advance. A
E41
landowner’s access that is physically affected by the CSSI must be reinstated to
at least an equivalent standard, in consultation with the landowner.
Building condition survey
Prior to commencement of any works, a suitably qualified person must Pre-construction
undertake building and structure condition surveys of all buildings and
structures identified in the documents listed in Condition A1 as being at risk of
damage. The results of the surveys must be documented in a Building Condition
E42 Survey Report for each building and structure surveyed. Copies of Building
Condition Survey Reports must be provided to the landowners of the buildings
and structures surveyed and, if agreed by the landowner, the relevant Council
within three weeks of completing the surveys, and no later than one month
prior to the commencement of works.
After completion of the works, condition surveys of all buildings and structures Post-
for which pre-Construction condition surveys were undertaken in accordance construction
with Condition E42 of this approval must be undertaken by a suitably qualified
person. The results of the surveys must be documented in a Building Condition
E43 Survey Report for each building surveyed. Copies of Building Condition Survey
Reports must be provided to the landowners of the buildings surveyed and, if
agreed by the landowner, the relevant Council within three weeks of
completing the surveys, and no later than three (3) months following the
completion of works.
Any damage caused to property as a result of the CSSI must be rectified or the All phases Note: This condition is not intended to
E44 landowner compensated, within a reasonable timeframe, with the costs borne limit any claims that the landowner
by the Proponent. may have against the Proponent.
Soils
Erosion and sediment controls must be installed and appropriately maintained
to minimise any water pollution. When implementing such controls, any
E45
relevant guidance in the Managing Urban Stormwater series must be
considered.
Contaminated sites
A Site Contamination Report, documenting the outcomes of Stage 1 and Stage 2
contamination assessments of land upon which the CSSI is to be carried out,
E46 that is suspected, or known to be, contaminated must be prepared by a suitably
qualified and experienced person in accordance with guidelines made or
approved under the Contaminated Land Management Act 1997 (NSW).
If a Site Contamination Report prepared under Condition E46 concludes that
specified land is contaminated such that it is and will remain unsuitable for the
CSSI, even after completion of all physical works required to construct the
CSSI, then:
a a Remediation Action Plan must be prepared in relation to the specified land,
by a suitably qualified and experienced person and in accordance with all
guidelines made or approved under the Contaminated Land Management Act
E47
(NSW);
b the Remediation Action Plan must be approved in writing by a NSW EPA
Accredited Site Auditor, and that approval must state that the specified land
can be made suitable for the purpose approved by this approval, if the works
described in the Remediation Action Plan are carried out; and
c the specified land must be remediated in accordance with the Remediation
Action Plan, as approved by the Site Auditor.
A copy of the Site Audit Statement and the associated Site Audit Report must
E48 be submitted to the Secretary and the relevant Council for information no later
than one (1) month before the commencement of Operation.
An Unexpected Contaminated Land and Asbestos Finds Procedure must be Pre-construction
E49 prepared and must be followed should unexpected contaminated land or
asbestos be excavated or otherwise discovered during Construction.
The Unexpected Contaminated Land and Asbestos Finds Procedure must be Construction
E50
implemented throughout Construction.
Sustainability
A Sustainability Strategy for the Construction of the CSSI must be prepared in
accordance with the Infrastructure Sustainability Council of Australia
E51
infrastructure rating tool or other justified sustainability rating mechanism to
achieve an equivalent ‘As Built’ rating of Excellent.
The Sustainability Strategy must be submitted to the Secretary for information
prior to the commencement of Construction, or within another timeframe
agreed with the Secretary, and must be implemented throughout the
Construction of the CSSI. The Sustainability Strategy must include:
E52 a details of the sustainability objectives and targets for the design and Pre-construction
Construction of the CSSI;
b details of the sustainability initiatives which will be investigated and / or Pre-construction
implemented; and
c a description of how the strategy will be implemented for the CSSI. Pre-construction
Traffic and transport
The CSSI must be designed and operated to meet relevant road design Pre-construction
E53 standards, and ensure it does not adversely impact network connectivity, or
the safety and efficiency of the road network in the vicinity of the CSSI.
Vehicles used in the delivery of the project must not use local roads unless no Construction
E54 suitable alternatives are available. Where the use of local roads is proposed,
these must be identified in a Traffic and Transport CEMP Sub-plan.
A Road Dilapidation Report must be prepared by a suitably qualified person for Pre-construction
local roads (and associated infrastructure) proposed to be used by construction
vehicles for works associated with the CSSI before the commencement of use
E55
by such vehicles. Copies of the Road Dilapidation Report must be provided to
the relevant Council within three (3) weeks of completing the surveys and no
later than one (1) month before the use of local roads by project vehicles.
If damage to roads occurs as a result of the Construction of CSSI, the Proponent Construction
E56 must rectify the damage so as to restore the road to at least the condition it
was in pre-works, unless otherwise agreed by the relevant Councils.
During delivery of the CSSI, measures must be implemented to maintain Pre-construction,
pedestrian and vehicular access to, and parking in the vicinity of, businesses Construction
and affected properties. Alternative pedestrian access, vehicular access, and
E57 parking arrangements, and signage to direct customers to these businesses and
affected properties, must be developed in consultation with affected
businesses. Such arrangements must be outlined in the Traffic and Transport
CEMP Sub-plan and implemented prior to the disruption occurring.
Signage and directions to businesses must be provided before, and for the Pre-construction,
E58
duration of, any disruption during the Construction of the CSSI. Construction
Operational signage must be provided along the project alignment to inform Pre-construction,
motorists of services and council and community assets within the vicinity of Construction
E59 the CSSI including Luddenham village, community facilities and tourist areas in
accordance with the Guide: Signposting (RTA July 2007) and Tourist Signposting
Guide (RMS and Destination NSW 2012).
Urban design and visual amenity
The CSSI must be designed to retain as many trees as possible. The planting, Construction
retention and replacement of trees is to be carried out in accordance with the
EIS. Trees removed during construction that are not within an endangered
E60 ecological community are to be replaced at a rate of two trees for every tree
removed. Tree planting must occur within the CSSI boundary unless otherwise
envisaged in the EIS, in consultation with the relevant Council, or otherwise
agreed by the Secretary.
Tree species selection is to be consistent with the plans and planting palette in
the EIS. Pot sizes of selected tree species are to be consistent with part 3.2.1
E61
(Rural road reserves) in the RMS Landscape Guideline (April 2008), subject to
the long-term viability of the plant.
An Urban Design and Landscape Plan must be prepared based on the detailed
E62 design, and in accordance with the commitments made in the documents listed
in Condition A1.
The Urban Design and Landscape Plan must incorporate monitoring and
maintenance procedures for the built elements, rehabilitated and replacement
E63 vegetation and landscaping (including visual screening and weed control) and
performance indicators, responsibilities, timing and duration and contingencies
where rehabilitation of vegetation and landscaping measures fail.
The Urban Design and Landscape Plan must be finalised following consultation
with the relevant Councils and the community. The Urban Design and
E64
Landscape Plan shall incorporate evidence of consultation on the proposed
urban design and landscape measures and the monitoring and maintenance
The Urban Design and Landscape Plan must be made publicly available and Pre-construction Note: Works that are subject to
submitted to the Secretary for information prior to the commencement of community consultation include those
works for which the Urban Design and Landscape Plan requires community design and landscaping details that are
consultation under the Plan, or within another timeframe agreed by the not required to eet the other
E65
Secretary. requirements of this approval and/or
specific technical criteria. For
example, it does not include structures
or landscaping works associated with
Utilities and services
Utilities, services and other infrastructure potentially adversely affected by the
delivery of the CSSI must be identified before works affecting them commence,
to determine the requirements for access to, diversion protection, and/or
support of such services. The relevant owner and/or provider of services must
E66 be consulted to make suitable arrangements for access to diversion,
protection, and/or support of the affected infrastructure as required. The
Proponent must ensure that disruption to any service is minimised and be
responsible for advising local residents and businesses affected before any
planned disruption of service occurs.
Waste
Waste generated in the delivery of the CSSI must be dealt with in accordance
with the following priorities:
a waste generation is to be avoided and where avoidance is not reasonably
practicable, waste generation is to be reduced;
E67 b where avoiding or reducing waste is not possible, waste is to be re-used,
recycled, or recovered; and
c where re-using, recycling or recovering waste is not possible, waste is to be
treated or disposed of at a waste management facility or premises lawfully
permitted to accept the materials.
Waste generated outside the site must not be received at the site for storage,
treatment, processing, reprocessing, or disposal on the site, except as
E68
expressly permitted by a licence or waste exemption under the POEO Act, if
such a licence is required in relation to that waste.
All waste materials removed from the CSSI site must only be directed to a
waste management facility or premise lawfully permitted to accept the
E69 materials or in accordance with a Resource Recovery Exemption or Order issued
under the Protection of the Environment Operations (Waste) Regulation 2014,
or to any other place that can lawfully accept such waste.
All waste must be classified in accordance with the EPA’s Waste Classification
E70 Guidelines, with appropriate records and disposal dockets retained for audit
purposes.
Water
Where available and practicable, and of appropriate chemical and biological
E71 quality, stormwater, recycled water or other water sources shall be used in
preference to potable water for the delivery of the CSSI, including dust control.
Drainage feature crossings (permanent and temporary watercourse crossings
and stream diversions) and drainage swales and depressions must be designed
E72
and constructed in accordance with relevant guidelines and designed by a
suitably qualified and experienced person in consultation with DPI Fisheries.
Northern Road Upgrade Stage 4 - Compliance Tracking Matrix
G36 - Environmental Protection
CEMP Preperation Auditing
Heading Section (G36) Statement Compliance Section Notes Review Review due Review Review Review Review Review Review Compliant Notes
in CEMP required? date due date due date due date due date due date due date (Yes/No)
General Scope 1.1 When carrying out the Work Under the Contract, apply:
(a) your corporate Contractor’s Environmental Management System (CEMS) (refer to Clause 2);
(b) your project specific Contractor’s Environmental Management Plan (CEMP) (refer to Clause
3) in accordance with State Tender Baseline Condition of Approval (C1-C8) and Federal Tender
Baseline Condition of Approval (29-38);
which must be developed in accordance with this Specification, and guided by AS/NZS ISO
14001
General Requirements Annexure A.
Develop, implement and maintain for the duration of the Contract, a Contractor’s
2
Environmental
Management System (CEMS) that meets the requirements of ISO 14001 and the NSW
Government
Environmental Management System Guidelines and the Department of Planning and
Environment
Draft Post Approvals Environmental Management Plan Guidelines.
Contractors CEMP - 3.1 The Principal will prepare an Over Arching Construction Environmental Management Plan
Preperation and (OACEMP) in accordance with (SSI-7127) Condition of Approval C1 and C2 and Federal
Submission of CEMP Conditions of Approval (CoA) 29-38. The OACEMP will also be prepared in accordance with NSW
Department of Infrastructure, Planning and Natural Resources (DIPNR) publication “Guideline
for the Preparation of Environmental Management Plans” and Department of Planning and
Environment “Environmental Management Plan” (Draft 2017).
Contractors CEMP - 3.1 Prepare a Contractor’s Environmental Management Plan (CEMP) for the Work Under the
Preperation and Contract.
Submission of CEMP The CEMP must be prepared in accordance with the Principal’s approved OACEMP. Your CEMP
Contractors CEMP - must be consistent
Your CEMP must: with, and incorporate, all relevant elements of your CEMS.
3.1
Preperation and
Submission of CEMP (a) include an Environmental Policy that contains a commitment to the principles of
Ecologically
Sustainable Development as detailed in the Protection of the Environment Administration Act
1991 (NSW);
(b) describe all relevant elements of, and include references to, the CEMS documentation and
how
these will apply to the Work Under the Contract;
(c) address all aspects and stages of the Work Under the Contract;
(d) address the requirements of all relevant environmental legislation and the Conditions of
Approval relevant to your work, including the Conditions of Approval;
(e) address the strategies, management plans and programs that have been prepared by the
Principal to address the Conditions of Approval;
Contractors CEMP - 3.1 Include in your CEMP all relevant management measures set out in the approved OACEMP,
Preperation and including Sub-plans to ensure:
Submission of CEMP (i) consistency and standardisation of wording and environmental management practices;
(ii) consistency in the management of construction impacts;
(iii) consistency in the application of mitigation and management measures; and,
(iv) a streamlined approval process for the approval of the CEMP.
Contractors CEMP - 3.1 The OACEMP and associated construction management Plans contain:
Preperation and (a) standard and generic construction management systems and processes; and,
Submission of CEMP (b) management and mitigation measures that generally apply to The Northern Road Upgrade
between Mersey Road, Bringelly and Glenmore Parkway Glenmore Park.
Contractors CEMP - 3.1 The OACEMP and associated Construction Management Plans are working documents for you
Preperation and which must be:
Submission of CEMP (i) used as the base for the preparation of your CEMP;
(ii) amended to suit project and site specific conditions and details; and,
(iii) amended to address any comments by the Principal, Environmental Representative,
regulatory Authorities or the DP&E.
Contractors CEMP - 3.1 You must highlight all changes that you make to the OACEMP in all versions of the CEMP that
Preperation and you present to the Principal for information, review, comment or approval.
Submission of CEMP
Contractors CEMP - 3.1 Submission of your CEMP and associated management Plans must comply with the following
Preperation and procedure:
Submission of CEMP 1. Review and comment by the Principal on the draft CEMP;
2. Resubmission of the amended draft CEMP to the Principal addressing the Principal’s
comments;
3. Review of the amended draft CEMP by the Principal to check that comments raised on the
draft CEMP have been satisfactorily addressed. If comments have not been satisfactorily
addressed by you, further updates must be carried out by you. This step can be repeated as
many times as necessary until all the comments have been satisfactorily addressed. You will
not be entitled to claim for additional costs or an extension of time for Completion to address
the comments on the amended draft CEMP;
Submission of CEMP
4. Following closeout of the Principal’s comments, submit the final CEMP to the Principal;
CEMP and sub-plan submission and re-submissions must provide:
(a) 1 x MS Word version original document;
(b) 1 x MS Word version with tracked changes showing edits or markups since previous
submission;
(c) 1 x MS Word version updated clean version, no track changes;
(d) 1 x PDF final with all appendices; and
(e) a spreadsheet showing how RMS comments have been addressed and status – Open /
Contractors CEMP - 3.1 You must respond to all issues and comments raised by the Principal, in the above described
Preperation and spreadsheet at every stage of review. To aid in the approval process for the CEMP and all
Submission of CEMP supplementary Plans, provide the tabulated responses for each issue or comment to the
Principal when submitting the revised CEMP.
Contractors CEMP - 3.1 The time period you must allow for the review of a complete submission for the stage of works
Preperation and covered by your CEMP by the Principal is twenty (20) working days per submission or re-
Submission of CEMP submission.
Contractors CEMP - 3.1 The time period you must allow for review by the Principal of a complete submission for the
Preperation and stage of works covered by your amended CEMP to ensure that all comments received on the
Submission of CEMP previous draft CEMP have been satisfactorily addressed by you is five (5) working days per
submission or re-submission.
Contractors CEMP - 3.1 The CEMP must also include the following elements:
Preperation and Incorporation of environmental hazard and risk management planning, which may include
Submission of CEMP items
such as:
(i) Details of the environmental hazards and risks associated with construction activities;
(ii) Environmental risk management measures;
(iii) Procedures to comply with all relevant legislative and industry standard requirements;
HOLD POINT Process Held: Commencement of Work not previously addressed by CEMS and CEMP documents
and authorised by earlier Hold Point release.
Submission Details: At least four (4) weeksprior to the proposed commencement of the stage of
Work Under the Contract nominated in the submission by you in accordance with the above
submission procedure, submit the CEMP and associated Sub-Plans and/or EWMS, as well as the
CEMS documents listed in Clause 3.1.
Planning - Environmental 3.2.1 Nominated in Annexure G36/A and prior to commencement of any work on Site, carry out an
Risk Assessment Workshop environmental risk assessment workshop to identify all the environmental constraints
associated with the Work Under the Contract and address the environmental risks associated
with the constraints and activities you propose to undertake.
Planning - Environmental 3.2.1 Use the environmental risk assessment workshop to develop risk mitigation and management
Risk Assessment Workshop strategies to eliminate or reduce the risk exposure. These risk mitigation strategies must be
consistent with the environmental safeguards and management measures listed in the
Environment Assessment documents listed in Annexure G36/A3 and with the RMS Biodiversity
Guidelines. Incorporate these risk mitigation strategies into your CEMP.
Planning - Environmental 3.2.1 Use the workshop to raise general awareness of good environmental management practices
Risk Assessment Workshop among your staff and subcontractors working on the Site and to develop ideas and actions to
improve environmental practices and to develop an audit and inspection program for the
works.
Planning - Environmental 3.2.1 Participants must include your site management staff, your Environmental Site Representative
Risk Assessment Workshop (refer Clause 3.3), representatives from all relevant regulatory agencies, the Environmental
Representative and any other personnel including subcontractors who will be performing the
Work Under the Contract. Agree the list of attendees with the Principal. Provide the Principal
and all invitees at least fifteen (15) working days prior to the workshop with an agenda and
any supporting information to allow for representatives of the Principal to also attend the
Planning - Environmental 3.2.1 Submit a final workshop report to the Principal within five (5) working days from the date of
Risk Assessment Workshop the workshop.
Planning - Environmental 3.2.1 Review the environmental risk assessment regularly to ensure it remains relevant for the
Risk Assessment Workshop duration of the Work Under the Contract.
Planning - Regulatory 3.2.2 The CEMP must identify your obligations under environmental legislation that are relevant to
Requirements and the
Compliance Work Under the Contract, including those listed in Annexure G36/M.
Planning - Regulatory 3.2.2 Planning approvals under the Environmental Planning and Assessment Act 1979 (NSW) and the
Requirements and Environment Protection and Biodiversity Conservation Act 1999 (Commonwealth) will be
Compliance obtained
Planning - Regulatory 3.2.2 The following approvals, licences and permits will be obtained by the Principal:
Requirements and (a) Environmental Protection Licence (EPL) under Section 48 of the Protection of the
Compliance Environment Operations Act 1997.
Planning - Regulatory 3.2.2 Ascertain from the appropriate authorities what other approvals, licences and permits are
Requirements and required for the Work Under the Contract.
Compliance
Planning - Regulatory 3.2.2 You are required to hold an Environment Protection Licence (EPL) for the Work Under the
Requirements and Contract. The Principal has been issued with an EPL prior to award of the Contract. You must
Compliance not commence work on site until the EPL has been transferred to your name. The Hold Point
in Clause 14.2 of Specification RMS G2 applies.
Planning - Regulatory 3.2.2 Obtain each necessary approval, licence and permit not obtained by the Principal prior to the
Requirements and commencement of any work which relates to that approval, licence, notification or permit.
Compliance Include copies of such approvals, licences and permits in the CEMP.
Planning - Regulatory 3.2.2 Include in your CEMS a compliance tracking program and keep the program up to date. Prior to
Requirements and commencement of the Compliance Tracking program, submit draft template to the Principal
Compliance for endorsement.
HOLD POINT Process Held: Commencement of any activity requiring an approval, licence and/or permit
from an appropriate authority.
Submission Details: At least five (5) working days prior to the activity, provide to the Principal
evidence of receipt of the approval, licence and/or permit from the relevant
authority.
Planning - Environmental 3.2.3 Include in the CEMP environmental objectives and targets for the Work Under the Contract
Objectives and Targets which
Planning - Environmental 3.2.3 The environmental objectives and targets must be measurable where practicable, are realistic
Objectives and Targets and relevant to the Work Under the Contract, and include a commitment to continuous
improvement of your CEMS.
Planning - Environmental 3.2.3 When establishing environmental objectives and targets, take into account the following:
Objectives and Targets (a) the environmental outcomes for the project as described in the Environment Assessment
documents listed in Annexure G36/A3;
(b) the results of the environmental risk assessment workshop;
(c) any applicable legal and other requirements;
(d) any technological, operational or other constraints or limitations.
Planning - Environmental 3.2.4 In addition to those specified elsewhere in Specifications RMS G36, G38 and/or G40, prepare
Work Method Statement EWMS and implement them as part of the Work Under the Contract for the following activities:
Aboriginal and non-Aboriginal heritage sites including Lawson’s Inn and Miss Lawson’s Guest
House archaeological sites;
protocols for the management of materials containing asbestos;
example:
- Construction and operation of sediment basins and/ or buffer swales and connecting drainage
for the associated catchment area;
- Construction of culverts, including associated staging, flow diversions, any dewatering, short
and long term stabilisation and removal of existing structures;
- Vegetation clearing and grubbing;
- Activities where construction water may be discharged into natural waterways;
- Construction and operation of concrete wash out areas;
receptors); and
and filling.
Planning - Environmental 3.2.4 The EWMS must include at least the following elements:
Work Method Statement (a) Description of the work activity, including any plant and equipment to be used;
(b) Outline of the sequence of tasks for the activity, including interfaces with other
construction activities (for example: the interface between cut and fill areas, stabilisation of
exposed areas, excavation for installation or upgrade of culverts, creek diversion works and
dewatering requirements);
(c) Maps (including an aerial background) identifying Identification work areas and of any
environmental and/or socially sensitive areas, sites or places (such as threatened species or
heritage items), likely potential environmental impacts including exclusion zones;
(d) Identification of potential environmental risks/impacts due to the work activity;
(e) Mitigation and management measures to reduce the identified environmental risk,
including assigned responsibilities to site management personnel;
(f) Process for assessing the performance of the implemented mitigation and management
measures including progressive review;
(g) Identification of practical cost-effective measures to reduce environmental risks/impacts
(consistent with the outcomes from the Environmental Risk Assessment Workshops (refer
Clause 3.2.1));
(h) A process for resolving environmental issues or conflicts; and
(i) Any safeguards resulting from consultation with public authorities and other stakeholders,
where appropriate.
Planning - Environmental 3.2.4 Develop the EWMS in consultation with the relevant site management personnel to ensure that
Work Method Statement all issues are addressed, methods and activities are practical and all personnel are aware of
their commitments and responsibilities. Review the EWMS periodically to ensure its
effectiveness and proper implementation and incorporate any improvements or changes
identified into subsequent revisions.
Planning - Environmental 3.2.4 In accordance with the approach outlined in the OACEMP, each Environmental Work Method
Work Method Statement Statement must be forwarded to the appropriate regulatory Authority (for high risk activities),
the Environmental Representative and Principal for review at least 21 working days prior to
commencement of the Works and any Temporary Work referred to in the Environmental Work
Method Statement. Proposed changes to Environmental Work Method Statements must be
advised
to the appropriate regulatory Authority, the Environmental Representative and Principal
Planning - Environmental 3.2.4 Consult the Principal to determine which Environmental Work Method Statement(s) are high
Work Method Statement risk
Planning - Environmental 3.2.4 Include in your CEMP a schedule of proposed EWMS for your activities.
Work Method Statement
Planning - Environmental 3.2.4 EWMS must be submitted to the Principal under a separate HOLD POINT to that for the CEMP.
Planning - Environmental 3.2.4 EWMS may be submitted progressively to suit the construction stages.
HOLD POINT Process Held: Commencement of work activities not previously addressed by EWMS documents
and authorised by earlier Hold Point release.
Submission Details: At least twenty one working days prior to the proposed commencement of
each applicable work activity, submit the EWMS documents, addressing the issues listed in
Clause 3.2.4 for the nominated work activity.
Planning-Resources, 3.3 The CEMP must indicate the names, responsibilities and authority of your site management
Responsibilities and personnel who have primary responsibility for developing, implementing and maintaining the
Authority CEMS and the CEMP for the Work Under the Contract, and rectifying any environmental
nonconformities identified by you or the Principal.
Planning-Resources, 3.3 Nominate in the CEMP a full-time Environmental Site Representative (ESR) as a member of
Responsibilities and your on-sitemanagement team, who will be the authorised contact person for communications
Authority with the Principal and the EPA on all environmental matters.
The ESR must have tertiary qualification in Environmental Science, Environmental Engineering
orequivalent, and a minimum of 5 years experience in environmental management on road
construction or other equivalent works.
Where your designated Environmental Management Representative will be based mainly off-
site, detail in the CEMP the relationship between the Environmental Management
Representative and the ESR.
Planning-Resources, 3.3 The ESR’s responsibilities and authority include the following:
Responsibilities and (a) advising on environmental matters specified in this Specification and compliance with all
Authority other relevant statutory approvals, licences, permits and authorisations;
(b) liaison with the Principal, the Environmental Representative and with all relevant
authorities on environmental matters;
(c) maintaining a register of all environmental management documents for the Contract;
(d) ensuring that the CEMP is established, implemented and maintained in compliance with
this Specification, including all Sub-Plans, procedures and supplementary EWMS, and upgrades
to these documents (as needed) to remain current with the progress of the Works;
(e) overall responsibility for the establishment, management, monitoring and maintenance of
erosion and sediment controls within the Site;
(f) carrying out regular daily inspections and auditing of the works at least every fortnight to
ensure that environmental safeguards are being followed;
(g) identifying where the implemented environmental measures are not meeting the targets
set, and identifying areas where improvement can be achieved;
(h) preparing monthly reports outlining the works that have been undertaken and the
achievements that have been met, as well as identifying those areas where improvements
were made and detailing environmental performance (see Clauses 3.11 and 3.12), including all
noncompliances with the requirements of the EPL and any other environmental reporting
requirements;
(i) facilitating environmental induction and toolbox talks for all site personnel;
(j) specific authority to stop work on any activity where the ESR deems it necessary to prevent
environmental nonconformities;
(k) notification to the relevant parties of any environmental incidents.
Planning-Resources, 3.3 The ESR must immediately advise you, the Principal and the Environmental Representative of
Responsibilities and any environmental incidents relevant to the Project Approval resulting from the works that
Authority are not dealt with expediently or adequately by you in accordance with your CEMP.
Planning-Resources, 3.3 The CEMP must include details of the role, qualifications and responsibilities of the ESR and
Responsibilities and any critical site activities that require the presence of the ESR.
Authority
Planning - Soil 3.3.1 You must engage, and retain until Completion, a suitably experienced external Certified
Conservationist Practicing Erosion and Sediment Control Professional (CPESC) as your Soil Conservationist.
Planning - Soil 3.3.1 All erosion, sediment and water pollution Plans, controls and measures must be reviewed by
Conservationist your Soil Conservationist prior to installation. Your Soil Conservationist must assist in project
training in regards to project erosion and sediment control issues.
Planning - Soil 3.3.1 Your Soil Conservationist must liaise on a regular basis with any soil conservationist appointed
Conservationist for the project by the Principal.
Planning - Soil 3.3.1 The CEMP must include details of the role, qualifications and responsibilities of the Soil
Conservationist Conservationist and any critical site activities that require the presence of the Soil
Conservationist.
Planning - Community 3.3.2 Provide a Community Relations Manager in accordance with RMS G1 Clause 10.11.
Relations Manager
Planning - Sustainability 3.3.3 Provide a Sustainability Manager in accordance with RMS G1 Clause 10.15.
Manager
Planning - Selection and 3.4 When complying with the purchasing requirements of RMS Q, include environmental
Management of management
Subcontractors requirements in the planning, selection and management of subcontractors.
Planning - Selection and 3.4 Include a requirement to comply with the CEMP in all contractual arrangements with your
Management of subcontractors.
Subcontractors
Planning - Selection and 3.4 For subcontracted work, include in the CEMP the procedures that you will implement for
Management of ensuring subcontractor compliance, including details of:
Subcontractors (a) the duties of each subcontractor for planning, implementing and monitoring environmental
protection measures and for keeping environmental records;
(b) the duties you will retain for environmental protection of subcontracted work;
(c) how environmental protection measures on subcontracted work interact with adjacent
work areas, as applicable;
(d) your surveillance program to monitor the effectiveness of each subcontractor’s
environmental protection measures together with the relevant project documentation.
Planning - Selection and 3.4 You must monitor subcontractors to ensure compliance is achieved with the CEMP and
Management of associated Plans.
Subcontractors
Planning - Competence, 3.5
training and awareness
Planning - 3.5.1 Ensure that all your staff (including plant operators and truck drivers) and subcontractor
Communications Training personnel
working on the Site behave in a courteous and professional manner when in dialogue with any
community member. All of your personnel must be:
(a) trained on how to respond to community queries;
(b) aware of and abide by the requirements for the release of information; and
(c) advised on the identity of the community within which they are working, by the
Contractor
Planning - 3.5.1 Community involvement obligations must be included in the site induction of all personnel
Communications Training working
on the Site.
Planning - 3.5.1 Establish and maintain a register of communications training carried out, including dates,
Communications Training names
Planning - Environmental 3.5.2 Provide to all your staff (including plant operators and truck drivers) and subcontractor
Training personnel working on the Site with environmental training to achieve a level of competence
and awareness appropriate to their assigned activities before they commence their assigned
activities. Do not permit anyone who has not undergone the appropriate environmental
Planning - Environmental 3.5.2 The CEMP must include a site-specific environmental induction and training plan that
Training describes the minimum level of training, experience and/or qualifications required for staff
and subcontractors working on the Site, the names of the persons to be trained, the proposed
frequency of training and the procedures for training.
Planning - Environmental 3.5.2 Environmental induction training must cover all elements of the CEMP and must include, as a
Training minimum, the following:
(a) purpose and objectives of the CEMP;
(b) requirements of due diligence and duty of care;
(c) conditions of environmental licences, permits and approvals;
(d) potential environmental emergencies on Site and the emergency response procedures;
(e) reporting and notification requirements for pollution and other environmental incidents
including identification of contaminated land, and for damage and maintenance to
environmental controls;
(f) high-risk activities and associated environmental safeguards, e.g. earthworks, vegetation
clearing, night works, operation and maintenance of concrete washouts, and washing,
refuelling and maintenance of plant and equipment;
(g) working in or near environmentally sensitive areas;
(h) site specific issues including:
· Site flagging protocol as outlined in Specification RMS G40 Annexure G40/F;
· erosion and sediment controls, water quality controls and sediment basin management;
· management of contaminated material (including asbestos impacted material);
· groundwater and surface water;
· environmentally sensitive locations and no-go/exclusion zones;
· obligation to report and the process for reporting environmental issues on site including
damaged environmental controls;
· your obligations under the Noxious Weeds Act 1993 to prevent the spread of noxious weeds
during construction;
· your responsibilities under the National Parks and Wildlife Act 1974, including the need to
cease work immediately and report any object of potential Aboriginal heritage unearthed
during clearing, grubbing and earthworks operations (refer Clause 4.9);
· your responsibilities under the Heritage Act 1977 if an object of potential Non-Aboriginal
heritage is uncovered during construction (refer Clause 4.10);
· your responsibilities under the Contaminated Land Management Act 1997;
· noise, vibration and air quality management controls (refer Clauses 4.6, 4.7, and 4.4);
· your requirement to maintain surrounding property access for residences, business owners,
and their visitors, and to minimise disruptions to these properties for the duration of
construction;
· location of refuse bins, washing, refuelling and maintenance of vehicles, plant and
equipment;
· waste minimisation principles;
· boundaries for vegetation clearing, fauna and fauna habitat management, including
Planning - Environmental 3.5.2 Establish and maintain a register of environmental training carried out, including dates,
Training names of
Planning - Environmental 3.5.2 Undertake refresher environmental awareness training as required, but not less than 6
Training monthly
intervals, based on environmental risk assessment and turnover of project personnel. Include
Planning - Environmental 3.5.2 Hold toolbox talks which identify environmental issues and controls when works commence in
Training a new area of the Site or a new activity as well as when environmental issues arise on site.
The toolbox talk must include but not be limited to:
(a) A description of the activity and the area;
(b) Identification of the environmental issues and risks for the area (including fauna or flora);
and,
HOLD POINT Process Held: Induction and training of staff and contractors working on site.
Submission Details: Drafts of all environmental induction and environmental training materials
must be provided to the Principal at least two weeks before it is planned to be used.
Planning - Working Hours 3.6 In the context of this clause, normal working hours are from Monday to Friday between 7.00
am to 6.00 pm and Saturday between 8.00 am to 1.00 pm inclusive, but excluding public
Planning - Working Hours 3.6 The CEMP must include a procedure for notifying the Principal, all relevant Authorities and the
community, in advance of any proposal to work outside of these working hours. Such changes
in working hours must comply with all licences, permits, approvals, consents, notification,
statutory requirements, etc and have been appropriately justified and assessed.
Planning - Working Hours 3.6 Any approval by the Principal to work outside the normal working hours detailed above is
conditional on you liaising with the community (refer to Clause 3.7), and complying with the
requirements of Clause 4.6, relevant CoA and the EPL.
Planning - Working Hours 3.6 Work outside of normal working hours is permitted without prior approval by the Principal in
the following circumstances:
(a) delivery of materials outside of normal working hours, where delivery at such times is
required by the Police or other authorities for reasons of safety or otherwise; or
(b) work during an emergency, where such work is necessary to avoid the loss of lives,
property and/or prevent environmental harm.
Planning - Communication 3.7 You must, as a minimum, comply with the requirements of the NSW State Government and
RMS
guidelines, policies and the following reference documents (refer to Annexure G36/A3) in
relation
to its community relations obligations:
(i) Privacy and Personal Information Protection Act 1998; (NSW);
(ii) NSW (Government) Advertising Handbook, March 2017;
(iii) RMS Communications and Stakeholder Engagement Toolkit which contains communications
templates that are kept up to date with the latest RMS branding and style guides;
(iv) Roads and Maritime Services brand guidelines, August 2017 (or subsequent edition);
(v) Roads and Maritime Services Editorial Style Guide, March 2014 (or subsequent edition);
Planning - Communication 3.7 (vi) Transport
Comply forrelevant
with the NSW UseTender
of Social Media Conditions
Baseline Policy, 18 November 2013;
of Approval and
for internal and site
communication, external communication and government authority consultation, stakeholder
and community communication and communication with subcontractors in relation to
notification of environmental problems and environmental incidents.
Planning - Communication 3.7 You must not release any information, in any form, regarding the Works, the temporary work
or
Planning - Communication 3.7 You must refer all enquiries from Federal, State and/or local government representatives to
the
Planning - Communication 3.7 You must recognise and identify the Principal’s role in any promotional material or award
submissions that you develop in relation to your work, the Works or the temporary works. All
written material on the project that you produce, including award submissions, must be
approved by the Principal prior to publication or release.
Planning - Communication 3.7 If you propose to produce a professional video on or set in the project, then video objectives,
format and content must be as agreed with the Principal. All proposed video content requires
approval by the Principal prior to starting the video production.
Planning - Communication 3.7 Describe in the CEMP the processes for external and internal communication in relation to the
environmental aspects of the Work Under the Contract.
Planning - Communication 3.7 Make all staff and subcontractors working on the Site aware of these external and internal
communications procedures and are properly trained in their application.
Planning - Liaison with 3.7.1 The CEMP must identify at least two persons (together with their contact telephone numbers)
EPA and/or Other who will be available to be contacted by the EPA on a 24 hour basis and who have authority to
Relevant Agencies take immediate action to shut down any activity, or to effect any pollution control measure,
as directed by the Principal, an authorised officer of the EPA and/or other relevant agencies.
Planning - Liaison with 3.7.1 Immediately notify the Principal of any visit to the Site by the EPA and/ or other relevant
EPA and/or Other agencies. Prepare a report for each occasion when the Site is visited by the EPA and/ or other
Relevant Agencies relevant agencies, notifying the Principal of the purpose and outcome of the EPA and/ or other
relevant agencies visit, and of all actions taken by you in response to the EPA visit and/ or
other relevant agencies. Submit this report to the Principal within one (1) working day of the
EPA and/ or other relevant agencies site visit.
Environmental Review 3.7.1.1 To facilitate consultation with environmental regulatory agencies and the community, an
Group Environmental Review Group (ERG) will be established by the Principal. The purpose of this
ERG will be to ensure prompt and effective consultation and resolution of environmental
issues raised by or affecting Government agencies, Council, the Principal, the community and
you. It is anticipated that the ERG will meet once a week or as otherwise agreed by the
regulatory agencies and the Principal.
At least 1 week prior to each ERG you must prepare and provide information to the Principal
for review prior to you disseminating this information to the wider ERG, including:
(a) current and upcoming issues;
(b) inspection and monitoring results;
(c) environmental nonconformance issues;
(d) community concerns;
(e) new or revised work method statements;
(f) upcoming works, particularly in sensitive areas;
(g) any design issues relevant to environmental impacts and/or management;
(h) training requirements; and,
(i) other issues relevant to environmental impacts and/or management.
You must ensure your relevant personnel as requested by the Principal, including the Project
Manager, and Environmental Management Representative or ESR, attend each ERG
meeting.
Planning - Community 3.7.2 Develop and implement a Community Involvement Plan complying, as a minimum with the
Liaison and/or Principal’s Community and Stakeholder Engagement Plan, RMS, May 2016.
The Community Involvement Plan must ensure that your community involvement meets the
desired outcomes detailed in the delivery section of the RMS Communications and Stakeholder
Engagement Toolkit.
Planning - Community 3.7.2 You must meet the reasonable needs and desires of the community and provide:
Liaison and/or (i) information on the project objectives, scope and timeframe and opportunities for input on
Notification' the construction of the project;
(ii) information on any of the construction investigations and activities that may affect them
including work required outside the nominated working hours and noisy work;
(iii) information regarding the issues raised in discussions with stakeholders and indirectly or
directly affected landowners;
(iv) information on the progress of the Work Under the Contract, significant milestones, design
changes, changed traffic conditions including temporary detours and temporary road closures,
and other matters that could either affect or concern the community; and
(v) your contact information including a 24 hours toll-free telephone number and postal
address.
The Community Involvement Plan must provide specific information in relation to community
Planning - Community 3.7.2 The Community Involvement Plan must also include:
Liaison and/or
Notification'
(i) a listing of the community stakeholders potentially affected by the Work Under the
Contract
and the potential impacts the Work Under the Contract may have on the identified
stakeholders, including the timing of those impacts. The list of community stakeholders must
include, as a minimum, relevant councils, State and Federal Members of Parliament,
emergency services, relevant public transport operators, relevant taxi services, freight and
transport unions, local chambers of commerce, local businesses, local residents, property
(ii) the level of involvement and engagement of community stakeholders for all of the Work
Under the Contract which may have impacts in the community, including the level of
information to be provided and consultation activities to be undertaken by you;
(iii) a map that indicates the locations of all properties that are potentially impacted on by
the Work Under the Contract, which must identify all potential impacts the Work Under the
Contract may have on the identified community stakeholders, including the timing of those
(iv) a risk assessment and proposed actions to mitigate or minimise the impact of the Work
Under the Contract on these stakeholders;
(v) the external (i.e. community stakeholders) and internal communication protocols and
procedures to manage and implement the Community Involvement Plan to Completion;
(vi) procedures for consulting and engaging with local businesses to ensure the concerns and
issues of local businesses are identified, addressed and reviewed regularly as part of the risk
assessment referred in section (iv) above, and your strategy for resolving these concerns and
issues and the controls to be implemented during the Work Under the Contract;
(vii) procedures for dealing with complaints and enquiries, including out of hours complaints
and enquiries, and response requirements;
(viii) procedures for early notification to the community, and the Principal of Work Under the
Contract that may impact on the identified community stakeholders;
(ix) procedures for publicising the details of the Work Under the Contract;
(x) procedures for training employees and subcontractors on the requirements of the
Community
(xi) a crisis communications sub-plan;
(xii) guiding principles for the overall approach to community and stakeholder involvement;
(xiii) identification of stakeholders to be consulted as part of the Community Involvement
Plan, including affected and adjoining landowners;
(xiv) progress of the Work Under the Contract and matters associated with environmental
management;
(xv) procedures and mechanisms through which stakeholders can discuss or provide feedback
to you and/ or the Principal in relation to the environmental management and delivery of the
(xvi) procedures and mechanisms through which you can respond to enquiries or feedback from
stakeholders in relation to the environmental management and delivery of the Work Under
the Contract;
(xvii) procedures and mechanisms to resolve complaints, issues and disputes that may arise
between
parties on the matters relating to environmental management and the delivery of the Work
Under the Contract. This may include the use of an appropriately qualified and experienced
independent mediator;
(xviii) business impact risk register to identify and manage the specific impacts associated
with
(xix) contact names and details;
(xx) identification of opportunities for the community to visit construction sites (taking into
consideration workplace, health and safety requirements);
(xxi) involvement of construction personnel in engaging with the local community; and
(xxii) identification of opportunities to provide accessible information regarding regularly
updated site construction activities, schedules and milestones at each construction site
including use of construction hoardings to provide information regarding construction, specific
Planning - Community 3.7.2 You are responsible for overall management and coordination of community information and
Liaison and/or involvement.
Notification' The Principal reserves the right to amend any public document generated by you.
Planning - Community 3.7.2 The Community Involvement Plan must ensure that:
Liaison and/or
Notification' (i) the local community is informed of decisions taken on the details of the Work Under the
Contract which will affect the community;
(ii) all relevant Authorities are informed of planned construction activities;
(iii) users of the affected road network are informed of planned traffic arrangements,
including
any temporary traffic switches or other activities resulting in likely delays. Users of the
affected road network include emergency services, the road transport industry, public
(iv) affected and concerned local residents and local businesses are informed of all
investigation
(v) unless otherwise advised by the Principal, you must arrange and facilitate all group and
public meetings and workshops relating to the Work Under the Contract;
(vi) the Principal is informed of all community issues, consulted on all decisions affecting the
local and wider (including driving) community, and invited to all sessions attended by
members of the community. You must not commit to a specific date for a presentation or site
tour to a community group without prior approval of the Principal;
(vii) the Principal must be contacted immediately in relation to planned or unplanned local
community protests that may arise during the Work Under the Contract;
(viii) any information is not released, in any form, regarding the Work Under the Contract to
any
(ix) all enquiries from Federal, State and/or local government representatives are referred to
the
(x) the Principal’s role is recognised and identified in any promotional material or award
submissions that it develops in relation to the Work Under the Contract. All written material,
including award submissions, on the Work Under the Contract must be approved by the
Principal prior to publication;
(xi) if you produce a professional video, the video objectives, format and content must be
approved by the Principal. All proposed video content requires approval by the Principal prior
to commencing the video production;
(xii) you provide a 24 hour toll free telephone service, for the period from eight weeks after
the
Date of the Contract until Completion, for the community to report incidents and register
complaints. You must also provide a continuously operated working hours telephone service
(xiii) during the period detailed in (xii) above, staff must receive and respond to telephone
calls
(xiv) the Community Relations Manager, and/or support staff, is available during construction
hours and after hours, if work is scheduled out of hours, from the Date of the Contract until
Completion.
Planning - Community 3.7.2 All communications activities are subject to the Principal’s approval according to the
Liaison and/or timeframes
Planning - Community 3.7.2 Key issues that must be addressed in the Community Involvement Plan include (but not
Liaison and/or necessarily
Notification' be limited to):
(i) traffic management (including property access, pedestrian access);
(ii) environmental matters;
(iii) construction activities;
(iv) noise and vibration mitigation and management;
(v) ongoing consultation with local business owners, including owners of agricultural
businesses, located close to the Works about the timing, duration and likely impact of
construction activities on their business operations; and
(vi) relocation and/or removal of farm infrastructure, including farm dams, as required and in
consultation with affected land owners.
You must maintain, implement and monitor the Plan throughout duration of the Works.
Planning - Community 3.7.2.1 (a) The Principal will provide a copy of RMS’s community contacts database (Consultation
Contacts Database Manager TM), in electronic format. You must maintain and input into this database
from
(b) eight
You weeks
must after
ensure the
that allDate of Contract
affected through local
and concerned to Completion.
residents and businesses,
property owners adjacent to the Works Under the Contract, emergency services,
relevant public transport operators, relevant road transport operators, and other key
stakeholders are included in the database.
(c) All interactions with stakeholders and the community including registers at staffed or
public displays, letters, phone calls, emails or conversations in person must be recorded
in the contact database within 24 hours of the interaction taking place.
(d) You must provide registers at any staffed or public display locations and on the project
website to enable the community to be included on the community contacts database.
(e) You must provide stakeholder contact data to the Principal upon request in a
manageable format, such as MS Word or MS Excel. The data provided must analyse
and identify trends including but not limited to:
(i) the frequency and location of issues and complaints raised by the community and
stakeholders; and
(ii) the frequency, type and location of communication and community engagement activities.
Planning - Community 3.7.2.2 (a) You must keep the community informed of the Work Under the Contract.
Information
Information to be provided to the community must as a minimum include:
(i) information on the progress of the Work Under the Contract;
(ii) work required outside the nominated working hours;
(iii) noisy works;
(iv) traffic information including any traffic disruptions and restrictions including temporary
detours and the temporary road closures;
(v) a general description of the traffic information provided by TMC and the methods for
accessing this information.
(vi) the toll-free, 24 hour telephone number;
(vii) your postal address; and
(viii) your email address.
(b) Methods to keep the community informed must be appropriate for the level of information
to be provided and the timeframe for the delivery of this information.
Methods may include, but are not limited to:

(i) notifications and flyers;
(ii) door knocking;
(iii) advertisements in local and metropolitan newspapers and online;
(iv) radio advertisements;
(v) Australian Traffic Network alerts;
(vi) variable Message Sign (VMS) boards including your temporary VMS and
Transport Management Centre permanent VMS;
(vii) the project website;
(viii) visualisation tools (including artist’s impressions)
(ix) emails to persons and entities on community contacts database;
(x) social media developed in accordance with the Transport for NSW Social Media
Management Policy (January 2013) and approved by the Principal;
(xi) banners on approved overhead structures; and
(xii) via traffic alerts on livetraffic.com.
(c) You must notify and consult local residents and businesses about construction activities
that will affect access or otherwise significantly disrupt use of their residences and premises.
(d) Notice must be given at least 5 working days before commencing work affecting the
residences and premises and must advise the nature of the work, why it is necessary, indicate
the expected duration plus any changes to arrangements for traffic, property access or parking
arrangements. In addition to the project’s toll-free, 24 hour telephone service, contact details
for your staff responsible for particular activities may also be provided.
(e) Communication packages relating to key project milestones or major impact construction
work involving traffic-switches, 24 hour, high-impact work or other work involving significant
impact to the traffic network and nearby community must be submitted to the Principal at
least 20 working days before the commencement of work.
Unless specified by the Principal, these communication packages must include:

(i) a work/event specific communication implementation plan including a description of the
work/event, the key impacts and issues, key messages, key stakeholder and community
audiences and the communication activities and material that will be used to communicate
with these audiences; and
(ii) final drafts of all communication material prepared for the work/event including web-text
updates, flyers, advertising artwork and scripts, door-knockingscripts, stakeholder letters, VMS
scripts and signage.
(f) Unless stated otherwise, all material proposed to be used for community information must
be submitted to the RMS Representative as a final draft for approval a minimum of 10 working
days prior to the proposed print date in the case of printed media, and a minimum of 10
working days prior to the proposed distribution date for other types of media. Proposed
distribution dates and background information must be provided on covering information
accompanying each approval submission.
(g) You are responsible for the print and distribution of printed communication materials.
Planning - New or 3.7.2.3 Notify local residents and businesses about any new or changed construction activities which
Changed Construction will affect access to their properties or otherwise disrupt the residents’ use of their premises,
Activities at least 5 working days before commencing work affecting residents.
Planning - New or 3.7.2.3 Such notification must state the nature of the work, why it is necessary, the expected
Changed Construction duration, details of any changes to the traffic arrangements or property access and the name
Activities and contact telephone number of your representative who can respond to any resident
Planning - New or 3.7.2.3 Address any concerns raised by residents in accordance with the complaints procedure as
Changed Construction required under Clause 3.7.3, or in accordance with any licence or approval held by you.
Planning - Extended 3.7.2.4 Inform the Principal, and the residents of the proposed work outside normal working hours in
Working Hours accordance with the Environment Protection Licence held by you.
(Environment Protection
License Held by
Planning - Project 3.7.2.5 The Principal will maintain and operate the existing project website to assist in disseminating
Website community information, receiving feedback and providing generic responses to common
enquiries. You must not maintain or operate any other website accessible to the public
relating to the Contract.
Planning - Project 3.7.2.5 Provide the Principal with material for the website including updated material as new
Website information becomes publicly available, and in any event at least monthly unless advised
otherwise by the Principal. All material for the website must comply with requirements of the
WC3 Web Content Accessibility Guidelines (WCAG) 2.0 Level AA. Documents must be optimised
for the web and supplied in both MS Word 2003.doc and PDF format. Utilise the following RMS
accessibility checklists, contained within Project Communication Templates, to ensure content
compliance:
(i) Accessibility checklist for content;
(ii) Accessibility checklist for MS Word documents; and
Planning - Project 3.7.2.5 The Principal will upload all website material at its discretion. You must submit all proposed
Website website material to the Principal for approval at least 10 working days prior to your planned
date for the Principal to upload the material.
Planning - Project 3.7.2.5 You must, as a minimum, provide the following to the Principal for the project website:
Website (i) notifications and community updates before they are distributed to the community and
stakeholders
(ii) background information on the Work Under the Contract;
(iii) a monthly photo gallery containing images of current and recent construction, community
and environmental management activities associated with the Work Under the Contract;
(iv) current and past display information, community updates, advertisements, and other
publications;
(v) PDFs of reports that are relevant to the Work Under the Contract, including documents on
environmental investigations;
(vi) information for the driving community, including road transport operators and public
transport operators and users, which includes predicted periods of delay and alternative
routes. This information must be updated weekly or more often when traffic conditions
change;
(vii) a document of frequently asked questions and responses as agreed with the Principal;
(viii) the project’s toll-free, 24 hour staffed telephone service number;
(ix) your email address;
(x) your postal address;
(xi) any other relevant items or information of interest; and
(xii) a means of allowing people to apply to be included on the community contacts database
Planning - Project 3.7.2.5 Continue to submit the required website material to the Principal until Completion.
Planning - Community 3.7.2.6 (a) Consultation periods with community feedback must be outlined in the Community
Involvement Involvement Plan.
(b) As a minimum, a two week period must be allowed for community feedback when
community involvement is possible.
(c) Following consultation periods, you must prepare a Consultation Outcomes Report to:
(i) outline community feedback and issues raised;
(ii) respond to each of the issues raised during consultation;
(iii) provide information on any changes to the proposal resulting from
consultation; and
(iv) articulate the decision about the element of the project consulted on.
(d) Consultation Outcomes Reports must be available on the project website and must be
provided to community members and stakeholders who provided feedback,
accompanied by a personalised letter.
(e) A notification must be issued to the community advising of the availability of the
Consultation Outcomes Report.
Planning - Advertising 3.7.2.7 (a) During construction, you must advertise significant issues that will affect the
community including detours, significant traffic disruptions, significant changes to
traffic arrangements and work outside of the working hours at least 7 days before the
commencement of that disruption, detour or change.
(b) You must prepare the content of all advertisements and submit this to the Principal.
(c) The principal will place all advertisements, including radio advertisements and online
advertisements.
(d) In consultation with the Principal, identify the appropriate media outlets for the
placement of advertisements including newspapers that are read and used by the
community and stakeholders identified in the Community Involvement Plan, including,
but not limited to: the local community, road transport industry, public transport
operators, the driving community, cyclists and pedestrians.
(e) Printed advertisements must conform to NSW (Government) Guidelines for
Advertising. Draft advertisements, including text and line drawings, and must be
provided to the Principal for approval a minimum of 20 working days prior to the
proposed printing copy deadline, unless otherwise agreed with the Principal.
(f) You must provide all electronic media advertisements, including draft radio scripts, to
the Principal for approval at least 20 working days prior to when the subject matter of
the advertisement is forecast to occur, unless otherwise agreed with the Principal.
(g) Advertising via social media must be developed in accordance the Transport for NSW
Social Media Management Policy (January 2013) and approved by the Principal and
the advertising content forwarded to the Principal at least 20 working days prior to
when the subject matter of the advertisement is forecast to occur, unless otherwise
agreed with the Principal.
(h) Where you become aware that any part of the Works Under the Contract that is the
subject of an advertisement is to be changed or varied so as to make the advertisement
substantially incorrect, you must immediately advise the Principal.
Planning - Notification 3.7.2.8 (a) During construction, you must prepare and distribute colour notifications providing
details of each event that will impact the local community and businesses. This would
include any changes (or potential changes) to local traffic, out of hours working, noise,
or other local issues as a consequence of the Work Under the Contract, in keeping with
a ‘no surprises’ approach to communications.
(b) The notifications must include maps, diagrams, illustrations and photos which enhance
the reader’s understanding of the event or work. You are responsible for any graphic
design required to produce customer-friendly maps, diagrams or artists impressions.
(c) The notifications must adhere to RMS templates, style and branding guidelines and
must be written in plain English. The notifications must accommodate the needs of
members of the community from non-English speaking backgrounds through the
inclusion of information on translation services.
(d) The notifications must be distributed to all local residents, local businesses and other
community stakeholders assessed as being potentially affected by the activities
described in the notice. The notification delivery must occur at least 5 working days
prior to the proposed activity described in the leaflets.
(e) The final draft of all proposed leaflets, and proposed leaflet distribution ranges, must
be submitted to the Principal for approval a minimum of 10 working days prior to the
proposed print date. Distribution dates and background information must be provided
on covering information accompanying each approval submission.
(f) You are responsible for the print and distribution of the notifications.
Planning - Notification of 3.7.2.9 (a) You must provide information on forecasted changes to traffic conditions, as a
Traffic Conditions consequence of the Work Under the Contract to the Principal, to facilitate traffic alerts
for major traffic changes or disruptions.
(b) For Work Under the Contract involving major traffic changes or disruptions, you must
prepare and submit a communication package to the Principal at least 20 working days
before the commencement of the work. Unless specified by the Principal, the
communication package must include:
(i) a work specific communication implementation plan including a
description of the work, the key impacts and issues, key messages, key
stakeholder and community audiences and the communication activities,
communication materials and methods for distribution;
(ii) specific radio, print, electronic media organisations and other outlets identified for
distribution to be agreed with the Principal;
(iii) range of distribution for each type of media; and
(iv) final drafts of all communication materials prepared for the work/event
including notifications, door knocking scripts, advertising artwork and
scripts, stakeholder letters, traffic alerts, VMS scripts and signage.
(c) Advertising must be managed in accordance with Clause 3.7.2.7.
(d) Where you become aware that any part of the Work Under the Contract that is the
subject of the traffic alert is to be changed or varied so as to make the traffic alert
substantially incorrect, it must immediately advise the Principal.
Planning - Responding to 3.7.2.9 (a) Register and track progress of all forms of representation from the community using
Community the contacts database as stipulated in Clause 3.7.2.1.
Representations
(b) Make customer feedback forms available at all staffed and public displays to enable
members of the community to provide comments.
(c) Representations received by the Principal and forwarded to you must be recorded and
monitored by you, together with any representations received directly by you.
(d) Acknowledge all representations within 5 working days of receipt.
(e) Respond to representations within 10 working days of receipt.
(f) Maintain a register of all representations, written, electronic and verbal, concerning
the Work Under the Contract. Provide a report on the status of responses to
representations in your monthly progress reports. The report must include the average
and maximum times taken to respond to representations.
Planning - Complaints 3.7.3 Within one working day of receiving a complaint about any environmental issue, including any
Management pollution incidents, arising from the Work Under the Contract, submit a written report to the
Principal detailing the complaint and the action taken to remedy the problem. A final report
together with your proposed measures to prevent the recurrence of such incidents must be
submitted to the Principal within 5 working days.
Planning - Complaints 3.7.3 Keep a register of all complaints, which must include the following details: A complaint is defined as an
Management (a) date and time of complaint; expression of dissatisfaction
(b) method by which the complaint was made (telephone, letter, meeting, etc); made to the Principal or
(c) name, address, contact telephone number of complainant (if no such details were you, related to the Work
provided, a note to that effect); Under the Contract,
(d) nature of complaint; services, or the complaints-
(e) action taken in response including follow up contact with the complainant.; handling process itself,
(f) any monitoring to confirm that the complaint has been satisfactorily resolved; where a response or
(g) if no action was taken, the reasons why no action was taken by you. resolution is explicitly or
Planning - Complaints 3.7.3 Provide for community enquiries and complaints handling and investigation 24 hours per day 7
Management days per week for the period from eight weeks after the Date of Contract until Completion,
ensuring the following are available:
(i) The toll-free, project specific phone number as stipulated in Clause 3.7.2 on which
complaints and enquiries may be registered;
(ii) a postal address to which complaints and enquiries may be sent; and
(iii) an email address to which electronic complaints and enquiries may be transmitted; and
The telephone number, postal address and email address must be published in newspaper(s)
circulating in the local area prior to the commencement of construction and prior to the
commencement of operation.
Planning - Complaints 3.7.3 Ensure that the Community Relations Manager, or a person delegated by the Community
Management Relations Manager, is available 24 hour per day 7 days per week when work is being
undertaken to receive, manage and take appropriate action in relation to community
enquiries and complaints.
Ensure that the community is adequately informed about the project’s toll-free, 24 hour
Planning - Complaints 3.7.3 Record all complaints in the database Consultation Manager TM and the record must include
Management the following:
(i) date, time and nature of complaint;
(ii) type of communication (telephone, letter, meeting, other);
(iii) name, address and contact number of complainant;
(iv) nature of the complaint;
(v action taken in response, including follow up contact with the complainant;
(vi) details of whether resolution was reached;
(vii) details of whether mediation was required or used; and
(viii) any monitoring to confirm that the complaint has been satisfactorily resolved.
Planning - Complaints 3.7.3 Report on the receipt and responses to complaints in your monthly progress report.
Management
Planning - Complaints 3.7.3 Expeditiously address and seek the early resolution of all complaints and claims, directed
Management against you, or any persons engaged on the Work Under the Contract, by members of the
community in relation to the Work Under the Contract. You must make use of dispute
resolution mechanisms and procedures to enable the prompt resolution of any claims that are
Planning - Complaints 3.7.3 Notwithstanding the requirement to expeditiously address and seek early resolution of all
Management complaints and claims, your Complaints Management System must receive, record, track and
respond to all complaints and enquiries within the specified timeframe.
Planning - Complaints 3.7.3 All complaints received must be acknowledged within 24 hours. When a complaint or enquiry
Management cannot be resolved immediately, a follow-up verbal response on what action is proposed must
be
provided to the complainant/enquirer within 7 working days of a complaint or enquiry being
Planning - Complaints 3.7.3 Your Complaints Management System must also include a process for the provision of a written
Management response to the complainant/enquirer within 10 working days, if the complaint or enquiry
cannot be resolved by the initial or follow-up verbal response.
Planning - Displays 3.7.4 (a) Contribute to public displays organised by the Principal as requested.
(b) The Community Relations Manager and your other relevant personnel must staff the public
displays as required by the Principal.
(c) Participate with the Principal in promotional displays associated with key local events and
activities, including local fairs, festivals and exhibitions, as required by the Principal. You
must not participate in any promotional displays, local events or activities without prior
approval of the Principal.
(d) Provide material for display purposes as required. The Principal will print all displays.
Planning - Media Liaison 3.7.5.1 (a) Immediately notify the Principal of any approach by the media (including industry
magazines).
(b) You must not contact, respond to enquiries or release information about the Work
Under the Contract to the media, political representatives or their staff.
(c) Ensure that all of your personnel and all personnel engaged on the Work Under the
Contract are aware of, and abide by, these requirements. Evidence of compliance with
this requirement must be provided to the Principal in your monthly progress reports.
Planning - 3.7.5.2 (a) On-going discussions must be held with the Principal regarding dates, commencing at
Media/Community Events least 3 months prior to the anticipated occurrence of the event, for major milestones,
including traffic switches and the opening of the Works or any stage of the Works to
traffic.
(b) Give the Principal at least 8 weeks written notice of the date for commencement of
construction and at least 8 weeks written notice of the date of opening of the Works or
any stage of the Works to traffic, to enable the Principal to organise any associated
official media/community events.
(c) Plan for and provide resources for any events notified by the Principal associated with
the opening of the Works to traffic. The Principal will organise any events associated
with opening the Works to traffic. You must develop and provide collateral in support
of the event/s as required by the Principal.
(d) You must not announce the proposed opening of the Works and/or any stage of the
Works to traffic without the prior approval of the Principal. The announcement of
proposed opening of the Works or any stage of the Works will be carried out by the
Principal in conjunction with the Federal and/or NSW State governments.
(e) You must anticipate a high level of interest in the project opening and must facilitate
and assist with the coordination of an opening event for the community. The event is
likely to include a public walk-through of the Works.
(f) Other opportunities for media events, including the achievement of other project
milestones and the opening of local roads to traffic must be discussed with the
Principal at least four weeks prior to the expected event.
(g) The Principal will manage all official media events and will be responsible for
coordinating community, media and political participation in such events, in
consultation with you.
(h) Cooperate with the Principal in the running of the media events and must provide
information on the logistics associated with any event.
(i) You must not erect or display company specific promotional banners during media
events.
Planning - Project 3.7.6 (a) Use “RMS project communication templates” for the preparation of community information
Branding to be published. These templates provide clear instruction on logo placement and visual style.
(b) Your logo must not appear on any public project communications, including project
publications, display material, website, project videos, non-moving plant (including
containers) or roadside signage without prior approval of the Principal.
(c) Your logo or banners must not appear on structures on the Site or areas where the Work
Under the Contract is being undertaken without the prior approval of the Principal.
(d) Provide access to suitable fencing, hoardings and buildings for the purposes of display of
RMS’s promotional material.
(e) Confirm with the Principal that the most recent templates are being used for
communication materials.
(f) Install shadecloth around construction sites, as required. This shadecloth must be designed
Planning - Project 3.7.7 in
(a) Take, and provide the Principal with, quarterly photographs (digital) of the progress of the
Documentation Work Under the Contract. The photographs must be of a professional quality (minimum 300
dpi) suitable for RMS and your use in publications, project communications and promotions
of a broader nature and for enlargement to use in display materials. Photographs must be
provided on a monthly basis of all substantial works.
(b) Facilitate access to your work sites for the installation of infrastructure for time-lapse
photography, remote controlled cameras or other project documentation devices at the
Principal’s request.
(d) Provide the Principal with monthly forecasts of predicted significant events (forecasting
three months in advance). The forecast must include detailed information about upcoming
activities that may create media attention, or that require pro-active communication tools to
accompany the activities or events including media releases, traffic alerts or advertising.
Planning - Emergency 3.8 The CEMP must include details of:
Planning (a) your key emergency response personnel, their respective responsibilities and contact
details including all-hours contact telephone numbers;
(b) emergency services (e.g. ambulance, fire brigade, spill clean-up services);
(c) your communication strategy, both internal and external (refer to Clause 3.7), during
emergencies;
(d) any identified potential environmental emergencies and/or incidents that may occur on
Site, and the response procedures for these emergencies;
(e) frequency of tests of the emergency response procedures;
(f) location on site of the register of, and information on, hazardous materials including
Material Safety Data Sheets (MSDS); and
(g) your Pollution Incident Response Management Plan (PIRMP), required for sites requiring an
EPL in accordance with section 5.7A of the POEO Act 1997.
Planning - Emergency 3.8 Induct all staff and subcontractors working on the Site about the potential environmental
Planning emergencies, and provide training in implementing the relevant environmental safeguards and
risk mitigation measures.
Planning - Emergency 3.8 A construction incident emergency spill plan must be developed and incorporated into the
Planning CEMP. The plan must include measures to avoid spillages of fuels, chemicals, and fluids onto
any surfaces or into any adjacent waterways. An emergency spill kit must be kept onsite at all
times.
Planning - Contractor's 3.9 Include in the CEMP procedure(s) to monitor and measure, on a regular basis, your
Monitoring, Inspection environmental management performance and to evaluate compliance with this Specification.
and Auditing This includes any monitoring required outside of normal working hours and days. The
procedures must contain the scope, methodology and responsibilities for its implementation.
Planning - Contractor's 3.9 Undertake regular site environmental inspections to assess the adequacy and effectiveness of
Monitoring, Inspection your environmental controls.The site environmental inspections must cover the following:
and Auditing (a) high risk activities and processes;
(b) work in environmentally sensitive areas;
(c) site preparedness for adverse weather conditions, including adequacy of environmental
controls and availability of emergency equipment.
Planning - Contractor's 3.9 Prepare a Construction Monitoring Program in consultation with relevant agencies and
Monitoring, Inspection undertake regular construction monitoring of noise and vibration.
and Auditing
Include in the Program:
(a) details of baseline data available;
(b) details of baseline data to be obtained and when;
(c) details of all monitoring of the project to be undertaken;
(d) the parameters of the project to be monitored;
(e) the frequency of monitoring to be undertaken;
(f) the location of monitoring;
(g) the reporting of monitoring results;
(h) procedures to identify and implement additional mitigation measures where results of
monitoring are unsatisfactory;
(i) any consultation to be undertaken in relation to the monitoring programs; and
(j) provision to provide any survey or monitoring data to Government agencies and
Departments within 30 working days of the request or as agreed to with the agency or
Department.
Planning - Contractor's 3.9 Undertake regular inspections to ensure that all retained vegetation and fauna habitat are
Monitoring, Inspection clearly
and Auditing marked and exclusion zones and fencing are maintained.
Planning - Contractor's 3.9 Undertake attended compliance noise and vibration monitoring following the receipt of a
Monitoring, Inspection complaint and report the results of the monitoring to the Principal as soon as possible. Where
and Auditing noise and / or vibration exceedances are detected, review your procedures in order to identify
means to minimise the impacts to residences.
The Principal will undertake periodic inspections of the Site. Where these inspections identify
environmental nonconformities, you must address them within the time specified by the
Planning - Contractor's 3.9 Include in the CEMP an environmental risk-based auditing program to verify that the Work
Monitoring, Inspection Under the Contract meets the requirements of this Specification plus the Conditions of
and Auditing Approval and that environmental control measures are effective. The program must specify
the type of audits to be conducted, their scope and their frequency (minimum frequency is
Planning - Contractor's 3.9 Submit a copy of each audit report to the Principal within 10 working days of the audit.
Monitoring, Inspection Review the
and Auditing risk-based auditing program following your initial audit and amend it if needed. The auditing
Planning - Contractor's 3.9 Conduct all your internal and external environmental audits for the Work Under the Contract
Monitoring, Inspection in
and Auditing accordance with AS/NZS ISO 19011.
Planning - Environmental 3.10 Promptly resolve any environmental nonconformities in accordance with your Environmental
Nonconformities Management System.
Planning - Environmental 3.10 Identify and control environmental nonconformities in accordance with RMS Q6.
Nonconformities
Planning - Environmental 3.10 If you fail to meet your environmental obligations under the Contract, including:
Nonconformities (a) failure by you or your subcontractors to conform to any requirements of this Specification,
your CEMS, and CEMP and the EPL; or
(b) failure by you to act promptly when you, the Principal, or any statutory authority having
jurisdiction over the Work Under the Contract, observe that the implemented environmental
controls are not effective; or
(c) failure by you to provide safeguards against a Category 1 environmental incident as
detailed in the RMS “Environmental Incident Classification and Reporting Procedure”, or
(d) nonconformities (including recurring issues from checklists, reviews, improvement notices,
inspections, audits and surveillance),
a Hold Point may apply.
HOLD POINT Process Held: Any activity that causes or has the potential to cause harm to the environment
due to your failure to meet your environmental obligations under the Contract (including
recurring issues from checklists, reviews, improvement notices, inspections, audits and
surveillance).
Submission Details: Verification that the failure has been rectified, and details of the
Planning - Records of 3.11 Maintain, as part of the project records in accordance with RMS Q Annexure Q/E, legible
Environmental Activities environmental records of all environmental activities associated with Work Under the
Contract to demonstrate compliance with the CEMS and CEMP. The records must include:
(a) site environmental inspection reports;
(b) environmental monitoring data and reports;
(c) internal and external audit reports;
(d) reports of environmental incidents, environmental complaints, associated actions taken,
and follow-up actions;
(e) minutes of management review meetings;
(f) induction and training records;
(g) all records required to demonstrate compliance of your activities with the conditions of
approval associated with the Works under Contract;
(h) all records required under the EPL;
(i) monthly reports of environmental performance (see Clause 3.11.1), including all non-
compliances with the requirements of the EPL, CoA, CEMP and OACEMP; and
(j) details of consultation with Councils, Government Agencies, community groups and other
parties as a result of the CoA requirements.
The data must be provided in drawings and spatial format ie DXF/DWG/Shape Files
Planning - Pre- 3.11.1.1 You must prepare a Pre-Construction Compliance Report and submit it to the Principal at
Construction Compliance least 4 weeks prior to the commencement of construction. The Pre-Construction Compliance
Report Report must include:
(a) Details of how the project commitments required to be addressed before construction
were complied with.
(b) The time when each relevant commitment was complied with, including dates of
submission of any required reports and/or approval dates.
(c) Details of any approvals or licences required to be issued by relevant Government
Departments before construction commences.
Planning - Monthly 3.11.1.2 You must prepare and submit to the Principal environmental reports for each month by the
Environmental Report 10th day of the following month. The monthly environmental report must include the
following:
(a) all complaints/ enquiries received and actions taken to resolve issues;
(b) all discharges from licensed points and any other dewatering activities including dates,
times, monitoring results and volumes released;
(c) all information regarding any incident that has occurred on site;
(d) construction updates for high risk activities;
(e) status of approvals;
(f) all information of any potential breaches of the Protection of the Environment
Operation Act 1997, including runoff from site, noise exceedances and air monitoring
exceedances;
(g) opportunities for continual improvement of your environmental management processes
and practices in conformance with Clause 3.12;
(h) all environmental monitoring data including but not limited to rainfall, dust, noise and
vibration, and water quality; and
(i) the following information:
For items a, b, c, f, h and i above the data collected in terms of physical locations must also
be provided in a spatial format ie DXF/DWG / Shape File suitable for inclusion in the Project
GIS.
Planning - Construction 3.11.1.3 You must provide the Principal with Construction Compliance Reports for inclusion in the
Compliance report Principal’s Construction Compliance Report for submission to the Department of Planning
and Environment and bring to the Principal’s attention any shortcoming.
Planning - Construction 3.11.1.3 You must prepare a report at the following times:
Compliance report (a) Six months after the start of construction and thereafter at six monthly intervals or at
other such periods as directed by the Principal.
(b) No sooner than six weeks prior to Completion.
Planning - Construction 3.11.1.3 The report(s) must include, but not be limited to, information on:
Compliance report (a) compliance with the OACEMP, CEMP and the Conditions of Approval;
(b) compliance with any approvals or licences issued by relevant Government Departments for
the construction of the Works;
(c) the implementation and effectiveness of environmental controls, assessed on a comparison
of actual impacts against performance criteria identified in the CEMP;
(d) environmental monitoring results, presented as a results summary and analysis;
(e) the number and details of any complaints and enquiries, including a summary of main
areas of complaint, action taken, response given and intended strategies to reduce complaints
of a similar nature;
(f) details of any review and amendments to the CEMP resulting from the Works during the
reporting period;
(g) any other matter relating to compliance with the Conditions of Approval or as requested by
the Principal;
(h) register of any consistency assessments undertaken and their status;
(i) results of any independent audits, including actions relating to any audit;
recommendations;
(j) evidence of implementation of any management strategies
(k) summary of all incidents notified in accordance the CoA; and,
(l) any other matters relating to compliance with the CoA or requested by the Secretary or
Planning - Construction 3.11.1.3 Include the following:
Compliance report
Planning - Construction 3.11.1.3 You must provide copies of the reports to the Principal by the 10th day of the month following
Compliance report the reporting period. You must provide WCAG2.0 compliant copies of all the Reports to the
Principal for distribution to the Environment Protection Authority (EPA), DP&E, the
relevant Council and any other relevant government agency nominated by the Principal. The
Report(s) must also be made publicly available.
Planning - Construction 3.11.1.3 As part of your Monthly Report you must provide an accurate representation of progressive
Compliance report compliance with OACEMP, CEMP and the Conditions of Approval and pro-actively identify
any risks of non-compliance.
Planning - Pre- 3.11.1.4 Three months prior to Completion provide input to the Principal’s Pre-Operational
Operational Compliance Compliance Report detailing compliance and evidence of compliance with the CoA for the
Report Work Under the Contract. The Principal’s Pre-Operation Report will include:
(a) Details of how the commitments required to be addressed before operation were
complied with.
(b) The time when each relevant commitment was complied with, including dates of
submission of any required reports and/or approval dates.
(c) Details of any approvals or licences required to be issued by relevant Government
Departments before operation commences.
You must hold these records for at least five years after the Actual Completion Date, and must
make these records available to the Principal and authorised EPA officers upon request.
Planning - Management 3.12 Develop a documented process to periodically review the effectiveness and proper
Review implementation of the CEMP. The management review process must identify opportunities for
continual improvement of your environmental management processes and practices, and
ensure that the CEMS and CEMP remain relevant to the Work Under the Contract.
Planning - Management 3.12 The management reviews must be undertaken at least quarterly and must include the
Review Principal’s
participation. The management reviews must comprise as a minimum the following:
(a) identification of areas of opportunity for improved environmental performance;
(b) analysis of the causes of nonconformities and deficiencies, including those identified in
environment inspections and audits;
(c) verification of the effectiveness of corrective and preventative actions;
Operational Control - Soil 4.1 Comply with the requirements of Specification RMS G38 for soil and water management.
and Water Management
Operational Control - 4.2.2 Include in your CEMP a Contaminated Land Management Sub-Plan, which must comply with the
Contaminated land Contaminated Land Management Act 1997 (NSW), RMS publication “Contaminated Land
Management Sub-Plan Management Guideline”, RMS “Environmental Incident Classification and Reporting
Procedure”, and EPA guidelines on contaminated land management and the OACEMP.
Operational Control - 4.2.2 The Contaminated Land Management Sub-Plan must provide for dealing with:
Contaminated land (a) areas of known contamination (if applicable);
Management Sub-Plan (b) unexpected contamination finds;
(c) any land contamination caused by you.
Operational Control - 4.2.2 The Contaminated Land Management Sub-Plan must include:
Contaminated land (i) investigations in the vicinity of moderate risk areas including service stations (operational
Management Sub-Plan and non-operational), stockpiles and market gardens;
(ii) contaminated land legislation and guidelines including any relevant licences and approvals
to
be obtained;
(iii) identification of locations of known or potential contamination and preparation of a map
showing these locations;
(iv) identification of rehabilitation requirements, classification, transport and disposal
requirements of any contaminated land within the Site;
(v) measures to manage stockpiled potentially contaminated soil in accordance with the
requirements of NSW EPA Waste Guidelines;
(vi) contamination management measures including waste classification and reuse procedures
and unexpected finds procedures for unanticipated discovery of contaminated material
during construction; and
(vii) asbestos handling and disposal requirements in accordance with NSW EPA guidelines and
Operational Control - 4.2.3 Promptly notify the Principal of any suspected or potential contamination exposed during
Unexpected construction activities, and cease all work activities within the vicinity of actual or suspected
Contamination Find contaminated land.
The Principal may at its discretion choose to take over the investigation and management of
an unexpected contamination find, and directly appoint an EPA accredited contaminated site
Operational Control - 4.2.4 Where the contamination is known or an unexpected contamination find has been identified, a
Remediation Action Plan Remediation Action Plan may be provided by the Principal.
If a Remedial Action Plan is not provided by the Principal, prepare a Remediation Action Plan
for remediating the known areas of contamination or an unexpected contamination find, and
areas of potential contamination in their immediate vicinity.
Operational Control - 4.2.4 The Remediation Action Plan must be prepared in accordance with EPA guidelines on
Remediation Action Plan contaminated
land management, and must include the following:
(a) testing requirements for any contaminated material prior to its disposal off site;
(b) validation plan, which must include the area in the immediate vicinity of (both below and
adjacent to) the known contamination;
(c) implications of the validation results on the waste classification for material that may be
HOLD POINT Process Held: Activities within the vicinity of actual or suspected contaminated land.
Submission Details: At least 5 working days prior, submit your Remediation Action Plan to be
prepared by you, and relevant procedures.
Operational Control - 4.2.4 Carry out remediation of the contaminated material, or its removal and disposal, in
Remediation Action Plan accordance with the Remediation Action Plan. Any changes to the Plan must be agreed to by
Operational Control - 4.2.5 Implement relevant control measures to divert any surface runoff away from the
Surface Runoff contaminated land, and capture and treat any surface runoff contaminated by exposure to the
Operational Control - 4.2.6 Prepare an Asbestos Management Sub-Plan (reviewed and approved by a suitably experienced
Asbestos and accredited Environmental Scientist/Engineer) as part of the CEMP. The Asbestos
Management Sub-Plan must be completed in accordance with relevant NSW EPA endorsed
guidelines (including the waste guidelines) and relevant industry codes of practice and must
include:
(i) Identification of potential asbestos on site, including advance work options to assess and
manage or mitigate the risk prior to commencing other works;
(ii) Measures to remove visible asbestos containing materials prior to disturbance of soils;
(iii) Appropriate measures to characterise in situ soil and fill material for the presence of
asbestos prior to and during ground disturbance activities in order to characterise existing
ground conditions and minimise the volume of potentially asbestos impacted spoil requiring
ongoing management and/or disposal;
(iv) Detailed material handling procedures designed to manage and handle any asbestos
including adopting work practises that ensure asbestos is not mixed with non-asbestos
materials;
(v) A draft Asbestos Removal Control Plan including a methodology for the identification and
disposal of asbestos containing materials;
(vi) Procedures for disposal of asbestos in accordance with NSW EPA guidelines (including the
Operational Control - Site 4.2.7 Carry out a Stage 2 Site Contamination Assessment in accordance with the findings and
Contamination recommendations of the Stage 1 contamination assessment carried out for the EIS and in
Assessment accordance with the Contaminated Land Management Act Guidelines available at
http://www.epa.nsw.gov.au/your-environment/contaminated-land/managing-contaminated-
land/statutory-guideline.
Operational Control - Site 4.2.7 Engage a consultant accredited by the EPA under the Contaminated Land Management Act to
Contamination carry out the Stage 2 site contamination assessment.
Northern Road Upgrade Stage 4
G36 Hold Points
Section (G36) Hold Point Completed? Notes
3.1 Process Held: Commencement of Work not previously addressed by CEMS and CEMP documents and authorised by earlier Hold Point
release.
Submission Details: At least four (4) weeks prior to the proposed commencement of the stage of Work Under the Contract nominated
in the submission by you in accordance with the above submission procedure, submit the revised CEMP and associated Sub-Plans
and/or EWMS, as well as the CEMS documents listed in Clause 3.1.
Release of Hold Point: The Principal will consider the documents prior to authorising the release of the Hold Point. The Principal may
3.2.2 request additional
Process information for
Held: Commencement inclusion
of any inrequiring
activity the revised
anCEMP before
approval, authorising
licence the release
and/or permit fromofanthe Hold Point.authority.
appropriate
Submission Details: At least five (5) working days prior to the activity, provide to the Principal evidence of receipt of the approval,
licence and/or permit from the relevant authority.
Release of Hold Point: The Principal will consider the submitted documents prior to authorising the release of the Hold Point.
3.2.4 Process Held: Commencement of work activities not previously addressed by EWMS documents and authorised by earlier Hold Point
release.
Submission Details: At least twenty one working days prior to the proposed commencement of each applicable work activity, submit the
EWMS documents, addressing the issues listed in Clause 3.2.4 for the nominated work activity.
Release of Hold Point: The Principal will consider the documents prior to authorising the release of the Hold Point for the nominated
work. The Principal may release the Hold Point for work covered by the EWMS progressively, consistent with your program for the
3.5.2 Work. The
Process Principal
Held: mayand
Induction request additional
training of staff information for inclusion
and contractors working in
onthe
site.EWMS before release of Hold Point.
Submission Details: Drafts of all environmental induction and environmental training materials must be provided to the Principal at least
two weeks before it is planned to be used.
3.10 Release
Process of Hold
Held: Point:
Any Thethat
activity Principal
causeswill
orconsider the submitted
has the potential documents
to cause harm to prior to authorising
the environment thetorelease
due of thetoHold
your failure meetPoint.
your
environmental obligations under the Contract (including recurring issues from checklists, reviews, improvement notices, inspections,
audits and surveillance).
Submission Details: Verification that the failure has been rectified, and details of the measures implemented to prevent recurrence.
Release of Hold Point: The Principal will consider the submitted documents and may inspect the relevant work prior to authorising the
release of the Hold Point. The Principal may request additional information in respect of the submitted documents.
4.2.4 Process Held: Activities within the vicinity of actual or suspected contaminated land.
Submission Details: At least 5 working days prior, submit your Remediation Action Plan to be prepared by you, and relevant procedures.
Release of Hold Point: The Principal will consider the submitted documents prior to authorising the release of the Hold Point. The
Principal may request additional information in respect of the submitted documents.
4.2.7 Process Held: Clearing and grubbing
Submission Details: At least 10 working days prior, submit your Stage 2 Contamination Assessment Report.
Release of Hold Point: The Principal will consider the submitted documents prior to authorising the release of the Hold Point.
4.7 Process Held: Commencement of pile driving, excavation by hammering or ripping, dynamic compaction, demolition operations, or any
other activity which may cause damage through vibration or airblast.
Submission Details: At least ten (10) working days prior, submit to the Principal a copy of the Building Condition Inspection Reports and
the VibrationManagement Sub-Plan or the combined Noise and Vibration Management
Sub-Plan (where blasting is not required).
Release of Hold Point: The Principal will consider the submitted documents prior to authorising the release of the Hold Point. The
4.9 PrincipalHeld:
Process may Engagement
request additional
of theinformation in respect
archaeological of the proposal and/or submitted documents.
consultant
Submission Details: At least 5 working days prior to your proposed engagement of the consultant, provide details of your proposed
archaeological consultant and the proposed salvage excavation methodology.
4.9 Release
Process of Hold
Held: Point: The Principal
Commencement will considerinthe
of construction thedocuments prior
vicinity of the to authorising
partially theimpacted
and totally release ofsites
the Hold Point.
Submission Details: The archaeological consultant’s salvage excavation report with confirmation that the salvage excavation is
complete.
Release of Hold Point: The Principal will consider the documents prior to authorising the release
of the Hold Point.
Northern Road Upgradge Stage 4 - Compliance Tracking Matrix
G38 - Soil and Water Compliance
Heading Section Statement Compliance in CEMP Section Notes Review Review due Review due Review Review Review Review Review Compliant Notes
(G38) required? date date due date due date due date due date due date (Yes/No)
General - Qualified 1.2.7 Personnel who prepare your Soil and Water Management Plan, Erosion and
Personnel Sediment Control Plans (including Stabilisation Sub-Plans and Stockpile
Management Sub-Plans) and who carry out erosion and sediment control
inspections in accordance with Clause 4, must have completed training in Blue
Books 1 and 2D and Erosion and Sedimentation Control (with a certificate as proof
of training) and who have suitable on site, hands on experience in preparing such
plans, including refresher training as appropriate.
Key personnel who control construction work at each worksite must also have
HOLD POINT completed a training
Process Held: course in of
Commencement Erosion and Sedimentation
construction work. Control.
Submission Details: List of personnel who will be working on the Contract, with
evidence of pertinent qualifications, to satisfy the requirements of this clause.
Release of Hold Point: The Principal will consider the submitted documents prior
to the release of the Hold Point.
Management Plans - 2.1.1 If specified in Annexure G38/A, prepare and implement a Soil and Water
Soil and Water Management Plan (SWMP) for the Work Under the Contract. The SWMP will form
Management Plan: part of the Contractor’s Environmental Management Plan (CEMP) specified in RMS
General G36, and incorporates the Erosion and Sediment Control Plan (ESCP) (refer Clause
2.2).
The SWMP must be prepared by a person with demonstrated skills and experience
in preparing the SWMP in accordance with the guidelines in the publication
Management Plans - 2.1.1 “Managing UrbanbeStormwater:
The SWMP must reviewed bySoils and
a soil Construction Volumes
conservationist 1 and
registered with2d”
the(the
RMSBLUE
at
Soil and Water category S1 or higher. You must respond to the review and incorporate any
Management Plan recommendations or justify decisions for not incorporating recommendations.
Management Plans - 2.1.2 The Soil and Water Management Plan (SWMP) must identify all risks relating to soil
Soil and Water erosion, and pollution caused by sediments and other materials, and describes how
Management Plan: these risks will be addressed during construction.
Plan Requirements
Management Plans - 2.1.2 The SWMP must also address:

Soil and Water (i) RMS Code of Practice for Water Management;
Management Plan: (ii) RMS Erosion and Sedimentation Procedure;
Plan Requirements (iii) The NSW Soils and Construction – Managing Urban Stormwater Volume 1 “the
Blue Book” (Landcom, 2004) and Volume 2 (DECC, 2008);
(iv) RMS Technical Guideline: Temporary Stormwater Drainage for Road
Construction (2011); and,
(v) RMS Technical Guideline: Environmental Management of Construction Site
Dewatering (2011).
Management Plans - 2.1.2 The SWMP must include details of the following, where relevant:
Soil and Water (a) Purpose and objectives of SWMP.
Management Plan:
Plan Requirements
(b) Approvals, licence requirements and relevant legislation.
(c) Site investigation and assessment of the following:

(i) soil properties (including dispersion properties and presence of acid sulphate
soils);
(ii) rainfall records and design parameters;
(iii) waterways and other water related sensitive environments;
(iv) groundwater;
(v) possibilities of, and limitations on, water extraction.
(d) Environmental control measures, including:
(i) responsibility for its implementation, including the names and contact details of
the person(s) responsible;
(ii) resources required for its construction, monitoring, maintenance and removal;
(iii) implementation schedule for the measures, related to construction activities;
(iv) monitoring and maintenance of the environmental controls;
(v) minimising the area of disturbance in riparian zones by clearly marking out
work zones in riparian areas and protection of areas with fencing or similar
material;
(vi) implementation of adequate sediment and erosion control in works near
riparian
(e) Otherzones.
associated plans, Environmental Work Method Statements (EWMS) and
procedures.
(f) Construction sediment retention basins, including details of the following:
(i) design of the construction sediment retention basins, including any temporary
modifications to the operational basins, providing details of the approach,
standards, criteria and references used in the design of the basins;
(ii) management of the basins;
(iii) procedures for testing, treatment and discharge of water from the basins;
(iv) procedures for the periodic removal and disposal of the sediment collected
within the basins.
(g) Training, including:
(i) site induction;
(ii) environmental training;
(iii) toolbox training.
(h) Inspection and auditing.
(i) An emergency spill incident plan which includes measures to manage and avoid
spillages of fuels, chemicals and fluids onto any surfaces or into any nearby
waterways;
(j) A wet weather rain event plan which includes a process for monitoring
potential wet weather
and identification of controls to be implemented in the event of wet weather;
(k) A review process by your Soil Conservationist and a process for updating the
SWMP to
address any
(l) A farm recommendations;
dam dewatering plan and
including:
(i) a map showing locations of farm dams to be dewatered;
(ii) Fisheries Permits and animal care and ethics requirements;
(iii) methodology for dewatering dams with consideration to aquatic ecology
including the
capture, storage, relocation, release of fish and other aquatic fauna;
(iv) euthanisation procedure (as required);
(v) location of any offsite discharge points; and
(vi) requirements to manage encounters of contaminated water.
In addressing items (g) and (h) above, refer to RMS G36.
Management Plans - 2.2.1 Prepare and implement an Erosion and Sediment Control Plan (ESCP) for the Work
Erosion and Sediment Under the Contract. The ESCP will form part of the CEMP, and where a SWMP is
Control Plan: General also required, the ESCP will be incorporated in the SWMP.
Management Plans - 2.2.1 Include progressive site specific ESCPs for each construction stage, showing
Erosion and Sediment contours, drainage paths, extent of disturbance and location of all erosion and
Control Plan: General sediment controls and identifying any constraints to ensuring that drainage paths
function at each construction stage.
Management Plans - 2.2.1 Revise the ESCP whenever the Contract Program or work methods change, and
Erosion and Sediment whenever the work methods and control structures are found to be ineffective or
Control Plan: General are no longer required. Have available at each fortnightly environmental
inspection copies of the current relevant ESCPs.
Management Plans - 2.2.1 The ESCP must be prepared by a person with demonstrated skills and experience in
Erosion and Sediment preparing the ESCP in accordance with the BLUE BOOK guidelines.
Control Plan: General
Management Plans - 2.2.2 The ESCP must identify all erosion and sediment control risks and describe how
Erosion and Sediment these will be addressed during construction.
Control Plan: Plan
Requirements
Management Plans - 2.2.2 The ESCP must include details of the following where relevant:
Erosion and Sediment (a) erosion and sediment control measures required:
Control Plan: Plan (i) before clearing and grubbing of the Site;
Requirements (ii) before removal of topsoil and commencement of earthworks within the
catchment area;
(b) how upstream water will be managed and diverted around disturbed areas so it
is not polluted by the construction activities;
(c) method of tree removal in intermittent watercourses, leaving grasses and small
understorey species undisturbed wherever possible;
(d) scour protection measures for haul roads and access tracks when these are an
erosion hazard due to either their steepness, soil erodibility or potential for
concentrating runoff flow;
(e) measures for promptly stabilising disturbed areas and temporary drains;
(f) measures to minimise erosion during construction of embankments;
(g) measures to minimise erosion and control sedimentation from stockpiles;
(h) methods of constructing batters to assist the retention of topsoil on the batter
slopes;
(i) measures to temporarily trap sediment in median areas at regular intervals;
(j) controls in runoff flow paths to reduce flow velocities and minimise the
potential for erosion;
(k) measures for controlling waste water discharge on or around the Site from
dewatering (refer to Clause 3.5), surface washing, grit blasting, saw cutting,
drilling, washing vehicles and plant and any other activities which add pollutants
to water;
(l) measures to be put in place during an extended shut-down of the Site or when
Management Plans - 2.2.2 (m) maintenance of erosion and sediment control structures including measures to
Erosion and Sediment restore their capacity;
Control Plan: Plan (n) inspection and auditing program for all erosion and sediment controls to ensure
Requirements that no disturbed area is left without adequate erosion and sediment controls;
(o) mapping and description of locations of construction sediment retention basins,
their catchments and drainage structures directing water to the basins;
(p) controls to be implemented at entry and exit points to minimise tracking of soil
and particulates onto pavement surfaces;
(q) removal of any materials transported onto adjacent road pavement surfaces
such as sweeping as soon as practical or at a minimum at the end of each working
day;
(r) additional controls to be implemented ahead of forecast rainfall events and
ahead of site shutdown of greater than two calendar days;
(s) staged plans for construction over minor waterways where culverts and/ or
bridges will be constructed; and,
(t) measures to manage contaminated soil and/or water that may be present
and/or identified during the implementation of erosion and sediment control
measures.
Management Plans - 2.2.3 When preparing the ESCP, subdivide the site into sections based on the separate
Erosion and Sediment catchment areas, or
Control Plan: Plan alternatively into high risk areas, that will be affected by Work Under the
Preparation Contract.
Management Plans - 2.2.3 Progressively, before work begins on any section of the Site, prepare a drawing for
Erosion and Sediment that section showing all controls required to avoid erosion and sedimentation of
Control Plan: Plan the Site, surrounding areas, watercourses, drainage systems, water bodies and
Preparation wetlands.
Update each drawing regularly as the site conditions changes during the progress
of Work Under the Contract. Include as part of the ESCP a procedure for updating
the drawings, and keep a register of all such drawings with the dates of
Management Plans - 2.2.3 Include on the drawings locations of all ancillary activities and/or areas that may
Erosion and Sediment impact on water quality, such as:
Control Plan: Plan (a) access and haulage tracks;
Preparation (b) borrow pits;
(c) stockpile and storage areas;
(d) temporary work areas;
(d) materials processing areas;
(e) compound areas;
(f) concrete and asphalt batching areas and location(s) of concrete washouts;
(g) known (or discovered areas) of contamination.
Management Plans - 2.3 Prepare a Water Quality Monitoring Program (WQMP), as a supplement to the
Water Quality ESCP, in accordance with the RMS Guideline for Construction Water Quality
Monitoring Monitoring and EPA publication “Approved Methods for the Sampling and Analysis
of Water Pollutants in NSW.”.
Management Plans - 2.3 The Principal will carry out the water quality monitoring program. Provide access
Water Quality at all times for the Principal to implement the program.
Monitoring
Management Plans - 2.3 Include the following in the WQMP:
Water Quality (a) objectives of the monitoring (including EPA licence requirements);
Monitoring (b) map showing the water sampling locations;
(c) sampling protocol, including sample collection, chain of custody information
and sample preservation;
(d) parameters to be monitored;
(e) method for interpretation of field results and identifying exceedance of water
quality criteria;
(f) accountabilities, responsibilities and training required the meet the monitoring
objectives;
(g) method of comparison of results between sampling locations (e.g. upstream and
downstream) and any water quality criteria and/or targets;
(h) reporting and recording of the monitoring results;
(i) responsibility for planning, implementing, checking and reviewing each element
of the monitoring;
(j) methodology for using monitoring results to assess and manage identified
problems;
(k) reporting requirements in the case the monitoring results exceed the set
Management Plans - 2.3 Laboratories used in the monitoring program must be accredited by the National
Water Quality Association of Testing Authorities (NATA).
Monitoring
Management Plans - 2.4 In preparing the SWMP and/or ESCP, be guided by the BLUE BOOK.
Design Guide Comply with the following requirements:
(i) estimate peak flows and other parameters needed to design drains and drainage
structures using the methods described in Australian Rainfall and Runoff;
(ii) use the Average Recurrence Interval (ARI) shown in Annexure G38/E for the
design of erosion and sediment control measures, unless site conditions or risks to
life, property or the environment suggest that other values are applicable;
(iii) superimpose the drawings accompanying the plans on A3 sized drainage
drawings of the Works.
Management Plans - 2.4 You do not need to submit the calculations carried out during preparation of the
Design Guide SWMP or ESCP with the plan, but you must retain them as an Identified Record.
You must forward a copy to the Principal upon request.
Management Plans - 2.5 Develop a documented process to periodically review the effectiveness and proper
Management Review implementation of the SWMP and ESCP. The management review process must
identify opportunities for continual improvement of your environmental
management processes and practices, and ensure that the SWMP and ESCP remain
current and relevant to the Work Under the Contract.
Soil and Water 3.1.1 In addition to the erosion and sediment control measures stated in Clause 2.2,
Management implement the following:
Measures - Erosion (i) placing the locations of site compounds, access tracks, stockpile sites and
and Sediment temporary work areas to minimise erosion;
Control: (ii) staging of work and programming of construction activities to minimise the
Implementation duration and extent of soil that is left exposed. This includes minimising the time
between clearing and initial earthworks and commencement of subsequent works
in intermittent and permanent watercourses;
(iii) temporary modification of operational basins during the construction period
for additional capture of stormwater runoff;
(iv) installing and lining catch drains and diversion banks in accordance with the
requirements of Specification RMS R11 before earthworks commence;
(v) installing scour protection at the base of permanent and temporary drainage
outlets;
(vi) constructing drains to direct runoff from disturbed areas to sediment basins or
to areas with adequate sediment trapping/filtering devices and away from
watercourses;
(vii) filtering of sediment prior to water entering any pit and management of
stormwater discharge through any pit;
(viii) staged re-vegetation of the Site as work proceeds, progressively undertaking
Soil and Water 3.1.1 (ix) procedure for diverting upstream water flow around or through the site with
Management adequate controls to prevent the mixing of upstream water and water originating
Measures - Erosion or discharging from the site;
and Sediment (x) procedure for collecting, treating and disposing of any wastewater or water
Control: generated on the site during construction processes;
Implementation (xi) procedure for maintaining, regularly trimming and compacting access tracks,
road formations and the edge of small batters to ensure durable surfaces and
minimise erosion;
(xii) procedure for compacting disturbed surfaces at the end of each work day to
reduce the erosion potential;
(xiii) providing hardstand material or rumble grids at exit points from stockpile
sites and construction areas onto public roads to minimise the tracking of soil and
particulates onto public roads;
(xiv) designing disturbed areas not directed to construction sediment retention
basins to comply with the requirements of the Blue Book to ensure potential
sediment load is less than 150m3 per year (refer section 6.3.2 in the Blue Book);
(xv) immediately after forming swales and catch drains and any temporary drains,
installing and maintaining temporary lining to the satisfaction of the Principal in
the swales and catch drains and temporary drains until permanent lining or
vegetation is applied;
Soil and Water 3.1.1 (xvi) providing designated impervious bunded washdown facilities for concrete
Management trucks and other vehicles at least 100 metres from areas prone to flash flooding or
Measures - Erosion 50 metres away from other natural and built drainage lines;
and Sediment (xvii) promptly using jute mesh or similar to provide scour protection for any
Control: earthen areas of waterways that have been disturbed and that do not have a
Implementation permanent vegetative or water cover and are likely to experience flows of a
minimum 1:5 year flow event until long-term stabilisation measures are
established as shown on the Drawings;
(xviii) procedure for monitoring Bureau of Meteorology forecast heavy rainfall
events in order to allow sufficient time to vacate and prepare the site prior to the
commencement of heavy rainfall events and flood events and also to allow for
programming of construction work to minimise the risk of erosion and
sedimentation; and
(xix) staging of work and programming of high risk soil and erosion activities to
HOLD POINT Process Held: Commencement of work in each catchment or sub-catchment
requiring the installation of erosion control and sediment capture measures not
previously addressed by ESCP and authorised by earlier Hold Point release.
Submission Details: Drawings prepared progressively for sections of the Site where
work is to commence. The drawing(s) must be signed and approved by your ESR,
Construction Superintendent and Project Manager before being submitted at least
ten working days before disturbance of the surface of the section of the Site.
Release of Hold Point: The Principal will consider the submitted drawing(s) prior to
authorising the release of the Hold Point.
WITNESS POINT Process Witnessed: Disturbance of the existing surface on a section of the Site
(catchment or sub-catchment), other than for the installation of erosion and
sediment capture measures.
Submission Details: Written advice, including signed approval by your ESR and
Construction Superintendent, that the measures described in the ESCP and
included on the drawing submitted progressively for that section of the Site,
including sediment basins and other water quality structures together with
associated temporary or permanent connecting stormwater drainage lines and/or
catch drains, have been implemented or the date by which implementation will be
completed. The advice must be forwarded at least five working days before the
Soil and Water 3.1.1 works are fencing
Sediment to commence.
must be woven polypropylene and cotton / geotextile thread
Management with a flow rate > 110 litres/m2/sec to AS 3706.9.
Measures - Erosion
and Sediment Identify the construction boundaries in accordance with RMS G40.
Control:
Implementation Erosion and sedimentation controls must remain in place until 70% of the disturbed
area beyond the pavement is stabilised or as otherwise agreed with the Principal.
Soil and Water 3.1.1 In the event of forecast storm events, heavy rainfall or flooding events:
Management (a) inspect the site to ensure that all erosion/sedimentation and stabilisation
Measures - Erosion controls are in place and in effective working order; and,
and Sediment (b) cease all work in the vicinity of flood-prone areas and collect all loose
Control: materials and wastes, and if there is a possibility that work sites could be flooded,
Implementation take action to prevent any environmental incidents such as potential pollution
incidents and protecting disturbed ground from erosion, including relocating all
materials that could cause harm onto higher ground and away from flood prone
Soil and Water 3.1.2 Maintain a register of inspection and maintenance of erosion control and sediment
Management capture measures, dates of discharge, water treatment (flocculation) performed,
Measures - Erosion discharge water quality as defined in Clause 2.3, volumes of sediment removed
and Sediment from each device, method of disposal of the sediment and daily rainfall.
Soil and Water 3.2 Establish erosion control and sediment capture measures, and maintain them
Management regularly, to divert offsite stormwater, manage onsite stormwater runoff and
Measures - Stockpile stabilise stockpiles in accordance with RMS Technical Guideline EMS-TG-010:
Management Stockpile Site Management and the BLUE BOOK guidelines.
Soil and Water 3.2 Design, establish, operate and decommission all stockpiles in accordance with the
Management RMS Draft Stockpile Management Procedures, 2011. Manage stockpiles in
Measures - Stockpile accordance with RMS Stockpile Site Management Guideline, RMS G36 and RMS
Soil and Water 3.2 Include a Stockpile Management Sub-Plan in your ESCP which includes, but is not
Management limited to:
Measures - Stockpile (i) Locations of stockpile sites;
Management (ii) Quantities and types of materials to be stockpiled;
(iii) Measures to ensure separation of different materials;
(iv) Controls to protect stockpiles from stormwater runoff;
(v) Stabilisation of stockpiles left for more than 20 days; and
(vi) Procedures for the control of other material you propose to place in stockpiles
which may pose environmental risk e.g. recycled bedding sand, lime, gypsum,
stabilised sand etc.
Soil and Water 3.2 Install erosion control and sediment capture measures prior to stockpiling
Management material.
Measures - Stockpile
Appendix A2
Environmental Aspects and Impacts
This Environmental Aspects and Impacts Register summarises the Environmental Risk
Analysis conducted as part of the CRAW for the Project.
The identification of significant construction activities and associated impacts that could
eventuate during construction of the Project is central to the selection of appropriate
environmental management measures.
The risk management process was undertaken to identify significant environmental risk for
the Project specific construction activities and aspects which are anticipated to be
undertaken in or near environmentally sensitive areas. The Project Team assigned each
potential impact an environmental risk category (as identified in Figure 1) with an inherent
risk (pre control) score and a residual risk (post control) score.
Any item identified with having an inherent score of extreme is identified as a significant
environmental risk for the Project.
Figure 1 – Risk Matrix
Title: Risk Register
Project: The Northern Road Upgrade Stage 4 Date of last review: 14/09/18
Owner: Jerry Cockburn, Glen Bolton
Heading Activity Hazard Aspect Unwanted Event Mandatory Controls Project Specific Controls Legal and other References
Uncontrolled Risk Controlled
Score Risk Score
Heritage Salvage Works salvage all PADs and '- Working near Indigenous / '- Damage/ disturbance to - develop salvage strategy with the appointed heritage consultants for - engage heritage consultants to perform salvage works - NPWS Act POEO Act
European heritage pre heritage sites Indigenous & heritage aboriginal and non aboriginal heritage - Erect signage and barricading
Construction working sites - If Indigenous artefacts are located liaise with traditional owners through - Clearly mark items to be protected until salvaged
around Heritage areas - Non-compliance appointed consultants - follow salvage management plan
- Reputation Extreme - All work to cease if any suspected bones or artefacts are located - Sign of received from RMS Moderate
- Inform management of any findings exclusion fencing where required
- Prior to works occurring works occurring
Pre-mobilisation Environmental Approvals Environmental approvals not fine prosecution from the EPA under "- Ensure all Construction approvals are in place prior to the Transfer EPL from RMS to Georgiou, develop Georgiou website to POEO Act
in place to commence work the POEO Act commencement of works '- Use of Legal and Other Obligations display monitoring data, develop PIRMP. EP&A Act
fine / prosecution from NSW office Register in preparation of EMP Apply and get approval from Water NSW for water supply works Water
of water - HSE Start-Up Checklist approval Managem
- Legal Compliance Evaluations Develop and get CEMP approved RMS ent Act
'- Use of HSEQ Meeting minutes to manage requirements for develop and get EWMSs approved by RMS 2000
High permits / licences DPE approval internal compliance tracking register RMS G36 Moderate
Consistency assessment approvals weekly env inspections
daily environmental complaints reporting to the EPA. Complaints
through the Community hotline
Supervisors & Engineers knowledgeable of the EMP requirements.
ESR available to supervise & offer advice to Construction team.
Storage of Hazardous Use of containers / tanks to Hazardous substances or dangerous Spillage resulting in exposure Storage containers e.g. flammable liquids must be of a good quality, sealed and Safety Data Sheet. Work Health & Safety Act 2011
Substances or Dangerous store hazardous substances goods to worker & environment suitably labelled indicating compliance with AS 2906:2001. Be marked as ChemAlert database. Work Health & Safety
Substances or dangerous goods (ground contamination) containing flammable liquids. Total flammable liquids stored to not exceed 250tr Where classified as 'hazardous', Georgiou will complete & Regulation 2017 (Schedule
(excess will require placarding). record the chemical risk assessment available within 11).
Storage containers not to exceed 30ltr ChemAlert. Project Safety Management Plan
Flammable liquids to be stored only with compatible substances. Subcontractors wishing to introduce a 'hazardous' substance Project Construction
Flammable stores to contain adequate bunding to contain 100% of the volume of are to provide the Project with a written risk assessment . Environment Management
Extreme the largest container with an extra 25% of the storage capacity up to 10,000 L SDS Register & file Plan. High
No Smoking or ignition source signs to be displayed Georgiou Hazardous
Chemicals Procedure.
NSW Code of Practice;
Managing risks of
hazardous chemicals in
the workplace
AS 2906: 2001 - Fuel
Hazardous Substances - Transportation of '- Hazardous substances - Spillage and release of - Licenced contractor to be employed to transport all dangerous good - Assessment shall be undertaken of any dangerous and POEO Act portable,
Containers,
hazardous substances dangerous goods and hazardous substances unless an exemption covers the transport, eg hazardous substances to be transported to determine if Dangerous
plastic andGoods
metal.(Road and
substances from transportation small quantities, single consignments of small receptacles and certain quantities license is required from Department of Consumer and Rail Transport)
AS 1940:2004 TheAct 2008
and storage. carried as tools of trade other requirements; Employment Protection. Workcover
storage and NSW
handling of
- Fire/explosion - Adequate storage and restraining devices while in transit (appropriate containers) - First aid kit on truck flammable and
- Injury to person and plant as per the Australian Dangerous Goods Code - Environmental Management Plan - Emergency Spill combustible liquids.
transporting dangerous goods - All Transportation quantities to be below State regulatory requirements for Response Sub Plan
or hazardous substances. transportation
- Contamination of land or - SDS to accompany chemicals transported
nearby water High - Spill kits/neutralising agents to be on truck Moderate
- Adequate relevant signage and placarding for container/truck
- Segregation from other dangerous goods as per the MSDS and dangerous goods
segregation table
- Transportation of goods to be done in accordance to ADG Code.
- Emergency Response Management Plan developed and in the event of a
hazardous substances release identified controls implemented
- Emergency Response Team Leader elected for project
- Emergency Response Team Leader trained in emergency procedure for hazardous
substance release events
- Truck contains UHF radio
Hazardous Substances Plant & Equipment usage Incorrect storage and handling of Spills and leaks. Contamination Provide SDS and emergency contact numbers Staff trained in the management of chemicals kept on site Work Health & Safety Act 2011
hazardous and dangerous goods of land or nearby waters. JHA/SWMS to include recommendations including PPE requirements for handling Store in low volumes Work Health & Safety
Storage lockers/tanks which and storage When storing hazardous substances ensure: Environmental Management Plan - Hazardous Chemicals Regulation 2017
are inadequate to prevent Adequate ventilation Management Environmental Sub Plan Emergency Response
fire/ explosion, intoxication or Relevant fire extinguishers are Management Plan
leaks. Detrimental impacts to available Adequate signage and WHS Regs 2011
personal health barricades if required All fuels (Schedule 11).
stored away from ignition Project Safety Management Plan
sources Project Construction
High Segregation as per the dangerous goods segregation table Environment Management Moderate
Have the correct bunding installed. The capacity of the spillage containment Plan.
should be at least 110% of the volume of the largest package with an extra 25% Georgiou Hazardous
of the storage capacity up to 10,000 L Chemicals Procedure.
When storage tanks are installed ensure that fuel storage and refuelling areas will NSW Code of Practice;
be designed with; Managing risks of
Bollards installed around fuel hazardous chemicals in
storage facilities. Spill the workplace
kits/neutralising agents to be on RMS QA Spec G22/J Truck &
truck Plant Requirements
Adequate relevant signage and placarding for container/truck /
Hazardous Substances Dangerous Goods / Failure in the fuel depot from Contamination of Bollards installed around fuel Pollution Incident Response Management Plan and POEO Act 1997
Secondary containment around containers (lined refuelling area) or
hazardous substances plant and equipment collision. Environment Fire/explosion storage facilities. Spill Emergency Response Management Plan developed and in the
double skinned Bulk chemical storage to be stored in bunded areas
storage kits/neutralising agents made event of a hazardous substances release identified controls
Compound located away from sensitive receptors
available implemented
High Adequate relevant signage and placarding for Emergency Response Team Leader trained in emergency Moderate
container/truck Preventative maintenance procedure for hazardous substance release events
program Environmental Management Plan -Hydrocarbon & Chemical
Secondary containment around containers or Management Environmental Sub Plan
double skinned Drive-over bund / lining for
General - General Works '- Storm water runoff sedimentation of waterways refuelling
soil area management sub plan to
and water - Place barriers/bunds around open drains POEO Act RMS G36 RMS G38
/ Stormwater drains Toolbox talks - progressive
be developed Emergency ESCPs
Response sediment controls in kerbs around SW pits in work zones.
Hydrocarbon spill QHEST -Georgiou
developed Street sweeper to be used when dirt on road
internal reporting system
EPL dewatering permit (Internal)
Compound located away from sensitive receptors clean water diversions to be installed
High sediment controls to be installed Moderate
basins to be designed and installed in accordance with
Basins to be installed prior to topsoil strip in accordance with
EPL.
Owner: Jerry Cockburn, Glen Bolton
Heading Activity Hazard Aspect Unwanted Event Mandatory Controls Project Specific Controls Legal and other References
Uncontrolled Risk Controlled
Score Risk Score
General - General Works '- Working near Indigenous / '- Damage/ - Planning in conjunction with Client to identify and then isolate/ - Vibration suppression if activities are likely to disturb NPWS Act POEO Act
heritage sites disturbance to demarcate areas of Indigenous & Heritage significance by qualified heritage or artefacts structural integrity
Indigenous & heritage surveyor - Obtain an impact study on the scope of the works and
sites - If Indigenous artefacts are located liaise with traditional owners through methodology on heritage or artefacts
- Non-compliance appointed consultants - Use of spotter where required
- Reputation - All work to cease if any suspected bones or artefacts are located and follow RMS - Identify Indigenous Management Plan
unexpected finds procedure - Conduct a Condition survey
Extreme Moderate
- Inform management of any findings - Erect signage and barricading
- Site induction - Refer to Miss Lawson's Guesthouse
- Minimise vibrational activities if likely to disturb Indigenous/ heritage buildings/ - Supervision and clear communication of clearing
areas - Environmental Management Plan - Cultural Heritage
- Clearly mark items to be protected Management Environmental Sub Plan
- Cultural & Heritage Protection Procedure
General - General Works '- Dust generation '- Degradation to fauna and flora - Water exposed areas when visible dust is observed - Visual dust monitoring to be conducted daily to ensure POEO Act RMS G38, G40
- Disturbance to - Where required, maintain communication with surrounding residents and business controls are adequate EIS
Residential/ Commercial owners - Dust monitoring will take place if complaints are received
- Dust Generation associated - Visual Dust monitoring - Air Quality & Dust Management Environmental Sub Plan
with subgrade stabilisation - Adhere to sign posted speed limits - Install wind fences if appropriate
(road works) High - Air Quality & Dust Management Procedure - Conduct regular weather checks Moderate
Dust bottles to be installed and collected monthly - weather monitor installed on site
- Environmental Management Plan Air Quality & Dust
Management Environmental Sub Plan
General - General Works '- Noise and vibration - Noise and vibration work within allocated hours - Maintain communication with surrounding residents and POEO Act
disruption to the community - liaise with stakeholders business owners. Advise local residents of commencement DEC interim
and/or legal non- - Any complaints registered and monitored through QHEST as per RMS System and duration of works, and if any out of hours work will construction noise
compliance. - Use quietest equipment where practically possible. occur guidelines EPL
- Noise & Vibration - Noise and vibration monitoring as set out in the N & V RMS G38
Management Plan management plan Assessing Vibration a
High Moderate
community liaison plan - property condition surveys study technical guideline NSW
EPL 21121 requirements & Conditions - Fit and maintain appropriate mufflers on plant EPA
- Environmental Management Plan - Noise & Vibration
Leadership walks & inspections to monitor standards
General '- Wash down / washout of plant water quality '- Contamination of water - Exclusion zones to prevent wash-down in develop pollution incident response plan POEO Act RMS G38, G40
sensitive areas develop soil and water wash-down only to occur at designated area away from EIS
Moderate management plan drainage lines and stormwater pits Low
Plant arrives on site clean - Environmental Management Plan - soil and Water
General '-Dewatering water quality contamination of waterways - Discharge water onto a stable surface - Reuse water on site to irrigate, dust suppression etc POEO Act RMS G38, G40
EPL And conditions (licence discharge points) - Environmental Management Plan - soil and Water EIS
- Disperse water where possible to facilitate infiltration through methods such as Management Environmental Sub Plan
spraying '- use a permit to discharge
Extreme - Water Management Procedure Moderate
- Reinfiltrate treated dewatering water
'- Identify regulatory requirements before discharging - test pH, Total Suspended Solids & Turbidity
- Assess water quality before discharging Procedure & general knowledge that all water is measured &
- Treat water before discharging where it does not meet the water quality objectives determined suitable prior to discharge
Waste Management - Storage of wastes '- Waste -littering and contamination of - Clear signage indicating type of waste receptacle - Appropriate segregation, storage and containment POEO Act
Site - Provide sufficient waste receptacles to meet demand and regular pick ups available for waste EPA NSW waste classification
- All food waste receptacles to have lids - Environmental Management Plan - Waste Management guidelines
- Periodic inspection to monitor waste onsite Environmental Sub Plan
- Use of registered waste removal contractor to remove all waste
Moderate Contaminated waste to be transported by a licensed carrier to a licensed Low
disposal facility Waste carrier licence to be attained when disposing of
contaminated material
Waste receipts to be retained
- Site Induction
- Toolbox Topics
Waste Management '- Office Administration '- Waste of resources - Waste
'- Management
Recycling Procedure
of empty ink cartridges '- Paper recycling bins EPA NSW waste
- Wasteful use of energy - Turn-off lights at non-critical times - Print on lower quality/ no colour to minimise toner usage classification
- Excessive paper to be - Where possible print/copy on both sides of paper and purchase printers with - Use of low energy globes where practical guidelines energy
Moderate Low
recycled at a cost to Georgiou capability to print double sided - Environmental Management Plan - Waste Management efficiency
- Waste Management Procedure Environmental Sub Plan opportunities
Energy and Resource Use '- Office Administration - Natural Resources - Excess use of natural - Turn-off lights when not required '- Paper recycling bins NGERs Act
resources (Fuel & electrical - Where possible please do not print - Print on lower quality/ no colour to minimise toner usage energy efficiency opportunities
consumption & waste Moderate - If the event that this can t be avoided print/copy double sided - Use of low energy globes Low
generation - Waste Management Procedure - Environmental Management Plan - Waste Management
Environmental Sub Plan
Refuelling of Plant & Equipment '- Refuelling plant and '- Hydrocarbons - Contamination of - Spill kit available with fuel source - Operators trained in use of re-fuelling equipment and POEO Act RMS G36 RMS
equipment soil / groundwater - Refuelling devices automatic operating function disabled informed of approved locations to refuel. G38
- Degradation to flora & Fauna - Fire suppression equipment - Designated personnel nominated for refuelling
High - Stop engine while refuelling - Drip trays for field refuelling Low
- no mobile phone use - Environmental Management Plan - spill response procedure
while refuelling spill EWMS Available for refuelling
response procedure
Repairs and Maintenance of '- Waste oils and parts '- Uncontrolled dumping at non '- Hazardous substances PIRMP
- Wastetooils
be to
developed
be collected and stored in approved facilities and disposed -servicing of plant to occur offsite unless breakdown POEO Act RMS G36 RMS
Plant & Equipment approved landfill sites contaminating the of using an approved licenced contractor servicing G38
- Hydrocarbons, degreasers and environment - Grease cartridges, oil filters etc to be disposed of in Hydrocarbon bins -Waste Receptacles to be located centrally on site where
detergents contaminating - Waste Management Procedure practically possible
waterways and soil - Environmental Management Plan - Waste Management
High Moderate
Environmental Sub Plan
No maintained works within 30 metres of waterways & spill
kit available
Clearing and Grubbing '- Land Clearing - Clearing of native vegetation '- Death/loss of protected - Identify and mark areas of protected flora / fauna, with demarcation of - Consult with Client/ relevant authorities or employ POEO Act RMS G40 RMS
outside of approved boundaries flora / fauna boundaries and illustrate on a map (which is consistent with the clearing consultants to conduct vegetation survey before works G36
- Permit conditions of - Breach of legislation permit) Approval from the client to undertake clearing and a copy of
compliance associated - Destruction of habitat - Ensure during planning stage to consult with Client to identify and isolate the clearing permit on file
with work on a project - Non-compliance to Extreme areas with protected flora / fauna FFMP Moderate
Client requirements - Site clearing boundary pegged by qualified surveyor and approved
prior to works commencing
- No access beyond site boundary permitted - Erect signage as
appropriate pre clearing ecological survey and report to be
conducted
Owner: Jerry
Cockburn,
Heading Glen Bolton
Activity Hazard Aspect Unwanted Event
Uncontrolled Risk
Mandatory Controls Project Specific Controls Legal and other References
Controlled
Score Risk Score
Clearing and Grubbing storage of mulch and topsoil Mulch and Topsoil management Mulch self combustion, - Dedicated topsoil stockpile location - Height restrictions (3m) POEO Act RMS G40
tannins in waterway. - Stockpile location communicated to - Transfer of topsoil directly to area undergoing RMS G36
Damage of topsoil to be work crew stabilise long term - Rehabilitation preferentially over topsoil stockpiling RMS Technical Stockpile
used for rehabilitation High stockpiles as per RMS spec Mulch stockpiles to be no higher than 3m to minimise heat Guideline Moderate
Mulch stockpiles to be no higher than 3m to minimise build up
heat build up Mulch to be stored away from waterways - Environmental Management Plan - Flora and fauna
and drainage lines management plan
Excavation Stockpile placement & Formation of stockpiles leading to Stockpiles exceeding 3m. Stockpiles over 3m to have their locations nominated to the RMS project Stockpile mgt protocol Work Health & Safety Act 2011
formation potential environmental incident, delegate. Stockpiles of soil to be seeded/sealed or covered within 14 Work Health &
Insufficient controls to contain days of formation. Safety Regulation
pollution. Stockpile stability & Fill materials / clay etc. to be compacted and 2017 NSW CoP:
access sealed. Adequate erosion & sediment controls Excavation
to contain run-off. NSW CoP: Managing the
Extreme Positioning to consider placement relative to intercepting risks of plant in the Moderate
sediment basins. Vehicle access paths onto stockpiles to limit workplace.
gradient to 30 degs. RMS Spec G36
Access paths protected with windrows/berms equal to half the diameter of the
vehicle wheel. Operators to monitor & report cracks, evidence of landslide, soft
spots etc. to site supervisor
& stop work until assessed.
Opinion of Geotechnical Eng to be
Excavations > 1.5 metres - Excavations fauna entrapment '- Trapped fauna resulting in '- Construct ramps on the sides of deep excavations and ramp exit points per 30m of '- Erect barriers POEO Act RMS G40
considered. Experienced operators to form
injury or death to fauna trench - Environmental Management Plan - Flora & Fauna RMS G36
& maintain stockpiles.
- Contact local authorities / qualified competent fauna handler to remove injured Management Environmental Sub Plan
Suitable
fauna blending of materials to provide integrity of stockpile.
- Inspect trenches/ excavations for trapped fauna prior to starting work
Moderate Low
- Backfill as soon as practicable
- Project to report any injury caused to fauna to Georgiou Environmental Coordinator
- Do not attempt to hurt any fauna unless directly threatening your safety
- Flora & Fauna Protection Procedure
Excavations > 1.5 metres '-Dewatering water quality contamination of waterways - Reuse water on site to irrigate, dust suppression etc POEO Act
Discharge water onto a stable surface - Environmental Management Plan - soil and Water RMS G38, G40 EIS
'- Identify regulatory requirements before discharging Management Environmental Sub Plan
Extreme - Assess water quality before discharging '- use a permit to discharge Moderate
- Treat water before discharging where it does not meet the water quality - test pH, Total Suspended Solids & Turbidity and treat to
objectives Licence discharge points meet parameters in bluebook
Excavations > 1.5 metres '- Exposure of in situ hostile '- Groundwater / soil '- Characterisation of material - Geotechnical Survey completed pre Construction POEO Act RMS G40
materials (including acid contamination - Develop remedial measures involving experts and stakeholders (where necessary) - Environmental Management Plan - Waste Management RMS G36
sulphate soils, asbestos). Moderate - Waste Management Procedure Environmental Sub Plan, Contaminated Land Management Low
Sub Plan
Working with Concrete - Wash down / washout of plant water quality '- Contamination of water - impervious concrete washout areas to be develop pollution incident response plan POEO Act RMS G38,
provided Exclusion zones to prevent wash- wash-down only to occur at designated area away from G40 REF
down in sensitive areas develop soil and water drainage lines and stormwater pits
Moderate management plan - Environmental Management Plan - soil and Water Low
Concrete Truck to wash out back at the depot.
Curing Concrete water runoff '- Contamination of water Bund curing compound in 1,000 Replace 1,000 litre as required POEO Act RMS G38,
Moderate litre pods Do not store in Monitor weather conditions and avoid using curing compound G40 REF Low
waterways in the rain
Road Construction earthworks '- Dust generation '- Degradation to fauna and flora '- Water exposed areas when visible dust is observed - Visual Dust monitoring to occur daily to ensure controls are POEO Act RMS G38,
- Disturbance to - Where required, maintain communication with surrounding residents and business adequate G40 REF
Residential/ Commercial owners - Dust monitoring if complaints are received
- Dust Generation associated - Visual Dust monitoring - Air Quality & Dust Management Environmental Sub Plan
with subgrade stabilisation High - Adhere to sign posted speed limits - Install wind fences if appropriate Moderate
(road works) - Air Quality & Dust Management Procedure - Conduct regular weather checks
- Environmental Management Plan Air Quality & Dust
Road construction Plant operating / adjacent Noise and vibration Noise and vibration leading to Plant & equipment maintained and serviced to OEM, defects reports and addressed. Maintain communication with surrounding residents and Work Health & Safety Act 2011
road traffic movements / industrial hearing loss / Plant & background noise levels routinely sampled to assess hazard and potential business owners. Advise local residents of commencement Work Health & Safety Regulation
earthworks disruption to the community impact on personnel. and duration of works, and if any out of hours work will 2017
/residents/Commercial and/or legal non- compliance. Minimal number of personnel to be within noise affected work areas / occur NSW CoP: Managing noise and
properties rotate tasks & personnel to account for TWA of exposure. Noise and vibration monitoring as set out in the N & V preventing hearing loss at
Work within allocated hours management plan work.
High - liaise with stakeholders Property conditions Surveys study NSW CoP: Managing the Moderate
- Any complaints registered and monitored through QHEST/ RMS PROCESS Fit and maintain appropriate mufflers on plant risk of plant in the
- Use quietest equipment where practically possible. Environmental Management Plan - Noise & Vibration workplace
- Noise & Vibration Management Environmental Sub Plan - Concrete & Masonry Cutting &
Management Plan Drilling - Code of Practice 2010
community liaison plan POEO Act
EPL Reporting requirements DEC interim
Road construction earthworks '- Dust generation '- Degradation to fauna and flora '- Water exposed areas when visible dust is observed
construction
POEO noise
Act RMS G38,
- Disturbance to - Where required, maintain communication with surrounding residents and business owners - Air Quality & Dust Management Environmental Sub Plan
Residential/ - Visual Dust monitoring -visual dust monitoring guidelines
G40 REF RMS G38
Commercial - Adhere to sign posted speed limits use water carts to provide dust suppression Assessing Vibration a technical
Moderate guideline NSW Low
- Dust Generation associated - Air Quality & Dust Management Procedure - Conduct regular weather checks and review wind forecast
with subgrade stabilisation - Environmental Management Plan Air Quality & Dust Management
(road works) Environmental Sub Plan
Road construction earthworks '- Noise and vibration - Noise and vibration disruption to -work within allocated hours - - Comply with EPL legislative requirements relating to working POEO Act
the community and/or legal non- - liaise with stakeholders periods, noise and vibration. DEC interim
compliance. - Any complaints registered and monitored through QHEST Advise local residents of commencement and duration of works, construction noise
- Use quietest equipment where practically possible. and if any out of hours work will occur guidelines EPL
- Noise & Vibration Management Plan - Noise and vibration monitoring as set out in the N & V RMS G38
Moderate management plan Assessing Vibration a technical Low
- Condition surveys required as per RMS spec guideline NSW EPA
- Fit and maintain appropriate mufflers on plant
- Environmental Management Plan - Noise & Vibration
Leadership walks & inspections to monitor standards
Road construction dewatering sediment basins water quality contamination of waterways - Follow EPL conditions for basin discharge limits and basin - Reuse water on site to irrigate, dust suppression etc POEO Act RMS G36
management Discharge water onto a stable surface - Environmental Management Plan - soil and Water Management RMS G38
'- Identify regulatory requirements before discharging Environmental Sub Plan
High - Assess water quality before discharging '- use a dewatering permit NSW Blue Book, Moderate
- Treat water before discharging where it does not meet the water quality objectives - test pH, Total Suspended Solids & Turbidity and treat to meets Landcom Managing
EPL discharge requirements Urban Stormwater
Hot Works '- Hot works '- Heat/ generation of sparks - Damage to Flora, Fauna and - Designate an area for hot works free from flammable and combustible items - Water carts/water tanks on standby EPL Act NPWS Act
POEO
from fire Prior to any hot works outside of the workshop area, high risk task permit to be - Create a buffer zone clear of debris
completed and approved (please obtain fire exemption from local authority) - Fire Warden Training
- Fire extinguishers located nearby - Hot works Permit
Moderate - Emergency Response Management Plan developed and in the event of a fire - Environmental Management Plan - Flora & Fauna Low
identified controls implemented Management Environmental Sub Plan
- Emergency Response Team Leader elected for project
- Emergency Response Team Leader trained in emergency procedure for fire events
Appendix A3
Environmental Policy
Appendix A4
Ancillary Facility Management Plan
Ancillary Facility Management Plan
The Northern Road Upgrade, between
Mersey Road and Eaton Road
Contents
1 INTRODUCTION............................................................................................................. 1
1.1 Background............................................................................................................. 1
1.2 Context ................................................................................................................... 1
1.3 Environmental Management System Overview ....................................................... 1
1.4 Consultation ............................................................................................................ 2
2 PURPOSE AND OBJECTIVES ....................................................................................... 3
2.1 Purpose .................................................................................................................. 3
2.2 Objectives and Targets ........................................................................................... 4
3 ENVIRONMENTAL REQUIREMENTS ............................................................................ 5
3.1 Relevant legislation and guidelines ......................................................................... 5
3.1.1 Minister’s Conditions of Approval ..................................................................... 6
4 ANCILLARY FACILITY DETAIL ...................................................................................... 9
4.1 EIS assessed ancillary facilities .............................................................................. 9
4.2 Main Compound ..................................................................................................... 3
4.3 Activities ................................................................................................................. 5
4.4 Plant and Equipment............................................................................................... 5
4.5 Timing and Duration................................................................................................ 1
4.6 Decommissioning and rehabilitation ........................................................................ 3
4.7 Ancillary Facilities not assessed in the EIS ............................................................. 3
5 ENVIRONMENTAL ASSESSMENT ................................................................................ 4
5.1 EIS assessment of ancillary facilities against CoA criteria ....................................... 4
5.2 Environmental aspects and impacts ........................................................................ 6
5.3 Flora and Fauna ..................................................................................................... 7
5.4 Soil and Water ........................................................................................................ 9
5.5 Flooding ................................................................................................................ 10
5.6 Heritage ................................................................................................................ 10
5.7 Noise .................................................................................................................... 13
5.7.1 Temporary acoustic barriers .......................................................................... 17
5.8 Vibration ............................................................................................................... 20
5.9 Traffic and Access ................................................................................................ 21
5.10 Visual .................................................................................................................... 22
5.11 Air Quality ............................................................................................................. 23
5.12 Community Consultation ....................................................................................... 23
6 ENVIRONMENTAL MITIGATION MEASURES ............................................................. 24
7 COMPLIANCE MANAGEMENT .................................................................................... 39
The Northern Road Upgrade, Between Mersey Road and Eaton Road
Ancillary Facility Management Plan 2
7.1 Roles and responsibilities ..................................................................................... 39
7.2 Training................................................................................................................. 39
7.3 Monitoring and inspections ................................................................................... 39
7.4 Auditing................................................................................................................. 39
7.5 Incident Management ........................................................................................... 40
7.6 Complaints Management ...................................................................................... 40
7.7 Reporting .............................................................................................................. 40
7.8 Ongoing risk analysis ............................................................................................ 40
8 REVIEW AND IMPROVEMENT .................................................................................... 41
8.1 Continuous improvement ...................................................................................... 41
8.2 AFMP update and amendment ............................................................................. 41
Appendices
Appendix A - Roads and Maritime leased land
Appendix B - Ancillary facilities assessment criteria for facilities not assessed in the EIS
Appendix C - Evidence of consultation
Appendix D - Unexpected Discovery of Contaminated Land Procedure
Appendix E - Roads and Maritime Unexpected Heritage Items Procedure
Glossary / Abbreviations
AFMP Ancillary Facilities Management Plan

A temporary facility for construction of the project including an
office and amenities compound, construction compound,
material crushing and screening plant, materials storage
compound, maintenance workshop, testing laboratory and
Ancillary Facility material stockpile area
Where an approved CEMP contains a stockpile management
protocol, a material stockpile area located within the construction
footprint is not considered to be an ancillary facility
CEMP Construction Environmental Management Plan
CCS Community Communication Strategy
CMS Complaint Management System
Compliance audit Verification of how implementation is proceeding with respect to

a environmental management plan (EMP) (which incorporates
the relevant approval conditions)
NSW CoA Conditions of approval in the NSW Infrastructure Approval SSI

7127
DoEE Commonwealth Department of the Environment and Energy
DP&E NSW Department of Planning and Environment
DPI NSW Department of Primary Industries
Ecologically sustainable Using, conserving and enhancing the community’s resources so

development that the ecological processes on which life depends are
maintained and the total quality of life now and in the future, can
be increased (Council of Australian Governments, 1992).
EEC Endangered Ecological Communities
EIS Environmental Impact Statement
EMP Environmental Management Plan
EMS Environmental Management System
Environmental aspect Defined by AS/NZS ISO 14001:2004 as an element of an

organisation’s activities, products or services that can interact
with the environment.
Environmental impact Defined by AS/NZS ISO 14001:2004 as any change to the

environment, whether adverse or beneficial, wholly or partially
resulting from an organisation’s environmental aspects.
Environmental incident An unexpected event that has, or has the potential to, cause
harm to the environment and requires some action to minimise
the impact or restore the environment.
Environmental objective Defined by AS/NZS ISO 14001:2004 as an overall

environmental goal, consistent with the environmental policy,
that an organisation sets itself to achieve.
Environmental policy Statement by an organisation of its intention and principles for

environmental performance.
Environmental target Defined by AS/NZS ISO 14001:2004 as a detailed performance

requirement, applicable to the organisation or parts thereof, that
arises from the environmental objectives and that needs to be
set and met in order to achieve those objectives.
Environmental A suitably qualified and experienced person independent of

Representative (ER) Project design and construction personnel employed for the
duration of construction. The principal point of advice in relation
to all questions and complaints concerning environmental
performance.
EP&A Act Environmental Planning and Assessment Act 1979
EPA Environment Protection Authority
EPBC Act Environment Protection and Biodiversity Conservation Act 1999
EPL Environment Protection Licence under the Protection of the

Environment Operations Act 1997.
Federal CoA Conditions of approval listed in Commonwealth approval EPBC

2016/7696
GEJV Georgiou, Ertech Joint Venture
GMS Georgiou Management System
Minister, the Minister for Planning NSW
Non-compliance Failure to comply with the requirements of the Project approval

or any applicable license, permit or legal requirements.
Non-conformance Failure to conform to the requirements of Project system

documentation including this CEMP or supporting
documentation.
NOW NSW Office of Water
OACEMP The Northern Road Upgrade – Mersey Road, Bringelly to

Glenmore Parkway, Glenmore Park Overarching Construction
Environmental Management Plan 2018
OEH NSW Office of Environment and Heritage
OOH Out of Hours (works outside standard work hours)
SPIR Submissions Preferred Infrastructure Report
PoEO Act Protection of the Environment Operations Act 1997
Project, the The Northern Road Upgrade between Mersey Road and Eaton
Road
SAP Sensitive Area Plans
Secretary Secretary of the Department of Planning and Environment
SSI State Significant Infrastructure
1 INTRODUCTION
1.1 Background
The project involves the realignment of 5.5km of The Northern Road (TNR) around the
Western Sydney Airport site with the construction of a four lane divided road and the
adjustment of public utilities. The project is contractually known as between Mersey Road and
Eaton Road of the Northern Road upgrade and one of three stages that has been assessed
under the same planning approvals (NSW Infrastructure Approval SSI7127 and EPBC
2016/7696). The planning approvals cover a 16km section of The Northern Road Upgrade
between Mersey Road, Bringelly and Glenmore Parkway, Glenmore Park.
A single Environmental Impact Statement (EIS) was prepared for the Project to satisfy the
environmental assessment requirements of both Part 5.1 of the EP&A Act and Part 8 of the
EPBC Act.
An Overarching Construction Environmental Management Plan (OACEMP) has been
developed by Roads and Maritime to address the NSW and Federal conditions of approval
and the management measures presented in the Final EIS and Submissions and Preferred
Infrastructure Report (SPIR).
1.2 Context
This Ancillary Facilities Management Plan (AFMP) forms part of the Construction
Environmental Management Plan (CEMP) for the Northern Road Upgrade, between Mersey
Road and Eaton Road Project (the Project).
This Management plan has been prepared to address the requirements of the Minister’s
Conditions of Approval (CoA) A16, the Roads and Maritime OACEMP, the mitigation and
management measures listed in the EIS and SPIR and all applicable legislation.
Ancillary facilities are defined in the Conditions of Approval (CoA) as:
“A temporary facility for construction of the project including an office and amenities
compound, construction compound, material crushing and screening plant, materials storage
compound, maintenance workshop, testing laboratory and material stockpile area.”
The definition in the Approval notes that: “Where an approved CEMP contains a stockpile
management protocol, a material stockpile area located within the construction footprint is not
considered to be an ancillary facility.”
As a stockpile management protocol is a component of the TNR between Mersey Road and
Eaton Road CEMP Appendix A1 - Soil and Water management sub plan, material stockpile
areas are not included in the definition of Ancillary Facilities for the Project.
1.3 Environmental Management System Overview

The overall Environmental Management System (EMS) for the Project is described in the
GEJV Construction Environmental Management Plan (CEMP).
Mitigation and management measures identified in this plan will be incorporated into site or
activity specific Environmental Work Method Statements (EWMS). EWMS will be developed
and signed off by environment and management representatives prior to associated works
and construction personnel will be required to undertake works in accordance with the
identified mitigation and management measures.
Used together, the CEMP, strategies, procedures and EWMS form a project management
system that identifies the required environmental management actions for Georgiou/Ertech
Joint Venture (GEJV) personnel and contractors.
1.4 Consultation
This AFMP has been developed in consultation with the EPA and local Council (Liverpool
City Council).
In accordance with CoA A6 and A8, evidence of consultation during the preparation of this
AFMP is provided in Appendix C. GEJV will carry out ongoing consultation with the EPA and
Council regarding issues relevant to ancillary facilities throughout Construction of the
Project.
All community consultation will occur in accordance with the Community Communication
Strategy (CCS).
2 PURPOSE AND OBJECTIVES
2.1 Purpose
The general process for establishing new ancillary facilities in an active construction zone
within the approved Project footprint is described in Section 2.3 of the Construction
Environmental Management Plan (CEMP) and is shown in Figure 2-1 below.
Figure 2-1 Ancillary facilities approval pathway
The Environmental Impact Statement (EIS) for the Project identified a number of compounds
and ancillary facilities that would be required for the construction of the Project, including
locations for hardstand areas, temporary building and offices, parking areas, material
laydown and storage areas. GEJV only intends to use areas that have already been
assessed by the EIS for ancillary facilities.
A description of the ancillary facilities assessed in the EIS is provided in Section 4. Section
5 outlines the aspects and impacts and section 6 the proposed environmental management
measures for the assessed ancillary facilities.
Section 4 details the ancillary facility assessment for ancillary facilities that are not identified
by description and location in the EIS.
2.2 Objectives and Targets
The key objective of the AFMP is to ensure that the potential impacts to the environment and
community are minimised and within the scope permitted in the specifications and the NSW
Infrastructure Approval. To achieve this objective, the following measures will be undertaken:
 Ensure appropriate controls and procedures are implemented during construction
activities to avoid or minimise real and potential impacts to the environment and
sensitive receivers along the Project corridor.
 Ensure appropriate measures are implemented to address the requirements specified
by Roads and Maritime Services, the Environment Representative, NSW Department
of Planning and Environment and other relevant NSW Agencies.
 Ensure appropriate measures are implemented to comply with all relevant legislation
and other requirements as described in Section 3.1 of this plan.
The following targets have been established for the management of impacts resulting from
operation of the ancillary facility sites during the Project:
 Ensure compliance with the relevant legislative requirements, Ministerial Conditions of
Approval and those contained in the EIS and Roads and Maritime’ QA Specification
G1, G2-C2, G36, G38 and the OACEMP.
 Minimise any impacts on the surrounding residents and businesses and other sensitive
receivers.
3 ENVIRONMENTAL REQUIREMENTS
3.1 Relevant legislation and guidelines
Legislation relevant to the management of ancillary facilities includes:
 Environment Protection and Biodiversity Conservation Act 1999 (EPBC Act)
 Environmental Planning and Assessment Act 1979 (EP&A Act)
 Protection of the Environment Operations Act 1997 (POEO Act)
 Protection of the Environment Operations (General) Regulation 2009
 Environmentally Hazardous Chemicals Act, 1985
 Pesticide Act 1999
 Contaminated Land Management Act 1997 (CLM Act)
 Waste Management Waste Avoidance and Resource Recovery Act 2001 (WARR Act)
 National Parks and Wildlife Act 1974 (NPW Act)
 Biodiversity Conservation Act 2016 (BC Act).
The main guidelines, specifications and policy documents relevant to this Plan include:
 Roads and Maritime QA Specification G1 – General requirements.
 Roads and Maritime QA Specification G2-C2 – General requirements (major
contracts).
 Roads and Maritime QA Specification G36 – Environmental Protection.
 Roads and Maritime QA Specification G38 – Soil and Water Management.
 Roads and Maritime QA Specification R44 – Earthworks
 Stockpile Site Management Guideline, Roads and Maritime 2015.
 The Northern Road Upgrade – Mersey Road, Bringelly to Glenmore Parkway,
Glenmore Park OACEMP 2018
 Interim Construction Noise Guideline (DECC, 2009)
 Roads and Maritime Construction noise and vibration guidelines (CNVG) (Roads and
Maritime, 2016)
 EPA Waste Classification Guidelines (EPA, 2014)
 Biodiversity Guidelines: Protecting and managing biodiversity on RTS Projects (Roads
Traffic Authority, 2011)
 Managing Urban Stormwater: Soils and Construction (4th Edition) Volume 1
(Landcom, 2004) (the “Blue Book”)
 German Standard DIN 4150-3 4150-3 (1999-02) - Structural vibration - Effects of
vibration on structures (Deutsches Institute fur Normung, 1999)
 British Standard BS 7385-2:1993 Evaluation and measurement for vibration in
buildings. Guide to damage levels from ground borne vibration.
 Assessing vibration: a technical Guideline (DEC, 2006)
The management of the ancillary facility must comply with the Northern Road Upgrade NSW
CoA relevant for between Mersey Road and Eaton Road.
3.1.1 Minister’s Conditions of Approval
The CoA relevant to this plan are listed in Table 3-1. A cross reference is also included to
indicate where the condition is addressed in this assessment or other Project management
documents.
Table 3-1 Conditions of Approval relevant to the AFMP
CoA Condition Requirements Compliance /

No. Reference within
this document
A15 Ancillary facilities that are not identified by description and location Yes. There are
in the documents listed in Condition A1 must meet the following currently no
criteria, unless otherwise approved by the Secretary: proposed
(a) the facility is development of a type that would, if it were not for ancillary facilities
the purpose of the CSSI, otherwise be exempt or complying for the project
development; or other than those
assessed in the
EIS. Refer section
4.7.
(b) the facility is located as follows: Yes. There
i. at least 50 metres from any waterway unless an erosion and currently no
sediment control plan is proposed
ancillary facilities
prepared and implemented so as not to adversely affect water
for the project
quality in the waterway in accordance with Managing Urban
other than those
Stormwater series;
assessed in the
ii. within or adjacent to land upon which the CSSI is being carried EIS. Refer section
out; 4.7.
iii. with ready access to a road network;
iv. to prevent heavy vehicles travelling on local streets or through
residential areas in order to access the facility, except as identified
in the documents listed in Condition A1;
v. so as to be in accordance with the Interim Construction Noise
Guideline (DECC 2009) or as otherwise agreed in writing with
affected landowners and occupiers;
vi. so as not to require vegetation clearing beyond the extent of
clearing approved under other terms of this approval except as
approved by the ER as minor clearing;
vii. so as not to have any impact on heritage items (including areas
of archaeological sensitivity) beyond the impacts identified,
assessed and approved under other terms of this approval;
viii. so as not to unreasonably interfere with lawful uses of adjacent
properties that are being carried out at the date upon which
construction or establishment of the facility is to commence;
ix. to enable operation of the ancillary facility during flood events
and to avoid or minimise, to the greatest extent practicable,
adverse flood impacts on the surrounding environment and other
properties and infrastructure; and
x. so as to have sufficient area for the storage of raw materials to
minimise, to the greatest extent practicable, the number of
deliveries required outside standard construction hours.
CoA Before establishment of any ancillary facility (other than minor This AFMP
A16 ancillary facilities described in Condition A17), the Proponent must
prepare an Ancillary Facilities Management Plan which details the
management of the ancillary facilities. The Ancillary Facilities
this document
Management Plan must be prepared in consultation with the EPA
and the relevant council(s) and submitted to the Secretary for
approval one month prior to installation of ancillary facilities. The
Ancillary Facilities Management Plan must detail the management
of the ancillary facilities and include:
(a) a description of activities to be undertaken during Construction Section 4.3
(including scheduling of construction);
(b) a program for ongoing analysis of the key environmental risks Section 4.5
arising from the activities described in subsection (a) of this Section 7
condition, including an initial risk assessment undertaken prior to
OACEMP section
the commencement of Construction of the CSSI; and
4.3.2
(c) details of how the activities described in subsection (a) of this Section 6
condition will be carried out to:
i. meet the performance outcomes stated in the documents listed
in Condition A1; and
ii. manage the risks identified in the risk analysis undertaken in
subsection (b) of this condition.
CoA Minor ancillary facilities comprising lunch sheds, office sheds, and Section 4.7
A17 portable toilet facilities, that are not identified in the documents
listed in Condition A1 and which do not satisfy the criteria set out in
Condition A15 of this approval must satisfy the following criteria:
(a) have no greater environmental and amenity impacts than those Section 4.7
that can be managed through the implementation of environmental
measures detailed in the CEMP required under Condition C1 of
this approval; and
(b) have been assessed by the ER to have: Section 4.7
i. minimal amenity impacts to surrounding residences and
businesses, after consideration of matters such as compliance with
the ICNG, traffic and access impacts, dust and odour impacts, and
visual (including light spill) impacts;
ii. minimal environmental impact with respect to waste
management and flooding; and
iii. no impacts on biodiversity, soil and water, and heritage items
beyond those already approved under other terms of this approval.
CoA Boundary fencing must be erected around all ancillary facilities that Section 5.7
A18 are adjacent to sensitive receivers for the duration of Construction
unless otherwise agreed with the affected receivers(s).
CoA Boundary fencing required under Condition A18 of this approval Section 5.7
A19 must minimise visual, noise and air quality impacts on adjacent
sensitive receivers.
CoA Construction vehicles arriving at the project site and construction Section 4.5
E28 compounds outside the standard construction hours described in
Condition E23 must not queue with idling engines.
CoA Temporary acoustic barriers (2.4 metres high) are to be installed Section 5.7.1
E31 as soon as site establishment works at the ancillary facility are
completed and before undertaking any works which are required to
be conducted at the facility. The schedule for installing and
removing the acoustic barriers, and justification for not installing
this document
acoustic barriers in certain locations, must be described in the
Ancillary Facilities Management Plan for the project prepared in
accordance with Condition A16. Acoustic barriers must be
inspected and maintained to remain effective throughout the use of
the construction compound.
4 ANCILLARY FACILITY DETAIL
4.1 EIS assessed ancillary facilities
The Environmental Impact Statement (EIS) for the Project identified a number of compounds
and ancillary facilities that would be required for the construction of the Project, including
locations for hardstand areas, temporary building and offices, parking areas, material laydown
and storage areas. The location of the ancillary facilities assessed in the EIS is provided in
Figure 4-1 and their key features shown in Table 4-1. Section 2 outlines the key features,
aspects and impacts and proposed environmental management measures for the assessed
ancillary facilities.
Figure 4-1 Locations of Ancillary Facilities assessed in the EIS and used for the project
Table 4-1 Proposed use of EIS approved ancillary facility areas
Location Purpose EIS proposed activities GEJV proposed activities
C1 Materials Storage of pits, pipes and This is currently used by TNR 2
storage culvert material. and is not in TNR 4 project
boundary. GEJV does not intend
No stockpiling of earthworks.
to use this area.
C1 are subject to lease
agreement
C2 Materials Storage of pits, pipes and This is currently used by TNR 2
storage culvert material. and is not in TNR 4 project
boundary. GEJV does not intend
No stockpiling of earthworks.
to use this area.
C2 are subject to lease
agreement
C3 Sediment Stockpiling and laydown of
Basins materials only to occur here
following approval of the CEMP
stockpile management protocol
and noise and vibration
management plan.
Possible minor ancillary facility
to be approved during
construction by the ER under
CoA A17. C3 are subject to
lease agreement
C4 Materials The site would consist of a Stockpiling and laydown of

storage, shed, lunch room, portable materials only to occur here
stockpiling, toilets and parking. following approval of the CEMP
Sediment stockpile management protocol
Storage of items such as
Basins and noise and vibration
concrete pits, pipes and
management plan.
culverts.
Could be used to stockpile
topsoil, mulch and drainage
backfill materials.
CoA A17.
C5 Materials Storage of concrete pits, pipes Stockpiling and laydown of
storage, and culverts. materials only to occur here
Partially stockpiling, following approval of the CEMP
located on Sediment stockpile management protocol
Commonwealth Basins and noise and vibration
backfill materials.
land associated management plan.
with (leased by
Roads and
Maritime) the
Western
CoA A17.
Sydney Airport.
Location Purpose EIS proposed activities GEJV proposed activities
stockpiling following approval of the CEMP
backfill materials.
management plan.

Partially
stockpiling following approval of the CEMP
located on Could be used to stockpile
Commonwealth topsoil, mulch and drainage
land associated backfill materials.
management plan.
with the
Western Possible minor ancillary facility
Sydney Airport. to be approved during
CoA A17.
C8 Staff Main compound. Main Compound site for GEJV

amenities, and Roads and Maritime. It
The site would consist of office
shed and would include toilets, amenities,
facilities for the contractor and
parking car parking, a shed and lunch
Roads and Maritime. It would
room.
Materials include toilets, amenities, car
storage, parking, a shed and lunch room. Storage of concrete pits, pipes
stockpiling and culverts.
Storage of concrete pits, pipes
and culverts. Stockpile of topsoil and mulch
and drainage backfill materials.
Stockpile of topsoil and mulch
and drainage backfill materials.
.
4.2 Main Compound

Of all the ancillary areas assessed in the EIS for the project the area proposed for the main
site compound is at C8. Other ancillary areas where leased by Roads and Maritime (see
Appendix A) will be used for stockpiling of materials or minor ancillary facilities as detailed in
Table 4-1.
The proposed location of the main compound is located adjacent to the new The Northern
Road alignment at the Northern extent of between Mersey Road and Eaton Road, this area
has been assessed in the EIS and has been leased by Roads and Maritime (see Appendix
A). The leased land (Lot 1 DP250030) has been previously used for agricultural purposes and
has been leased by Roads and Maritime for the duration of the Project construction.
The EIS included an indicative layout for the main ancillary facility and location, this is shown
in Figure 4-2. GEJV has further refined the layout of the main ancillary facility and has reduced
footprint required, this has in turn reduced impacts of the operation of the ancillary facility
including increasing buffer distances to the nearest residential receivers, see Figure 4-3. The
proposed main compound area (Lot 1 DP250030) will include:
 Office facilities
 Car park for light vehicles and heavy vehicles
 Ablution facilities
 Chemical storage
 Material stockpiles and storage
 Erosion and sediment controls
 Boundary fencing
 Temporary storage and stockpiling of earthworks and pavement material
 Plant and equipment will be refuelled with fuel truck coming to site on an as required
basis.
 There will be no static mechanical workshop on site.
Figure 4-2 EIS map of location and layout of main compound at ancillary area C8
Figure 4-3 GEJV proposed refined main compound layout at ancillary area C8
4.3 Activities
Activities to be carried out at the main facility will generally include:
 Pre-start meetings/toolbox talks and site meetings
 Primary location for the removal of waste materials (Putrescible, recyclable (Paper &
Cardboard) and septics)
 Emergency evacuation point
 Parking of heavy (for delivery only) and light vehicles
 Storage of fuels and chemicals
 Stockpiling of procured materials (Pipe, small precast products, fittings etc)
Materials
 Geofabric Rolls
 Pre cast concrete units (e.g. culverts)
 PVC and poly pipe
 Bedding sand
4.4 Plant and Equipment

Light vehicles will use the site on a daily basis. Heavy vehicles will deliver construction
materials to the site and will sometimes be parked at the site. Small power tools will be used.
Indicative plant, equipment and material to be stored at the ancillary site are listed below;
Plant
 Heavy vehicles (for deliveries only)
 Light vehicles
Plant (Ancillary Facility set up)
 Grader
 Dozer
 Excavator
 Water Cart
 Rollers
 Trucks
 Concrete trucks
Equipment
 Generator (until main power is connected, will not be operated outside normal work
hours)
 Hand tools; plate compactors, drills, shovels, etc.
 Ablution blocks
All the above plant will be used for the site establishment only and equipment listed will be
used during the operation of C8.
Storage of hazardous and dangerous goods
 6m x 3m self bunded dangerous goods container, the bund capacity will be 120% of
the largest stored container
 Concrete curing chemicals (any IBCs to be bunded with 110% capacity)
 Paints
 Adhesives
 Cleaning products
 There will be no fuel cell on site, refuelling will be completed with tankers on an as
required basis. The fuels are in 20ltr jerry cans for small motors
Waste Storage
 Lidded skip bins for putrescible, recyclable and office waste to prevent pests and
vermin.
 Open skip bins to store construction wastes.
 Sewage storage tanks at ablution facility – these will have high level alarms set at 80%
capacity.
 Licenced waste transporters will be used to remove wastes from site to an
appropriately licenced facility and all waste tipping dockets and tracking dockets will
be retained on site.
Waste bulk materials like excavated soils, demolition wastes will be temporarily stored
at the stockpile area until they are classified under the NSW EPA waste classification
guidelines and removed from site to licenced facility.
4.5 Timing and Duration

Ancillary areas and the main compound site will be established and commence operation once
approval is granted by the ER, DPE and Roads and Maritime. There are pre-establishment
activities that will occur prior to approval and these include; pre clearing ecology surveys, pre-
construction land condition assessments, Aboriginal heritage and non-Aboriginal heritage
salvage, stage 2 contamination assessments (completed by Roads and Maritime) and
advance contamination assessment for topsoil stripping. All the activities associated with pre
establishment, establishment and operation of the ancillary facilities will occur during the
approved construction hours and conditions associated with noise as per CoA E23 – E31, as
follows:
CoA E23 Standard construction hours
a) 7.00am to 6.00pm, Monday to Friday (C8 will adhere to these hours)
b) 8.00am to 1.00pm on Saturdays; and (C8 will adhere to these hours)
c) At no time on Sundays or public holidays. (C8 will adhere to these hours)
There are no OOHW expected to be required during the site establishment or operation of C8.
CoA E24 Highly noise intensive activities
Except as permitted by an EPL, highly noise intensive works that result in an exceedance of
the applicable noise management level at the same receiver must only be undertaken:
a) between the hours of 8:00 am to 6:00 pm Monday to Friday;
b) between the hours of 8:00 am to 1:00 pm Saturday; and
c) in continuous blocks not exceeding three hours each with a minimum respite from
those activities and works of not less than one hour between each block.
For the purposes of this condition, 'continuous' includes any period during which there is less
than a one-hour respite between ceasing and recommencing any of the work the subject of
this condition. There is no highly intensive noise activities expected to occur during the site
establishment and/or operation of C8.
CoA E25 Community Consultation
The Proponent must identify and consult with receivers identified as being subject to levels
that exceed the Highly Noise Affected criteria with the objective of determining appropriate
hours of respite unless an agreement is reached with those receivers.
CoA E26 Out of hours work
Notwithstanding Condition E23 works associated with the CSSI may be undertaken outside
the specified hours in the following circumstances:
a) for the delivery of materials required by the NSW Police Force or other authority for
safety reasons; or
b) where it is required in an emergency to avoid injury or the loss of life, to avoid damage
or loss of property or to prevent environmental harm; or
c) where it causes LAeq (15 minute) noise levels:
i. no more than 5 dB(A) above the rating background level at any residence in
accordance with the Interim Construction Noise Guideline (DECC, 2009), and
ii. no more than the noise management levels specified in Table 3 of the Interim
Construction Noise Guideline (DECC, 2009) at other sensitive land uses, and
iii. continuous or impulsive vibration values, measured at the most affected
residence are no more than those for human exposure to vibration, specified in
Table 2.2 of Assessing Vibration: a technical guideline (DEC, 2006), and
iv. intermittent vibration values measured at the most affected residence are no
more than those for human exposure to vibration, specified in Table 2.4 of
Assessing Vibration: a technical guideline (DEC, 2006); or
d) no more than 15 dB(A) above the night time rating background level at any residence
during the night time period, when measured using the LAeq (1 minute) noise
descriptor; or
e) where different hours are permitted or required under an EPL in force in respect of the
works, in which case those hours must be complied with.
CoA E27 Emergency works notification
On becoming aware of the need for emergency works in accordance with Condition E26 the
Proponent must notify the ER and the EPA (if an EPL applies) of the need for those works.
The Proponent must also use its best endeavours to notify all affected sensitive receivers of
the likely impact and duration of those works.
CoA E28 Queuing and Idling Construction Vehicles
Construction vehicles arriving at the project site and construction compounds outside the
standard construction hours described in Condition E23 must not queue with idling engines.
CoA E29 Respite
The Proponent must consult with potentially affected community, religious, educational
institutions and noise and vibration-sensitive businesses to identify periods during which they
would be adversely affected by noise generating works, and must not schedule those works
during those periods unless the Proponent and the potentially affected institution or business
have made other arrangements (at no cost to the affected receiver), or the Secretary has
otherwise approved the works.
CoA E30 Cumulative Construction Noise Impacts
The Proponent must ensure that all works for the delivery of the CSSI are coordinated with
utility works, including those works undertaken by third parties, to minimise cumulative impacts
of noise and vibration and to maximise respite for affected sensitive receivers.
CoA E31 Ancillary Facility Acoustic Barriers
Temporary acoustic barriers (2.4 metres high) are to be installed as soon as site establishment
works at the ancillary facility are completed and before undertaking any works which are
required to be conducted at the facility. The schedule for installing and removing the acoustic
barriers, and justification for not installing acoustic barriers in certain locations, must be
described in the Ancillary Facilities Management Plan for the project prepared in accordance
with Condition A16. Acoustic barriers must be inspected and maintained to remain effective
throughout the use of the construction compound.
4.6 Decommissioning and rehabilitation

Decommissioning and rehabilitation of the ancillary facility (main compound and all other
ancillary areas) will be undertaken as part of the finishing works towards the end of the
construction program in late 2020 and will include the following activities;
 Removal of all fencing, signage and temporary structures
 Site clean-up and disposal of all surplus materials
 Stabilisation and re-vegetation of the sites as per Urban Design and Landscape Plan.
 Reinstatement of all leased areas to the pre-existing condition unless otherwise agreed
by the land holder.
After restoration of the areas to pre-existing condition or better, a post-construction land

condition assessment will occur by an independent environmental consultant. This will assess
the land against pre-existing contamination or waste issues identified in the pre-construction
land condition assessment.
4.7 Ancillary Facilities not assessed in the EIS

GEJV does not intend to establish ancillary facilities in areas that have not been assessed in
the EIS. Where ancillary areas are proposed in areas other than those detailed in Table 4-1,
they must be assessed against and meet the criteria listed in the Ancillary facilities
assessment criteria (Appendix B) and be included in this AFMP unless otherwise approved
by the Secretary, in accordance with NSW-CoA A15. In the event of additional ancillary
facilities being proposed that have not been assessed in the EIS/SPIR, these facilities would
have to be assessed in accordance with conditions A15 or A17, depending on the nature of
the ancillary facilities.
For minor ancillary facilities include offices, sheds and staff amenities that are not identified
in the EIS they must also be assessed against and meet the criteria (Appendix B). In
accordance with the responsibilities of the ER set out in CoA A17, the ER can assess the
impacts of minor ancillary facility. The ER will use Ancillary facilities assessment criteria
(Appendix B) for facilities not assessed in the EIS.
Any future additional ancillary facilities will be detailed in an updated AFMP for assessment
and approval purposes.
5 ENVIRONMENTAL ASSESSMENT
5.1 EIS assessment of ancillary facilities against CoA criteria

The ancillary facilities identified in the EIS & G1 were assessed in accordance with the
location criteria included in the Critical SSI Standard Conditions of Approval.
These standard conditions have been developed to help infrastructure providers understand
the types of conditions likely to be applied to State significant infrastructure projects if they
are approved, including conditions related to locating ancillary facilities. The criteria used for
the EIS assessment is generally the same as the criteria in the NSW Infrastructure Approval
for the Project under NSW CoA A15 (b)(i-x). The only exception is criterion (e) on level land
which is within the standard conditions of approval, but not within the final NSW
Infrastructure Approval (SSI-7127).
In accordance with NSW COA A15, if any ancillary facilities not already identified in the EIS
and SPIR are proposed, these facilities will be assessed against the criteria listed in NSW
CoA A15 (b)(i-x) (Appendix B). The criteria used in the EIS assessment of ancillary facilities
are as follows:
(a) At least 50 m from a waterway unless an erosion and sediment control plan is
prepared and implemented so as not to affect water quality in the waterway in
accordance with Managing Urban Stormwater series
(b) Within or adjacent to land where the critical state significant infrastructure is being
carried out
(c) With ready access to a road network
(d) So as to avoid the need for heavy vehicles to travel on local streets or through
residential areas in order to access the facility
(e) On level land
(f) So as to be in accordance with the Interim Construction Noise Guidelines (DECC,
2009) or as otherwise agreed in writing with affected landowners and occupiers
(g) So as not to require vegetation clearing beyond the extent of clearing approved under
other terms of this approval except as approved by the ER as minor clearing
(h) So as not to have any impact on heritage items (including areas of archaeological
sensitivity) beyond the impacts identified, assessed and approved under other terms
of this approval
(i) So as not to affect lawful uses of adjacent properties that are being carried out at the
date upon which construction or establishment of the facility is to commence
(j) To enable operation of the ancillary facility during flood events referred to in Section
8.1 and to avoid or minimise, to the greatest extent practicable, adverse flood
impacts on the surrounding environment and other properties and infrastructure
(k) So as to have sufficient area for the storage of raw materials to minimise, to the
greatest extent practicable, the number of deliveries required outside standard
construction hours.
The results of the assessment of each proposed ancillary facility against the EIS assessment
criteria above is summarised in Table 5-1.
Table 5-1 EIS assessment of proposed ancillary facilities against criteria in standard conditions
of approval
Compound Ancillary facility site location criteria
location
(a) (b) (c) (d) (e) (f) (g) (h) (i) (j) (k)
C1 Y Y Y Y Y No Y Y Y Y Y
C5 Y Y No Y Y Y* Y Y Y Y Y
C6 Y Y No Y Y Y Y Y Y Y Y
C8 Y Y Y Y Y No* Y Y Y Y Y
*Preferred locations for pug mill
Some of the proposed ancillary facilities for the Northern Road between Mersey Road and
Eaton Road would not meet some of the specified criteria specifically criteria (c) and (f).
Further assessment of these sites against these specific criteria is provided in Table 5-1,
including proposed management measures and justification for proposing these sites.
Table 5-2 Proposed mitigation measures for criteria not met

Criteria Proposed Management Measure
Applicable compound or laydown site(s)

C5, C6.
Additional assessment
c) With ready access There is no current road access to these sites. There would not be a
to a road network dedicated haul/access road constructed for these sites. Access to C5
and C6 will be via the mainline construction access to a suitable
access point on The Northern Road.
By not constructing a dedicated haul/access road, potential impacts
associated with clearing vegetation would be minimised. There
Criteria Proposed Management Measure
would also be fewer indirect impacts associated with dust and noise
emissions outside of the proposed construction footprint.
f) So as to be in Applicable compound or laydown site(s)
accordance with the All sites with the exception of C5 and C6.
Interim Construction
Additional assessment
Noise Guidelines
(DECC, 2009) or as There would be residential receivers located within 200 m of the
otherwise agreed in proposed construction compound and laydown sites. However, due
writing with affected to the predominantly rural-residential nature of the project area, the
landowners and site fencing as per CoA A-18 and the number of affected receivers
occupiers would be relatively low. GEJV has reduced the footprint of the main
ancillary facility at C8 and this has increased the distances to some
of the residential receivers. There also was introductory consultation
with the residents surrounding the facility.
Predicted worst case construction noise levels from the ancillary
facility C8 from daytime activities would comply with Noise
Management Levels (NMLs) for most receivers within the study area.
Where they do not comply, GEJV will install 2.4m acoustic barriers at
the ancillary boundary adjacent to the potentially affected receiver
(western boundary).
Predicted worst case construction noise levels from out of-hours
work would exceed night time NMLs at receivers within the study
area at some time, including noise as a result of construction activity
within ancillary facilities. Management measures to mitigate against
any predicted NML exceedances for out of-hours work are detailed in
section 5.7
All other Ancillary areas except for C8 (Main Compound) will be used
for stockpiling and laydown and would not be established until after
the CEMP is approved. The mitigation measures for these areas will
be covered by the CEMP stockpile management protocol and the
Construction Noise and Vibration Management Plan.
5.2 Environmental aspects and impacts

Establishment and operation of the ancillary facilities will result in a range of potential
construction noise, air (dust), biodiversity, traffic and visual impacts, including those
identified in Table 5-3 below.
Table 5-3 Environmental aspects and potential impacts
Environmental
Potential impacts
aspect
There is no requirement for tree removal as part of the main
compound (C8) ancillary facility.
Flora and fauna
Unapproved vegetation clearing
Disturbance or mortality of fauna during clearing works
Habitat loss, degradation, or fragmentation
Traffic impacts associated with heavy vehicle movements (e.g.
deliveries, heavy plant mobilisation, spoil and material haulage)
Traffic including potential conflicts with local traffic and increased congestion.
The high number of light vehicle movements at the certain times of the
day may also cause increased congestion.
Mobilisation of sediment laden/contaminated runoff entering
Erosion and waterways and drainage lines
sedimentation
Unauthorised offsite discharge.
Due to close proximity to neighbouring sensitive receivers during
compound/ancillary facility establishment and operation there is a
Noise and potential to impact with noise and vibration.
vibration Noise disturbance to sensitive receivers due to out of hours work
Noise generated by operation of facility and construction traffic
accessing facilities
Generation of dust emissions and odours from access roads and
Air quality transport of materials during facility establishment and operation.
Nuisance to local residents
Potential disturbance/destruction to identified heritage sites(Miss
Lawson’s Guesthouse)
Heritage
Impact to undiscovered or undocumented heritage sites
Unauthorised access to Heritage areas
Storage of
Accidental spills and leaks, resulting in pollution of waterways and
hazardous
soils (hydrocarbons, curing agents, septic waste).
substances
Generation of waste by site personnel using offices and staff amenities
Waste and Generation of waste during establishment of ancillary facilities
recycling disposed of incorrectly, e.g. recyclable materials being sent to landfill
and not meeting ISCA requirements.
Potential for site hoardings or other exposed surfaces to be vandalised
Potential for site lighting to affect the amenity of surrounding land uses
Visual amenity
Potential for waste to not be placed in appropriate bins and result in
litter around the construction worksites
Contaminated Potential for encountering previously undocumented contaminated
land material (i.e. ACM)
Direct land use impacts associated with the location of construction
Socio-economic compounds, temporarily disrupting use and access to land including
rural or vacant land, residential and commercial uses.
5.3 Flora and Fauna

Field surveys for the EIS identified vegetation within the assessed ancillary areas to provide
poor quality fauna habitat as it is agricultural pastureland. The only exceptions are ancillary
areas C2 and C8 as these areas contain Cumberland Plain Woodland (see Figure 5-2). As
detailed in table 4-1, area C2 is currently being used by TNR 2 and Georgiou does not intend
to use this area for TNR 4.
Ancillary area C8 includes a small area of Cumberland Plain Woodland in the western corner
and given that GEJV has reduced the footprint for this ancillary area it is not anticipated that
establishment of ancillary facility C8 will result in any direct impacts to this EEC and
subsequently any native flora or fauna. As this area of EEC falls directly under the design for
the new road alignment it will need to be cleared for construction of the new road. Given the
low habitat potential of the surrounding agricultural pastureland it is unlikely that noise,
vibration or light associated with the operation of ancillary facilities will have an adverse impact
on surrounding native flora and fauna.
The safeguards outlined in the Construction Flora and Fauna Management Sub Plan will apply
for the establishment and operation of all ancillary areas. The safeguards include; pre clearing
surveys, ongoing monitoring, erosion and sediment control, and rehabilitation will
appropriately manage the risks to flora and fauna associated with the ancillary facilities. A
summary of these mitigation measures are also detailed in Section 6 of this plan.
EEC
Area C8
EEC
Area C2
Figure 5-1 Threatened ecological communities
5.4 Soil and Water

The establishment and operation of the ancillary facility would result in clearing of grass and
topsoil, stockpiling of soils, stockpiling of pavement materials, chemical storage, and general
maintenance and refuelling of equipment and plant. The EIS did not identify any contaminates
of concern in any of the locations of proposed for ancillary facilities.
The potential impacts associated with these activities may include;
 Exposure of soils during earthworks, creating the potential for offsite transport of
eroded sediments and pollutants
 Exposure of unexpected contamination and asbestos during topsoil stripping and
earthworks, creating the potential to mobilise contaminants and contaminate other
areas.
 Increased turbidity of waterway due to exposure, erosion, runoff and dust propagation
 Contamination from site compounds, chemical storage areas and ablution facilities
 Fuel, chemicals, oils, grease and petroleum hydrocarbon spills from construction
machinery polluting the river and soils.
 Disturbance of unidentified contaminated land and subsequent generation of
contaminated runoff.
 Alteration of surface and subsurface flows that could cause disturbances to hydrology.
The Construction Soil and Water Management Sub – Plan and section 6 of this plan outline
proposed mitigation measures to manage these risks which include;
 Training of all project personnel on sound erosion and sediment control practices
 Development and implementation of erosion and sediment control plans
 Correct stockpile management
 Correct storage and handling of chemicals and hydrocarbons
 Spill response materials and procedures
 Controls and management for ablution facilities
 Contaminated Lands Unexpected Finds Procedure (Appendix D)
5.5 Flooding
In the Project EIS, a technical working paper (Appendix K) was prepared to assess the flooding
impacts associated with the construction and operation of the approved Project. The proposed
route of the project crosses a number of existing drainage lines along which a series of both
small and large dams are located. The EIS flood models show that high hazard flooding is
generally confined to the farm dams and the incised reaches of the drainage system which
are typically located downstream of the project corridor for events up to 100 year ARI. All the
ancillary facilities including the main compound area will maintain a 50m buffer distance to any
of the existing dams
5.6 Heritage
The potential impacts on Aboriginal heritage associated with the construction and operation
of the approved Project were assessed in the Project EIS. As detailed in section 5.1 and table
5.1, the ancillary areas have been assessed for impact on heritage items (including areas of
archaeological sensitivity).
The Ancillary facility C8 assessed within the EIS is within an area with a known Aboriginal
Heritage and non-Aboriginal Heritage site. The Aboriginal heritage site is TNR AFT 22 (Figure
5-3) and the non-Aboriginal Heritage site is Miss Lawson’s Guesthouse Site (Figure 5-4).
However, as GEJV has reduced the footprint for the ancillary area C8 it is not anticipated that
establishment of ancillary facility will result in any direct impacts to these known heritage items.
These known heritage sites will be fenced off and salvaged prior to construction occurring in
these areas. Both heritage sites are under the proposed new road alignment and can be
fenced off and avoided during establishment of the main compound area.
A clearance from the Project Archaeologist would be given stating that salvage has finished
in these areas prior to any disturbance occurring in these areas. All salvage areas are
considered to be exclusion zones until clearance has been provided.
Mitigation and management measures for heritage are detailed in the Construction Heritage
Management Plan and summarised in section 6. These include to follow Roads and Maritimes
unexpected finds procedure (Appendix E) should an item of cultural heritage be identified.
Figure 5-2 Location of identified Aboriginal heritage sites within the Project area
Figure 5-3 Location of Miss Lawson’s Guesthouse Site
5.7 Noise
The nearest sensitive receivers to the proposed main compound area are Properties in semi-
rural surrounds of Luddenham (identified as noise catchments 4 and 5 in the EIS). Existing
background noise to these receivers results from traffic on The Northern Road. Other ancillary
facilities south of along the proposed new road alignment are generally semi-rural properties
located adjacent to new section of the project with minimal exposure to traffic noise on The
Northern Road (identified as noise catchments 6, 7 and 8 in the EIS). Figure 5-4 below is from
the EIS Appendix H – Technical working paper: Noise & Vibration shows the relevant noise
catchments for the ancillary facilities.
Figure 5-4 Noise Catchments relevant to Ancillary Facilities
Based on measured noise levels described in Section 10.9 of Appendix H – Technical working
paper: Noise & Vibration, the project-specific construction noise management levels for the
noise catchment areas have been determined and are presented in Table 5-4.
Table 5-4 Project Noise Management Levels
Monitored or determined RBL Noise Management Level (NML)

dB(A) LAeq(15 minute) dB(A)
Sleep
disturbance
STD Hrs Out Of Hours (OOH)
screening
NCA (RBL (RBL+5dB)
criterion
+10dB)
LAmax dB(A)
STD OOH OOH OOH Day Day Evening Night (RBL+15dB)
HRS Day Evening Night NML NML NML NML
RBL RBL RBL RBL
4 37 38 38 37 47 43 43 42 52
5 42 44 43 34 52 49 48 39 49
6 42 44 43 34 52 49 48 39 49
7 37 38 38 37 47 43 43 42 52
8 48 53 47 42 58 58 52 47 57
The sound power level adopted for each item of plant and equipment in the EIS modelling of
construction noise for the ancillary facilities is indicated below in table 5-5.
Table 5-5 Plant sound power levels for ancillary facilities

Concurrently operating Ancillary Facilities
Area Typical plant and equipment Sound Power Level
dB(A) LAeq(15min)
Ancillary Facilities Front end loader 112
excluding C6 & C8 Excavator 109
Road truck 108
Compressor 109
Welding equipment 105
Light vehicles 88
Generator 101
Ancillary Facilities Front end loader 112

C6 & C8 Excavator 109
Road truck 108
Compressor 109
Welding equipment 105
Light vehicles 88
Generator 101
* Note: sound power level includes a 5dB (A) penalty for annoying noise characteristics
The predicted construction noise impacts from activities during the establishment and
operation of the ancillary facilities during standard construction hours to the affected residents
in the noise catchments has been undertaken in the EIS noise assessment and summarised
below in Table 5-6. This table indicates the worst case construction noise levels predicted for
the least and most affected residences.
Table 5-6 Predicted Noise impacts from Ancillary Facilities during Standard Hours
NCA NML Predicted noise levels Number of affected residents
Range of predicted noise levels (dB(A)) 46-60

complying 1
0-10 dBA above 14
Number of NML
4 47 Residence 10-20 dBA above 1
NML
20+ dBA above NML None
Highly noise None

≥75 dBA
affected
Complying 211
Number of 0-10 dBA above NML 12

5 52 Residence 10-20 dBA above NML 1
Highly noise
affected
≥75 dBA None

Complying 14
Number of 0-10 dBA above NML None

6 52 Residence 10-20 dBA above NML None
Highly noise
affected
≥75 dBA None

Complying 17
Number of 0-10 dBA above NML 2

7 47 Residence 10-20 dBA above NML None
Highly noise
affected
≥75 dBA None

8 58 Number of Complying 93
Residence 0-10 dBA above NML 12
10-20 dBA above NML None
Highly noise
affected
≥75 dBA None
It is anticipated that establishment and operation of all ancillary facilities will generally be
carried out during standard construction working hours in accordance with the CoA E23, and
Interim Construction Noise Guideline (DECC, 2009);
 7.00am to 6.00pm, Monday to Friday
 8.00am to 1.00pm on Saturdays; and
 At no time on Sundays or public holidays.
The delivery of oversized plant/equipment under road guidelines may be required to occur
outside of normal hours in accordance with CoA E26(a) however they will arrive to site and
engine shut off until after 7am where they will be unloaded within standard work hours.
From the EIS noise assessment it is evident that during standard construction hours within
most NCAs, it is expected that noise from the nearest ancillary facility (in isolation of noise
from any other mainline works) will comply with the NML. It may exceed the NML by up to 10
dB (A) at a small number of receivers (up to 12 receivers within NCA 5) when that facility is
operating at peak capacity. Additionally, one receiver in each of NCA 4 and NCA 5 may be
exposed to noise levels up to 20 dB(A) above the NML during times of peak operations.
As shown in Figure 5-3 GEJVs refinement of the ancillary area layout will increase buffer
distances to the nearest residential receivers. Considerations of these factors will reduce the
predicted noise levels and potential noise impacts determined in the EIS. Further detail on the
actual noise impacts with consideration to these measures are detailed in Section 5.7.1.
The only out of hours works that would occur at the main compound facility at C8 would be
office administrative related activities and these activities will not impact sensitive noise
receivers. It is not expected that loading or unloading of materials, processing of materials or
operation of plant will be required outside of standard hours at any of the ancillary areas. In
the unlikely event that out of hours works are required, they will be undertaken in accordance
with the EPL and the through the out-of-hours work procedure in the Construction Noise and
Vibration Management Plan.
The Construction Noise and Vibration Management Plan has been developed to detail noise
mitigation measures consistent with the EPL, Roads and Maritime’ CNVG, the EIS and the
OACEMP. The relevant noise mitigation measures associated with the ancillary facilities have
been summarised in section 6.
5.7.1 Temporary acoustic barriers

NSW CoA E31 requires that temporary acoustic barriers (2.4 metres high) are to be installed
prior to commencement of work and inspected and maintained throughout the use of the
ancillary sites, unless a justification for not installing acoustic barriers in certain locations, has
been described in this plan. The temporary acoustic barriers will be installed in accordance
with Figure 5-4.
The EIS assessed potential noise impacts from the main compound area which falls within the
noise catchment 4 (NCA 4). The nearest property is at the north east corner of the compound
site (105-106 Adams Road) is directly adjacent and within 50m from the site compound. As
detailed in Table 5-5 for NCA 4 the nearest residence (105-106 Adams Road) will experience
noise levels from the compound area 10-20 dBA above NML.
GEJV has further reduced the footprint of disturbance for the main ancillary facility at C8 as
shown in Figure 5-3 and 5-7.
A desktop assessment, using Roads and Maritime Services Noise Estimator Tool, was
undertaken to determine the potential impacts during operation of the facility to the nearest
receivers. This assessment has been used to determine required noise mitigation measures
including noise attenuation structures like hoarding. The recommended noise mitigation
measures derived from Noise Estimator Tool are aligned with recommendations in the Roads
and Maritime Construction Noise and Vibration Guideline 2016 and the Interim Construction
Noise Guideline (DECC, 2009). The results are summarised in Table 5-6 below. The noise
management levels (NML’s) have been adopted from the Project EIS working paper on Noise
and Vibration.
Table 5-2 Noise assessment for proposed main ancillary facility operation
Nearest Distance to Nearest Predicted Noise Recommended noise

Sensitive GEJV Ancillary Noise level Management mitigation measures
Receiver ancillary Activity (Figure (dBA) Level /dB(A)
facility (m) 5-6)
105-115 305m from Carpark 45 47 Predicted noise levels are

Adams carpark activities within the NMLs.
Road Standard noise mitigation
Parking of light
measures to be applied
vehicles for
as per table 6-1.
compound
office area
305m from OOHW 45 43 (evening) Out of Hours works only

carpark Compound to occur if compliant with
activities 42 (Night)
CoA in accordance with
the CoA E23, the EPL
Possible office
and the Interim
administrative
Construction Noise
work
Guideline (DECC, 2009).
Laydown and
Predicted noise levels
280m from storage
45 Adams are within the NMLs.
storage and activities
Road 47 48
laydown Standard noise mitigation
Delivery of
area measures to be applied
materials with
as per table 6-1.
road trucks
Stockpiling of
materials using
excavators and
truck and dogs
Parking of heavy
vehicles
(excavators,
trucks, etc)
280m from OOHW Storage 47 43 (evening) Out of Hours works only

storage and and laydown to occur if compliant with
laydown activities 42 (Night)
area the CoA E23, the EPL
Possible
and the Interim
oversize Construction Noise
deliveries Guideline (DECC, 2009).
Laydown and
storage Currently the vacated
activities house(40 Eaton Road)
adjacent to the proposed
Delivery of
facility is offering
materials with attenuation to nearest
170m from road trucks resident this will be in
storage and conjunction with the
Stockpiling of 53 48
laydown acoustic dampening .e.g.
materials using
area construct a 2.4m high
excavators and
topsoil noise mound or
18 Eaton truck and dogs
use 2.4m high acoustic
Road
Parking of heavy hoarding to reduce
vehicles potential noise impacts
(excavators, by 10dBA.
trucks, etc)
170m from OOHW Storage 53 43 (evening) Out of Hours works only

storage and and laydown to occur if compliant with
laydown activities 42 (Night)
area the CoA E23, the EPL
Possible
and the Interim
oversize Construction Noise
deliveries Guideline (DECC, 2009).
Build a 2.4m high topsoil

Carpark noise mound or use 2.4m
activities high acoustic hoarding
along the southern
80m from
2074 The Parking of light 60 48 boundary of the carpark
carpark
Northern vehicles for to reduce potential noise
Road compound office impacts at the nearest
area residential receiver by
10dBA.
80m from OOHW Carpark 43 (evening) Out of Hours works only

60 to occur if compliant with
carpark activities
42 (Night)
Possible the CoA E23, the EPL
oversize and the Interim
deliveries Construction Noise
Build a 2.4m high topsoil

Carpark noise mound or use 2.4m
activities high acoustic hoarding
along the southern
80m from
Parking of light 60 48 boundary of the carpark
carpark
vehicles for to reduce potential noise
compound office impacts at the nearest
70 Eaton area residential receiver by
Road 10dBA.
Out of Hours works only

OOHW Carpark
to occur if compliant with
activities
43 (evening) CoA in accordance with
80m from
60 the CoA E23, the EPL
carpark Possible
42 (Night) and the Interim
oversize
deliveries Construction Noise
Figure 5-5 Noise attenuation for main compound
5.8 Vibration
The nearest buildings to the ancillary facilities are equal or greater than 50m away and a
vibratory roller (<300Kn, typically 7-12 tonnes) is likely to be the most vibration intensive
equipment to be used during construction of the ancillary facility. The safe working distance
for a vibratory roller of this size is approximately 15m for cosmetic damage (British Standard
BS 7385) and approximately 100m for human comfort (DECCW). The vibratory roller will be
used for site establishment activities for the main compound for approximately one week.
As the safe working distances will not be exceeded, structural damage from vibration is
unlikely at any adjacent residential buildings. It is possible that human discomfort vibration
criteria will be exceeded and all nearby residents will be notified of the timing and duration of
the works.
For structural damage to heritage structures, the vibration limits set out in the German
Standard DIN 4150-3: Structural Vibration – Part 3 Effects of vibration on structures However,
none of the houses within 100m of the ancillary facility are heritage listed buildings and the
heritage site ‘Miss Lawson’s Guesthouse’ is an archaeological site which will be salvaged prior
to site establishment in this area.
As detailed in Section 6, pre and post construction property condition surveys will be
undertaken on buildings within 100m of vibrating compaction activities to identify any impacts
associated with the establishment and operation of the ancillary facility.
5.9 Traffic and Access

With the exception of ancillary facilities C5 and C6, designated access and haulage routes
for light vehicles entering and exiting temporary ancillary facilities will be along The Northern
Road and surrounding local road network. However continual access to local roads and
properties will be provided as per NSW CoA E41 and G36 clause 4.20 (e). Access to
ancillary facility C5 and C6 will be via the mainline construction access to a suitable access
point on The Northern Road. The use of local roads to access ancillary facilities will be
limited to Eaton Road for access to the main compound at ancillary area C8 as light vehicles
will access the ancillary facility as per Figure 5-5. This will provide continual movement of
local traffic on the northern road section and minimal impact on Eaton road. Figure 5-5 will
not as part of the ancillary works but as stage 1 works. However this demonstrates plans to
keep construction traffic (light vehicles) away from local residents to mitigate against
nuisance noise etc. A condition survey will be completed on Eaton road pre construction in
accordance with CoA E-55. There will be an estimate of 200 light vehicle movements
throughout the 10 hour working day.
In accordance with CoA E26, construction vehicles arriving at ancillary facilities outside the
standard hours of work will not queue with idling engines. Site personnel will be provided
with specific training on mitigation of noise emissions from construction vehicles.
Vehicle Management Plans will be developed in accordance with the Traffic Management Plan
to ensure safe vehicle movements in and out of the ancillary facility sites and provide specific
mitigation measures including those detailed in Section 6.
Figure 5-6 - Proposed road layout as noise & traffic mitigation measure
5.10 Visual
The ancillary facilities will result in a temporary increase in the visual extent of the construction
site and activities. The proposed location for the main compound is farmland, located 500m
south east from the town of Luddenham. The main compound will therefore result in a
temporary visual change, it will have 2m high security fencing with shade cloth installed and
will not have tall structures. Any obstruction of views from existing residential receivers
adjacent to the main compound will be minimal.
The compound site would have some security lighting which has the potential to cause light
spill during the evening and night time period. The security lighting at the main office would
most likely be mains power connected and would be directed away from adjacent residential
properties to ensure any light spill impact minimised. In the event that a generator is required
it will be short term until the facility is connected to the mains supply and only operated inside
standard work hours and will be switched off overnight.
The visual and light spill impacts associated with the ancillary facilities will be temporary in
nature as the ancillary facilities including the main compound will only be in place for 2 years
during the construction of between Mersey Road and Eaton Road of The Northern Road. All
ancillary facility areas will be stabilised and re-vegetated as per the Landscape Plan developed
for the Project.
5.11 Air Quality
Establishment of the ancillary facility will result in the disturbance of the ground surface.
Primary sources of dust emissions associated with the establishment and operation of the
ancillary facility are;
 Clearing of grasses and topsoil removal.
 Movement of soil and fill.
 Wind erosion from unsealed surfaces and stockpiles.
 Vehicles travelling over unsealed areas.
The effects of construction activities on airborne particulate matter would be temporary and
the mitigation measures detailed in the Construction Air Quality Management Plan and Section
6 of this plan include;
 The carpark, Eaton Road and access tracks will be stabilised to minimise dust impacts
from movement of plant within the ancillary area. Eaton road has a bitumen surface,
however if there is a build of dust or mud it will be cleaned as per the Air quality
management plan.
 A water cart will be utilised when performing earthworks during establishment works
and during stockpiling.
 Stabilising stockpiles that will be in place for more than 20 days and keeping stockpiles
less than 3m in height. This will be completed in accordance with Roads and Maritime
stockpile management guideline and the protocol included in the CEMP.
 Covering of all materials transported to and from the construction site.
 Visual monitoring of air quality to verify the effectiveness of controls and enable early
intervention.
 The installation and monitoring of depositional dust gauges to quantify dust levels and
determine whether control measures are adequate or whether further actions are
required. A depositional dust gauge will be installed directly adjacent to the nearest
residence at the main compound at ancillary area C8.
5.12 Community Consultation

Consultation regarding the Project was undertaken during the EIS exhibition period. This
assessment confirms and further informs the findings of the previous assessments undertaken
in relation to construction activities located in this area of the Project.
Roads and Maritime has consulted with owners of the land where ancillary facilities are
proposed. Lease agreements have been acquired with the relevant land owners and Roads
and Maritime and the leased areas are shown in Appendix A.
Property condition surveys will be completed before the establishment of the facility. Targeted
consultation with residents and businesses located near the project area will be undertaken
via notifications and/or doorknocking in accordance with the Community Communication
Strategy (CCS) for the project and GEJV’s Construction Community Liaison Management
Plan which is stage specific and aligned to meet the processes within the CCS. The
consultation will provide the surrounding community with details of the proposed activities for
each stage of use (i.e. establishment, operational and decommissioning/rehabilitation).
Roads and Maritime and GEJV will continue to carry out ongoing consultation activities with
neighbouring residents and business to inform them of potential amenity impacts (including
noise and vibration, traffic and access, dust and odour, and visual impacts) and explain the
appropriate mitigation measures that will be implemented.
6 ENVIRONMENTAL MITIGATION MEASURES
This section details the environmental mitigation measures specific to the ancillary facilities
that will be implemented to minimise the environmental impacts associated with the
establishment and operation of the ancillary facilities.
A range of environmental mitigation measures are identified in the various assessment and
approval documents for the project, including the EIS, the Submissions and Preferred
Infrastructure Report, NSW and Federal Conditions of Approval, OACEMP and Roads and
Maritime standard documents. Site specific mitigation measures have been adapted from
these documents as relevant to the establishment; operation, decommissioning and
rehabilitation of the ancillary facility, as outlined in Table 6-1.
Table 6-1 Environmental Mitigation Measures
ID Measure/Requirement When to Responsibility Reference

Implement
General
GEN1 Prior to establishing the ancillary facility a pre-construction land Prior to site ESR, G36, Cl4.15.2
condition assessment will be undertaken by an independent establishment Independent OACEMP
environmental consultant. This will assess the land for any pre- Consultant Ap A4, Section 2.3.1
existing contamination or waste issues prior to taking possession.
GEN2 When the areas of land used for the site facilities are no longer Post - construction ESR G36, Cl4.15.2
required, and after restoration of the areas to pre-existing condition Independent OACEMP
or better, a post-construction land condition assessment by an Consultant Ap A4, Section 2.3.1
independent environmental consultant is required.
The approval holder must undertake the action, including those parts of the ESR
Prior to site G36, CCHMP and
GEN3 action that occur on Commonwealth Land, in accordance with all conditions Independent
in the NSW Infrastructure Approval. establishment Federal-CoA 1
Consultant
The person taking the action must maintain accurate records substantiating
all activities associated with or relevant to the conditions of approval,
including measures taken to implement all management plans required by
this approval, and make them available upon request to the DoEE. Such ESR
G36, CCHMP and
GEN4 records may be subject to audit by the DoEE or an independent auditor in Construction Independent
Federal-CoA 11
accordance with section 458 of the EPBC Act, or used to verify compliance Consultant
with the conditions of approval. Summaries of audits will be posted on the
DoEE’s website. The results of audits may also be publicised through the
general media.
Flora and Fauna
FF1 A Construction Flora and Fauna Management Plan (CFFMP) would Pre - construction ESR G36 Section 4.8
be developed for the project. The plan would include procedures for OACEMP
pre- clearance surveys that are consistent with the Roads and Ap A4, Table 2-3,
Maritime Biodiversity Guidelines (RTA, 2011). All work to be in
accordance with the CFFMP.
FF2 Contain construction activities within the construction works zone Prior to site Project Manager OACEMP
boundary and occupy the minimum area practicable for limiting establishment Superintendent Ap A4, Table 2-3
impacts on adjoining areas, including the extent of native vegetation ESR
construction
clearing.
FF3 Clear boundaries will be applied for construction and exclusion Prior to site Project Manager G36 Section 4.8
zones for equipment, machinery and traffic to prevent unnecessary establishment Superintendent OACEMP
damage to native vegetation and fauna habitats. ESR Ap A4, Table 2-3
FF4 Clearing limits will be accurately and clearly marked. Existing trees Prior to site Project Manager G36 Section 4.8
within construction area and compounds that do not need to be establishment Superintendent OACEMP
ESR Ap A4, Table 2-3
The Northern Road Upgrade, Stage 4
Implement
removed will be identified, protected and maintained throughout the
construction period.
FF5 Once clearing limits have been surveyed and marked, a suitably Prior to site Ecologist G36 Section 4.8
qualified and experienced fauna ecologist will undertake a pre- establishment ESR
clearing survey to identify any concerns to specific species.
FF6 During vegetation clearing, timber and root balls must be retained Site establishment Superintendent CoA E5
where practicable for reuse in habitat enhancement and Construction ESR
rehabilitation work. The retained timber and root balls may be used
on or off the CSSI site. Prior to the commencement of vegetation
clearing, the Proponent must consult with community groups, the
Mulgoa Valley Landcare Group and relevant government agencies
to determine if retained timber and root balls could be used for
environmental rehabilitation projects, before pursuing other disposal
options.
FF7 Clearing boundary demarcation and tree protection zones will be Construction ESR G40 / good practice
inspected during the weekly environmental inspection and recorded
in the Georgiou One App Environmental inspection template.
Inspection findings will be reported in the environmental monthly
report.
FF8 Native vegetation would be re-established in accordance with Guide Rehabilitation ESR CoA B5
3: Re-establishment of native vegetation of the Biodiversity and landscaping
Guidelines: Protecting and managing biodiversity on RTA projects
Soil and water
SW1 A Construction Soil and Water Management Plan (CSWMP) would Pre - construction ESR G38
be developed in accordance with the Roads and Maritime OACEMP
specification G38 – Soil and Water Management and the Blue Book Ap A4, Table 2-3,
– Soils and Construction – Managing Urban Stormwater Volume 1
(Landcom, 2004) and Volume 2D (DEC, 2008a). All work to be in
accordance with the SWMP.
SW2 Training will be provided to all project personnel, including relevant Pre-construction Superintendent G38/G36, Good
subcontractors on sound erosion and sediment control practices and Construction practice
ESR
the requirements from this plan through inductions, toolboxes and
targeted training.

Implement
SW3 An erosion and sediment control plan will be developed in Prior to site Superintendent ESCPs
accordance with Managing Urban Stormwater – Soils and establishment ESR G38
Construction Volume 1 (Landcom, 2004) and Volume 2D (DECC,
Blue Book (Landcom,
2008). This plan will incorporate erosion control measure to limit the
2004), NSW-CoA E8
movement of soil from disturbed areas, and sediment control
measures to remove any sediment from runoff.
SW4 All soils to be transported offsite, will be identified and classified in Construction Superintendent G36 Clause 4.11
accordance with the Protection of the Environment Operations Act ESR
1997 (POEO Act) and Waste Classification Guidelines
SW5 All topsoil will be surveyed for contamination prior to stripping and Pre-construction Superintendent G36 Clause 4.2.3,
monitored during topsoil stripping. Construction ESR R44 cl 2.3
An Unexpected Discovery of Contaminated Land Procedure
(Appendix D) will be implemented if potentially contaminated land,
spoil or fill is encountered. Works in the vicinity will be stopped or
modified and will not recommence until the material has been
analysed and management measures implemented.
SW6 A spill management procedure will developed as part of the Pollution Pre-construction ESR PIRMP for EPL
Incident Response Plan (PIRMP) and personnel will be inducted on Construction holders under the
its procedures in the event of a spill. All fuels and chemicals will be POEO Act 1997
stored and used in accordance with the appropriate guidelines and
standards
SW7 All erosion and sediment controls will be inspected weekly and post Construction ESR G36 Clause 3.3.1
rainfall events >10mm. Soil conservation inspection will occur on a
monthly frequency. Required maintenance and improvements will be
recorded in the Georgiou One App Environmental inspection
template. Inspection findings will be reported in the environmental
monthly report.
SW8 Where available and practicable, captured stormwater, recycled Construction Superintendent G36, CoA E71
water or other water sources shall be used in preference to potable
ESR
water for construction, including dust control and assist compaction..
Stockpile Management
SP1 Stockpiling of material will not occur within 5m of vegetation Pre-construction Project Manager G38 Clause 3.2
protection areas and tree protection zones. Delineation will be in Construction ESR
accordance with AS 4970.

Implement
SP2 Stockpiles will be located at least 5m from concentrated water flows Pre-construction Project Manager G38 Clause 3.2
and 50m from the top of bank of any watercourse or drainage line Construction ESR
SP3 Cover, or otherwise protect from erosion, stockpiles that will be in Pre-construction Project Manager G38 Clause 3.2
place for more than 4 weeks as well as any stockpiles that are Construction ESR
susceptible to wind or water erosion, within 10 days of forming each
stockpile in accordance with the blue book.
SP4 Clean topsoil to be retained for rehabilitation purposes, weed Pre-construction Project G38 Clause 3.2
contaminated topsoil to be separated from clean topsoil. Construction Manager, ESR
SP5 Weed mitigation measures including early establishment of a sterile Construction Project Manager G38 Clause 3.2
cover crop on topsoil stockpiles will be implemented to prevent and ESR
minimise the growth of weeds.
SP6 There would be no stockpiling of soil or construction materials within Pre-construction Project Manager OACEMP
utility easement corridors Construction ESR Ap A4, table 2-3
SP7 Controls will be placed around stockpiles and immediately Pre-construction Superintendent G38 Clause 3.2
downslope of excavated areas to minimise siltation and Construction
sedimentation.
SP8 The ESCP must detail the measures that will be implemented to Pre-construction ESR G38 Clause 3.2
protect stockpiles from erosion by wind and water erosion. Construction
SP9 Stockpile areas will be included in the weekly and post rainfall Site establishment ESR G38 Clause 3.2
environmental inspections and recorded in the Georgiou One App Construction
Environmental inspection template. Inspection findings will be
reported in the environmental monthly report.
Material Storage and Management
CH1 A project-specific Construction Waste and Energy Management sub- Pre - construction ESR G38
plan (CWEMP) would be prepared before construction. The plan OACEMP
would adopt the Resources Management Hierarchy principles of the Ap A4, Table 2-3
WARR Act. All work to be in accordance with the CWEMP.
CH2 All fuels, chemicals, and liquids would be stored at least 50 m away Construction Site Supervisor G36 Cl 4.3
from the existing stormwater drainage system and would be stored
Foreman OACEMP
in an impervious bunded area within the compound site.
Ap A4, Table 2-3
CH3 Storage, handling and use of dangerous goods and hazardous Site establishment Site Supervisor OACEMP
substances would be in accordance with the Work Health and Safety
Construction Foreman Ap A4, Table 2-3

Implement
Act 2011 and the Storage and Handling of Dangerous Goods Code
of Practice (WorkCover NSW, 2005).
CH4 Inspect all plant and equipment daily for leakages of fuel, oil or Site establishment Operators G36 Cl 4.3
hydraulic fluid. Repair any defective or deteriorated equipment that Construction
may result in leaks or leaks before using plant or equipment.
Maintain records of plant inspections
CH5 Keep adequate quantities of suitable material to counteract spillage Site establishment Superintendent\ G36 Clause 4.3
readily available. Clean up all chemical spills immediately. Construction Foreman
CH6 Emergency spill kits for the management of wet and dry chemical Site establishment Superintendent\ G36 Cl 4.3
spills must be available at all compound areas Construction Foreman
CH7 Vehicle wash downs and/or concrete truck washouts would be Site establishment ESR, G36 Cl 4.11
undertaken within a designated bunded area of an impervious Construction Superintendent OACEMP
surface or undertaken off-site Foreman Ap A4, Table 2-3
CH8 Waste oil, oily rags, oil filters and oily waters will be disposed of by Construction ESR, G36 Cl 4.11
an appropriately licensed contractor to a waste facility where the Superintendent
materials are lawfully accepted. Foreman
CH9 Storage of dangerous goods and hazardous materials would occur Construction Superintendent OACEMP
in accordance with suppliers’ instructions and relevant Australian Foreman Ap A4, Table 2-3
Standards and may include bulk storage tanks, chemical storage
cabinets / containers or impervious bunds
CH10 Provide security for buildings, materials, construction plant and Site establishment ESR Best practice
machinery. Take all necessary precautions to make the area safe to Construction Superintendent
the public Foreman
CH11 Ensure that adequate rubbish receptacles are provided to enable & Site establishment ESR Best practice
promote waste segregation from putrescible waste and recyclable Construction Superintendent
waste. Service these receptacles regularly and to the satisfaction of Foreman
the Principal to ensure that the construction area remains tidy.
CH12 Waste management measures will be based upon the philosophy of Construction Superintendent G36 Clause 4.11
reduce, reuse, recycle and appropriate disposal. Refer to ESR
Construction Waste & Energy Management Plan and Sustainability
Management Plan.

Implement
CH13 All wastes, including contaminated wastes, would be identified and Construction Superintendent OACEMP
classified in accordance with the Waste Classification Guidelines: ESR Ap A4, Table 2-3
Part 1 Classifying Waste
CH14 Disposal of any non-recyclable waste would be in accordance with Construction Superintendent OACEMP
the POEO Act and Waste Classification Guidelines: Part 1 ESR Ap A4, Table 2-3
Classifying Waste
CH15 Concrete pumping or concreting activities will be undertaken in Construction Superintendent Good Practice
accordance with Environmental Best Management Practice ESR
Guideline for Concreting Contractors 2002 to prevent and/or
minimise spillages.
CH16 The refuelling of plant and maintenance machinery would be Construction Superintendent Good Practice
undertaken at least 50m from waterways with appropriate spill
ESR OACEMP
containment mechanisms in place such as impervious bunding and
the provision of spill kits nearby. Ap A4, Table 2-3
CH17 Hydrocarbon, chemical and waste storage areas will be included in Construction ESR Good Practice
the weekly and post rainfall environmental inspections and recorded
in the Georgiou One App Environmental inspection template.
Inspection findings will be reported in the environmental monthly
report.
Heritage
HER1 A Construction Cultural Heritage Management Plan (CCHMP) would Pre - construction ESR G38
be prepared as part of the CEMP prior to construction providing OACEMP
protocols and procedures to be implemented during construction to Ap A4, Table 2-3
ensure the protection of items of heritage significance. Works must NSW -CoA E9, NSW-
be in accordance with the CCHMP and known heritage items (both CoA E11
Aboriginal & non-Aboriginal) will have an demarcation fence and
signed exclusion zone, this will be communicated in the project
induction and toolboxes.
HER2 Prior to commencing work all construction personnel will undergo a Pre - construction ESR G36 Section 5, NSW-
induction which would contain information on heritage values and CoA C5
items in the area and on environmental management measures to
minimise potential heritage impacts. This induction will identify
procedures for unexpected heritage finds.
Works must be in accordance with the CCHMP

Implement
HER3 The Roads and Maritime’s unexpected finds protocol will be Site establishment Project Manager Roads and Maritime
implemented for the works in relation to unexpected heritage finds Construction Superintendent Roads and Maritime
and in the event of uncovering possible human skeletal remains Unexpected Heritage
ESR
This includes cessation of works in the vicinity, assessment of the Items Procedure –
significance of the item(s) and determination of appropriate Annexure B, NSW CoA
mitigation measures including when works can re-commence by a E16, E17, E21, E22
suitably qualified and experienced archaeologist in consultation with
the Department, OEH and registered Aboriginal stakeholders. Works
must be in accordance with the CCHMP
Project Manager NSW-CoA E11
Miss Lawson’s Guesthouse will be demarcated with signage erected and Site establishment
HER4 communicated as area is a No GO Zone for the duration of construction.
Superintendent
Construction
ESR
Noise and Vibration
NV1 A Construction Noise and Vibration Management Plan (CNVMP) Pre - construction ESR G38
would be prepared in accordance with the requirements in the ICNG OACEMP
and Roads and Maritime CNVG. All work to be in accordance with Ap A4, Table 2-3
the CNVMP.
NV2 Implement all reasonable and feasible mitigation measures to Prior to site Superintendent G36, Cl4.16
ensure the works comply with the relevant Noise Management establishment ESR OACEMP
Levels. This shall include; Site establishment Ap A4, Table 2-3
 Works will be undertaken in accordance within the standard Construction NSW CoA E23- E25
working hours unless in compliance with the Project EPL or and E28
CoA E26.
 All construction plant and equipment used on the site will be:
- Fitted with properly maintained noise suppression
devices in accordance with the manufacturer’s
specifications.
- Maintained in an efficient condition.
- Operated in a proper and efficient manner
 All noise and vibration complaints will be managed in
accordance with the Complaints Management System.
 loading and unloading will be carried out away from sensitive
receivers, where practicable
 Ensure all deliveries occur during standard construction
hours where reasonable and feasible.

Implement
 Loading and unloading should be carried out away from
sensitive receivers, as far as practicable.
 Avoiding noisy plant from working simultaneously in close
proximity adjacent to sensitive receivers will result in reduced
noise emissions and exposure.
 Equipment which is used intermittently is to be shut down
when not in use.
 Where possible, equipment with directional noise emissions
should be oriented away from sensitive receivers.
 Reversing of equipment should be minimised so as to
prevent nuisance caused by reversing alarms.
 schedule a respite period of one hour for every three hours of
continuous high noise generating construction activity, or
scheduling high noise generating works to the less sensitive
times of 9:00 am to 12:00 pm or 2:00 pm to 5:00 pm.
 Noise intensive works to be completed in continuous blocks
not exceeding three hours each with a minimum respite from
those activities and works of not less than one hour between
each block.
 GEJV must identify and consult with receivers identified as
being subject to levels that exceed the Highly Noise Affected
criteria with the objective of determining appropriate hours of
respite unless an agreement is reached with those receivers.
 Locate topsoil as noise mounds along the perimeter of
compound site adjacent to residential receivers as per the
Ersed Plan for main site compound.
 Construction vehicles arriving at the project site and
construction compounds outside the standard construction
hours described in Condition E23 must not queue with idling
engines.
NV3 Pre and post construction property condition surveys will be
undertaken at houses within 100m of the ancillary areas to identify Prior to site G36, Cl4.15.2
any impacts associated with the establishment and operation of the establishment Project Manager OACEMP
ancillary facility. Construction ESR Ap A4, Section 2.3.1,
Property condition reports are to be provided to landowners and Councils
E36, E42 & E44
(where agreed by landowner) within 3 weeks and no later than one month
prior to commencement of works.

Implement
When working within 5m of a sensitive receptor the “no vibe” function will be
used on the roller.
If compaction is required within 5m of Mrs Lawson’s Guesthouse or other
heritage structures, a vibration setting will be turned off.
GEJV may conduct vibration testing before and during vibration generating
activities that have the potential to impact on heritage items to identify
minimum working distances to prevent cosmetic damage. ln the event that
the vibration testing and monitoring shows that the preferred values for
vibration are likely to be exceeded, the Proponent must review the
construction methodology and, if necessary, implement additional mitigation
measures.
NV 4 The CSSI must be constructed with the aim of achieving the following
construction vibration goals:
(a) for structural damage to heritage structures, the vibration limits set out
in the German Standard DIN 4150-3: Structural Vibration – Part 3
Effects of vibration on structures;
(b) for damage to other buildings and/or structures, the vibration limits set G36, Cl4.15.2
out in the British Standard BS 7385-1:1990 – Evaluation and Site establishment Project Manager
OACEMP
measurement of vibration in buildings—Guide for measurement of Construction ESR
Ap A4, Section 2.3.1,
vibration and evaluation of their effects on buildings (and referenced in
Australian Standard 2187.2 – 2006 Explosives – Storage and use –
Use of explosives); and
for human exposure, the acceptable vibration values set out in Assessing
Vibration: A Technical Guideline (Department of Environment and
Conservation, 2006).
NV5 GEJV to ensure that vibration from construction activities does not exceed Site establishment Project Manager
the vibration limits set out in the British Standard BS 7385-2:1993 Evaluation G36, Cl4.15.2
Construction ESR OACEMP
and measurement for vibration in buildings. Guide to damage levels from
groundborne vibration. Ap A4, Section 2.3.1,
NV6 Attended noise monitoring will occur monthly at the nearest Site establishment ESR Good practice.
residential receiver against the NMLs. Attended noise monitoring will Construction
also occur if a complaint is received or during any OOHW.
NV7 Temporary acoustic barriers (2.4 metres high) are to be installed as Site establishment Project Manager CoA E31
soon as site establishment works at the ancillary facility are Construction ESR
completed and before undertaking any works which are required
to be conducted at the facility. unless a justification for not installing
acoustic barriers in certain locations, has been described in this
plan. Acoustic barriers must be inspected and maintained to remain
effective throughout the use of the construction compound.
Effluent Management

Implement
EM1 Toilet blocks will be fitted with a 4000L waste holding tank. Pumping Site establishment Project Manager Good practice.
out of waste is to be conducted by a licensed waste contractor and Construction ESR
disposed of at a suitably licensed waste facility in accordance with
the Construction Waste Management sub-plan and EPA
requirements
EM2 Push taps will be installed within the toilet blocks to prevent taps Site establishment Project Manager Good practice.
being left on accidentally. Construction ESR
EM3 A high sensor auto shut off valve (80%) will be installed on the waste Site establishment Project Manager Good practice.
system to prevent the tank from overflowing. Construction ESR
The system will be checked weekly as part of environmental
inspections.
Traffic and access
TR1 A Construction Traffic Management Plan (CTMP) would be Pre-construction Project Manager G36 Clause 3.1
developed, approved, implemented and monitored as part of the Construction OACEMP
project. The TMP would ensure the use of local roads by heavy
Ap A4, table 2-3
vehicles to access temporary ancillary facilities would be limited as far
as is reasonably practicable. All work to be in accordance with the
CTMP.
TR2 Wherever practical all removal and delivery of materials and plant Site establishment Superintendent Good practice
will be timed to occur outside of the peak traffic periods to minimise Construction
delay in the area however within standard construction hours.
TR3 Construction vehicles arriving at the project site and Construction Site establishment Superintendent CoA E28
compounds outside the standard Construction hours must not queue Construction
with idling engines.
TR4 Unencumbered access to private property must be maintained Site establishment Superintendent CoA E41
during Construction unless otherwise agreed with the landowner in Construction
advance. A landowner’s access that is physically affected be
reinstated to at least an equivalent standard, in consultation with the
landowner.
TR5 Vehicles used in the delivery of the project must not use local roads Site establishment Superintendent CoA E54
unless no suitable alternatives are available. Where the use of local Construction
roads is proposed, these must be identified in a Traffic Management
plan.

Implement
TR6 A Road Dilapidation Report must be prepared by a suitably qualified pre-construction Project Engineer CoA E55
person for local roads (and associated infrastructure) proposed to be Superintendent
used by Construction vehicles for works associated with the project
before the commencement of use by such vehicles. Copies of the
Road Dilapidation Report must be provided to the relevant Council
within three (3) weeks of completing the surveys and no later than
one (1) month before the use of local roads by project vehicles.
TR7 If damage to roads occurs as a result of Construction, the Proponent Post construction Project Engineer CoA E56
must rectify the damage so as to restore the road to at least the Superintendent
condition it was in pre-works, unless otherwise agreed by the
relevant Councils.
TR8 During construction, measures must be implemented to maintain Construction Project Engineer CoA E57
pedestrian and vehicular access to, and parking in the vicinity of, Superintendent
businesses and affected properties. Alternative pedestrian access,
vehicular access, and parking arrangements, and signage to direct
customers to these businesses and affected properties, must be
developed in consultation with affected businesses.
TR9 Signage and directions to businesses must be provided before, and Pre-construction Project Engineer CoA E58
for the duration of, any disruption during Construction. Construction Superintendent
Visual
VIS1 The visual impact of ancillary facilities on adjacent residential areas Pre-construction Superintendent Good practice
will be minimised through the careful planning and positioning of Construction ESR
temporary offices, other plant and material laydown areas, and
specific management of lighting and potential for light spill within the
identified ancillary facility.
VIS2 Undertake property adjustments and relocation of infrastructure (for Construction Superintendent OACEMP
example, fencing, dams, property access) in consultation with the ESR Ap A4, Table 2-3
property owner.
VIS3 Areas affected by construction would be reinstated and restored in Prior to completion Superintendent OACEMP
accordance with the urban design and landscape strategy. of project Foreman Ap A4, Table 2-3
VIS4 Any areas temporarily disturbed during construction will be Prior to completion Superintendent G36, Cl4
rehabilitated as soon as feasible and reasonable following the of project Foreman
completion of construction/operation of the ancillary facilities.
VIS5 The design of temporary lighting must avoid unnecessary light spill Construction Superintendent OACEMP
on adjacent residents or sensitive receivers and be designed in ESR Ap A4, Table 2-3
accordance with AS 1158.1-1986.
Implement
VIS6 Consider the provision of barriers to screen views from visually Construction Superintendent OACEMP
sensitive nearby areas such as rural dwellings, residential and ESR Ap A4, Table 2-3
recreational areas.
VIS7 Contain construction activities within the construction works zone Construction Superintendent OACEMP
boundary and occupy the minimum area practicable for limiting ESR Ap A4, Table 2-3
impacts on adjoining areas, including the extent of native vegetation
clearing.
Air Quality
AIR1 Dust and emissions generation at compounds would be managed Pre-construction Superintendent G36, Cl4.4
by: Construction Foreman OACEMP
 installation of perimeter screening around compound sites Ap A4, Table 2-3,
 impose low speeds limits around compound sites to limit the NSW-CoA E71, NSW-
generation of dust from vehicle movements CoA E72
 apply wheel-wash or rumble grid facilities at access points to
limit the tracking of materials beyond the site boundary
 ensure that compound area surfaces are well compacted or
sealed to limit the potential for dust generation
 regularly water stockpiles and limit the amount of materials
stockpiled around the site
 Limit stockpiling activities during conditions where winds are
blowing strongly in the direction(s) from the stockpiling
location to nearby receivers.
 position stockpiling areas as far as possible from surrounding
receivers
W here available and practicable, and of appropriate chemical
and biological quality, stormwater, recycled water or other
water sources may be used in preference to potable water for
the delivery of the CSSI, including dust control.
AIR2 Dust generation will be visually inspected daily by the supervisors Construction Supervisors, G36 Clause 4.4.1
during all works to ensure excess dust is not generated and is not ESR OACEMP
leaving site. Air quality and dust management will be formally Ap A4, Table 2-3,
inspected weekly and recorded in the Georgiou One App NSW CoA E71
Environmental inspection template. Inspection findings will be
reported in the environmental monthly report.
AIR3 Install depositional dust gauges in accordance with the Construction Construction Supervisors, OACEMP
Air Quality Management Sub Plan to quantify dust levels and ESR Ap A4, Table 2-3
determine whether control measures are adequate or whether
further actions are required. A depositional dust gauge will be
Implement
installed directly adjacent to the nearest residence at the main
compound at ancillary area C8.
Waste
WE1 Waste generated in the delivery of the Project must be dealt with in Construction ESR, G36 Cl. 4.11.1
accordance with the waste minimisation hierarchy principles of Superintendent NSW CoA E68 – E70
avoid/reduce/reuse/ recycle/dispose with the following priorities:
i. waste generation is to be avoided and where avoidance is
not reasonably practicable, waste generation is to be
reduced;
ii. where avoiding or reducing waste is not possible, waste is to
be re-used, recycled, or recovered; and
iii. where re-using, recycling or recovering waste is not possible,
waste is to be treated or disposed of at a waste management
facility or premises lawfully permitted to accept the materials.
Waste generated outside the site must not be received at the site for
storage, treatment, processing, reprocessing, or disposal on the site,
ESR, EIS Table 8-45, WR-1
WE2 except as expressly permitted by a licence or waste exemption Construction
Superintendent NSW CoA E68
under the POEO Act, if such a licence is required in relation to that
waste.
All waste materials removed from the CSSI site must only be
directed to a waste management facility or premise lawfully
permitted to accept the materials or in accordance with a Resource ESR,
Construction NSW CoA E69
WE3 Recovery Exemption or Order issued under the Protection of the Superintendent
Environment Operations (Waste) Regulation 2014, or to any other
place that can lawfully accept such waste.
All waste must be classified in accordance with the EPA’s Waste
Classification Guidelines, with appropriate records and disposal ESR,
WE4 Construction CoA E70
dockets retained for audit purposes Superintendent
Community Consultation
CON1 Affected residents and local business owners will be consulted prior Pre - construction Community G36 Clause 3.7.2
to establishing the ancillary facility to identify appropriate measures Liaison Officer OACEMP
to manage potential impacts which will be in accordance with the ESR Ap A4, Table 2-3
Community Communication Strategy (CCS)
CON2 On-going consultation in accordance with the CCS to local business Pre – construction Community G36 Clause 3.7.2
owners, including owners of agricultural businesses, located close to Construction Liaison Officer OACEMP
Implement
construction works about the timing, duration and likely impact of ESR Ap A4, Table 2-3
construction activities on their business operations would be carried
out.

7 COMPLIANCE MANAGEMENT
7.1 Roles and responsibilities
The Project Team’s organisational structure and overall roles and responsibilities are outlined
in Section 5.1.7 - 5.1.14 of the OACEMP. Specific responsibilities for the implementation of
environmental controls are detailed in Section 7 of this Plan.
7.2 Training
All employees, contractors and utility staff working on site will undergo site induction training
relating to the development and operation of ancillary facilities. The induction training will
address elements related to facility operations including:
 Existence and requirements of this AFMP.
 Relevant legislation.
 Community expectations.
 Traffic and access.
 Soil and water management.
 Dust management.
 Flood warning and evacuation.
 recognition and awareness of site hazards
 Contingency and emergency response planning.
 Spill management.
 Handling and disposal of hazardous goods and materials.
 Construction vehicle noise minimisation measures.
 Vegetation clearing.
 Sensitive areas and exclusion zones.
Further details regarding staff induction and training are outlined in Chapter 6.7.1 of the
OACEMP.
7.3 Monitoring and inspections

As detailed in Section 6.1 of the OACEMP, weekly inspections of the site, including ancillary
facilities, will occur for the duration of the project. The Environmental Site Representative will
undertake these inspections. In addition regular inspections (fortnightly or monthly as required)
by the Independent Environmental Representative will occur and an ER Inspection Report will
be provided to Roads and Maritime and the GEJV. Additional requirements and responsibilities
in relation to monitoring and inspections are documented in Section 6.1 of the OACEMP.
7.4 Auditing
Audits will be undertaken to assess the effectiveness of environmental controls, compliance
with this plan, CoA and other relevant approvals, licenses and guidelines. Audit requirements
are detailed in Section 6.4 of the OACEMP.
An audit schedule will be developed as per Section 6 of the OACEMP by GEJV’s

Environmental Manager and will include all external and internal audits.
The Northern Road Stage 4 Project

Ancillary Facilities Management Plan 59
7.5 Incident Management
An Incident Reporting Procedure (section 6.5 of the OACEMP) covers incidents management
and the reporting requirements. A Pollution Incident Response Management Plan (CEMP -
Appendix A2) has been developed to minimise the impact of spills including details on the
requirements for managing, cleaning up and reporting.
7.6 Complaints Management

Complaints will be recorded in accordance with the approved Community Communication
Strategy and Complaints Management System. Information will be recorded as per the
requirements of the Complaints Register for the project. All resident complaints will be
managed as per the timelines identified in the Complaints Management System and reported
to Roads and Maritime for inclusion in complaints reporting.
7.7 Reporting
Reporting requirements and responsibilities are documented in Section 6.5 of the OACEMP.
7.8 Ongoing risk analysis

GEJV Environmental Representatives are responsible for ensuring Project environmental
risks are identified and included in the risk register and appropriate mitigation measures
implemented throughout the construction of the Project.
Review and, if necessary, update of the Project risk register will be an ongoing process
which will occur, as a minimum:
 when a risk has been identified
 where there is a change in work systems, materials, equipment, practices or
procedures on site
 in response to incidents
 where new information about an environmental risk becomes available or where
personnel raise concerns about an environmental risk
 at regularly scheduled times (monthly), including during reviews of the Project risk
register at GEJV Project meetings and the quarterly management review meetings
(Error! Reference source not found. of the OACEMP.
The requirement for the regular review and update of the aspects and impacts register as
part of continuous improvement is included in Error! Reference source not found. of the
OACEMP.
Where new risks are identified, these will be included in the risk register, assessed and
control measures put in place to eliminate or minimise the level of risk. Monitoring and review
of the effectiveness of control measures will be carried out during weekly environmental
inspections and may include consultation with site personnel involved in managing the
identified risks.

8 REVIEW AND IMPROVEMENT
8.1 Continuous improvement
Continuous improvement of this plan will be achieved by the ongoing evaluation of
environmental management performance against environmental policies, objectives and
targets for the purpose of identifying opportunities for improvement. The continuous
improvement process will be designed to:
 Identify areas of opportunity for improvement of environmental management and
performance.
 Determine the cause or causes of non-conformances and deficiencies.
 Develop and implement a plan of corrective and preventative action to address any
non-conformances and deficiencies.
 Verify the effectiveness of the corrective and preventative actions.
 Document any changes in procedures resulting from process improvement.
 Make comparisons with objectives and targets.
8.2 AFMP update and amendment

The processes described in section 1.6 of the OACEMP will be used to update or revise this
Plan. This will occur as needed throughout the project life.
A copy of the updated plan and changes will be distributed as required to all relevant
stakeholders such as DPE & EPA Council in accordance with the approved document control
procedure – refer to Section 1.6 of the OACEMP. In the event that the AFMP requires
amendment, the ER can approve comments that are deemed to be minor however in the event
that suggested amendments are deemed to be significant then the amended plan will be
resubmitted back to the DPE for approval and additional consultation where required.
In the case of ancillary facilities that come under condition A15, the AFMP would be updated
to reflect any additional ancillary facilities and the assessment as per condition A15.
Any future additional ancillary facilities will be detailed in an updated AFMP for assessment
and approval purposes.

Appendix A
Roads and Maritime Leased Areas
The AFMP demonstrates how the site is set up in conjunction with EIS and G1
specifications.
Table 8-21 - Location of the Ancillary locations to be considered under the approval of this
AFMP.
Proposed Location Lot & DP Reference Status of lease RMS Approved Purpose
Not referenced in G1 Not approved to Sediment
C1 To be agreed
Specification date Basin
Not referenced in G1 Not approved to Ancillary
C2 To be agreed
Specification date Facility
Sediment
C3 Lot 92 DP27550 To be agreed Yes
Basin
Sediment
C4 Lot 102 DP812653 Approved Yes
Basin
Sediment
C5 Lot 11 DP 1092165 Approved Yes
Basin
Ancillary
C6 Lot 2 DP 851626 Approved Yes
Facility
Not approved Not approved to Sediment
C7 Lot 20 DP258
to date date Basin
Ancillary
C8 DP250030 Approved Yes
Facility

Figure 5-7 – Location of the proposed of Ancillary locations

Appendix B
Ancillary facilities assessment criteria (NSW-CoA A17)
for facilities not assessed in the EIS

Ancillary facilities assessment criteria (NSW-CoA A17) for facilities not assessed in the EIS
Criteria Yes/No Evidence Comments

Location
Purpose
Is the facility a minor facility (eg office, shed or staff amenities)?
Criteria
Minor ancillary facilities comprising lunch sheds, office sheds, and portable toilet facilities, that
1. are not identified in the documents listed in Condition A1 and which do not satisfy the criteria
set out in Condition A15 of this approval must satisfy the following criteria:
2.
have no greater environmental and amenity impacts than those that can be managed through
the implementation of environmental measures detailed in the OACEMP required under
Condition C1 of this approval; and
3.
have been assessed by the ER to have:
i. minimal amenity impacts to surrounding residences and businesses, after consideration of
matters such as compliance with the ICNG, traffic and access impacts, dust and odour
impacts, and visual (including light spill) impacts;
ii. minimal environmental impact with respect to waste management and flooding; and
iii. No impacts on biodiversity, soil and water, and heritage items beyond those already
approved under other terms of this approval.
Approval of minor ancillary facility
Are criteria above met?
Date of approval by ER

Appendix C
Evidence of consultation

Ancillary Facilities Management Plan
67
Form Agency Date Review Comment Roads and Maritime / Contractor response
Received
Email EPA 16/08/18 Email received on the 16/08/18 from the EPA advising that Noted by GEJV
it is not their policy to review management plans. The EPA’s
expectations will be specified in the project’s environmental
protection licence when it is issued.
Phone Liverpool 13/08/18 Georgiou Environmental Manager received a phone call GEJV sent an email response to the
Call Council from the Liverpool Council delegate on the 13/08/18. The Liverpool Council delegate on the 15/08/18
Liverpool council delegate had no issues with the Ancillary with further detail on the traffic
Facility Management Plan as all areas had been previously management proposed for the project
assessed in the EIS. The Delegate asked for further detail including an offer to provide traffic staging
on the traffic staging and traffic controls to be implemented plans and vehicle management plans for
on the project. information when they have been
completed the GEJV traffic consultant.

Appendix D
Unexpected Discovery of Contaminated Land Procedure
Purpose
The purpose of this management procedure is to effectively manage any unexpected finds of
contaminated material on the Northern Road Upgrade, .between Mersey Road and Eaton
Road
Scope
There is potential for previously unidentified contaminants to be uncovered during the works.
This might be by observation of any unusual physical/sensory characteristics of the impacted
soil, such as changes in colour, changes in texture, visual evidence, or odour. Unexpected
finds may include unexpected discovery of hazardous building materials, such as asbestos
containing materials, or unexpected discovery of contaminants in addition to the type already
identified on-site, such as surface or buried material with visual or olfactory evidence of
contamination.
Induction/Training
All GEJV personnel are to be inducted on the identification of potential land contamination
including asbestos contaminated material and coal tar in existing asphalt. They will be trained
in the relevant actions associated with this procedure during the project site induction and
regular toolbox talks.
Procedure
Follow the procedure listed below in the case of unexpected contamination finds;
1. Works should cease in the area and the supervisor should be notified immediately
2. The area should be cordoned off to prevent access by other workers and public
3. A suitably qualified environmental consultant will be engaged to provide interim advice
based on visual inspection on construction health and safety, material storage and material
disposal to allow construction to proceed as soon as practical.
4. The suitably qualified environmental consultant will prepare a Remediation Action Plan in
accordance with EPA guidelines on contaminated land management and this will be
provided to Roads and Maritime under G36 hold point cl 4.2.3.
5. Unexpected potentially contaminated material will be excavated and separately stockpiled
in a secure location on strong impermeable plastic sheeting and covered top and sides
with securely fitted plastic sheeting.
6. The stockpile will be protected by adequate sediment controls to collect runoff and prevent
overland stormwater flow from affecting the base of the stockpile.
7. Potentially contaminated materials from different parts of the construction area will be
segregated into separate stockpiles. The separate stockpiles should be signposted and
the source location of the materials on site recorded.
8. When the potentially contaminated material has been removed, the area from which this
material was excavated will also be isolated. Further excavation or other construction work
will not occur in that area until advice from a suitably qualified environmental consultant is
provided confirming that any contaminated material has been removed and that the area
is suitable for further excavation or construction activity.
9. The location from which potentially contaminated materials is excavated and the location
of the stockpile of excavated material will be recorded on a site plan. Records will include

67
an outline of the area and depth of the potentially contaminated materials and the volume
of material excavated.
10. A suitably qualified environmental consultant will assess the potentially contaminated
material and prepare a report advising whether the material is contaminated at levels
exceeding the NSW EPA endorsed guidelines for reuse on-site and/or whether the material
needs to be disposed of off-site as waste, and the classification of that waste.
11. Where contaminated material is assessed as being unsuitable for reuse on site, the area
where the material was excavated will require validation.
For asbestos
Unexpected asbestos / ACM find procedure
In the event that a person on site identifies or disturbs asbestos / ACM that is not already
identified in the Asbestos Register, GEJV will follow all reporting and notification requirements
in OACEMP Appendix A7 Roads and Maritime Environmental Incident Classification and
Reporting Procedure, including notifying the ER. GEJV will also undertake the following
actions:
 Stop work in the area potentially impacted by ACM as soon as it is safe to do so and
move to the upwind side of the area, or away from the area.
 Assess the potential immediate risk to human health posed by the unexpected find and
assess if evacuation is necessary.
 Delineate an exclusion zone around the affected area using fencing and/or appropriate
barriers and signage. Keeping soil damp will minimise the release of fibres to air.
 Contact the Environmental Scientist / Engineer for advice and request a site visit to
undertake a risk assessment of the unexpected find and determine what further
assessment and/or remediation works are required.
 Implement advice and validate outcomes are assessed by the Environmental Scientist
/ Engineer to be satisfactory. Document outcome, presenting recommendations to the
Roads and Maritime Project Manager.
 The Roads and Maritime Project Manager to confirm that works may resume in the
affected area, in consultation with the ER.
Note: Where a NSW EPA Accredited Site Auditor has been engaged, Roads and Maritime in
consultation with the specialist Contaminated Land Consultant, will inform the Site Auditor of the
unexpected find and proposed measures to remediate/manage risks from ACM. These measures
should be endorsed by the Site Auditor before implementation.
The unexpected asbestos management procedure during Construction is summarised in the

flow chart (below)
Where small fragments of ACM or suspected ACM are found, and provided that:
 The total number of fragments is < 20, or

 The total surface area of the fragment/piece is < 1 m2, or
 The fragments are spread over an area of < 10 m2, and
 The fragments are non-friable and located on ground surface or within the topsoil layer
then the Contractor Environmental Scientist / Engineer will collect any fragments and
place it in a 200 mm polythene bag for later disposal at an appropriate waste facility. A
detailed visual inspection of the area will be carried out by the Contractor
Environmental Scientist /
 Engineer, which will involve wet raking of the areas to a depth of 10 cm for any further
fragments. If no further fragments are identified, works can continue.

If, during the visual inspection, the Contractor Environmental Scientist / Engineer determines
that the criteria described above are exceeded, or if suspected asbestos / ACM continues to
be identified during excavation works and/or if it is thought that any uncovered material might
be considered asbestos containing and friable, works will cease and the Environmental
Scientist / Engineer will assess the situation and determine an appropriate course of action in
accordance with Section 4.
I f required the GEJV will engage an Environmental Scientist / Engineer will remove samples
of the material for testing at a NATA-accredited laboratory and will monitor airborne dust
levels. Following testing, the Environmental Scientist / Engineer will determine and report:
 if the asbestos is non-friable or friable
 the extent of the contamination
 options for the appropriate remediation of the area (Section 4)
 the requirement for a licenced asbestos removalist (Section 4)
 The requirement for health screening of workers on site.

Asbestos Management Procedure during Construction
Figure 5-8

67
Appendix E
Roads and Maritime Unexpected Heritage Items
Procedure
In the event that an item is discovered, Figure 5-9 shall be followed and the Project ESR will
be contacted.
The following actions will directly comply with the Roads and Maritime Unexpected Heritage
Items Procedure as per Annexure B in Appendix B5 - Construction Cultural Heritage
Management Plan.
Unexpected Heritage Items Procedure
Figure 5-9

67
Appendix A5
Document Register
Register of Project environmental documents
Management CEMP Relevant procedures/programs Recipient/ review by

Plan Ref
Legal and App A1 Compliance tracking matrix Roads and Maritime
Contractual
Requirements
Environmental App A2 Project risk register Roads and Maritime
Aspects and
Impacts Register
Environmental App A3 Roads and Maritime
policy
Ancillary Facility App A4 Minor Ancillary facility checklist and The Secretary, DP&E
Management Plan procedure.
Consultation required with
EPA, Liverpool City Council
Sensitive Area App A6 Roads and Maritime
Plans
Construction Traffic App B1 Construction Traffic Management Roads and Maritime, ER
Management Plan Plan
Construction Flora App B2 Unexpected Threatened Species or Roads and Maritime, ER

and Fauna EECs Finds Procedure
Management Sub
Fauna Handling and Rescue
Plan
Procedure
Weed and Pathogen Management
Plan
Vegetation Clearing Procedure
Construction Noise App B3 Construction Noise and Vibration Roads and Maritime, ER
and Vibration Monitoring Program
Management Sub
Out of Hours Work Procedure
Plan
Construction Soil App B4 Water, Soil and Contamination Roads and Maritime, ER
and Water Monitoring Program Sediment Basin
Management Sub Management and Discharge
Plan Procedure
Dewatering of Site Excavations
Dam Dewatering Procedure
Stockpile Management Protocol
Management of Tannins from
Vegetation Mulch Procedure
Concept Erosion and Sediment
Control Plans
Construction App B5 Unexpected Heritage Items Roads and Maritime ER

Cultural Heritage Procedure
Management Sub
Plan
Management CEMP Relevant procedures/programs Recipient/ review by
Plan Ref
Construction Air App B6 Construction Air Quality Monitoring Roads and Maritime, ER
Quality Program
Management Sub
Plan
Construction Waste App B7 Waste Management Register Roads and Maritime
and Energy
Coal Tar Asphalt Management Plan
Management Sub
Plan Location of waste facilities
Construction App B8 Unexpected Discovery of Roads and Maritime, ER

Contaminated Land Contaminated Land Procedure
Management Sub
Asbestos Management Plan
Plan
Other Management App B9 Roads and Maritime
Measures Sub Plan
Construction App B10 Roads and Maritime, ER
Sustainability
Management Plan
PIRMP App B11 Roads and Maritime
Construction App B12 Roads and Maritime

Community Liaison
Plan
Environmental App A7 Environmental incident classification Issued for information to
procedures and reporting procedure Roads and Maritime
App A9 Georgiou Nonconformity and

corrective and preventative action
procedure
App A10 Georgiou auditing, review and
inspection standard
Environmental App A8 Environmental work method EWMS to be approved

work method statement register individually under hold points
statements by Roads and Maritime
Appendix A6
Sensitive area plans
Appendix A7
Environmental incident classification and reporting
procedure
(QYLURQPHQWDO,QFLGHQW
&ODVVLILFDWLRQDQG
5HSRUWLQJ3URFHGXUH
6HSWHPEHU
7+,63$*(,6/()7,17(17,21$//<%/$1.
$ERXWWKLVUHOHDVH
7LWOH (QYLURQPHQWDO,QFLGHQW&ODVVLILFDWLRQDQG5HSRUWLQJ3URFHGXUH
$SSURYDO
3UHSDUHGE\ (QYLURQPHQW0DQDJHU3HUIRUPDQFH,PSURYHPHQW 6FRWW0DFKDU
5HYLHZHGE\ 'LUHFWRU(QYLURQPHQW2SHUDWLRQV 6DOO\'XUKDP
$SSURYHGE\ 'LUHFWRU(QYLURQPHQW 0LFKDHO&URZOH\
'RFXPHQW&RQWURO
9HUVLRQ 5HOHDVHGDWH 6HSWHPEHU
3XEOLFDWLRQ1XPEHU 506 ,6%1
3DJH
&RQWHQWV
$ERXWWKLVUHOHDVH
$FURQ\PVDQGGHILQLWLRQV
,QWURGXFWLRQ
$LP
2EMHFWLYHV
6FRSHDQGFRYHUDJH
(QYLURQPHQWDOLQFLGHQWFODVVLILFDWLRQ
(QYLURQPHQWDOLQFLGHQWUHVSRQVH
&RQVLGHUDWLRQVDQGVWHSVIRUHQYLURQPHQWDOLQFLGHQWUHVSRQVH
&ULWLFDOLQFLGHQWV
(QYLURQPHQWDOLQFLGHQWUHSRUWLQJ
(QYLURQPHQWDOLQFLGHQWUHSRUWIRUP
&RPSOHWLQJWKHLQFLGHQWUHSRUWIRUP
6XEPLWWLQJWKHLQFLGHQWUHSRUWIRUP
5RDGVDQG0DULWLPHFRQWDFWV
5HJXODWRU\DJHQF\QRWLILFDWLRQ
1RWLILFDWLRQRI0DWHULDO+DUPSROOXWLRQLQFLGHQWV
'HILQLWLRQRI0DWHULDO+DUPSROOXWLRQLQFLGHQWV
'HWHUPLQLQJLIDQLQFLGHQWVKRXOGEHFRQVLGHUHG0DWHULDO+DUP
5HOHYDQWDXWKRULWLHVWRQRWLI\
7KHUHOHYDQWLQIRUPDWLRQWRSURYLGH
6XPPDU\RIRWKHUUHJXODWRU\DJHQF\QRWLILFDWLRQUHTXLUHPHQWV
5HTXHVWVIRUZULWWHQUHSRUWVIURPUHJXODWRU\DXWKRULWLHVDFWLYLWLHVGHOLYHUHGLQWHUQDOO\E\5RDGV
DQG0DULWLPH
3DJH
$FURQ\PVDQGGHILQLWLRQV
$FURQ\P 'HILQLWLRQ
'( 5RDGVDQG0DULWLPH6HUYLFHV'LUHFWRU(QYLURQPHQW
'(2 5RDGVDQG0DULWLPH6HUYLFHV'LUHFWRU(QYLURQPHQW2SHUDWLRQV
'3( 'HSDUWPHQWRI3ODQQLQJDQG(QYLURQPHQW
(QYLURQPHQWDOKDUP $Q\DFWWKDWGHJUDGHVRUSROOXWHVWKHHQYLURQPHQW
(3$ 16:(QYLURQPHQW3URWHFWLRQ$XWKRULW\
(3 $$FW (QYLURQPHQWDO3ODQQLQJDQG$VVHVVPHQW$FW
(3%&$FW (QYLURQPHQW3URWHFWLRQDQG%LRGLYHUVLW\&RQVHUYDWLRQ$FW
(3/ (QYLURQPHQW3URWHFWLRQ/LFHQFH
32(2$FW 3URWHFWLRQRIWKH(QYLURQPHQW2SHUDWLRQV$FW
5() 5HYLHZRI(QYLURQPHQWDO)DFWRUV
5RDGVDQG0DULWLPH 16:5RDGVDQG0DULWLPH6HUYLFHV
6(4& 5RDGVDQG0DULWLPH6HUYLFHV6DIHW\(QYLURQPHQWDQG4XDOLW\&RRUGLQDWRU
6(42 5RDGVDQG0DULWLPH6HUYLFHV6DIHW\(QYLURQPHQWDQG4XDOLW\2IILFHU
3DJH
,QWURGXFWLRQ
$LP
7KH(QYLURQPHQWDO,QFLGHQW&ODVVLILFDWLRQDQG5HSRUWLQJ3URFHGXUHWKH3URFHGXUHDLPVWRHQVXUH5RDGV
DQG0DULWLPH6HUYLFHVZRUNHUVDQGFRQWUDFWRUVXQGHUVWDQGKRZWRFODVVLI\UHVSRQGWRDQGUHSRUW
HQYLURQPHQWDOLQFLGHQWVWKDWRFFXUDVDUHVXOWRI5RDGVDQG0DULWLPHPDQDJHGDFWLYLWLHV
2EMHFWLYHV
7KHREMHFWLYHVRIWKH3URFHGXUHDUHWR
x (QVXUHDOOUHOHYDQW5RDGVDQG0DULWLPHZRUNHUVPDQDJHUVDQGFRQWUDFWRUVDUHPDGHDZDUHRI
HQYLURQPHQWDOLQFLGHQWVSURPSWO\DQGFDQUHVSRQGDFFRUGLQJO\
x (QVXUHVLWHZRUNHUVXQGHUVWDQGWKHLPPHGLDWHHQYLURQPHQWDOLQFLGHQWUHSRUWLQJUHTXLUHPHQWV
x (QVXUHDOOZRUNHUVXQGHUVWDQGUHSRUWLQJWLPHIUDPHVLQFOXGLQJVWDWXWRU\UHTXLUHPHQWV
x (QVXUHLQFLGHQWVDUHUHSRUWHGWRHQDEOHPRQLWRULQJVKDULQJRIOHVVRQVOHDUQWDQGUHVSRQVHWRHPHUJLQJ
HQYLURQPHQWDOLQFLGHQWWUHQGV
x &RPSO\ZLWKVWDWXWRU\REOLJDWLRQVWRUHSRUWFHUWDLQHQYLURQPHQWDOLQFLGHQWVWRUHJXODWRUVDQGRWKHU
UHOHYDQWJRYHUQPHQWDJHQFLHVVHHVHFWLRQ
6FRSHDQGFRYHUDJH
7KLV3URFHGXUHLVDSSOLFDEOHWRDOO5RDGVDQG0DULWLPHDFWLYLWLHVZKHUHHQYLURQPHQWDOLQFLGHQWVPD\RFFXU
7KLVLQFOXGHVEXWLVQRWOLPLWHGWR
x 7HPSRUDU\DFWLYLWLHVVXFKDVSUHOLPLQDU\LQYHVWLJDWLRQVHJJHRWHFKQLFDODQGHQYLURQPHQWDOVXUYH\V
DQGWKHFRQVWUXFWLRQDQGPDLQWHQDQFHRI5RDGVDQG0DULWLPHDVVHWV
x $FWLYLWLHVDW5RDGVDQG0DULWLPHSURSHUWLHVDQGIDFLOLWLHV
x 9HVVHOVRSHUDWHGE\0DULWLPHGLYLVLRQ
x $FWLYLWLHVXQGHUWDNHQE\FRQWUDFWRUVRQEHKDOIRI5RDGVDQG0DULWLPH
7KHUHTXLUHPHQWVRIWKLV3URFHGXUHPXVWEHFRPPXQLFDWHGWRDOO5RDGVDQG0DULWLPHZRUNHUVDQG
FRQWUDFWRUVHJGXULQJLQGXFWLRQVZKRDUHXQGHUWDNLQJDFWLYLWLHVZKHUHLQFLGHQWVPD\RFFXU
7KH3URFHGXUHLVIRULQWHUQDOUHSRUWLQJSURFHVVHVH[FHSWZKHUHLQFLGHQWVDUHLGHQWLILHGWKDWQHHGWREH
QRWLILHGWRUHJXODWRUVDQGRWKHUUHOHYDQWDXWKRULWLHVVHHVHFWLRQ
7KHSURFHGXUHGRHV127FRYHUHQYLURQPHQWDOLQFLGHQWVFDXVHGE\
x 2SHUDWLRQDOURDGDQGWUDIILFDFWLYLWLHVRIWKHJHQHUDOSXEOLFHJYHKLFOHDFFLGHQWVILUHVFDXVHGE\
GLVFDUGHGFLJDUHWWHEXWWV
x %RDWLQJDFFLGHQWVH[FHSWWKRVHLQYROYLQJ5RDGVDQG0DULWLPHYHVVHOV
x 'XPSLQJRIPDWHULDOVE\PHPEHUVRIWKHSXEOLFRQ5RDGVDQG0DULWLPHURDGVLGHVRUODQGH[FHSW
ZKHUHKD]DUGRXVPDWHULDOVDUHXQH[SHFWHGO\IRXQGGXULQJURDGFRQVWUXFWLRQRUPDLQWHQDQFHDFWLYLWLHV
,OOHJDOGXPSLQJVKRXOGEHUHSRUWHGWRWKH16:(QYLURQPHQW3URWHFWLRQ$XWKRULW\(3$
x 0DULQHRLODQGFKHPLFDOVSLOOVFRYHUHGE\WKH1DWLRQDO3ODQIRU0DULWLPH(QYLURQPHQWDO(PHUJHQFLHV
$XVWUDOLDQ0DULWLPH6DIHW\$XWKRULW\
3DJH
(QYLURQPHQWDO,QFLGHQW&ODVVLILFDWLRQDQG5HSRUWLQJ3URFHGXUH
(QYLURQPHQWDOLQFLGHQWFODVVLILFDWLRQ
7KHUHDUHWKUHHFDWHJRULHVRIHQYLURQPHQWDOLQFLGHQWVDVGHWDLOHGLQ7DEOH
7DEOH(QYLURQPHQWDOLQFLGHQWFODVVLILFDWLRQ
&DWHJRU\ 'HVFULSWLRQ ([DPSOHV
'LVFKDUJHRIZDWHUVIURPVLWHQRWLQDFFRUGDQFHZLWKDQ\DSSURYDOUHTXLUHPHQWVHJ
GLVFKDUJHFULWHULDLQDQ5HYLHZRI(QYLURQPHQWDO)DFWRUV5()VDIHJXDUGRU(QYLURQPHQW
3URWHFWLRQ/LFHQFH(3/FRQGLWLRQ
3ROOXWLRQRUSRWHQWLDOSROOXWLRQRIZDWHUV
3RWHQWLDOEUHDFKHVRIOHJLVODWLRQRU 8QPDQDJHGYHKLFOHWUDFNLQJRIPDWHULDOVRUHPLVVLRQVRIGXVWRIIHQVLYHRGRXUVRUQRLVH
3ROOXWLRQ EH\RQGWKHVLWHERXQGDU\WKDWDUHQRWPDQDJHGLQDFFRUGDQFHZLWKDSSURYDOUHTXLUHPHQWV
IDLOXUHVRISURFHVVWKDWUHVXOWLQDFWXDORII ,QFLGHQWV
VLWHHQYLURQPHQWDOKDUPRUUHVLGXDORQ DQGRUPLJKWLPSDFWRQQHDUE\ODQGXVHUV
VLWHHQYLURQPHQWDOKDUP
3ROOXWLRQLQFLGHQWVWKDWWKUHDWHQKDUPWRWKHKHDOWKRUVDIHW\RISHRSOHHJRGRXUV
RU
:RUNVXQGHUWDNHQRXWVLGHDSSURYHG 8QDXWKRULVHGRULOOHJDOGLVSRVDORUWUDQVSRUWRIZDVWH
&DWHJRU\ DUHDVZLWKRXWUHTXLUHGDSSURYDORU
ZLWKRXWHQYLURQPHQWDODVVHVVPHQW $VSLOORURWKHULQFLGHQWWKDWFDXVHVSROOXWLRQWRODQG
RU
$Q\0DWHULDO+DUPSROOXWLRQLQFLGHQWDV 8QDXWKRULVHGKDUPRUGDPDJHWRQDWLYHIORUDDQGIDXQDWHUUHVWULDORUDTXDWLFPDULQH
GHILQHGE\3DUWRIWKHProtection of
the Environment Operations Act 1997 &RQVHUYDWLRQ 8QDXWKRULVHGGUHGJLQJRUUHFODPDWLRQZRUNVZLWKLQDZDWHUFRXUVH
32(2$FW %UHDFKHV
$ILUHFDXVHGE\5RDGVDQG0DULWLPHDFWLYLWLHVWKDWWUDYHOVEH\RQGWKHERXQGDU\FDXVLQJRU
SRWHQWLDOO\FDXVLQJKDUPWRWKHHQYLURQPHQWRUFRPPXQLW\
8QDXWKRULVHGKDUPWR$ERULJLQDOREMHFWVDQG$ERULJLQDOSODFHV
+HULWDJH
%UHDFKHV 8QDXWKRULVHGGDPDJHWRDQ\6WDWHRUORFDOO\VLJQLILFDQWUHOLFRU+HULWDJHLWHPRULWHPOLVWHG
RQWKH5RDGVDQG0DULWLPH6HFWLRQUHJLVWHU
3DJH
)DLOXUHWRFRPSO\ZLWKWKHUHTXLUHPHQWVRI
x 7KH(QYLURQPHQWDO3ODQQLQJDQG$VVHVVPHQW$FW(3 $$FWLQFOXGLQJH[HPSW
DFWLYLWLHV3DUWGHWHUPLQDWLRQVDQG3DUWDSSURYDOV
3ODQQLQJDQG x $Q(QYLURQPHQW3URWHFWLRQDQG%LRGLYHUVLW\&RQVHUYDWLRQ$FW(3%&$FW
FRPSOLDQFH DSSURYDO
EUHDFKHV
x $Q(3/
x $&(03RUHQYLURQPHQWDOZRUNPHWKRGVWDWHPHQW
x $SHUPLWIURPDUHJXODWRUHJXQGHUWKH)LVKHULHV0DQDJHPHQW$FW
$SURFHGXUDODGPLQLVWUDWLYHRUWHFKQLFDOEUHDFKRIHQYLURQPHQWDOUHTXLUHPHQWVLQFOXGLQJ
x )DLOXUHWRSUHSDUHRUVXEPLWUHTXLUHGGRFXPHQWVUHSRUWVRURWKHUFRUUHVSRQGHQFH
x )DLOXUHWRFRPSO\ZLWKWKHUHTXLUHPHQWVRI
o 7KH(QYLURQPHQWDO3ODQQLQJDQG$VVHVVPHQW$FW(3 $$FWLQFOXGLQJH[HPSWDFWLYLWLHV
)DLOXUHVRISURFHVVRUHYHQWVWKDWGRQRW 3DUWGHWHUPLQDWLRQVDQG3DUWDSSURYDOV
UHVXOWLQRIIVLWHHQYLURQPHQWDOKDUPRU o $Q(QYLURQPHQW3URWHFWLRQDQG%LRGLYHUVLW\&RQVHUYDWLRQ$FW(3%&$FWDSSURYDO
UHVLGXDORQVLWHHQYLURQPHQWDOKDUP o $Q(3/
&DWHJRU\
7KHVHLQFLGHQWVPD\UHVXOWLQWHPSRUDU\
RQVLWHHQYLURQPHQWDOKDUPWKDWFDQEH o $&(03RUHQYLURQPHQWDOZRUNPHWKRGVWDWHPHQW
UHFWLILHGWRSUHH[LVWLQJFRQGLWLRQV o $SHUPLWIURPDUHJXODWRUHJXQGHUWKH)LVKHULHV0DQDJHPHQW$FW
6SLOOVDQGGLVFKDUJHVWKDWGRQRWOHDYHDVLWHERXQGDU\DQGDUHFOHDQHGXSZLWKRXWUHVLGXDORQVLWH
HQYLURQPHQWDOKDUPDQGWKHDUHDRIWHPSRUDU\LPSDFWFDQEHUHVWRUHGWRSUHH[LVWLQJFRQGLWLRQV
$ILUHWKDWLVFRQWDLQHGRQVLWHDQGGRHVQRWFDXVHRUSRWHQWLDOO\FDXVHDGYHUVHLPSDFWWRWKHHQYLURQPHQWRU
FRPPXQLW\
6HGLPHQWRUVLWHZDWHUWUDYHOOLQJEH\RQGDVLWHERXQGDU\DQGZKHUHLWFDQEHGHPRQVWUDWHGWKDW
x (URVLRQDQGVHGLPHQWFRQWUROVZHUHLQVWDOOHGDQGPDLQWDLQHGLQDFFRUGDQFHZLWKDQHURVLRQDQG
VHGLPHQWFRQWUROSODQDQG
$QHYHQWRUXQH[SHFWHGILQGWKDWRFFXUV
x 7KHFDXVHRIWKHLQFLGHQWZDVUHDVRQDEO\XQIRUHVHHQRUWKHZHDWKHUUDLQZLQGHWFHYHQWH[FHHGHGWKH
RXWVLGHWKHVFRSHRIUHDVRQDEOH
5HSRUWDEOH(YHQW GHVLJQFDSDFLW\RIFRQWUROV
HQYLURQPHQWDOFRQWUROVDQGPLWLJDWLRQ
PHDVXUHV 1RWHWKHVHHYHQWVDUHFRQVLGHUHGWRKDYHRFFXUUHGDQGWKHUHVSRQVHVKRXOGFRPPHQFHLQDFFRUGDQFHZLWK
6HFWLRQZKHQVHGLPHQWRUVLWHZDWHUILUVWWUDYHOVEH\RQGWKHVLWHERXQGDU\HJZKHQDQDSSURSULDWHO\
VL]HGDQGPDLQWDLQHGVHGLPHQWEDVLQFRPPHQFHVRYHUWRSSLQJ
$QXQH[SHFWHGDUFKDHRORJLFDOILQGWKDWLVEHLQJPDQDJHGLQDFFRUGDQFHZLWKWKH5RDGVDQG0DULWLPH
3DJH
6WDQGDUG0DQDJHPHQW3URFHGXUH 8QH[SHFWHG$UFKDHRORJLFDO)LQGV´
$QXQH[SHFWHGWKUHDWHQHGVSHFLHVILQGWKDWLVEHLQJPDQDJHGLQDFFRUGDQFHZLWKWKH³5RDGVDQG0DULWLPH
%LRGLYHUVLW\*XLGHOLQHV±XQH[SHFWHGWKUHDWHQHGVSHFLHVILQGVSURFHGXUH´
$QXQH[SHFWHGILQGRIFRQWDPLQDWHGVRLOVDVEHVWRVRURWKHUSRWHQWLDOO\KD]DUGRXVVXEVWDQFHVGXULQJ
FRQVWUXFWLRQRUPDLQWHQDQFHZRUNV1RWHWKDWRQFHDSDUWLFXODUFRQWDPLQDQWLVLGHQWLILHGRUIRXQGIRUWKHILUVW
WLPHHLWKHUGXULQJSURMHFWSODQQLQJRUFRQVWUXFWLRQSKDVHVLWLVWKHQUHDVRQDEO\H[SHFWHGWREHIRXQGVR
DGGLWLRQDOILQGVQHHGQRWEHUHSRUWHGLQWKLVFDWHJRU\
)RUPDOUHJXODWRU\DFWLRQIURPDQHQYLURQPHQWDOUHJXODWRULQFOXGHVEXWLVQRWOLPLWHGWR
x 3HQDOW\LQIULQJHPHQWQRWLFHV3,1V
)RUPDOUHJXODWRU\DFWLRQIURPDQ
HQYLURQPHQWDOUHJXODWRUWKDWKDVQRW x &OHDQXSQRWLFHV
5HJXODWRU\$FWLRQ
DOUHDG\EHHQUHSRUWHGLQFRQMXQFWLRQZLWK x 3UHYHQWLRQQRWLFHV
DQRWKHULQFLGHQW
x 2IILFLDOFDXWLRQVZDUQLQJV
x (3$VKRZFDXVHQRWLILFDWLRQV
1RWH)RUDQ\LQFLGHQWZKHUHWKHUHLVDVVRFLDWHGIRUPDOUHJXODWRU\DFWLRQIURPDQHQYLURQPHQWDOUHJXODWRUFRSLHVRIWKLVFRUUHVSRQGHQFHPXVWEHIRUZDUGHG
WRHQYRSV#UPVQVZJRYDXLQDGGLWLRQWRWKH(QYLURQPHQWDO,QFLGHQW5HSRUWVHHVHFWLRQ
3DJH
(QYLURQPHQWDOLQFLGHQWUHVSRQVH
&RQVLGHUDWLRQVDQGVWHSVIRUHQYLURQPHQWDOLQFLGHQWUHVSRQVH
7KHVWHSE\VWHSUHVSRQVHIRU&DWHJRU\LQFLGHQWV&DWHJRU\LQFLGHQWVDQG5HSRUWDEOH(YHQWVLV
GHWDLOHGLQ7DEOHDDFWLYLWLHVXQGHUWDNHQE\FRQWUDFWRUVDQG7DEOHEDFWLYLWLHVXQGHUWDNHQE\5RDGV
DQG0DULWLPH5HJLRQDO0DLQWHQDQFH+RZHYHUVRPHNH\SRLQWVDSSO\WKURXJKRXWDOOVWDJHVRIWKH
UHVSRQVHWRDQ\HQYLURQPHQWDOLQFLGHQW
x ,ILQGRXEWWUHDWDOOLQFLGHQWVDV&DWHJRU\WRHQVXUHUHSRUWLQJWLPHIUDPHVFDQEHPHW
x 6WURQJFRQVLGHUDWLRQVKRXOGEHJLYHQWRQRWLI\LQJ
o 5RDGVDQG0DULWLPH&RUSRUDWH&RPPXQLFDWLRQVIRUDQ\LQFLGHQWVWKDWKDYHSRWHQWLDOIRU
FRPPXQLW\RUPHGLDDWWHQWLRQVHHVHFWLRQ
o 5RDGVDQG0DULWLPH:RUN+HDOWKDQG6DIHW\%UDQFKIRUDQ\LQFLGHQWVWKDWLQYROYHDFWXDORU
SRWHQWLDOULVNVWRZRUNHUKHDOWKDQGVDIHW\VHHVHFWLRQ
x 7KHSHUVRQUHVSRQVLEOHIRURSHUDWLRQDOPDQDJHPHQWRIWKHVLWHDFWLYLW\VKDOODVVXPHUHVSRQVLELOLW\IRU
WKHUHVSRQVHWRWKHLQFLGHQWDQGGLUHFWDFWLRQVDVQHFHVVDU\DQGLQDFFRUGDQFHZLWKWKLV3URFHGXUH
x $5RDGVDQG0DULWLPH(QYLURQPHQW0DQDJHUFDQFRQVXOWZLWKWKH'LUHFWRU(QYLURQPHQW2SHUDWLRQV
'(2WRUHFODVVLI\WKHFDWHJRU\RIDQLQFLGHQWZKHUHDSSURSULDWH
$Q\5HJXODWRU\$FWLRQUHFHLYHGWKDWKDVQRWDOUHDG\EHHQUHSRUWHGLQFRQMXQFWLRQZLWKDQRWKHULQFLGHQW
VKRXOGEHLPPHGLDWHO\IRUZDUGHGWRWKHHQYRSV#UPVQVZJRYDXPDLOER[DQGIROORZHGE\DQLPPHGLDWH
SKRQHFDOOWRWKHUHOHYDQW5RDGVDQG0DULWLPH(QYLURQPHQW0DQDJHUZKRZLOOLPPHGLDWHO\DGYLVHWKH
'(2&RQVLGHUDWLRQVKRXOGWKHQEHJLYHQDVWRZKHWKHUDQHQYLURQPHQWDOLQFLGHQWKDVRFFXUUHGVHH
VHFWLRQWKDWVKRXOGEHUHSRUWHGLQDFFRUGDQFHZLWKWKLVVHFWLRQ
3DJH
7DEOHD(QYLURQPHQWDOLQFLGHQWUHVSRQVH DFWLYLWLHVXQGHUWDNHQE\FRQWUDFWRUV
5HVSRQVLELOLW\IRU 7LPHIUDPH
FRPSOHWLQJDFWLRQ
$FWLRQ &DWHJRU\
&DWHJRU\
6WHS
,QFLGHQWV
,QFLGHQWV
5HSRUWDEOH(YHQWV
6WRSZRUNLQUHOHYDQWDUHDLIQHFHVVDU\DQGWDNHDFWLRQVWRSUHYHQWDGYHUVHLPSDFWWRKXPDQKHDOWKRU
WKHHQYLURQPHQW 3HUVRQZKRLGHQWLILHV
,PPHGLDWH ,PPHGLDWH
1RWHKXPDQKHDOWKDQGVDIHW\LVWKHSULPDU\FRQFHUQDQGQRDFWLRQVKRXOGEHWDNHQLILWLVQRWVDIHWR LQFLGHQW
GRVR
3HUVRQZKRLGHQWLILHV
$GYLVHWKHFRQWUDFWRUVLWHPDQDJHPHQWWHDP ,PPHGLDWH ,PPHGLDWH
LQFLGHQW
$GYLVHWKH5RDGVDQG0DULWLPHSURMHFWPDQDJHPHQWWHDPDQGWKHUHOHYDQW5RDGVDQG0DULWLPH
&RQWUDFWRU ,PPHGLDWH 'D\RIWKHLQFLGHQW
(QYLURQPHQW0DQDJHU
&RQVLGHULIWKHLQFLGHQWLVDSROOXWLRQLQFLGHQWWKDWFRQVWLWXWHV0DWHULDO+DUPLQDFFRUGDQFHZLWK3DUW
RIWKH32(2$FW)RU0DWHULDO+DUPSROOXWLRQLQFLGHQWVQRWLI\UHOHYDQWDJHQFLHVVHHVHFWLRQ6LWHV &RQWUDFWRU ,PPHGLDWH ,PPHGLDWH
ZLWKDQ(3/VKRXOGLPSOHPHQWWKHLU3ROOXWLRQ,QFLGHQW5HVSRQVH0DQDJHPHQW3ODQ
$GYLVH'(2E\SKRQH7KH'(2PD\UHTXHVWSKRWRJUDSKVDQGDEULHIVXPPDU\RINQRZQLQIRUPDWLRQ
YLDHPDLO7KHIROORZLQJ5RDGVDQG0DULWLPHPDQDJHUVVKRXOGDOVREHQRWLILHGE\SKRQHDVUHOHYDQW ,PPHGLDWHO\
5RDGVDQG0DULWLPH
IROORZLQJDGYLFHRI 1$
x 'LUHFWRU(QYLURQPHQW0DMRU3URMHFWV (QYLURQPHQW0DQDJHU
WKHLQFLGHQW
x 'LUHFWRU(QYLURQPHQW0RWRUZD\V
:KHUHUHOHYDQWQRWLI\LQFLGHQWWRDSSURSULDWHUHJXODWRU\DJHQF\VHHVHFWLRQ1RWHWKLVGRHVQRW $VUHTXLUHGE\ $VUHTXLUHGE\
&RQWUDFWRU
UHIHUWRWKHUHTXLUHPHQWWRQRWLI\0DWHULDO+DUPSROOXWLRQVLQFLGHQWVVHH6WHS OHJLVODWLRQ OHJLVODWLRQ
&RPSOHWHWKHLQFLGHQWUHSRUWIRUPVHHVHFWLRQLQFOXGLQJVLJQRIIIURP5RDGVDQG0DULWLPH3URMHFW :LWKLQEXVLQHVV :LWKLQEXVLQHVV
&RQWUDFWRU
0DQDJHUDQGVXEPLWWR5RDGVDQG0DULWLPH(QYLURQPHQW0DQDJHU VHHVHFWLRQVDQG GD\VRIWKHLQFLGHQW GD\VRIWKHLQFLGHQW
5RDGVDQG0DULWLPH 2QWKHGD\RIUHFHLSW 2QWKHGD\RIUHFHLSW
6LJQDQGVXEPLWLQFLGHQWUHSRUWIRUPWRHQYRSV#UPVQVZJRYDX
(QYLURQPHQW0DQDJHU RIWKHIRUP RIWKHIRUP
)RU0DWHULDO+DUPSROOXWLRQLQFLGHQWVSURYLGHDZULWWHQUHSRUWWRHDFKUHOHYDQWDXWKRULW\VHHVHFWLRQ &RQWUDFWRU :LWKLQGD\VRIWKH
1$
LQFLGHQW
8QGHUWDNHLQFLGHQWLQYHVWLJDWLRQOHYHORILQYHVWLJDWLRQWREHDSSURSULDWHWRWKHVHYHULW\RIWKHLQFLGHQW
:LWKLQPRQWKRI
WRGHWHUPLQHURRWFDXVHDQGDQ\QHFHVVDU\FRUUHFWLYHDFWLRQV6XPPDULVHILQGLQJVLQµ,QFLGHQW/HVVRQV &RQWUDFWRU 1$
LQFLGHQW
/HDUQW¶WHPSODWHDQGVXEPLWWR(QYLURQPHQW0DQDJHUIRUUHYLHZ
5RDGVDQG0DULWLPH :LWKLQZHHNRI
6XEPLWILQDO,QFLGHQW/HVVRQV/HDUQWWRHQYRSV#UPVQVZJRYDX 1$
(QYLURQPHQW0DQDJHU UHFHLSW
5RDGVDQG0DULWLPH
&RQVLGHUWKHQHHGIRUDQ\UHTXLUHGFRUUHFWLYHDFWLRQVWREHDGGUHVVHGWKURXJKDPDQDJHPHQWV\VWHP
(QYLURQPHQW0DQDJHU $VDSSURSULDWH $VDSSURSULDWH
HJFRUUHFWLYHDFWLRQUHTXHVW
DQGSURMHFWWHDP
3DJH
$OWHUQDWHZRUNIORZVLJQDWRU\DUUDQJHPHQWVPD\EHUHTXLUHGIRUSURMHFWVZKHUHDWKLUGSDUW\LVLQYROYHGHJDGHOLYHU\DXWKRULW\7KHVHDUUDQJHPHQWVFDQEHFRQILUPHG

ZLWKWKHUHOHYDQW5RDGVDQG0DULWLPH(QYLURQPHQW0DQDJHU
7DEOHE(QYLURQPHQWDOLQFLGHQWUHVSRQVH DFWLYLWLHVXQGHUWDNHQE\5HJLRQDO0DLQWHQDQFHLQFOXGLQJFRQWUDFWRUVRU50&&RQEHKDOIRI5HJLRQDO0DLQWHQDQFH

5HVSRQVLELOLW\IRU 7LPHIUDPH
FRPSOHWLQJDFWLRQ
$FWLRQ &DWHJRU\
&DWHJRU\
6WHS
,QFLGHQWV
,QFLGHQWV
5HSRUWDEOH(YHQWV
6WRSZRUNLQUHOHYDQWDUHDLIQHFHVVDU\DQGWDNHDFWLRQVWRSUHYHQWDGYHUVHLPSDFWWRKXPDQKHDOWKRU
WKHHQYLURQPHQW 3HUVRQZKR
,PPHGLDWH ,PPHGLDWH
1RWHKXPDQKHDOWKDQGVDIHW\LVWKHSULPDU\FRQFHUQDQGQRDFWLRQVKRXOGEHWDNHQLILWLVQRWVDIHWRGR LGHQWLILHVLQFLGHQW
VR
$GYLVHWKH5RDGVDQG0DULWLPHVLWHPDQDJHPHQWWHDPDQGWKHUHOHYDQW5RDGVDQG0DULWLPH
3HUVRQZKR
(QYLURQPHQW0DQDJHUDQG6DIHW\(QYLURQPHQW4XDOLW\2IILFHU6(426DIHW\(QYLURQPHQW4XDOLW\&R ,PPHGLDWH ,PPHGLDWH
LGHQWLILHVLQFLGHQW
RUGLQDWRU6(4&
$GYLVH'(2E\SKRQH7KH'(2PD\UHTXHVWSKRWRJUDSKVDQGDEULHIVXPPDU\RINQRZQLQIRUPDWLRQ (QYLURQPHQW
,PPHGLDWH 1$
YLDHPDLO7KHUHOHYDQW5HJLRQDO0DLQWHQDQFH0DQDJHUPXVWDOVREHQRWLILHG 0DQDJHU
&RQVLGHULIWKHLQFLGHQWLVDSROOXWLRQLQFLGHQWWKDWFRQVWLWXWHV0DWHULDO+DUPLQDFFRUGDQFHZLWK3DUW ,PPHGLDWHO\
RIWKH32(2$FW)RU0DWHULDO+DUPSROOXWLRQLQFLGHQWVQRWLI\UHOHYDQWDJHQFLHVVHHVHFWLRQ6LWHV '(2 IROORZLQJDGYLFHRI 1$
ZLWKDQ(3/VKRXOGLPSOHPHQWWKHLU3ROOXWLRQ,QFLGHQW5HVSRQVH0DQDJHPHQW3ODQ WKHLQFLGHQW
:KHUHUHOHYDQWQRWLI\LQFLGHQWWRDSSURSULDWHUHJXODWRU\DJHQF\VHHVHFWLRQ1RWHWKLVGRHVQRW (QYLURQPHQW $VUHTXLUHGE\ $VUHTXLUHGE\

UHIHUWRWKHUHTXLUHPHQWWRQRWLI\0DWHULDO+DUPSROOXWLRQVLQFLGHQWVVHH6WHS 0DQDJHU OHJLVODWLRQ OHJLVODWLRQ
5HOHYDQW5RDGVDQG
&RPSOHWHWKHLQFLGHQWUHSRUWIRUPVHHVHFWLRQLQFOXGLQJVLJQRIIIURP5RDGVDQG0DULWLPH3URMHFW :LWKLQEXVLQHVV :LWKLQEXVLQHVV
0DULWLPHVLWH
0DQDJHUDQGVXEPLWWR6(4&VHHVHFWLRQ GD\VRIWKHLQFLGHQW GD\VRIWKHLQFLGHQW
UHSUHVHQWDWLYH
2QWKHGD\RI 2QWKHGD\RI
6(4&WRVLJQDQGVXEPLWLQFLGHQWUHSRUWIRUPWRUHOHYDQW(QYLURQPHQW0DQDJHUVHHVHFWLRQ 6(4&
UHFHLSWRIWKHIRUP UHFHLSWRIWKHIRUP
(QYLURQPHQW 2QWKHGD\RI 2QWKHGD\RI
6LJQDQGVXEPLWLQFLGHQWUHSRUWIRUPWRHQYRSV#UPVQVZJRYDX
0DQDJHU UHFHLSWRIWKHIRUP UHFHLSWRIWKHIRUP
:LWKLQGD\VRIWKH
)RU0DWHULDO+DUPSROOXWLRQLQFLGHQWVSURYLGHDZULWWHQUHSRUWWRHDFKUHOHYDQWDXWKRULW\VHHVHFWLRQ '(2 1$
LQFLGHQW
8QGHUWDNHLQFLGHQWLQYHVWLJDWLRQOHYHORILQYHVWLJDWLRQWREHDSSURSULDWHWRWKHVHYHULW\RIWKHLQFLGHQWWR
GHWHUPLQHURRWFDXVHDQGDQ\QHFHVVDU\FRUUHFWLYHDFWLRQV6XPPDULVHILQGLQJVLQµ,QFLGHQW/HVVRQV :LWKLQPRQWKRI
6(4& 1$
/HDUQW¶WHPSODWHDQGVXEPLWERWKWR(QYLURQPHQW0DQDJHUIRUUHYLHZ&RQVLGHUWKHQHHGIRUDQ\UHTXLUHG LQFLGHQW
FRUUHFWLYHDFWLRQVWREHDGGUHVVHGWKURXJKDPDQDJHPHQWV\VWHPHJFRUUHFWLYHDFWLRQUHTXHVW
5RDGVDQG0DULWLPH
:LWKLQZHHNRI
6XEPLWILQDO,QFLGHQW/HVVRQV/HDUQWWRHQYRSV#UPVQVZJRYDX (QYLURQPHQW 1$
0DQDJHU
UHFHLSW
3DJH
&RSLHVRIIRUPDOUHJXODWRU\DFWLRQIURPDQHQYLURQPHQWDOUHJXODWRUWKDWKDVQRWDOUHDG\EHHQUHSRUWHGLQ
FRQMXQFWLRQZLWKDQRWKHULQFLGHQWPXVWEHIRUZDUGHGWRWKHUHOHYDQW5RDGVDQG0DULWLPH(QYLURQPHQW
0DQDJHUDQG6(4&6(42IRU5HJLRQDO0DLQWHQDQFHSURMHFWVDQGHQYRSV#UPVQVZJRYDXLPPHGLDWHO\
XSRQUHFHLSW
&ULWLFDOLQFLGHQWV
6RPH&DWHJRU\LQFLGHQWVUHTXLUHHVFDODWLRQVRUHOHYDQWPHPEHUVRIWKH5RDGVDQG0DULWLPH([HFXWLYH
DUHDZDUHRIWKHLQFLGHQWDQGUHDG\WRUHVSRQGDVQHFHVVDU\&DWHJRU\LQFLGHQWVZLOOEHGHHPHGµ&ULWLFDO
,QFLGHQWV¶IRUHVFDODWLRQWRWKH([HFXWLYHZKHQWKH\KDYHWKHSRWHQWLDOIRU
x 5HJXODWRU\DFWLRQHJ(3$3HQDOW\,QIULQJHPHQW1RWLFHDQGRU
x 5HSXWDWLRQDOGDPDJHHJPHGLDFRYHUDJHDQGRU
x 6LJQLILFDQWHQYLURQPHQWDOKDUP
*XLGLQJIDFWRUVWKDWZLOOEHFRQVLGHUHGZKHQGHWHUPLQLQJZKHWKHUWKHUHKDVEHHQµVLJQLILFDQW¶
HQYLURQPHQWDOKDUPLQFOXGH
x :KHQWKHUHKDVEHHQDFWXDORUSRWHQWLDOKDUPWRWKHKHDOWKRUVDIHW\RISHRSOHRUWRWKHHQYLURQPHQW
WKDWLVQRWWULYLDO
x $FWLRQVUHTXLUHGWRSUHYHQWPLWLJDWHRUPDNHJRRGWKHDFWXDORUSRWHQWLDOHQYLURQPHQWDOKDUPDUHOLNHO\
WRH[FHHG
:KHQDSRWHQWLDOµ&ULWLFDO,QFLGHQW¶LVUHSRUWHGWKH'(2ZLOOLPPHGLDWHO\EULHIWKH'LUHFWRU(QYLURQPHQW
'(ZKRZLOOPDNHDGHWHUPLQDWLRQRQZKHWKHULWZLOOEHFRQVLGHUHGDµ&ULWLFDO,QFLGHQW¶7KH'(ZLOOWKHQ
EULHIWKH5RDGVDQG0DULWLPH&KLHI([HFXWLYHDQGUHOHYDQW([HFXWLYH'LUHFWRUDVZHOODVDQ\RWKHU
PHPEHUVRIWKH([HFXWLYHDVDSSURSULDWH:KHQWKH'(FDQQRWEHFRQWDFWHGWKH'(2ZLOOPDNHWKH
GHWHUPLQDWLRQDQGPDNHWKHUHOHYDQW([HFXWLYHEULHILQJV
3DJH
(QYLURQPHQWDOLQFLGHQWUHSRUWLQJ
(QYLURQPHQWDOLQFLGHQWUHSRUWIRUP
7KH(QYLURQPHQWDO,QFLGHQW5HSRUW)RUPVKRXOGEHFRPSOHWHGIRU&DWHJRU\LQFLGHQWV&DWHJRU\
LQFLGHQWVDQG5HSRUWDEOH(YHQWVDQGLVDYDLODEOHRQWKH5RDGVDQG0DULWLPHZHEVLWH
&RPSOHWLQJWKHLQFLGHQWUHSRUWIRUP
$OOSDUWVRIWKH,QFLGHQW5HSRUW)RUPPXVWEHFRPSOHWHGLQDFFRUGDQFHZLWKWKLVSURFHGXUHDQGIROORZLQJ
WKHLQVWUXFWLRQVZLWKLQWKHIRUP7KH)RUPDQGDQ\VXEVHTXHQWUHSRUWVPXVWRQO\LQFOXGHIDFWXDO
LQIRUPDWLRQ6SHFXODWLRQDERXWWKHFDXVHVDQGRXWFRPHVRILQFLGHQWVDUHQRWWREHLQFOXGHG
7KH)RUPPXVWEHVLJQHGE\WKHIROORZLQJ
6LJQDWRU\ 5HDVRQ
7KHSHUVRQPDNLQJWKH 7KHSHUVRQZLWQHVVHGWKHLQFLGHQWRUKDVWKHPRVWNQRZOHGJHRIWKHLQFLGHQWDQGFDQ
UHSRUW SURYLGHVXIILFLHQWIDFWXDOLQIRUPDWLRQ
7RHQVXUHDOOUHOHYDQW5RDGVDQG0DULWLPHSDUWLHVFDQEHPDGHDZDUHRIWKHLQFLGHQWDQG
7KH5RDGVDQG
DSSURSULDWHUHVRXUFHVFDQEHDOORFDWHGDQGRUDSSURYHGWRUHVSRQGWRWKHLQFLGHQW7KLV
0DULWLPH3URMHFW
DOVRHQVXUHVWKHSURMHFWPDQDJHPHQWWHDPDUHDZDUHRIDQ\HQYLURQPHQWDOSHUIRUPDQFH
0DQDJHU
WUHQGVLIPXOWLSOHLQFLGHQWVRFFXU
6DIHW\(QYLURQPHQWDQG
4XDOLW\&RRUGLQDWRU 7RHQVXUH5HJLRQDO0DLQWHQDQFHPDQDJHPHQWV\VWHPVWDIIDUHDZDUHRIWKHLQFLGHQWDQG
5RDGVDQG0DULWLPH DQ\QHFHVVDU\PDQDJHPHQWV\VWHPFKDQJHVFDQEHPDGHRQFHFRUUHFWLYHDFWLRQVDQG
5HJLRQDO0DLQWHQDQFH OHVVRQVOHDUQWDUHILQDOLVHG
RQO\
7KHUHOHYDQW5RDGVDQG
&RQFXUUHQFHWKDWWKHLQFLGHQWLVDGHTXDWHO\GHVFULEHGDQGWKHLPPHGLDWHDFWLRQVDQG
0DULWLPH(QYLURQPHQW
FRUUHFWLYHDFWLRQVDUHDSSURSULDWH
0DQDJHU
$VQRWHGLQ7DEOHDDOWHUQDWHVLJQDWRU\DUUDQJHPHQWVPD\EHUHTXLUHGIRUSURMHFWVZKHUHDWKLUGSDUW\LV
LQYROYHGHJDGHOLYHU\DXWKRULW\7KHVHDUUDQJHPHQWVFDQEHFRQILUPHGZLWKWKHUHOHYDQW5RDGVDQG
0DULWLPH(QYLURQPHQW0DQDJHU
6XEPLWWLQJWKHLQFLGHQWUHSRUWIRUP
$OO,QFLGHQW5HSRUW)RUPVPXVWEHSRSXODWHGVLJQHGDQGVXEPLWWHGHOHFWURQLFDOO\QHYHUSULQWHGVLJQHG
VFDQQHGHWFWRHQDEOH5RDGVDQG0DULWLPHWRHOHFWURQLFDOO\FDSWXUHWKHLQIRUPDWLRQHQWHUHGLQWKHIRUP
&RPSOHWHG,QFLGHQW5HSRUW)RUPVVKRXOGEHVXEPLWWHGE\WKH5RDGVDQG0DULWLPH(QYLURQPHQW0DQDJHU
WRWKH(QYLURQPHQW2SHUDWLRQVPDLOER[
x HQYRSV#UPVQVZJRYDX
,WLVHVVHQWLDOWKDWDFOHDUDQGFRQVLVWHQWVXEMHFWOLQHFRQYHQWLRQLVXVHGWRDOORZWUDFNLQJRI
FRUUHVSRQGHQFHDERXWHDFKLQFLGHQW$OOHPDLOVDERXWDQLQFLGHQWEHWZHHQDOOSDUWLHVVKRXOGVWUXFWXUHWKH
VXEMHFWOLQHDVIROORZV
x &DWHJRU\; SURMHFWQDPHLQFLGHQWORFDWLRQ GDWH
x )RUH[DPSOH&DWHJRU\±0DLQ5RDG8SJUDGH±GGPP\\
:KHUHLQIRUPDWLRQFDQQRWEHJDWKHUHGZLWKLQWKHWLPHIUDPHVVHWRXWLQWKLV3URFHGXUHWKHLQFLGHQWIRUP
VKRXOGEHVXEPLWWHGWRWKHPDLOER[DVDµGUDIW¶ZKHWKHURUQRWWKHLQIRUPDWLRQFRQWDLQHGLVIXOO\FRPSOHWHG
x )RUH[DPSOH&DWHJRU\±0DLQ5RDG8SJUDGH±GGPP\\'5$)7
7KH(QYLURQPHQW0DQDJHUVKRXOGWKHQUHTXHVWIXUWKHULQIRUPDWLRQIURPWKHSHUVRQPDNLQJWKHUHSRUWDQG
WKHILQDOUHSRUWVKRXOGEHVXEPLWWHGZLWKLQWKHQH[WKRXUV
3DJH
5RDGVDQG0DULWLPHFRQWDFWV
7KHUHOHYDQW(QYLURQPHQW0DQDJHUIRUHDFKUHJLRQDQG3URMHFW2IILFHLVWKHILUVWSRLQWRIFRQWDFWIRU
HQTXLULHVUHODWLQJWRHQYLURQPHQWDOLQFLGHQWV&XUUHQWFRQWDFWVIRUDOO5RDGVDQG0DULWLPH(QYLURQPHQW
0DQDJHUVFDQEHIRXQGRQWKH5RDGVDQG0DULWLPHZHEVLWH
(QYLURQPHQW0DQDJHUVFDQDOVRSURYLGHFRQWDFWGHWDLOVIRURWKHUUHOHYDQWFRQWDFWVGXULQJDQLQFLGHQWVXFK
DV&RPPXQLFDWLRQVRU:RUN+HDOWKDQG6DIHW\
7KH'(2RYHUVHHVWKHDSSOLFDWLRQRIWKLV3URFHGXUHDQGFDQEHFRQWDFWHGLQWKHDEVHQFHRIWKHUHOHYDQW
(QYLURQPHQW0DQDJHUIRU&DWHJRU\LQFLGHQWV
x 3KRQH
5HJXODWRU\DJHQF\QRWLILFDWLRQ
1RWLILFDWLRQRI0DWHULDO+DUPSROOXWLRQLQFLGHQWV
'HILQLWLRQRI0DWHULDO+DUPSROOXWLRQLQFLGHQWV
8QGHU3DUWRIWKH32(2$FWWKHUHLVDGXW\WRLPPHGLDWHO\QRWLI\LHSURPSWO\DQGZLWKRXWGHOD\HDFK
UHOHYDQWDXWKRULW\VHHVHFWLRQRIDSROOXWLRQLQFLGHQWZKHUHPDWHULDOKDUPWRWKHHQYLURQPHQWLV
FDXVHGRUWKUHDWHQHG
7KH32(2$FWVWDWHVWKDWDSROOXWLRQLQFLGHQWVKRXOGEHFRQVLGHUHG0DWHULDO+DUPLI
³LLWLQYROYHVDFWXDORUSRWHQWLDOKDUPWRWKHKHDOWKRUVDIHW\RIKXPDQEHLQJVRUWRHFRV\VWHPVWKDW
LVQRWWULYLDORU
LLLWUHVXOWVLQDFWXDORUSRWHQWLDOORVVRUSURSHUW\GDPDJHRIDQDPRXQWRUDPRXQWVLQDJJUHJDWH
H[FHHGLQJ´
0DWHULDO+DUPRQO\UHODWHVWRSROOXWLRQLQFLGHQWV2WKHUHQYLURQPHQWDOLQFLGHQWVVXFKDVFRQVHUYDWLRQ
KHULWDJHDQGSODQQLQJEUHDFKHVDUHQRWLQFOXGHGLQWKHGHILQLWLRQRIDSROOXWLRQLQFLGHQW
'HWHUPLQLQJLIDQLQFLGHQWVKRXOGEHFRQVLGHUHG0DWHULDO+DUP
$VVRRQDVDSHUVRQEHFRPHVDZDUHRIDSROOXWLRQLQFLGHQWWKDWKDVWKHSRWHQWLDOWRFDXVH0DWHULDO+DUP
WKH&DWHJRU\LQFLGHQWUHVSRQVHVKRXOGEHIROORZHGVHH7DEOHDDQG7DEOHEDERYH7KH
GHWHUPLQDWLRQRQZKHWKHUDSROOXWLRQLQFLGHQWVKRXOGEHFRQVLGHUHG0DWHULDO+DUPVKRXOGEHPDGHLQ
DFFRUGDQFHZLWK7DEOH
7DEOH'HWHUPLQDWLRQRI0DWHULDO+DUPSROOXWLRQLQFLGHQWV
3URMHFWGHOLYHU\ 0DWHULDO+DUPGHWHUPLQDWLRQ
7KH'(2VKRXOGPDNHWKHGHWHUPLQDWLRQDQGDQ\DVVRFLDWHGQRWLILFDWLRQVRQZKHWKHUD
SROOXWLRQLQFLGHQWVKRXOGEHFRQVLGHUHG0DWHULDO+DUP
,IWKH'(2LVQRWDYDLODEOHWKHUHOHYDQW(QYLURQPHQW0DQDJHUVKRXOGVHHNDGYLFHIURPRWKHU
$FWLYLWLHVXQGHUWDNHQ
5RDGVDQG0DULWLPH(QYLURQPHQW%UDQFK'LUHFWRUVRUPDNHWKHPDWHULDOKDUPGHWHUPLQDWLRQ
E\5HJLRQDO
WKHPVHOYHV
0DLQWHQDQFH
,IQRDVVLVWDQFHFDQEHREWDLQHGDQGLWLVVXVSHFWHGWKDWDSROOXWLRQLQFLGHQWVKRXOGEH
FRQVLGHUHG0DWHULDO+DUPWKHSURMHFWVKRXOGQRWLI\WKHUHOHYDQWDXWKRULWLHVLQDFFRUGDQFHZLWK
7DEOHDRU7DEOHEDVUHOHYDQW
7KHFRQWUDFWRUSURMHFWWHDPVKRXOGPDNHWKHGHWHUPLQDWLRQDQGDQ\DVVRFLDWHGQRWLILFDWLRQV
RQZKHWKHUDSROOXWLRQLQFLGHQWVKRXOGEHFRQVLGHUHG0DWHULDO+DUP
7KHUHOHYDQW5RDGVDQG0DULWLPH(QYLURQPHQW0DQDJHURU(QYLURQPHQW%UDQFK'LUHFWRUPD\
FRQWDFWWKH'(2WRDVVLVWLQPDNLQJDQDVVHVVPHQWRIWKHLQFLGHQWWRDLGWKHFRQWUDFWRULQ
$FWLYLWLHVXQGHUWDNHQ GHWHUPLQLQJLIWKHSROOXWLRQLQFLGHQWVKRXOGEHFRQVLGHUHG0DWHULDO+DUP
E\FRQWUDFWRUV :KHUH5RDGVDQG0DULWLPHEHOLHYHVDSROOXWLRQLQFLGHQWVKRXOGEHFRQVLGHUHG0DWHULDO+DUP
EXWWKHFRQWUDFWRUGLVDJUHHV5RDGVDQG0DULWLPHLVUHTXLUHGE\ODZWRQRWLI\(3$DQGRWKHU
UHOHYDQWDXWKRULWLHV,QWKLVLQVWDQFHWKH'(2RU'(ZRXOGPDNHDGHWHUPLQDWLRQRQZKHWKHU
WKHLQFLGHQWVKRXOGEHQRWLILHGE\5RDGVDQG0DULWLPHDV0DWHULDO+DUP5RDGVDQG0DULWLPH
ZRXOGSURYLGHGHWDLOVRIDQ\QRWLILFDWLRQVPDGHWRWKHFRQWUDFWRU
3DJH
(YHQLIRQO\OLPLWHGLQIRUPDWLRQLVDYDLODEOHIRUDSROOXWLRQLQFLGHQWEHLQJFRQVLGHUHG0DWHULDO+DUPHDFK
UHOHYDQWDXWKRULW\PXVWEHLPPHGLDWHO\QRWLILHGZLWKWKHLQIRUPDWLRQDYDLODEOHDQGXSGDWHVSURYLGHGDVVRRQ
DVIXUWKHUUHOHYDQWLQIRUPDWLRQEHFRPHVDYDLODEOH
,QFLUFXPVWDQFHVZKHUHWKHUHLVGRXEWDERXWWKHQHHGWRQRWLI\DSROOXWLRQLQFLGHQWDV0DWHULDO+DUP5RDGV
DQG0DULWLPHDQGLWVFRQWUDFWRUVVKRXOGDOZD\VHUURQWKHVLGHRIQRWLILFDWLRQ
:KHQLQGRXEWFRPPXQLFDWH
1RWH5RDGVDQG0DULWLPHLVQRWUHVSRQVLEOHIRUQRWLI\LQJD0DWHULDO+DUPSROOXWLRQLQFLGHQWFDXVHGE\D
WUDIILFRUYHKLFOHDFFLGHQWZKHUHQRWLILFDWLRQKDVDOUHDG\RFFXUUHGE\VRPHRQHDWWKHVFHQH+RZHYHULILWLV
EHOLHYHGQRWLILFDWLRQKDVQRWEHHQXQGHUWDNHQ5RDGVDQG0DULWLPHVKRXOGXQGHUWDNHQRWLILFDWLRQLQ
DFFRUGDQFHZLWKVHFWLRQ(QYLURQPHQW%UDQFKFDQSURYLGHDGYLFHLQWKLVLQVWDQFHVHHVHFWLRQ
5HOHYDQWDXWKRULWLHVWRQRWLI\
7KHUHOHYDQWDXWKRULWLHVWKDWPXVWEHQRWLILHGIRUD0DWHULDO+DUPSROOXWLRQLQFLGHQWDUHOLVWHGLQWDEOHV
DDQGEEHORZ,WLVLPSRUWDQWWRQRWHWKHRUGHURIQRWLILFDWLRQDQGSKRQHQXPEHUVWRXVHFDQYDU\
GHSHQGLQJRQWKHQDWXUHRIWKHSROOXWLRQLQFLGHQWDVGHWDLOHGLQWKHWZRWDEOHV
$OORIWKHDXWKRULWLHVOLVWHGZKHWKHUFRQVLGHUHGUHOHYDQWRUQRWPXVWEHFRQWDFWHGIRUHDFK0DWHULDO+DUP
SROOXWLRQLQFLGHQWWRVDWLVI\32(2$FWUHTXLUHPHQWV6HULRXVSHQDOWLHVDSSO\WRERWKLQGLYLGXDOVDQG
FRUSRUDWLRQVIRUIDLOLQJWRQRWLI\0DWHULDO+DUPSROOXWLRQLQFLGHQWV
x 0D[LPXPSHQDOW\IRULQGLYLGXDOV
x 0D[LPXPSHQDOW\IRUFRUSRUDWLRQV
7DEOHD$XWKRULWLHVWRQRWLI\IRU0DWHULDO+DUPSROOXWLRQLQFLGHQWVWKDWSUHVHQWDQLPPHGLDWHWKUHDWWR
KXPDQKHDOWKRUSURSHUW\
2UGHU $XWKRULW\ &RQWDFW1XPEHU
)LUHDQG5HVFXH16:
16:(3$HQYLURQPHQWOLQH
&RQWDFWWREHGLUHFWHGWRWKH
0LQLVWU\RI+HDOWKYLDWKHORFDO3XEOLF+HDOWK8QLW ORFDO3XEOLF+HDOWK8QLWRUYLVLWWKH16:
+HDOWK:HEVLWH
6DIH:RUN16:
7KH$SSURSULDWH5HJXODWRU\$XWKRULW\ EHLQJHLWKHU /RFDOFRXQFLO FRQWDFW2IILFHRI/RFDO
x /RFDOFRXQFLO *RYHUQPHQWRQRUYLVLWWKH2IILFH
x :HVWHUQ/DQGV&RPPLVVLRQHUIRUWKH:HVWHUQ RI/RFDO*RYHUQPHQWZHEVLWH
'LYLVLRQH[FHSWDQ\SDUWRIWKH:HVWHUQ'LYLVLRQ :HVWHUQ/DQGV&RPPLVVLRQHU±SKRQH
ZLWKLQWKHDUHDRIDORFDOFRXQFLO
7DEOHE$XWKRULWLHVWRQRWLI\IRU0DWHULDO+DUPSROOXWLRQLQFLGHQWVWKDWGR127SUHVHQWDQLPPHGLDWH
WKUHDWWRKXPDQKHDOWKRUSURSHUW\
2UGHU $XWKRULW\ &RQWDFW1XPEHU
16:(3$HQYLURQPHQWOLQH
7KH$SSURSULDWH5HJXODWRU\$XWKRULW\ EHLQJHLWKHU /RFDOFRXQFLO FRQWDFW2IILFHRI/RFDO

x /RFDOFRXQFLO *RYHUQPHQWRQRUYLVLWWKH2IILFH
RI/RFDO*RYHUQPHQWZHEVLWH
x :HVWHUQ/DQGV&RPPLVVLRQHUIRUWKH:HVWHUQ
'LYLVLRQH[FHSWDQ\SDUWRIWKH:HVWHUQ'LYLVLRQ :HVWHUQ/DQGV&RPPLVVLRQHU±SKRQH
ZLWKLQWKHDUHDRIDORFDOFRXQFLO
&RQWDFWWREHGLUHFWHGWRWKH
0LQLVWU\RI+HDOWKYLDWKHORFDO3XEOLF+HDOWK8QLW ORFDO3XEOLF+HDOWK8QLWRUYLVLWWKH16:
+HDOWK:HEVLWH
3DJH
6DIH:RUN16:
)LUHDQG5HVFXH16:
7KHDSSURSULDWHFRQWDFWIRUWKH$SSURSULDWH5HJXODWRU\$XWKRULW\DQG3XEOLF+HDOWK8QLWZLOOYDU\
DFFRUGLQJWRWKHJHRJUDSKLFORFDWLRQRIWKHDFWLYLW\7KHVHFRQWDFWQXPEHUVVKRXOGEHIRXQGLQDGYDQFH
DQGVWRUHGIRULPPHGLDWHDFFHVVHJLQDSURMHFW¶V&RQVWUXFWLRQ(QYLURQPHQWDO0DQDJHPHQW3ODQDQGRU
RQVLWHQRWLFHERDUGVVKRXOGDSROOXWLRQLQFLGHQWQHHGWREHQRWLILHG
7KHUHOHYDQWLQIRUPDWLRQWRSURYLGH
,WLVLPSRUWDQWWRDYRLGVSHFXODWLRQRQRULJLQFDXVHVRURXWFRPHVRIDSROOXWLRQLQFLGHQWLQGLVFXVVLRQVZLWK
WKHDXWKRULWLHV6HFWLRQRIWKH32(2$FWSURYLGHVWKHLQIRUPDWLRQWKDWQHHGVWREHQRWLILHGEHLQJ
D 7KHWLPHGDWHQDWXUHGXUDWLRQDQGORFDWLRQRIWKHLQFLGHQW
E 7KHORFDWLRQRIWKHSODFHZKHUHSROOXWLRQLVRFFXUULQJRULVOLNHO\WRRFFXUWKHQDWXUHWKHHVWLPDWHG
TXDQWLW\RUYROXPHDQGWKHFRQFHQWUDWLRQRIDQ\SROOXWDQWVLQYROYHGLINQRZQ
F 7KHFLUFXPVWDQFHVLQZKLFKWKHLQFLGHQWRFFXUUHGLQFOXGLQJWKHFDXVHRIWKHLQFLGHQWLINQRZQ
G 7KHDFWLRQWDNHQRUSURSRVHGWREHWDNHQWRGHDOZLWKWKHLQFLGHQWDQGDQ\UHVXOWLQJSROOXWLRQRU
WKUHDWHQHGSROOXWLRQLINQRZQ
H 2WKHULQIRUPDWLRQSUHVFULEHGE\WKHUHJXODWLRQV
2QO\NQRZQLQIRUPDWLRQVKRXOGEHSURYLGHGZKHQQRWLI\LQJRID0DWHULDO+DUPSROOXWLRQLQFLGHQW,IIXUWKHU
LQIRUPDWLRQEHFRPHVNQRZQDIWHUWKHLQLWLDOQRWLILFDWLRQWKDWLQIRUPDWLRQPXVWLPPHGLDWHO\EHQRWLILHGWRDOO
DXWKRULWLHVLQDFFRUGDQFHZLWK6HFWLRQVHHDERYH7KHLPPHGLDWHYHUEDOQRWLILFDWLRQLVWREHIROORZHG
E\ZULWWHQQRWLILFDWLRQWRHDFKUHOHYDQWDXWKRULW\ZLWKLQVHYHQGD\VRIWKHGDWHRQZKLFKWKHLQFLGHQW
RFFXUUHG
&RPSO\LQJZLWKWKHVHQRWLILFDWLRQUHTXLUHPHQWVGRHVQRWUHPRYHWKHQHHGWRFRPSO\ZLWKDQ\RWKHU
OHJLVODWLYHUHTXLUHPHQWVIRULQFLGHQWQRWLILFDWLRQHJUHTXLUHPHQWVXQGHU(3/FRQGLWLRQVRUWKH:RUN+HDOWK
DQG6DIHW\$FW
6XPPDU\RIRWKHUUHJXODWRU\DJHQF\QRWLILFDWLRQUHTXLUHPHQWV
6SHFLILFVWDWXWRU\UHTXLUHPHQWVUHODWLQJWRWKHQRWLILFDWLRQRIHQYLURQPHQWDOLQFLGHQWVWRUHOHYDQWUHJXODWRU\
DJHQFLHVDUHVXPPDULVHGLQ7DEOH$GGLWLRQDOUHTXLUHPHQWVDGRSWHGE\5RDGVDQG0DULWLPHDUH
LQGLFDWHGLQLWDOLFV$Q\QRWLILFDWLRQWRUHJXODWRU\DJHQFLHVVKRXOGEHLQGLFDWHGLQWKH(QYLURQPHQWDO,QFLGHQW
5HSRUW)RUPWRFRQILUPWKDWDQ\UHTXLUHGQRWLILFDWLRQVKDYHEHHQLQLWLDWHG
7DEOH5HJXODWRU\DJHQF\QRWLILFDWLRQUHTXLUHPHQWV
5HJXODWLQJ
/HJLVODWLRQLVVXH 6HFWLRQUHTXLUHPHQW
DXWKRULW\
&RPPRQZHDOWK$ERULJLQDO 'HSDUWPHQWRI
6HFWLRQ±UHTXLUHPHQWWRQRWLI\WKH0LQLVWHURIWKHGLVFRYHU\RI
DQG7RUUHV6WUDLW,VODQGHUV WKH(QYLURQPHQW
$ERULJLQDOUHPDLQV
+HULWDJH3URWHFWLRQ$FW DQG(QHUJ\
6HFWLRQ±UHTXLUHPHQWWRQRWLI\LI5RDGVDQG0DULWLPHDFWLYLWLHV
&RQWDPLQDWHG/DQG
(3$ KDYHFRQWDPLQDWHGODQGRULI5RDGVDQG0DULWLPHRZQVODQGWKDW
0DQDJHPHQW$FW
KDVEHHQFRQWDPLQDWHG
2IILFHRI
6HFWLRQ±UHTXLUHPHQWWRQRWLI\WKH+HULWDJH&RXQFLORIWKH
+HULWDJH$FW (QYLURQPHQW
ORFDWLRQRIWKHUHOLFRQFHDUHOLFKDVEHHQGLVFRYHUHGRUORFDWHG
DQG+HULWDJH
2IILFHRI
1DWLRQDO3DUNVDQG:LOGOLIH 6HFWLRQ$±UHTXLUHPHQWWRQRWLI\WKHORFDWLRQRIDQ$ERULJLQDO
(QYLURQPHQW
$FW REMHFWWKDWLVWKHSURSHUW\RIWKH&URZQ
DQG+HULWDJH
3URWHFWLRQRIWKH (3$DQGRWKHU 6HFWLRQ±UHTXLUHPHQWWRLPPHGLDWHO\QRWLI\SROOXWLRQLQFLGHQWV
(QYLURQPHQW2SHUDWLRQV$FW UHOHYDQW WKDWFDXVHRUWKUHDWHQ0DWHULDO+DUPWRWKHHQYLURQPHQWVHH
DXWKRULWLHV 6HFWLRQ
3DJH
3URDFWLYHUHSRUWLQJWRWKHORFDO(3$RIILFHURIRIIVLWHSROOXWLRQ
LQFLGHQWVWKDWRFFXUDVDUHVXOWRI5RDGVDQG0DULWLPHDFWLYLWLHVLV
(3$
HQFRXUDJHGDVVRRQDVSUDFWLFDEOHDIWHUWKHSROOXWLRQLQFLGHQW
RFFXUV
6HFWLRQ±UHTXLUHPHQWWRQRWLI\DQDSSURSULDWHILUHRIILFHURIWKH
16:5XUDO)LUH
5XUDO)LUHV$FW LQDELOLW\WRH[WLQJXLVKDQ\ILUHEXUQLQJGXULQJDEXVKILUHGDQJHU
6HUYLFH
SHULRGDSSOLFDEOHWRWKHODQG
%UHDFKRI&RQGLWLRQVRI 'HSDUWPHQWRI
'3(VKRXOGEHQRWLILHGE\WKHSURMHFWSURSRQHQWZKHQWKHUHKDV
$SSURYDOSURMHFWVDSSURYHG 3ODQQLQJDQG
EHHQDEUHDFKRID&RQGLWLRQRI$SSURYDO&R$7KHUHPD\DOVR
XQGHU3DUWRIWKH(3 $ (QYLURQPHQW
EHRWKHUQRWLILFDWLRQUHTXLUHPHQWVLQFOXGHGLQWKH&R$
$FW '3(
,IDQHQYLURQPHQWDOLQFLGHQWKDVWKHSRWHQWLDOIRUXQDSSURYHG
:DWHUVXSSO\FDWFKPHQW /RFDOZDWHU
LPSDFWVRQDGULQNLQJZDWHUVXSSO\WKHUHOHYDQWZDWHUVXSSO\
DUHDV VXSSO\DXWKRULW\
DXWKRULW\PXVWEHDGYLVHG
5HTXHVWVIRUZULWWHQUHSRUWVIURPUHJXODWRU\DXWKRULWLHVDFWLYLWLHV

GHOLYHUHGLQWHUQDOO\E\5RDGVDQG0DULWLPH
6KRXOG5RDGVDQG0DULWLPHGLUHFWO\UHFHLYHDUHTXHVWIURPDUHJXODWRU\DXWKRULW\IRUDZULWWHQUHSRUW
UHJDUGLQJDQHQYLURQPHQWDOLQFLGHQW(QYLURQPHQW%UDQFKDQG/HJDO%UDQFKPXVWEHLPPHGLDWHO\
FRQWDFWHGIRUDGYLFH1RIXUWKHUFRUUHVSRQGHQFHLQFOXGLQJHPDLODERXWWKHLQFLGHQWVKRXOGEHGLVWULEXWHG
HLWKHULQWHUQDOO\RUH[WHUQDOO\XQWLODGYLFHLVUHFHLYHG(QYLURQPHQW%UDQFKZLOOFRRUGLQDWHZLWK/HJDO%UDQFK
WR
x $VVLVWLQWKHLQYHVWLJDWLRQRIWKHLQFLGHQW
x 3URYLGHOHJDODGYLFHWRWKHSURMHFW
x &RRUGLQDWHWKHSUHSDUDWLRQRIWKHZULWWHQUHVSRQVHWRWKHUHJXODWRU\DXWKRULW\
3DJH
Appendix A8
Environmental Work Method Statement Registers
EWMS register
Number Name Revision no Reviewed by Date
001 Site Compound Set-up B Roads and Maritime 15
002 Clearing and Grubbing (working in B Roads and Maritime

environmentally sensitive areas)
003 Site Survey A Roads and Maritime
004 Topsoil Stripping B Roads and Maritime, ER
005 Services Investigation B Roads and Maritime, ER
006 Geotech Investigation B Roads and Maritime, ER
007 Boundary Fencing B Roads and Maritime, ER
008 Culvert Installation and Extension A Roads and Maritime
009 Sediment Basin Management S Roads and Maritime
010 Earthworks A Roads and Maritime
011 Rehabilitation of Hydrocarbon Soil A Roads and Maritime
012 Demolition A
EWMS training / induction attendance register
[We, the undersigned, confirm that we have been trained and inducted on this EWMS and the details have been explained and clearly
understood. We clearly understand that the environmental controls in this EWMS must be applied as documented, otherwise work is to cease
immediately.]
EWMS number Inductee Name Company Position Signature Date
Appendix A9
Georgiou nonconformity, corrective and
preventative action procedure
Nonconformance Reporting and Corrective
Action Procedure
NON-CONFORMANCE REPORTING & CORRECTIVE

ACTION
PROCEDURE GC-HSE-PRO-126
Document Document
Date Revision Description Version Revised by
Owner Authoriser
Peter Grant
06/12/2013 Initial upload to new GENIE Intranet 1.0 Sean Baker Sean Baker
Smith
Procedure updated to distinguish processes
for Product NCRs and System NCRs,
17/08/2016 2.0 Sean Baker Sean Baker Gary Georgiou
updates to definitions and reference to
Product NCR severity classifications.
Section 3.2.3 updated to address
Lambros
22/12/2016 requirement to confirm effectiveness of 3.0 Sean Baker Sean Baker
Siamos
actions taken with Product NCRs
Section 2 updated to reflect latest risk Katherine Lambros
29/08/2018 4.0 Sean Baker
matrix classification levels Woodford Siamos
2018 Georgiou Group Pty Ltd
Reproduction of this document, in whole or in part, in any format or media is prohibited without express permission from the authorised
Quality Representative of Georgiou.
GC-HSE-PRO-126 Uncontrolled when saved or printed Page 1 of 5

29/08/2018 Ver: 4.0 Always refer to GENIE for latest version Print Date: 16-Oct-18
Action Procedure
1. PURPOSE & SCOPE
This procedure describes the requirements associated with the identification, reporting and correction of Product
and System non-conformances.
This Procedure applies to all Georgiou operations including subcontractors and suppliers to Georgiou.
2. TERMINOLOGY & DEFINITIONS

General Terms and Definitions associated with Georgiou’s Management System can be found within Georgiou’s
Terminology & Definitions Guideline.
Key definitions associated with this procedure are defined below
Item Description
Non-conformance; Non-fulfilment of a requirement (customer requirement, product requirement,
management system requirement).
Product Non-conformance Is the result of a product/process or service that does not conform to specified
requirements or stated expectation.
Severity classification levels have been established for product non-conformances,

detailed below.
Product NCR Classification

 Class 3 - rectification costs below or equal to $20,000
Levels
 Class 2 - rectification costs above $20,000 and less than $1000,000
 Class 1 - rectification costs equal to or above $100,000
System Non-conformance Non-conformance which is directly related to the administration and/or management
system. May be identified through audit (internal, client and Third party), Incident
Investigations, Workplace Inspections, Complaints and Georgiou Management System
Reviews. Two Severity classification levels have been established for System Non-
conformances.
System Non-conformance
 Minor: where isolated discrepancies are found between what has/is required
Severity Classification
and what has/is occurring. A minor non-conformance does not have the
potential to cause significant adverse effects to project quality, the
environment or safety
 Major: The absence of a system or part of the system, or that the documented
systems or procedures are not being followed. Potential to cause significant
adverse effects to project quality, the environment or safety.
QHEST Web-based event management reporting system used by Georgiou for reporting of
HSEQ Incidents and Non-conformances.
NOTE: Some Georgiou projects may utilise alternative systems for Product Non-
conformance reporting due to client or other requirements, subject to prior approval
by the Quality Manager. The requirements of this procedure still apply when using
alternative reporting systems. All System NCRs shall be reported via QHEST.

Action Procedure
3. PRODUCT NON-CONFORMANCES
3.1 Identification and Segregation

Upon identification of a product non-conformance undertake the following;
 Where practicable, the product shall be segregated to prevent inadvertent use or release. This may
include a combination of labelling/marking and documentation.
 Ensure the matter is communicated within the project team.
 Quality documentation, such as the Lot register and Inspection and test Plans/Checklists, shall be updated
to note the Non-conformance and current “on-hold” status.
 All Non-conforming product shall remain “on-hold” until disposition to release is approved and received
from the required authority in accordance with Project specific Quality Management plan requirements.
3.2 Product Non-conformance Reporting

All Product Non-conformances shall be reported via the web-based reporting application (QHEST). Formal reporting
shall occur as soon as practicable, but as a minimum within 24hrs of the issue being detected. The involvement of
staff throughout the System Non-conformance process shall be in accordance with Appendix 8.1 NCR Notification
and response matrix.
3.2.1 Assess Severity and Classify NCR – Estimate Costs
Estimate the costs of rectifying the Product NCR when the issue is identified/reported to allow classification of the
NCR. This may include costs associated with;
 Rework ie. Materials, Plant and equipment, Labour
 Costs associated with re-design
 Demolition, waste disposal and transport
 Time delays
 Costs associated with inspection, testing and verification
Estimated costs are to be reported within QHEST. The party responsible for the rectification costs are also to be
recorded (ie Subcontractor/Georgiou).
NOTE: Initial reported rectification costs will be an estimate only. It is anticipated that rectification costs will need
to be updated as the NCR is further investigated and followed up. The actual rectification costs shall be confirmed
prior to the NCR being closed.
3.2.2 External Reporting and Approval
The Project Manager is responsible for the notification of the Non-conformance to relevant parties as contractually
required and seeking and recording approval from the client, Designer, or other stakeholder on the proposed
correction
3.2.3 Non-conformance Report Close-Out
NOTE: Where non-conforming product is reworked, repaired, or otherwise corrected by an approved method it shall
be re-inspected and/or tested to verify and demonstrate conformance to requirements. Where external approval is
required, this must be obtained and recorded prior to closing the Non-conformance.
Once all approved actions associated with a non-conformance report have been completed, actual rectification
costs associated with the NCR shall be updated and the NCR closed.
The QHEST NCR reporting system requires that responsible and Close-out Manager roles are assigned with the NCR,
these roles shall undertake the following;

Action Procedure
Responsible Manager ensure the corrective and preventative actions identified to address the Non-
conformance are adequate to address the issue. Ensure those persons assigned
actions complete them in a timely manner.
Close-Out Manager verify that the identified corrective and preventative actions have been taken
and are effective in preventing recurrence.
NOTE: Where an alternative NCR system to QHEST is utilised by a project for product NCR reporting, the above
requirements apply – the person responsible for closing the NCR shall confirm effectiveness of actions taken.
Project NCR reporting templates shall address this requirement.
4. SYSTEM NON-CONFORMANCES
4.1 Reporting System Non-conformances

Systems and/or their implementation that do not meet requirements will be deemed non-conforming and must be
reported as a System Non-Conformance within the QHEST web-based reporting system. The involvement of staff
throughout the System Non-conformance process shall be in accordance with Appendix 8.1 NCR Notification and
response matrix.
4.1.1 System Non-conformance Classification
Each System non-conformance will be identified with one of the following functional areas: Health and Safety,
Environment, Quality or Other. Other categories include areas of the business such as Tendering, HR, Commercial
or Administration.
System non-conformance severity and correction type are classified as either Minor or Major. No cost data is
required for system non-conformance correction.
Corrective and Preventative actions to address the System Non-conformance shall be recorded within QHEST and
assigned to relevant persons. Actions may include; new or updated process procedures and/or evidence of training
4.1.2 Responsibility for addressing System non-conformance
The QHEST system requires that responsible and Close-out Manager roles are assigned with the NCR, these roles
shall undertake the following;
Responsible Manager ensure the corrective and preventative actions identified to address the Non-
conformance are adequate to address the issue. Ensure those persons assigned
actions complete them in a timely manner.
Close-Out Manager verify that the identified corrective and preventative actions have been taken
and are effective in preventing recurrence.
5. CHANGE MANAGEMENT
Corrective or preventative actions that identifies or results in new or changed hazards or the need for new or
changed controls, or a change to the Georgiou Management System are to be undertaken in accordance with the
requirements of Georgiou’s Change Management Procedure GC-HSE-PRO-136.

Action Procedure
6. MONITORING & MEASUREMENT
The Georgiou Quality Manager is responsible for maintaining systems to monitor and measure Non-conformances
reported to ensure timely and effective management and enable review and communication of Management System
performance.
Product Non-conformances Establishment and maintenance of a Non-conformance Revenue Frequency rate

(NCR-FR). Trend/analysis of NCR rework costs by Business Unit by Month.
System Non-conformances Weekly BSR report sent to Business Unit Managers identifying status of Non-
conformances and associated actions recorded within QHEST.
7. REFERENCES
 Change Management Procedure GC-HSE-PRO-267
 Terminology & Definitions Guideline GC-ADM-PRO-009
 Georgiou Risk Matrix
8. APPENDICES
8.1 Appendix A – Non-conformance Notification and Response Matrix

The following outlines the minimum personnel involvement in response to reported non-conformances.
Responsible Manager Close-Out Manager Internal Notification Investigation
Product NCR
Class 3 Project Quality Project Manager Project Team Supervisor, Project
Representative Engineer, Project Quality
Representative
Class 2 Project Manager Construction Business Unit Snr Supervisor, Project
Manager/Operations Management (CMs, Engineer, Project Quality
Manager OM’s and EGMs) Representative
Quality Manager as
required
Class 1 Construction Business Unit General Business Unit Snr Construction/Operations
Manager/Operations Manager Management (CMs, Manager,
Manager OM’s and EGMs), and Supervisor/Project
all Georgiou Senior Engineer, Project Quality
Leadership team Representative
Quality Manager
System NCR – notifications issued via QHEST workflow
Minor Project Quality Project Manager Project Team Supervisor, Project
representative Engineer, Project Quality
Representative
Major Construction Manager Business Unit General Business Unit Snr Construction/Operations
Manager Management (CMs, Manager, Quality
OM’s and EGM, HS Manager,
Manager, Quality Supervisor/Project
Manager) Engineer, Project Quality
Representative

Appendix A10
Georgiou auditing, review and inspection standard
Auditing, Reviews and Inspections
AUDITING, REVIEWS AND INSPECTIONS
STANDARD GC-HSE-STA-155
Document Document
Date Revision Description Version Revised by
Owner Authoriser
Changed from GC- MGT-ST007 to GC-
18/12/2013 HSE-STA-155 and re-versioned for new 1.0 Alyson Bray Sean Baker Scott Morris
GENIE document control system
s3.1.8 updated to define current audit
schedule requirements. s 3.1.8 K. Woodford/
18/05/2015 2.0 Sean Baker Scott Morris
Corrective Actions process consolidated S. Baker
for all audit types.
S3.1.1 updated to include HiPD
Reviews. S3.6 updated - removed
2/12/2015 3.0 K.Woodford Sean Baker Travis Kingdon
reference to meetings (addressed in
Management System Standard).
S3.2.2 Amended Workplace Inspection
31/03/2016 requirements from weekly to monthly 4.0 K.Woodford Sean Baker Travis Kingdon
(MOC-GC513)
Responsibilities/accountabilities
Katherine
9/08/2016 updated following changed HSEQ 5.0 K.Woodford Sean Baker
Woodford
organisational structure.
2018 Georgiou Group Pty Ltd
Reproduction of this document, in whole or in part, in any format or media is prohibited without express permission from the authorised
Quality Representative of Georgiou.
GC-HSE-STA-155 Uncontrolled when saved or printed Page 1 of 6

1. PURPOSE & SCOPE

This Standard describes the processed used by Georgiou to evaluate and review the implementation of the Georgiou
Management System. Audits, reviews and inspections are completed for the following purpose;
 To identify compliance against Georgiou procedures, plans, legal requirements and other obligations;
 To identify areas where performance needs to be improved;
 To identify leading practise, so that such practises can be communicated and implemented across other
Georgiou operations.
This Standard applies to all Georgiou operations.
2. TERMINOLOGY & DEFINITIONS

Terms and definitions used within this document are further explained in Georgiou’s Terminology & Definitions
Guideline.
3. DESCRIPTION
3.1 Audits and Reviews

Audits and Reviews involve a formal and systematic process of assessing conformance with specific procedures
through interviews, document review and physical verification of operational controls in the workplace. At
Georgiou, the following audits and reviews will be undertaken;
3.1.1 Internal System Audits and Reviews
Internal System audits are those conducted on a site, business unit or functional area to determine compliance to
the management systems and an assessment as the effectiveness of those requirements to meet our legal and other
obligations. Internal system audits comprise any of the following;
 Quality Audits
 HSE Audits
 HSE Mobilisation Audits
 Management System Audits
 Environmental Compliance Reviews
 Commercial Audits
 HR Audits
3.1.2 Company Environmental Legal Compliance Evaluation
An evaluation of Company environmental legal and other obligations will be undertaken to determine compliance
with environmental legislation, approvals, licenses and other applicable requirements. Over a rolling three year
period, desktop reviews and site visits will be undertaken to evaluate Georgiou activities conducted within each
jurisdiction. Planned visits will be documented on the Auditing and Review Schedule.
The Environment Management System Representative is accountable for ensuring that the evaluations are
completed by a person with suitable expertise. The HSE Legal and Other Obligation Directory’s will be updated
to reflect any new requirements and a plan put in place to address corrective or preventative actions to maintain
compliance.

3.1.3 Vendor Audits
Vendor Audits are those conducted by Georgiou on a Subcontractor or Supplier that have been engaged by Georgiou
to inspect and evaluate their management system, as well as its practices, products, and documentation.
Site’s Manager's will be accountable for arranging Vendor Audits where required to control risk or meet contractual
requirements. Requirements for these audits are to be detailed within site specific Management Plans.
3.1.4 Second and Third Party Audits
Second party audits are those conducted on a Georgiou site or the Georgiou Management System by a party who has
an interest in Georgiou, to provide verification of conformance to client or contractual requirements. The
notification that a Second party audit is to take place will be directed to the Accountable Manager who will
coordinate the audit and inform the Q Management System Representative for inclusion in the Audit & Review
Schedule.
Third party audits are those conducted by a third party such as regulatory bodies and certifying bodies to
determine compliance to certification or accreditation requirements. The Q Management System Representative is
responsible for arranging and coordinating third party audits and communicating outcomes to the organisation.
3.1.5 Training and Competency
Internal audits/reviews will be conducted by persons suitably experienced and/or trained in auditing and who are
independent of the site being audited e.g. A HSE cannot audit a site for which they are the HSE Representative.
Wherever possible, new Auditors to Georgiou or newly trained Auditors will be required to observe an experienced
Auditor conduct at least one audit before completing a solo audit, and during their first solo audit they will be
observed by an experienced Auditor.
The scope and criteria of an audit will determine the number of auditors to be assigned. Where it is deemed
necessary that more than one auditor is required, an audit team will be formed and a lead auditor nominated.
The assigned auditor(s) will be responsible for scheduling, preparing, performing and reporting on the audit.
3.1.6 Internal System Audit/Review Frequency
During project start-up the audit requirements for each project will be determined. Project audit requirements will
be determined with consideration of the nature of the work being completed (i.e. HSEQ risks), the number and
value of subcontracts, and any contractual requirements for audits. Operating facilities and functional areas will
be audited at least annually.
After each completed audit/review a recommendation will be made by the auditor that the frequency should
either:
1) Continue as per scheduled - monitoring required
2) Decrease - sufficient controls are in place to manage risk
3) Increase - insufficient controls are in place to manage risk
In the event of a serious incident or complaint, non-conformity, financial loss or other valid reason an unscheduled
audit/review may be initiated in addition to the stated requirements within this Standard.
3.1.7 Scheduling Internal Audits/Reviews
The Quality Management System Representative is responsible for maintaining the Audit & Review Schedule on the
company intranet. The Audit and Review Schedule is to detail the following;
 Project being audited

 Start and end date of audit

 Reason for audit
 Nominated person to conduct the audit /review
 Type of review/audit
 Audit status
 Link to completed Audit Report
Where possible, the schedule will reflect audits/reviews to be conducted for the current financial year, however,
at a minimum, should always display audits/reviews scheduled at least 3 months in advance.
If an audit/review is not conducted for any reason then this reason will be noted on the schedule and re-scheduled
as appropriate. The approval to delay or reschedule an audit will be at the discretion of the Quality Management
System Representative.
3.1.8 Audit/Review Findings- Corrective/Preventative Actions
All non-conformities and improvement opportunities identified will be raised as a BSR in QHEST with actions
assigned to address each item. The auditee will be the assigned Responsible Manager for ensuring follow-up and
closeout of the audit actions. Their Line Manager will be the assigned Close-out Manager for ensuring the
effectiveness of the actions taken.
The auditee is responsible for responding, in the format required by the Auditor, to each non-conformity and
improvement opportunity raised in the report and accountable for closing out any actions within the agreed time-
frame.
Immediate Actions to Audit Findings
Any non-conformities that are identified during the audit/review, that have the potential to cause serious harm to
the environment, person or product/service which cannot be immediately controlled, are to be isolated by use of
barricading and or warning signs and communicated to persons on site as soon as practicable.
3.1.9 Communicating Audit Findings
For each audit completed, the final audit report, detailing audit findings, is to be forwarded to Business Unit (BU)
Management responsible for the audited area. At a minimum this will include the BU General Manager, Construction
and/or Operations Managers.
Where required, audit findings will be communicated to the wider organisation through Bulletins or GENIE alerts.
3.2 Inspections
3.2.1 Daily Task Inspections
All work areas will be visited by supervisory personnel daily to ensure tasks are being carried out in accordance
with planned activities and risk controls. This inspection does not require a formal record to be made, with the
exception of tasks being undertaken with a JHA/SWMS and/or Permit to Work where the supervisor will observe the
task and JHA/SWMS and sign the daily review in accordance with Georgiou’s Job Hazard Analysis Procedure.
3.2.2 Workplace Inspections
Workplace Inspections are conducted to check the working conditions and practices within an area or site. They are
to be conducted as a minimum monthly unless otherwise stated in the Sites HSE Management Plan. Office
inspections are only required to be done as a minimum bi-monthly. The inspection will include a sample of items in
the workplace and recorded on the Workplace Inspection – Site Form in One app.
3.2.3 Detailed Hazard Inspections
Detailed Hazard Inspections (DHI’S) focus on a specific high risk activity and associated hazards and controls. DHI’s
are to be conducted as directed by the Site’s Management, based on risk identification and/or legal or other
obligations. The inspection will be recorded on the applicable Detailed Hazard Inspection Form or if available on
the DHI in One app.
3.2.4 Plant, equipment and supplies
Plant, equipment and supplies will be inspected in accordance with the Plant and Equipment Control Standard.
3.2.5 Training and Competency
Workplace and Detailed Hazard Inspections will include a suitably experienced or knowledgeable person in the
hazards, Georgiou and legal or other requirements pertaining to the inspection.
3.2.6 Scheduling Inspections
The Site HSE Representative or nominee will schedule the required inspections on the Sites Monitoring Schedule.
Detailed Hazard Inspections will need to be scheduled when it likely that a High Risk Activity is to be undertaken.
The Monitoring Schedule will record the following as a minimum:
 Type of inspection
 The date in which the inspection will take place
 Nominated person to conduct the inspection
Where possible, the schedule will reflect inspections to be conducted for the current financial year, however, at a
minimum, should always display inspection scheduled at least 3 months in advance.
If an inspection is not conducted for any reason then this reason will be noted on the schedule and re-scheduled as
appropriate. The original scheduled inspection date and the newly scheduled inspection date will be maintained.
The approval to delay or reschedule an inspection will be at the discretion of the Site’s Manager.
3.2.7 Inspection Findings -Corrective/Preventative Actions
In the event that an inspection reveals hazards, the necessary actions to rectify the hazard will be allocated to a
person who has the responsibility and authority to address the issue. Hazards which are not able to be actioned
immediately will be recorded in the QHEST system and the action close-out date must be reflective of the risk
priority. The Site’s Manager will be accountable for the monitoring of close-out actions at the Site monthly
meetings.
Any significant hazards that are identified, that have the potential to cause serious harm to the environment or
person which cannot be immediately controlled, are to be isolated by use of barricading and or warning signs and
communicated to persons on site as soon as practicable.
3.3 Workforce Participation

Where practicable, audits, reviews and inspections should involve management, site HSE representative and
workers at all levels including Subcontractors.
3.4 Document & Record Control

The person conducting or coordinating the audit/review/inspection is responsible for ensuring records are
maintained in the Document Management System to enable validation of the system and for use in subsequent
audits/reviews/inspections.

3.5 Communication of Findings

The findings resulting from audits/reviews/ inspections will be communicated to personnel on site through toolbox
meetings, pre-start meetings, displaying a copy of the audit/ review/inspection on the HSE notice board or a
combination of these communication measures.
3.6 Review of Performance

Audit, review and inspection results will be consolidated to analyse performance trends, the effectiveness of the
Georgiou Management System and areas for improvement.
4. REFERENCES
 Audit and Review Schedule
 Job Hazard Analysis Procedure
 Plant and Equipment Control Standard
 Management System Standard
 HSE Legal and Other Obligation Directory

Appendix A11
Georgiou ISO Certification
9/08/2016 Ver: 5.0 Always refer to GENIE for latest version Print Date: 2-Nov-18
Section B: Supporting Management Plans
Appendix B1
Construction Traffic Management Plan
Appendix B2
Construction Flora and Fauna Management Sub Plan
Appendix B3
Construction Noise and Vibration Management Sub
Plan
Appendix B4
Construction Soil and Water Management Sub Plan
Appendix B5
Construction Cultural Heritage Management Sub
Plan
Appendix B6
Construction Air Quality Management Sub Plan
Appendix B7
Construction Waste and Energy Management Sub
Plan
Appendix B8
Construction Contaminated Land Management Sub
Plan
Appendix B9
Other Management Measures Management Plan
Appendix B10
Construction Sustainability Management Plan
Appendix B11
Pollution Incident Response Management Plan
Appendix B12
Construction Community Liaison Plan

#TNR Stage 4 Construction Environmental Management Plan

Uploaded by

Document Information

Original Title

Copyright

Available Formats

Share this document

Share or Embed Document

Sharing Options

Did you find this document useful?

Is this content inappropriate?

Copyright:

Available Formats

#TNR Stage 4 Construction Environmental Management Plan

Uploaded by

Copyright:

Available Formats

Construction

GEJV Environmental Manager

EPA pollution hotline NA 131 555

Liverpool City Council ~ 1300 362 170

SafeWork NSW ~ 131 050

An Overarching Construction Environmental Management Plan (OACEMP) has been

The purpose of this CEMP is to provide a structured approach to the management of

In particular, this CEMP provides:

1.2.1 Conditions of approval

Issue-specific sub-plans have been prepared to address CoAs relevant to specific

Other relevant management measures to be addressed in Construction (including socio-

1.2.2 Ecologically Sustainable Development

Certification and approval

Reviews will be undertaken in consultation with key stakeholders to ensure all

Figure 2-1: Project location and key features

Construction Proposed work Plant and equipment Approximate

Early works  Notification of residents of Construction work  Trucks 6 months

Environmental Policy and Procedures

Other environmental OACEMP and

Auditing and reporting

Figure 3-1: Project environmental management document system overview

Table 3-1: Environmental Management Sub-plans and Strategies

3.3.2 Environmental Work Method Statements

3.3.4 Sensitive area maps

3.3.6 Environmental system procedures, forms and other documents

Legal and other requirements

4.2.2 Approvals, Permits and Licensing

Table 4-1: Licenses, Permits and Approvals

Environmental aspects and impacts

4.3.1 Environmental risk assessment workshop

4.3.2 Ongoing risk analysis

Environmental objectives and targets

The targets are incorporated into relevant environmental management sub-plans.

Table 4-2: Environmental objectives and targets

Objective Target Measurement tool

Implement sustainability  Enhance positive environmental, Measure, monitor and

5.1.1 Environmental Representative (ER)

Roads and Maritime Senior Environmental Environmental Review Group

Roads and Maritime Project Construction Project Roads and Maritime

Roads and Maritime Construction Manager Roads and Maritime

Environmental Site Community Relations

*Information describing the

Roads and Maritime roles

5.1.3 Roads and Maritime Project Director

5.1.4 Roads and Maritime Senior Project Manager

5.1.5 Roads and Maritime Project Managers

5.1.6 Roads and Maritime Environmental Manager (or delegate)

5.1.7 Project Manager

5.1.10 Environmental Site Representative

5.1.11 Communications Relations Manager

Further details of the CRM’s responsibilities are provided in the CCS.

5.1.14 Wider Project team (including sub-contractors)

Records of all subcontractors' work practices, effectiveness of environmental protection

GEJV will regularly review and keep a record of:

All environmental documentation submitted by sub-contractors will be subject to review and

5.3.1 Environmental induction

5.3.2 Toolbox talks, training and awareness

Targeted environmental awareness training will be provided to individuals or groups of

Table 5-1: Environmental Awareness Training

5.3.3 Daily pre-start meetings

The environmental component of pre-starts will be determined by the Superintendent and

Pre-start topics, dates delivered and a register of attendees will be recorded.

5.3.4 Communications Training