The document contains sequences for frataxin proteins from several species, including mouse, rat, dog, rhesus monkey, human, horse, macaque, cow, chimpanzee. Frataxin is a mitochondrial protein involved in iron homeostasis. The sequences show conservation of several residues across species.
The document contains sequences for frataxin proteins from several species, including mouse, rat, dog, rhesus monkey, human, horse, macaque, cow, chimpanzee. Frataxin is a mitochondrial protein involved in iron homeostasis. The sequences show conservation of several residues across species.
The document contains sequences for frataxin proteins from several species, including mouse, rat, dog, rhesus monkey, human, horse, macaque, cow, chimpanzee. Frataxin is a mitochondrial protein involved in iron homeostasis. The sequences show conservation of several residues across species.
MWTLGRRAAAGLLPRSAPPGSAAAGAGTRGPTRAAPLHGGRGLRVGTGAARGPSHANLSLHHLNQLVNVK KQSVCLMNMRTVGTVSSPGSLDETTYERLAETTLDSLAEFFEDLADKPYTLEDYDVSFGSGVLTVKLGGD LGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLATELTKAFKIKLDLSSLAYSGKG T
>Rhesus gi|109111727|ref|XP_001093449.1| PREDICTED: similar to frataxin isoform 1