EXPLANATION EVENT UNIT

CEREBRO VASIKULMAR ACCIDENT (CVA)

Name : Theresia Ine Diaz

NRP : 9103020022

FACULTY OF NURSING WIDYA MANDALA CATHOLIC UNIVERSITY

SURABAYA
 EXTENSION EVENT UNIT

I. Situation Analysis
Based on the results of a survey in Palamoko village, 35% of the residents there
are affected CVA disease (Stroke), 25% of 35% of residents affected by CVA
disease male and 10% of 35% are male female genital. Flat The average resident
in Palamoko village has a lack of knowledge about CVA disease (stroke). The
education level of the residents in the village is SD (Elementary School), Junior
High School (Junior High School) and 25% of the residents there uneducated.
During a visit to Palamoko village it turned out that residents more often consume
foods such as meat, salty food and also often smoke.
A. Predisposing Factors (predisposing)
In the survey process when asked about CVA (Stroke), it turns out that there are
some of them who still don't know what is CVA disease, and there are also some
of them who have know about CVA disease but don't know what to do what to do
to overcome / cure the disease. Residents there who are affected by CVA disease
say they often complain It's hard to control what foods you can and can't eat
consumed when exposed to the disease. Residents all this time too often use
natural remedies to reduce the feeling of no delicious on body, especially in the
part of the body affected by a stroke. Their habits when symptoms of CVA appear
or when they feel unwell, they just do things like compress using leaves on the
part that feels uncomfortable tasty / swollen, as well as provide traditional
ingredients.
B. Enabling Factor
Many residents in the village of Palamoko who have jobs as fishermen at sea and
tobacco growing farmers (material for cigarettes) Therefore, the people in the
village often consume salty food from the sea and also often smoked from
ingredients grown tobacco. Besides that, cultural factors too affect this disease,
that is, at any event they will always get slaughtered meat, then they also often
consume foods such as pork, beef and even buffalo meat. The residents of
Palamoko Village said when their condition was not good only or worse they
never go to service health on the grounds that the place of service is far away,
lack of facilities to go there, damaged roads and lack of funds treatment
C. Reinforcing Factor (reinforcing)
 The residents of Palamoko Village really look forward to this event counseling
about CVA (Stroke) so they can increase their knowledge them in preventing
their disease and can implement a lifestyle healthy so that they can take good care
of themselves properly. Citizens too said that in the area there are health facilities
in the form of a health center, but still lack of health personnel.
II. Subject matter: Counseling about CVA (stroke) includes understanding, sign &
symptoms, classification, causative factors, and ways to prevent CVA disease
(strokes).
III. Competency Standards/Objectives
a. General purpose
After counseling about CVA (Stroke) Disease during the 45 minutes, participants
are expected to be able to understand and be able to xplain about CVA disease
(stroke) properly and correctly.
b. Special purpose :
1. 100% of participants were able to explain the meaning of CVA (stroke)
2. 100% of participants were able to mention the factors causing CVA (stroke)
3. 100% of participants were able to mention the signs and symptoms of CVA
(stroke)
4. 100% of participants were able to state the classification of CVA (stroke)
5. 100% of participants are able to understand and apply how to handle CVA
( Stroke )
c. Contents/sub subject
1. Definition of CVA Disease (Stroke)
2. Causes of CVA Disease (stroke)
3. Signs and symptoms of CVA (stroke)
4. Classification of CVA Disease (stroke)
5. How to prevent CVA (Stroke)
IV. Execution time :
a. Place : Palamoko Village Hall, Lamboya, West Sumba
b. Day & Date : Saturday, September 25, 2021
c. Time: 08.00-08.45WIB
V. Activity plan :
a. Target: Community of Palamoko Village, Lamboya, West Sumba
b. Method: Discussion and question and answer
 c. Media: Powerpoint and Leaflet
d. Schedule
A. Timing
Activity Description of
Time Method Media Executor
step activities
1.Presence
2.Greetings
3.Explain the
08.00-
purpose
08.05 opening Talks - Theresia
4.Contract time
(5 minutes)
5.Test knowledge
About disease CVA
(Stroke)
Explaining the
material:
1. explain definition
CVA (strokes)
2. mention cause
factor CVA (stroke)
3. Mention the sign
08.05- PPT
Presenter of And symptoms CVA Lectures,
08.25 ( 20 and Theresia
material (strokes) discussions
minutest) Leaflet
4. mention
CVA classification
(Stroke)
5. Mention the way
prevention
CVA disease
(strokes)
08.20- Evaluation 1. Giving chance on Question PPT Theresia
08.35 (15 participants for ask and answer and
minutes ) 2. Giving 5 question Leaflet
in the form of :
 Short definition
 About CVA disease
(Stroke)
 Some factor
reason CVA
disease (strokes)
 Sign and disease
symptoms CVA
(stroke)
 disease
classification
CVA (strokes)
 How to
Prevention
disease CVA
(strokes)
1. Deliver
essence of matter
08.35-
2.Ending meeting
08.40 (5 Closing talk - Theresia
with prayers and
minutes )
regards
3.Final attendance

B. Place Setting
VI. Evaluation
a. Evaluation of the structure:
1.Setting the place as planned
2. Place and media as planned
3.90% of the invitees who attended the counseling
4.10% of the invitees did not attend the counseling
b. Process evaluation:
1. The roles and tasks of students are in accordance with the plan
2.Time according to plan
3. During the process, it is hoped that the audience will be able to follow the
whole process counseling activities
4. During the activity, the audience is expected to play an active role
c. Evaluation of results:
1.70% of participants answered and asked questions about CVA (stroke)
2. As many as 20% of participants are passive when the counseling event is held.
Some participants are still busy with their own business such as talking with the
person next door, playing with gadgets and not focusing when given short
question by the presenter/presenter.
3.About 10% of participants left behind information about extension activities
which was held because it was late
4. Participants give questions to the instructor, regarding the material not
understood
5. Participants are able to explain the meaning of CVA (stroke)
6. Participants are able to state the factors that cause CVA (stroke)
7. Participants are able to state the signs and symptoms of CVA (stroke)
8. Participants are able to state the classification of CVA (stroke) disease
9. Participants are able to state how to prevent CVA (stroke)

VII. Attachment
1. Extension Materials
 A. Definition of Disease (CVA)/Stroke
Stroke is an acute neurologic deficit caused by cerebrovascular disorders that
occur spontaneously sudden and can cause disability or death (Munir, 2015).
The definition of stroke according to the World Health Organization is a rapidly
growing clinical sign of impaired brain function. focal or global, with
symptoms lasting 24 hours hours or more, can cause death in the absence of
other causes other than vascular (Munir, 2015). From several definitions of
stroke according to the above experts can conclude that stroke is a disease or
disorders of the neurological system that occur due to lack of blood supply
oxygen to the brain can suddenly occur because of a blockage or rupture of a
blood vessel to the brain which can cause symptoms and even cause death.
Stroke is one of the diseases caused by bloodsucking on the brain so as to
make someone have the disease. This disease can affect everyone especially in
the elderly. At that age he is said to be vulnerable because range of diseases
such as hypertension, diabetes, obesity, and gout.
B. Factors Causing Cerebro Vascular Accident (CVA)/Stroke
There are several factors that increase the risk of stroke. These risk factors can also
increase the risk of a heart attack. These factors include:
a. Health factors, which include:
1.Hypertension
2.Diabetes
3.High Cholesterol
4.Obesity
5.Heart Disease
b. Lifestyle factors, which include:
1.Smoking
2. Lack of exercise or physical activity
3. Consumption of illegal drugs
4. Addicted to alcohol
c. Other factors, including:
1. Heredity factors. People who have family members who have had a stroke, are
at high risk of developing a disease that the same.
2.Russian factor: With increasing age, a person has a risk stroke is higher than
younger people.
C.Signs and Symptoms of Cerebro Vascular Accident (CVA)/Stroke
Symptoms of stroke are difficulty walking, speaking, and understanding, and
paralysis or numbness of the face, arms, or legs. Such as explained below:
a. Muscles: paralysis with weak muscles, difficulty walking, instability, coordination
problems, muscle stiffness, paralysis in one side of the body, or overactive
reflexes.
b. Visual: temporary loss of vision in one eye, sudden loss of ability to see, blurred
vision, or double visual display.
c. Whole body: tiredness, lightheadedness, or vertigo
d. Sensing: tingling or reduced touch sensation
e. Members of the body: lethargic or numb
f. Speech: loss of ability to speak or difficulty speaking
g. Facial treatment: numb or muscle limp
h. Also common: receptive aphasia, rapid out-of-control movements, confusion
i. Mental illness, difficulty swallowing, or headaches
D. Classification of Cerebro Vascular Accident (CVA)/Stroke
1. Ischemic Stroke (Stroke Blockage), the most common stroke:
a .Emboli Stroke: Blood clot or plaque that forms in the heart or large arteries that
are transported to the brain.
b. Thrombotic Stroke: Blood clot or plaque that forms in the arteries that supply
blood to the brain.
2.Hemorrhagic Stroke (Bloody Stroke)
a. Intracerebral haemorrhage: Rupture of blood vessels and blood enter the tissue
causing the cell-cell to die so that the impact on the work of the brain stops. The
most common cause is Hypertension.
b) Subarachnoid hemorrhage: rupture of a blood vessel close to the surface of the
brain and blood leaks between the brain and skull bones. The causes can be
different, but usually due to the rupture of an aneurysm can also make the
heartbeat become irregular.
E. How to Prevent CerebroVasicular Accident(CVA)/Stroke
The main way to prevent stroke is to adopt a lifestyle healthy. In addition, identify
and avoid existing risk factors, and follow the doctor's advice. Various actions
stroke prevention, including:
a. Maintain diet.
 Eating too many salty and fatty foods can increase the amount of cholesterol in
the blood and the risk of causing hypertension which can trigger a stroke. Avoid
consuming salt excessive. The ideal salt consumption is as much as 6 grams or
one teaspoon per day. The recommended food is food that is rich in unsaturated
fat, protein, vitamins, and fiber. All nutrients can be obtained from vegetables,
fruit, whole grains, low meat fat like skinless chicken breast.
b. Exercise regularly.
Regular exercise can make the heart and circulatory system blood works more
efficiently.Exercise can also lower levels cholesterol and keep your weight and
blood pressure at the right level healthy.
c. Quit smoking.
Smokers are twice as likely to have a stroke, because smoking can narrows blood
vessels and makes it easier for blood to clot. Not smoking means also reducing the
risk of various health problems others, such as lung and heart disease.
d.Avoid consuming alcoholic beverages.
Liquor contains high calories. If consumed excessive, a person is susceptible to
various stroke-triggering diseases, such as diabetes and hypertension. Excessive
consumption of alcoholic beverages It can also cause an irregular heartbeat.
e.Avoid the use of drugs / chemicals.
Some types of drugs can cause narrowing of the arteries and reduce blood flow.
2. DaftarPustaka PRAYOGI,I.
(2020).STUDILITERATUR:ASUHANKEPERAWATANPASIEN
CVA(CEREBROVASCULERACCIDENT)HEMORRHAGICDENGAN
MASALAHKEPERAWATANDEFISITPERAWATANDIRI:MANDI
(Doctoraldissertation,UniversitasMuhammadiyahPonorogo).

Anisa,N.A.(2019).ASUHANKEPERAWATANPADAPASIENCVANON
HEMORAGIKDENGANMASALAHKEPERAWATANHAMBATAN
MOBILITASFISIKDiRuangMultazamRSUAisiyahPonorog
(Doctoraldissertation,UniversitasMuhammadiyahPonorogo).

https://www.halodoc.com/kesehatan/stroke
http://www.p2ptm.kemkes.go.id/infographic-p2ptm/penyakit-parukronik/apa-
saja-jenis-jenis-stroke
3. Attendance of Participants

ATTENDANCE LIST OF PARTICIPANTS OF CVA (stroke) counseling

AT THE PALAMOKO VILLAGE HALL, LAMBOYA, SUMBBARAT
Saturday, September 25, 2021

No. Nama Tanda - tanda

Surabaya, September 25, 2021

Theresia Ine Diaz

9103020022