l

Year 13, Issue 1

A research based monthly magazine on

Yoga, Ayurveda, Cultural and Spiritual message

September 2015

l Price

15/-

Published by Divya Yog Mandir (Trust) Haridwar, under the

guidance and encouragement of Honourable Swami Ramdevji Maharaj

The collective `purushartha` of Patanjali

Yogpeeth will pave the way for the direction of
the good fortune of the country
1 SeptemberU 2015

l September

Year 13, Issue 1

A research based monthly magazine on

Yoga, Ayurveda, Cultural and Spiritual message

2015

l Price

15/-

Published by Divya Yog Mandir (Trust) Haridwar, under the

guidance and encouragement of Honourable Swami Ramdevji Maharaj

Udhyam Sahasam dhairyam buddhih shakti parakramah

Shedet yatra vartante tatra dev sahaykrit.

The collective `purushartha` of Patanjali

Yogpeeth will pave the way for the direction of
the good fortune of the country
1 SeptemberU 2015

INDEX
n

Year 13 n Issue 01 n September 2015

Published in Hindi, English, Gujarati, Marathi, Bangla, Punjabi,

Oriya, Assamese, Telugu, Kannada, Tamil and Nepali

a
a
a

Editor

Acharya Balkrishna

Associate Editor

Dr. Vijay Kumar Mishra

a
a
a

Office
Patanjali Yogpeeth
Maharishi Dayanand Gram,
Delhi-Haridwar national highway,
near Bahadarabad,
Haridwar-249402, Uttarakhand
Phone (01334) 240008,
244107, 246737
Fax (01334) 244805, 240664
e-mail yogasandesh1@gmail.com
e-mail divyayoga@rediffmail.com
on the web www.divyayoga.com

Subscription Fee
One copy
Annual
Five Years
Eleven Years
Abroad (Annual)

15/150/700/1500/800/-

Publishing

a
a
a
a
a
a
a
a
a
a
a
a
a
a
a

Eternal wisdom
Editorial
Eagle wood is highly fragrant, very useful
Divine formula of life
Tribute and remembering the moments spent at Patanjali
Yog Peeth by respected former President APJ Abdul Kalam
Mothers and sisters should get full dignity
Sleeplessness and its natural-yogic treatment
Your Experience
Mind is full of amazing miraculous capabilities
Cow milk full of omega - 3 and ......
Bharat is front-runner in various fields
Why worry for snoring, epilepsy or cataract?
The truth of English being the global language
Message of Sansthan
30 medicinal plants and 20 `yogasans` useful in diabetes
Naturopathy of Patanjali Yoggram
The world on the way of reconstruction
For the best scale of rural development....
Some domestic methods for protecting agriculture:
Important message for the readers of Yog Sandesh
Song: With the strength of Yoga
Take maximum production of chilli with Patanjali process
Arogya Guru my salute to you

03
04-05
06-09
10
11
12-13
14-16
17
18-20
22-23
24-26
28-29
30-31
34-44
46-48
50-51
52-53
54-56
57
59
61
62-64
67

(Dainik Bhaskar Group)

B-220, Pahse II, Noida-201305,
G.B. Nagar, U.P.

Publisher and printer Divya Yog Mandir (trust), Kripalu Bagh

Ashram, Kankhal, Haridwar-249408, Published by Rishi offset
printers, Ved Mandir, Gita Ashram, Jwalapur Haridwar and
printed at M.P. Printers, B-220, Phase II, Noida, G.B. Nagar, U.P.
Editor, Acharya Balkrisna. RNI NO.:DELENG/2006/16626
Yog Sandesh is basically published in Hindi. Therefore some
errors are possible while translating the contents from Hindi to
other languages. It is not necessary for the editor to have coherence with the views expressed in the contents of the magazine.
All disputes are to be settled in the court of law at Haridwar.

Read this magazine yourself, inspire five others to read and then place in five new families so that this
agitation, being inspired by seers could spread, reach and benefit every human being. - Editor

Eternal wisdom

The everlasting truth from the Shaswat Pragya of

Shredhyey Yogrishi Param Pujya Swamiji Maharaj

The formula of completeness and success of life

. There should be no alternative to the pledge and to fulfill the sacred oath taken by us,
every effort should be made. Physically, mentally, psychologically and spiritually, we are
independent though we depend on others in view of economical, social, family and political
aspects. But this is little trouble, which could be overcome though, it gives little pain. The
completeness of the life is in the manhood. The external manhood effort (purushurth) takes
up to prosperity while internal manhood takes us to the extreme of `Samadhi` (trance).
. When we perform service and meditation, without any selfishness we receive three gifts from
the almighty. First one is the best, refined, positive and complete judicious intelligence, the
second one is the best powerful and completely healthy body and the third one is patronage
of the best and competent parents and most intelligent and efficient teachers. Enjoying
the worldly pleasures will not give us good fortune and more we enjoy the pleasures, more
the blessings of the god for our good work decays. Hence, a complete pious and rational
person has the duty that he starts the public service form 10 per cent and later extend it
to 100 per cent. Thus, service to the mankind is the platonic service. This service has been
named as `brahma karma`, `akam`, `aapt kam`, or divine duty in Vedas, philosophy, Gita
or Upnishads. We shall get rid of our inconsiderate wishes and live life, in accordance to
the `Vedas`, teachers, `Shastras` and the soul. We shall not dis-honour or violate the wish,
order, inspiration or the direction of the almighty in the soul.
. In the life, we shall take some decisions very firmly and live life with authority. Such
tendency gives divinity, greatness, sage ship, divinity and completeness. We could easily
remove macro-defects from the life immediately like non-vegetarianism, intoxication,
anger, revenge, reaction, violence, falsehood or if we say in proper words, any action against
the `yama-niyam`. Dilute the macro defects of the life slowly with firmness and one day,
you will succeed.
Social, economical, practical, family and other mutual relationship should be maintained on
the principle of generosity, co-existence and reciprocity but we should be firm and committed
completely, while following Vedic principles preached by the seers, our conduct, guru and the
organization and there shall be no compromise or wavering attitude. Firmness and generosity
should be two guiding forces or models for us, which we shall follow with commitment, which
are of much importance in the life. If we dont follow these two principles, pain, injustice, nonreligion and disorder are bound to happen. I myself live on the same principle and people, who
have affection to me; I pray all of them to live on this formula. We will have to be firm towards self,
look as god in every individual and should be generous towards the humanity. We all will have to
move towards complete truth with complete divinity.

3 SeptemberU 2015

Editorial

`Kapalbhati Pranayam`
I

n the field of yoga different discussions are being held on the word `Kapal bhati`. Some people
opined that it is an action or `karma` but no Pranayam while in the Patanjali Yogpeeth and the
literature been published from here, it is placed under the category of Pranayam. Thus, some sort
of confusion has been created, so I am presenting some facts here.
First-of-all, we will have to decide as what is the definition of `Pranayam` and whether Kapalbhati
falls under its ambit? As Kapalbhati is identified as `karma` or `kriya` i.e. action in `shatkarma`,
no objection can be raised that Pranayam is a kind of `karma` or `kriya`. Thus, Kapalbhati is
a Pranayam, it has been also placed in the category of `karma` in `shatkarma`. Thus, it is specific
quality or magnificence that `Kapalbhati` is a `Pranayam` and also included in the refining activity
under `Shatkarma`.
Acharya Balkrishna
Otherwise also, Bhrastika, Suryabhedam, Ujjaiyi, Seetakari, Sheetali, Anulom-vilom and Bhramari
and other Pranayams refine impurities and frailty of the body, mind and organs. Thus, if we accept
all Pranayams as refinery process, there should be no objection as every Pranayam is a `karma`.
`Hathpradipika` says that some `acharyas` accept purification of all impurities and frailty with
Pranayam. They do not consider `Shatkarma` process important for it.
Pranayamairaive Sarve Sushyanti Bhala Iti,
Acharyaknantu Keshanchidnayam Karma na Samtam. (Hath 2/38).
Pranayam purifies all impurities and hence, many `yogis` or `acharyas` do not find other refinery
processes important. As in Yoga Darshan, `tapa, `swadhyay` and `ishwar pranidhan` all are `kriya
yog`, rule and `ashtang yoga` too. First-of-all, I try to speak out the explanation of Pranayam in the
`Shastra` tradition and in context of the core Pranayam. The word Pranayam has found reference in
Manu Smriti, Gita, Yoga Darshan, Hathyoga and Purans.
In Sanskrit language, meaning of any word depends on root and suffix. Pranayam is a derivative word,
which has been made by two words `Prana` and `Ayam`. `Ayam` means dimensions, extensions,
control, deficiency, prohibition or perception. The meaning of word `ayam` in context of `Pranayam`
is discontinuance of `prana` i.e. the normal breathing, deficiency, prohibition and control.
Maharshi Patanjali and Vyas Muni have given the same definition.
Tasminsati shwas prashwasyagartiviched Pranayam (Yoga Darshan 2/49)
Satyasanjaye Bahasya Vayorachmanam shvasam, koshthayasya vayodnisaranam prashyas.
Tayogartiviccheda ubhaya Pranayam. (Yoga Darshan- Vyas Bhashya 1/49)
Pranayam Tridhaprokta: Purak kumbhk rechkah. (Hath 2/71)
In this connection, it is written in Yogavashishtha
Trayana paurvaparyene prathmabhumikaya
sadhyanushthanniyamadektva vyawaharoppatte,
Na tu tadrashvakyeshu militanamev pranayamtatva vivkshitam (Yo Va)
Vkshyaman chaturvidh pranayamsyey samanaylakshnam gativicchedam,
Shostrokatritya swabhavikgate pratishedh-ityartha.
4 SeptemberU 2015

Sach rechkpurakkumbhkeshvnugatah (Yo Va page 268)

So, the conclusion can be drawn that it is the refusal of the normal pace of Pranayam, its discontinuance,
deficiency or control. In Gita also, the explanation of Pranayam is the same.
Apanejuhatiprana pranepanah tathaspare,
Apnespanvritto juhati prakshipanti prana pranavranti purkasya pranayam kuvantityartha.
Pranepanam tathaspare johati rechkakhyam cha pranayam kurvantityete.
Pranapangati mukhnasikabhya vayornigamanah pranasya gatistdiparyayena dhogmana mpanasya te
pranapanmati ete rudhva, nirudhya pranayamparayana pranayam tatpara kumbhkavyam pranayam
kurvantivarthyam. (Shankarbhashyam).
The derivation from Gita also makes it clear that to hold the normal speed of prana is `purak`,
`rechak` or `kumbhak` pranayam.
Now we come to Kapalbhati. Why it has been named as Pranayam or why it has been kept it in the
category of `Pranayam` and even the bigger question is that whether it is in accordance with the
`shastra`. So, first we see the Yoga Darshan as preached by Maharshi Patanjali.
Pacchardanvidharanabhya va pranasya (Yoga Darshan 1/34)
Koshthaysa Vyornasikaputabhya prayatna visheshadwavamanam pracchardanam.
Vidharanam Pranayam. Tabhya va manasa sthithi sampadyate.
The `Vyas Bhashya` of Yoga Darshan says `effortful expulsion of breath from both the nostrils and
its hold is the process of Pranayam. In Yoga Darshan, the process of Pranayam has been explained but
it has not been given proper noun. We should have given a proper noun means relevant name to it
and hence this Pranayam of Yoga Darshan has been given as Kapalbhati. The logic behind is that in
`Hatha Pradipika`, this process has been mentioned as Kapalbhati. This is our logic, in accordance
with the `Shastras`.
Atha Kapalbhati:
Bhastravllohkarasya Rechpuro Sasambhramo
Kapalbhatirvikhyata Kaphadosha Vishoshani. (Hath 3/36).
Pushing the breath out like bellows of blacksmith forcefully means laxative and hold it normally or
supplement it is called Kapalbhati.
Kapalbhati falls in the category of Pranayam a wherever there will be the process of laxative, factitive
or `kumbhak` will be held, at all the place Pranayam will come into practice. This is the tradition of
`gurus` and shastras. The meaning of Kapalbhati in words is it is the union of `Kapal`, means the
forehead and `bhati` comes from the `mastiksha` i.e. brain and bha-dipto, which means enlightened,
shining, aura or vigour. This is Kapalbhati Pranayam. Not thousands but crores of people have
performed Pranayam and it is our experience that it treats many diseases, including incurable one,
supplies hemoglobin and other nutritious elements, it awakens `ashata chakra`, treats sexual diseases,
controls sexual desires and gives aura and brightness on the face. People, who perform Kapalbhati
gets brightness on the face and if, Kapalbhati is performed for nine months, the person gets extremely
glorious. So, the denomination is extreme correct and relevant.

5 SeptemberU 2015

Health in Herbs

Eagle wood is highly

fragrant,
very useful

Scientific name- Aqilaria malaccensis Lam. Syn-Aquilaria agallocha Roxb. ex DC.

Family name- Thymelaeaceae
English name- Eagle wood, agar
wood ; Sanskrit- Aguru, Krimijagdh, Pravar, Loh, Rajarh, Yograj,
Vanshik, Krimij, Jongak, Anaryak;
Hindi- Agar, Uda
Assamese- Sasi; Urdu- Agar
Kannada- Agaru; GujaratiAgar;Tamil- Aggalichandanam
Telugu- Agru;Bengali- Agru,
Aggar, Uggar;Punjabi- Panwar,
Chakunda; Marathi- Agar
Malyalam- Kayagahru
English- Agar wood, Aloe wood,
Malayan Agar wood, Agallochum;
Arabic- Ood-e-Garqi, Agare-Hindi
Persian - Agar- Uda-ae-Hindi

6 SeptemberU 2015

Acharya Balkrishna
Patanjali Ayurved is conducting a widespread research
to stop the oppression of this body endowed by
almighty. In Indian Ayurveda, a medicine is that which gives a person the
sense of being healthy and make him free from diseases. Since our body
is directly connected with the nature, therefore a disease is also born due
to natural imbalance. In this situation, a medicine has to be made from
natural ingredients. Moreover, if we will use any chemical as a medicine
for treatment of diseases, it will sooner or later definitely show its adverse
impact on our health. For eternally good health, it is necessary to find a
medicine for mental or physical problems from the nature itself.
Patanjali Yogpeeth has conducted intense research on herbs and their
prescribed dose and has come up with this series of "Health in Herbs".
This time here is the description of the properties of eagle wood. These
description can be found in detain in the book named- Jadi Buti Rahasya.

Patanjali

There are many types of Agar plant. In Aryan scriptures and Ayurvedic texts,
following types of this plant have been described.
1. Krishnaguru 2. Kashthaguru 3. Dahaguru 4. Mangalya Guru.
Among them, Krishnaguru is considered as the best and is highly used in
treatment of diseases due to its medicinal values. Woods of this species of the
plant are of high density therefore they sink when kept in water. Assam has
been very famous due to abundance of this plant but the countries which are
world - wide famous for supply of its wood are Bhutan, Myanmar, Malaya,
Malaysia and Philippines. In North India , its trees are found upto 500
metre height in the areas consisting of North-Eastern Himalaya, Meghalya,
Manipur, Nagaland, Tripura's hilly areas, West Bengal, etc.

Chemical composition:
In the fungus infected wood, oil that can be vaporised is found. Aquillochin,
Lignain, a & B - Agairofuron, Agraio, Dihydroagarofuron, Agarospirol,
basic Liriodenine, selinine, besides 48 per cent alcohol dissolvable substances
are found.

Ayurvedic properites and effect:

gar is a huge, ever-green

tree. In Charak Samhita,
it has been described as
a medicine to cure headache, to be
applied for cooling of body parts,
and in winter it has been described
as very useful. It also talks about
its properties to cure sore. It wood
contains a wax-like soft and fragrant
material, which is used for making
Agarbatti. Kautalya Arthshastra
talks about its trade at a huge scale.
In Hebrew scriptures, it has been
called as Alhot. Moreover, in Greek
and Roman scriptures, it has been
called as Agelocan and in ancient
Arabic texts, it has been called as
Uda Hindi and Adhalukhi.

Its juice has acrid taste, hot in nature for sperm, light, smooth, cures cough
and gastric problems. It also increases pitta in the body.
By applying its fragrant paste, it gives cooling effect. It is Hridya, interesting,
Shwashar, Sheetprashamak, Shirovirechak, Medshoshak, Varnaprasadak, etc.
It is useful in treatment of the problems like ear problems, Akshirog, leprosy,
Hikka, Chhardi, breathing, jaundice, head problems etc.
Krishnaguru- It is acrid in taste, full of juices, Ushna Virya, a bit cures
Tridosha, especially Pitashamak. Its paste is very cool.
Kashthguru: Its juice is acrid in taste, hot in nature, cures cough and its paste
on being applied gives rough feeling.
Dahaguru: It is also acrid in taste, hot in nature, nourishes hair, has colouring
effect, cures hair problems.
Manglyaguru: It has cool nature, heavy, yogavahi, cures leprosy, etc.
Agarusar: It is acrid, bitter, hot and cures gastric, purifies sores, worms and
leprosy. Its smoke is fragrant and cures gastric.

Qualities of best Agar:

l
l
l
l

It sinks in water.
In tube test, it shows impact on human nostrils and its cells.
The extract of Ethyl Acetate shows oxidising nature.
Extract of its leaves has the nature of anti-biotic.

7 SeptemberU 2015

Health in Herbs
Medicinal use, quantity and
method:
Head diseases:
1. Headache: Rub a piece of Agar
wood like sandal wood and
add some camphors into it and
apply on the head. It is very
effective in head related pain.

2. Chest problems:
1. Cough: Take 1-3 gm Agar
power and add some dry ginger
into it and use with honey. It
is effective in cough related
problems.
2. Swelling in respiratory ducts:
Take Agar power and camphors
and crush them together. Apply
it on the chest. It will cure the
problem.
Breath: Take 2 drops of Agar oil
in a betel leaf, and administer it to
the patient. It is effective in breath
related problems.

Stomach diseases:
1. Arbud: Take 10 gm of Agar
wood, make its tea, use it to
make 20-40 ml tea, which is
very effective in this problem.
2. Vomiting: Administering
1-2 gm Agar powder is very
effective.
3. Low appetite: Take 1-3 gm
Agar wood powder and use it
with honey. It is very effective.
Sex diseases:
8 SeptemberU 2015

Its trees are 18-20 metre high, curved at various places, full of
branches. Its bark is thin like a piece of paper, it is soft, a bit flexible,
white with a little bit yellowish appearance. Since its internal
wood is affected by fungus is black in colour and has some special
fragrance. Its leaves are 5-12 cm long, 1.8-5 cm wide, smooth and as
thin as a piece of paper. Its flowers are small in size, greenish white
in colour, in the shape of umbrella, and they are found in bunches.
Its fruits are 2.5 cm long, have wrinkles on being dried, flowers and
fruits are found between May and November. Its wood begins to get
mature after a tree turns 21. Before turning mature, the wood lacks
fragrance, has a very simple yellowish colour. But after maturing, its
branches accumulate juices in its various parts. It makes the plant's
wood useful and heavy in weight. Its pieces are sold in the market.
The quality of wood depends upon the quantity of the juice in the
wood. Higher the juice, better is the quality. In some parts of the
wood, the juice gets accumulated in the form of Ral or wax which
is used as fragrant wax which is sold in the market by the name of
Dhoop. After the wood turns mature, a worm starts rot into it due to
which it becomes even more fragrant and at this stage it is called the
true fragrant Agar. For better fragrant results, its wood is chopped
and stored beneath soil to improve its quality even further. Due to
this, its colour turns black.

Raktarsh: It will be cured when its 1-3 gm powder is added in three times
quantity of sugar candy and administered to the patient.
Kidney diseases:
1. Prameh: Take equal quantities of Patha Panchang, Agar wood, turmeric,
and make its tea. It 10-20 ml quantity is useful in the problem.
1. Diseases of reproduction system:
1. Sutika rog: Administer 10-20 ml tea of Agar wood to a patient after and
before birth of child. It is very effective. If dry ginger or sonth are added
into it, it will be even more effective.

Joint pain diseases:

1. Gastric problems: This disease and related diseases are cured if the paste of
its wood is applied on the affected parts of the body.

Skin diseases:
Paste of its wood when applied on affected body part is very effective.
Paste of its leaves is also effective in related problems.

All body diseases:

Swelling: In cough related swelling, paste of Chorak and Agar is very
effective.

Fever: The water treated with Agar

wood, the thrust in this problem is
cured.
Chemical treatment: Take 2-5
gm Agar extract, spread it in an
iron pot, in the morning take 375
ml water and mix it into the water
and administer it for one year. It
will cure old age problems and
increases longevity of life.
You will get a lot of strength if for
15 days Agar milk is taken.
If 1-2 drops of Agar oil is taken
regularly, it gives a lot of strength.
Keep 1-2 drops of old Agar oil
in betel leaves, and kept in the
mouth it will cures sex hysteria.

Poison treatment:
Jangamvish: If its wood is crushed
and applied on the place of a
snake bite it will cure the effect of
the bite.

Special:
Pryojyang: Fungus infected
internal wood.
Quantity: Oil 1-5 drops, powder
0-5-3 gm, extract 1-2 gm, tea
10-40 ml and it has to be taken
according to the advice of a
doctor.
Special notes: Agar's internal
wood has ascomycetous mold,
phaeoacremonium parasitica ,
etc fungus and for safety of the
wood from them a special resin is
discharged from the plant.

9 SeptemberU 2015

Spirituality

Divine
formula of life
Swami Ramdev

We are in fact sons

and daughters of
sages. Therefore,
there has to be
divinity in our
behaviour. This
has to be our main
identity.

(Ahead of last issue)

We are trying to spot problems in the fields
like medical science, agriculture, industries,
art, culture, music, literature, government,
administration, management and media.
The problems faced by the country are poverty, lack of knowledge, lack of education ,
deprivation, injustice, exploitation, inequality,
violence, falsehood, greed, corruption ,
blackmoney, scams and scandals, adulteration,
war mentality, religious bigotry, etc . Its reason
is the lack of the kind of education which a
child should get in his childhood.
Vedic knowledge and modern science will
help the world to produce divine leadership,
divine characters and divine activities and this
kind of education can be provided through
our humble services. We are confident that
our service will help India to emerge as World
Leader in the field of economy, defence,
spiritualism, etc and our nation will get rid of
deprivation.
We are in fact sons and daughters of sages.
Therefore, there has to be divinity in our
behaviour. This has to be our main identity.
Divinity lies in our gens. This has to be
10 SeptemberU 2015

developed fully. We have to keep ourselves

away from three things: One is that we should
not let ourselves deteriorate our moral values,
while living in the world of morality, we have
the duty to lead all on the path of Yoga and
Dharma.
Second thing is previous birth's destiny , this
birth's wrong habits, nature and sanskar etc,
despite experiencing such things around us,
we should not allow them happen in our lives.
Reverence to almighty, is to see his existence
in all the things found around us in the world ,
inspiration of almighty in our soul, knowledge
in our brain, sensitivity in the heart, and in the
whole body presence of almighty as the essence
is the real reverence to almighty. Worshiping
almighty is viewing him in idol form and
expressing full gratitude towards him is the
real worshiping of almighty.
Meditation is to focus on the fact that
almighty is the source of all our activities and
functions , he is the source of the peace which
we experience, etc .
Lets come and realise this form of almighty in
our heart and be a part of a new beginning.
To continue...

Tribute and remembering the moments spent at Patanjali

Yog Peeth by respected former President APJ Abdul Kalam

At Patanjali Yogpeeth, respected Swami Ramdev ji , respected Balkrishna ji and his excellency
Abdul Kalam in special thinking

Then President Sri APJ Abdul Kalam wrote in the visiting book of Patanjali Yogpeeth, a
historical moment

At Rashtrapati Bhawan, Swami ji and Acharya ji

Special discussion on the issue of nation building.

11 SeptemberU 2015

Woman dignity
Further from last issue
49. Even vulgarity cries on seeing the way women are shown in advertisements, Dirty thoughts of a human, is feeling shrunken,
This kind of nudity needs garments I
50. Lustful traders of knowledge, who are always in search of
material pleasure, Such dirty people have written destructive
literature, Their shops must shut down immediately.
51. Some people call her their slave, others called her the doorway
of hell, Such people must be beaten and punished
It is required to have Dayanand like great souls who can fight
with the system.
52. A woman some or other way feels joy
But she is mostly seen crying, she is the origin of all pleasure of
men, she now needs rest.
53. It seems exploiters are enjoying all pleasures,
Tears of her eyes narrate her oreals,
It is really strange, this has to be realised by all.
54. She suffers due to mal-nutrition, has weak body, even then she
is loved by all, she has small forehead, very less blood in her
body, her tears tell the story, a woman's heartbeats are heavy,
she needs dedication.
55. She has great capability of creativity, her power is enormous,
Make Supatra independent and safe, hand over the responsibility to build,
If the world gives her respect, such an ambience is required.
56. She always prefers penance, bears insult,
To make her mind normal she often silently cries,
No such a story is required.
57. All the ties are cause of all pains, but bonding of love is amazing, While remaining hungry, she is contented, repents on
eating, Such a deprived women need love and respect.
58. She mighty look alive, but her heart is dead, she has no sense
of personality, the fire of her identity is extinguished,
Is it right that to work in self-interest should not be allowed.
59. There is a person, which needs a personality
It is also needed to enhance her inherent qualities,
The one who helps her to forget her pain, such a favour is
required.
60. You got fame both in house and also in the battle field,
You are forerunner in all the fields,
The voice should be silenced which shouted at her.
61. Vedic hymns sung by Lopamudra and Apala,
Mother Anusuya took care of Trivedas as a mother takes care
of a child, Savitir fought for her husband, returned her life.
62. In the court of Janak of Videh, scholar Yagyavaalak came,
But on listening Gargy's arguments, he was stunned ,
Some day a man's arrogance must end.
12 SeptemberU 2015

Mothers and

sisters should

get full dignity

n

Dr Suman,

Chief Central In-charge of women's cell, Patanjali Yog Samiti

63. When she fought against injustice, then Devaki got desired
results, She was always tested but only pains came to her kitty,
The Krishna who tolerated his mother's anger is required.
64. Moropant Dada had a daughter whose name was Chhabili,
She received all important knowledge timely, she became a
proud personality, She did not sought jewellery but asked for
arrow and bow.
65. Chand Biwi and Chenamma stunned their enemies in the
battle field, Durga and Ahilya left their imprints in administration. Need high names of Aruna, Bhikha ji Kama like.
66. Madalsa and Mayanta made their son according to their
desire, Jhalkari and Panna made a new history,
Such a story is required in which one sacrifices for others.
67. There are lady monks like goddesses, many things are there
to their credit, She is as humble as mother earth, she is the
respectful dignity of favours There is a need for loving system
in place of exploitation.
68. Half-body has become half coloured, it is humans ideas,
Thought process has got disturbed just do something to mend
the situation. Just don't forget contribution, needs an able
identity.
69. If a man is Shrama-meru, a woman is the flow of feelings,
A man is owner of material world, a woman has collection
of spiritualism, May they have their originality always, equal
treatment is required.
70. Have seen that decline so far, now its time for rise,
Now the time is going to change, now the divine preparations
are over, If you need credit then you need to focus on the target.
71. Saw darkness always, eyes got flashed in the brightness of
light, lived always in dirty smell, new smell is not liked,
Decline has to be associated with rise and prosperity.
72. If not able then why to expect for fruit,
Mother got respect when Krishna Kanhai is born
A mother should be considered as the centre of the qualities
of men.

73. Neither did ever yoga in life, nor achieved knowledge in life,
Accumulated wealth but was defeated at the end,
Now have got a golden chance, it has to be noted.
74. Provide her best education, she will get voice with blessings of
god, she will become wise,
The world could sing the song that is required.
75. Give them big responsibilities and watch with patience and
sunn all your prejudices , it is needed that doer is silent and
others are praising her.
76. Never torture a woman, make them free from problems,
If you want high results, then enhance their qualities,
if you want sons like Ram, Krishna and Bharat
77. She needs affection in the childhood, needs respect in young
age, she needs help when her body becomes weak due to old
age, such an edge is required which could make it shining.
78. A Nari means one who doesn't have an enemy but the whole
world is her enemy, but the things which could not be done
by men was done by the women, her problems need to be
sorted out.
79. She is abused in the name of less dowry, less beauty after marriage, she is scolded if she does not give birth to a male child, a
woman is suppressed by a women, needs wisdom.
80. It is said a woman is daughter of goddess mother Jagdamba,
don't know why is she unhappy, she has faced many problems,
now needs blessings.
81. She has incurred troubles since beginning, a woman has faced
bore many troubles, now she needs to be empowered.
82. She will agree to live without food but don't keep her hungry
of love, if a woman is unhappy, it will invite great destruction,
she needs to be free from insult, deprivation.
83. Don't consider her inferior, consider her able, show respect to
her, leave no stone unturned to improve her condition, do not

blame, do not insult, it is required.

84. Governments changed with promises only, all the promises of
commissions and committees proved to be useless, now need
the law which could improve their condition.
85. Brave women of India great scholars , it was that time when
were the best in the world, she needs the open sky.
86. She is often called Kulmata, owner of a family , then India was
spotted as world leader, Now need to stop maltreatment with her.
87. A Lakshmi was made a maid servant, her dignity was destroyed, the world snatched her power, now she needs divine
justice.
88. Initially she was later treated as a maid, this was really a horrible development, now she needs freedom.
89. On seeing death, even birds unite , it has also been seen that
cows together chased away a lion, now women too should
unite like honeybees.
90. You will have to rise on your own, when you will make efforts,
by being well educated and enlightened, she came out with
self-respect, time will change again with victory songs.
91. Don't sit idle that one day someone will come to your rescue,
some miracle will change your destiny, change will come but
with great sacrifice.
92. You know your importance, don't consider men as your
competitor. Don't lose your privacy in professionalism, get rid
of all illusions, for which science is needed.
93. You won't realise change with simple knowledge and literacy,
committees and organisations will not end your problems,
you save yourself from destruction, if you need to rise high.
94. You need employment, is hunger your problem, has degrees
and diplomas helped people to pass exams, awaken your soul
with Diksha.
95. O dear women, there is no scope for your improvement without self-awakening, men should also end all evil traditions,
the one who is getting to be dedicated in the feet of almighty,
such a sincerity is needed.
96. You may be diluted in size, but you are heaviest in all, senior,
elder and best, you are dearest of mother Jagdamba, the whole
world should listen it.
97. Originality of men and women should be maintained, both
are supplementary to each other, both need to get equal status.
98. All abuse women in the world, she gives birth to all men,
should she not get love?
99. It is impossible to get rid of her favours, one effort can be
made with wholehearted effort, at least she should get credit
of her work.
100. Acceptability, cooperation, work distribution according to
respective nature, mutual attraction for love, pure arising of
soul, all will be well with the blessings of almighty.
To continue in next issue.
13 SeptemberU 2015

Research

Sleeplessness and its

natural-yogic treatment
n

Dr. Shirley Telles and Shivangi Pathak, Patanjali Research Department, Patanjali Yogpeeth, Haridwar

Sleep

is very important for life long good health. According to National Sleep Institute, sleep is necessary for proper
function of a person's body.

Sleep keeps our heart healthy.

Reduces tension.
l Controls the body's excitements.
l Keeps us active.
l Improves our memory.
l Controls our weight.
l Improves immune system of the body.
l Controls the danger from depression.
l Rejuvenates our body.

movement). Four stages are concerned to NREM

stage and fifth one comes under REM.

c.

l
l

here are five stages of sleep. The first two

stages are called NREM (Non-rapid
eye movement) and REM (Rapid eye

14 SeptemberU 2015

a.

b.

d.

First stage: It is the primary stage of sleep. In this

stage, a bit light sleep happens, and it is the stage
between sleep and wake up. The span of this
stage happens to be 5-10 minutes.
Second stage: In this stage of sleep, the body
temperature begins to go down, heart beat also
declines, span of this stage is 20 minutes.
Third stage: This is the stage when a person
moves from light sleep to deem sleep stage.
Fourth stage: This is the stage when a person is in

e.

deep sleep. Its span is 30 minutes. It is this stage

when a person urinates on the bed or walks while
in the stage of sleeping.
REM (Rapid Eye Movement) : This is the fifth
stage of sleep, most of dreams come in this stage.
During this stage, breathing and activities of
mind increases while the muscles become very
calm.

In the situation of sleeplessness: Many people

complain about their sleeplessness. Due to lack of
sleep your whole day's activities , hunger, balance and
your immune system are badly hit. It increases the
chances of being caught by the diseases. Excess of sleep
causes heart related diseases, diabetes, obesity, and
Brain activity is high
most similar to being
awake and dreaming
occurs
REM SLEEP

3 months to 1 year - 14-15 hours

1 year to three years- 12-14 years
3-5 years - 11-13 hours
5-12 years- 10-11 hours
12-18 hours- 85-10 hours
Above 18- 7.5-9 hours
If sufficient sleep is not taken, the chances of early
aging grows and a person feels anxiety while sleep
repairs the cells of our body and brings the toxicants
out of our body. Therefore we must take at least 6-8
hours sleep regularly.

Yoga is a solution
If you are suffering from the problem of sleeplessness
or insomnia, yoga can be a best solution. Yoga
Light sleep, feeling very
drowsy
STAGE 1

90 - 120 mins.
Transition
between light and
deep sleep, slow
high amplitude delta
waves

STAGES
3&4

also on immune system. It also increases chances of

many other diseases. Excess sleep is also bad for heart,
may lead to diseases like diabetes, obesity and can also
cause memory related problems. Therefore, for good
health we should take sufficient sleep. Here we have a
chart which presents age-wise sleeping hours.

Age limit Sleeping hours

2 month old child - 12-18 hours

STAGE 2

Stable sleep heart

rate slows, breathing
very regular

improves blood circulation in the body. It balances

our nervous system, brings out toxic substances out
of our body and rejuvenates it.
Regular yoga is effective to cure many diseases like
sleeplessness, irregular sleep, reduces tension of whole
day and helps us to take sound sleep in the night.
The yoga which is done with awareness they help to
restore chemicals of the brain and keeps it in balanced
state. It is a must that a person should maintain the
15 SeptemberU 2015

Research

state of his breath. Pranayam is also useful in curing

insomnia. Yoga should be practised in the guidance of
a trained yoga teacher.
Balanced life style:
Life style and sleep are co-related as bad bad life
style affects the quality of your sleep and this way
the whole sleep is disturbed. Change in lifestyle is
a process which takes time. If once we are ready for
change, even then it is difficult to follow the path of
change. Below is some methods how to bring change
in the life style which is a must for go n od sleep.

We should avoid taking saturated and trans fats and

the food made of them. Avoid taking french fry,
potato chips and other such snack foods.
Beverages: Some drinks increases duration of sleep
and can also decrease it, before going to bed, it will be
good to take milk or herbal tea.
Fresh herbs: Healthy herbal medicines are effective
to maintain the composure of our body. For example
sage is a fragrant herb. Moreover, avoid taking green
or red chilly in the night as they cause the excitement
of the body.

Other methods for good sleep:

l Decide

a definite time to go to sleep.

l Build a peaceful ambience for good sleep.
l Make sure that the bed is comfortable.
l Regular exercise is a must.
l Before going to bed, avoid taking any energy
drink like tea, coffee, etc.
l Take light meal in dinner.
l Avoid smoking.
l Ensure composure of your body before going to
bed.
l Make yourself free from anxiety.
l Avoid stress on the bed and ensure composure of
your mind.

Balanced diet is necessary

Food also plays a vital role in this regard. Healthy
food helps build healthy cells and also ensures regular
functions of the body organs. Following are some
food which are a must for good sleep:
Complex carbohydrates: Whole grain flour's
chapaties- Brownrice, avoid carbohydrates like cake,
cookies, pastries and other sugar rich food which
reduce the level of serotorin level which has a bad
impact on sleep.
Heart healthy food: Unsaturated fats, like Alsi oil,
soya oil, walnut oil and sunflower oil maintain good
health of heart and increases the level of serotorim.
16 SeptemberU 2015

Some other methods can help us to take good

sleep.
l Avoid practise of Bhastrika pranayam in the late
night. Its practise produces a lot of energy which
many cause disturbance in the sleep.
l One should also avoid watching exciting TV
programmes or films in the night as they can
disturb your sleep. Instead, it will be better to
listen soft music, mantras, reading books etc.
l We need to develop our own sleeping style as it
is never advisable to sleep in day time. It disturbs
our biological clock. Ideally, it is better to sleep
for half an hour in the day and eight hours in the
night.
l Before going to bed in the night one should review
his whole day's activities and his bed should be
cleaned till the level of satisfaction.
l One should take meal by 8.30 pm and go to bed
after two hours.
l If you had any quarrel in the family, it is better to
fix it before going to bed.
l One should avoid using exciting stuff s before
going to bed especially you have the problem of
sleeplessness.
l This way yoga, good lifestyle, good food habit, etc
we can improve the quality of sleep and hence can
enjoy a happy and peaceful life.
l

Your experience
Got rid of problems of heart and memory loss
Yoga gave me a new lease of life, otherwise I won't have survived after 1994 fatal heart attack. I had to
visit Delhi after that, there my angiography was done and it was found that many arteries are blocked ,
I was treated for a year and I was advised to go for bypass surgery. I saw Baba ji on TV doing yoga, who
descried every form of yoga and its benefits, Baba ji is of the view that yoga can cure all the problems, I
started doing yoga every day and my problem was over.
One year back I had memory loss problem. I was not able to recognise my wife, children and other
relatives. I stopped taking meal and all my activities came to a standstill. There was no chance of my
survival, the medicines suggest by my son who is a doctor , I am still taking them, but it was yoga which
helped me in a great way to recover. I am getting rid of depression and other problems. It is advised to
every individual to take yoga at least half an hour to keep healthy. Kapalbhati and Anulom-Vilom are
specially advised to be practised.
I regularly do yoga even at the age of 89, yoga makes us to change our view towards life and ambience
around us which help reduce our stress in a big way. This keeps all our body parts active.
At this time, yoga is being spread all round the world and Baba Ramdev ji played a vital role in it for
which I offer him many many thanks.
From
PL Gupta,
79, D-5, Vibhav Appartments, New Agra, Agra-5

Unprecedented benefit in stomach problem

Baba ji, the methods of yoga suggested by you have helped me in a great way. I have been suffering from
stomach pain and other such problems since long. I went for so many kind of treatments but of no avail.
Then I got guidance of a Patanjali Yoga teacher. She advised me to follow the methods suggested by her.
Since I started her way of yoga practising I got rid of all stomach related problems besides others. Swami ji
, for expansion of yoga and Pranayam, I will always be grateful to you. May your glory spread around the
world and all the patients could get benefited from you.
From
Ram Shiromani Mishra,
Ward no-07, District Anuppur (MP)

Got rid of blood pressure and headache

Swami ji was suffering from blood pressure and intense headache. I also had pain in my feet. I would
often use pain killer and their side effect caused me many other diseases. I came across a Yoga trainer of your
organisation and she inspired me to practise yoga. With her advice, I continued to do yoga and Pranayam
like Kapal Bhati, Anulom-Vilom and my problem of BP and pain got over. Now yoga has become a part
of my like and I am also associating others with it.
From
Umesh Singh,
Near- Paper Mill, District - Anup pur (MP)

17 SeptemberU 2015

Spiritualism

Mind is full of amazing

miraculous capabilities
B

y keeping mind in view, a very high song has been

sung in Yajush Mantras- Such a mind of mine be
full of Shiva Sankalpa, as auspicious can be produce only
auspicious things with Shiva Sankalpa. If
it does not happen, it will be like
an inapt charioteer who either
lands him master's chariot
in trouble or fails to take
him to his destination.
Mind is also like a
charioteer and it
can also do the
same.
The sadhaks
who see mind as
an enemy, they
say that it is the
mind which gives
birth to all sorts of
wrong things. All
pranks, mischiefs, all
wickedness , all deceits are
filled in the mind. In the
condition of lures, troubles, it is the
mind which first leaves a person in
trouble. It is fully ruthless, cruel, sensual, greedy, selfish,
lustful, sinner, envious. The mind full of arrogance, don't
know what makes a person to do. It puts Sadhaks in big
troubles and itself steps back. It is the genesis of sin. It
is friend of sin. It has got nothing to do with Satya, Shiv
and Sundar. It has just only to do with its lustful tendency.
Ahead of all, if the whole world goes in the well, it does
not care.
18 SeptemberU 2015

Acharya Pradyumna ji

Maharaj ji is of the view that a Sadhak is required to

be careful from their it by considering it as biggest enemy.
It is so treacherous that it suddenly strikes and get back,
it will take away all your prosperity
therefore Sadhaks should not rely
on it even a bit. Its cruelty
cannot be defined in words.
It you trust on it even a
bit, it is such an enemy
which will one day
on getting a right
opportunity it
gets inside the
body
and
d e s t r o y s
intestines. He
often cautions the
Sadhaks- O my
dear Sadhaks, there
is a cobra in you home,
it is so poisonous that its
bite will cause your
immediate death.
It is such a hidden fire which
simmers from inside and on getting the
opportunity, it destroys your whole property. It is that
crocodile to which you have mistakenly considered a
wooden piece which is to be used to get across the river.
Though you are at fault by doing so. It will engulf you
very soon.

Tendencies of mind:
Kaam-Chikitsa-Vichikitsa-Shraddha-Ashraddha-

Dhritih-Adhritih- Hrih-DhihBhih are the various forms of

mind. Without mind, there
is no existence of sex,
resolution, etc. Deep sleep is
never meant for the mind.
Therefore the two do not exist
there.
The various forms of desire in
a person, it happens according to a
person's Gyan-Sanskar. Sanskar is the
best, the level of knowledge is high, in this
situation, a person's desires are also to be the best, based
on Karma. Otherwise, ominous things and such Karmas
strike back. Rise and decline of Gyan and Sanskar is
based on Tatsajatiya Gyan and Karma and similarly by
going ahead it gets associated with the mind and it forms
an endless series. Auspicious or ominous desires make
a person to make efforts to achieve them. This is called
the pledge.
Similarly, on any issue, doubt is called Vichikitsa.
When it is done to clear the doubt, then it is good but
when it is done for wrong purpose it gives you massive
loss. Whatever it might be the forms of doubt or
Vichikitsa, it is the mind which is their medium. God,
truth, dharma, oneself, result and in the previous births,
etc, deep belief is called Shraddha. Injustice, partiality,
etc are ominous qualities toward which there happen
to be lack of respect. And a Sadhak's great welfare is
ensured. But when the truth and dharma, almighty, etc
are not trusted then it invites great destruction.
Sorrow and joy, profit and loss, etc how so much they
mighty be, the almighty, truth, dharma, etc are to be
trusted and respected one should not give up. It is called
Dhriti. Adhriti and Ashraddha have two different forms.
Being not firm in wrong activities and in this form,
Adhriti is useful but in Sukarma or in one's resolution
of life if there is Adhriti then it is destructive. Hesitant
tendency of mind is called Hrih (shyness) which is born
in two forms - one in doing false things and second in

experiencing one's incapabilities

in doing true works. The
tendency of doing best works
is called Dhih or Dharanavati
Buddhi or wisdom. If this
mind
acquires
wrong
tendencies then it can prove
to be destructive. The tendency
which is called fear is called bhih.
For good life and thinking, fear is
must. But sometimes, a person feels fear
on following an unknown path. It is no way a
right thing to do.

When our mind becomes a friend

With regard to mind, Maharaj ji has advised that mind
should be considered as a friend. He is of the view that
the way a friend does not do any harm to his friend the
same way if our mind become our friend, it always
involves itself to ensure our well being.
Methods to make the mind a friend, it is required to
pray before it in the following way:
"O my dear mind, you are my brilliant and dearest
friend. I under you leadership have been sailing my ship
under your guidance successfully. I have full faith on
you. You will never stab in my back.If any obstacle of
this world or that world creates any hinderance in my
ways then it is only you on whom infinite power can be
trusted by me. I have trust that you will destroy such
powers. Who other is there to bear your power. In front
of your immense power, all the enemies are destroyed
in the way as a Vajraa does. I have experienced your
power."
"You are stable and engrossed in yourself like a sage.
There you are full of intense power like a brave soldier.
The work which you decide to do , even Triloki cannot
stop you. You are my eternal power and most worshiped
deity of my heart , you are the best friend, you are like
Indra, you are like Kuber, troubles are like garlands of
your neck. O my mind you are my true friend. You are
19 SeptemberU 2015

Spiritualism

an incarnation of a mother's love, and you are an ocean

of eternal patience like a Guru. I cannot describe your
greatness in words. The only thing that I want from you
is that you always pour your like like a dearest friend.
May I also always be full of pure love for you.
In the journey of life I need your
cooperation to move ahead in life."

Mind is ready to
learn
Whatever is told to mind
it learns them quickly. It was
proved in a news story
published in Navbharat
Times' August 1989 issue. It
was said in the story that a person
by changing his way of thinking and
shunning negativity and relying on selfconfidence, can accomplish everything which
has been impossible in the eyes of people. This was
proved when a Dutch national Emil Stilband walked
on amber. With the help of mental strength , he
successfully enthused all the 104 viewers thronged there
to do the same what he had done. All of those who were
present there were full of great enthusiasm.
US' Robin's Research Institute's European region
director Mister Stilband first delivered his speech on
Mind's Enormous Power and inspired people to rely on
it and then suddenly started walking on the amber by
calling it cold grass.
During this a five years old girl Surabhi too walk on
them with great joy, Mr Kulkarni of Birla Planetarium,
and his kids besides others also enjoyed walking on the
ambers. In his speech, Mr Kulkarni described that
human mind has infinite strength and stressed on the
need to protect it.
In this practical example , we have known about
enormous strength of mind. Many a times, while
sleeping, it is felt that someone is touching us, it is like
20 SeptemberU 2015

similar feeling as one feels in normal situation on being

touched by others, the same thing is felt when we are
sleeping and no body is there.

It is also possible through

mind:
Through mental power, the
skin is not in only sensory
organs but the feelings can be
found in all sensory nerves.
The way there is no smell, but
the nostrils start sensing the
smell, ears start listening,
eyes see the face, though they
seem to be simple phenomenon
but it should be noted that how
our mind fills us with the same kind
of sensation as which we sense in wake
up state. It is possible only due to concentration
of mind.
Our purpose to cite the aforementioned incidents is
not to promote superstition but if our mind gets to be
fully trustworthy then in that special condition it is full
of enormous power. The whole body system starts to
follow the command of the mind. Is it a small thing?
Whoever teaches us whatever, our mind learns them
quickly and it shows a tendency to work accordingly.
When it is taught to our mind that material things give
pleasure, it has tendency towards that. And when it is
taught to it that material things are bad then again it
shows tendency the same way.
Similarly, when it comes to the mind that I am in
peace, the whole body system comes into harmony.
When it comes to the mind that I my mind is disturbed,
the whole body system is disturbed. When we fill in the
mind that mind is the biggest enemy, then we start
considering it our biggest enemy. When we have a
tendency to consider the mind as the best friend it
appears the same way.

Amidst the expressions of nation building, Pujya Swami Ramdevji Maharaj and the Andhra Pradesh Chief Minister
Chandrababu Naidu and in the below picture Pujya Swami Ramdevji Maharah is seen performing `jalabhishek` to
`Maa` in Nashik Mahakumbh.

21 SeptemberU 2015

Culture and Health

Cow milk full of

omega - 3 and Swarnaras
n

Dr. D N, Retd. Senior Medical Officer

ow has a beautiful co-existence with the nature. This is

the reason why a change in
her nature is observed prior to every
earthquake, though we fail to understand the signals and fall victim to the
natural calamity. Cow is the foundation of sensitivity and literature, therefore there is a rule not to feed her stale
and rotten food.

21 day colustrum

is considered to be the best in the world, she is considered in

Indian culture as sacred as Kaamdhenu. Cow is also being a
symbol of our devotion. In India's every walk of life, whether it be agriculture,
trade, literature, science or religion, cow has a special place. From birth to
death, cow is considered to be very sacred. Every body organ of cow is believed to be places of deities. The idea that a cow's body is home to all the four
Vedas is based on science. When a cow shows affection to her calf the foam
which comes out of her mouth makes the place sacred. In every cow product,
there works a special kind of science. Now it is time to have a scientific outlook towards cow which has to be beyond religion .

Cow

Fresh cow milk till 21 days is considered to be colustrum. It is like nectar

and is full of divine properties. It improves our immune power and can cure
many incurable diseases. Our ancient
medical experts have called it Piyush
or colustrum and many vital medicines
have been prepared after long research
by the US scientists. Some of these
medicines are- Lactopherine, With colustrum, bobin colustrum, etc. Indian
scientists too should conduct similar
research to develop such effective medicines out of cow milk.
There have come some scientific facts
to the fore that where a cow drinks
water, there flows sacred water. Place
where cows breath in group, it becomes
sacred.
The areas where there is large population of cows, they are largely free from
diseases. Cow dung is used a fertiliser
and it is good for fertility of soil.

Cow's anatomy
There are four chambers in a cow's

22 SeptemberU 2015

rays of atom bombs. All nutrients for mental and physical vitality are found
in Desi cow milk. Similarly, we can preserve our natural resources by using
cow dung for making biogas.
The smoke produced from burning of cow dung cake destroys harmful
germs and insects in the ambiance. Cow dung is effective in destroying radiation from atomic reactors.

Laborious animal:
bodyFirst chamber is called rumen, second one is called reticulum, third one
is called omasum, fourth one is called
abomasum.
Chewing the cud makes her products
like milk, dung, urine, etc. pure.

Cow and gold element:

There is a Suryaketu named nerve in
a cow's body which produces gold in
her body when her body is exposed to
sun rays. This is the reason why her milk
is yellowish. Cow is the only animal of
which spine has Suryaketu. It attracts
sun rays towards it. The gold produced
this way makes all the cow products like
butter, milk, ghee, etc yellowish. When
consumed, they make our body diseasefree. The nutrients of cow milk are not
destroyed even after boiling.
Cow ghee is very effective in destroying toxic substances in the body.
It is also capable in curing insect bite,
wound, etc. Russian scientists concluded that the ground which is coated with
cow dung can reduce the effect of the

Cow milk is considered as nectar in Indian tradition. In ancient time,

there was no system of tying her at one place and feeding it this way. There
was also no dairy industry those days. The environment in which cows were
kept was free from harmful chemicals and pollution. However, it has been
scientifically proved that products of a cow which is fed on fresh food and
water are capable in curing many diseases. In Ayurveda, there is extensive
description of feeding a cow in fresh environment and fresh food.
Cow has a nature to graze while walking and wandering. She is most happy when she is allowed to wander from one place to another. Unfortunately,
due to dairy culture, the cows are not allowed to wander and hence her milk
is become harmful.

Source of Omega- 3
Importance of Omega- 3 is now being recognised since 2000 due to its
effect on a person's mind and mental abilities. Today people are so conscious
about using unsaturated fats in their meal that Omega- 3 has started to be
sold in the market as a cure to all major diseases and its trade is of billions
of rupees. Though this vital nutrient is available in abundance in cow milk.
In fact, the cows which are kept at one place and not allowed to wander in
search of food, have saturated fats in their milk which cause obesity and
bad for our health. On the contrary, wandering cows' milk contains unsaturated fats in abundance like Omega - 3 and Omega -6 and they are called
EFA necessary fats. It is this fat which is vital for human body. If cows are
fed with Khalli, Binaula and dana, their milk will contain saturated and
unhealthy fats while green food for her will increase the level of healthy
unsaturated fats and consumption of this kind of milk will keep us healthy.
Modern science too is also of the view that presence of omega - 3 increases
the quantity of DHA (Dehydrogenated Acid) and with this element human brain and eye power develop well and presence of the two is vital for
mental growth. Hence cow milk is deemed as nectar.
23 SeptemberU 2015

National pride
is still front runner in different aspects. The former Congress Government was atheist and materialistic and had vex
with the tradition of knowledge and education, which was but natural for a political outfit like his. Albeit, they tried
to keep people and the nation attentive only on economical issue but they miserably failed on that front too. It is not a secret that till
a few years back, the Congress and its associates were making hue and cry, saying that the main issue is to remove poverty from the
country. They also claimed that the people are deprived of their rights and solving these problems is their basic motto of politics. None
of their leader had the farsightedness that Bharat itself is a super power, which will emerge as a strong nation in the years to come. They
always talked of the depravity. But despite all such adverse circumstances, the people of the country remained active in such adverse
and negative circumstances and now, it is being discussed as the future super economical power at the global scenario. Though, none,
who were the part of the ruling system, could predict this to happen. Thus, the Government, which was striving hard in the field of
economics, could not predict that Bharat will be future global power. Thus, the icons of the previous Government were exposed as
they could not predict what is going to happen, in the field in which they claimed to be the master leave apart, other aspects of the
governance. And despite what has been said and stated, Bharat is on the driving seat in many of the fields. Here is the article.

Bharat

Bharat is front-runner
in various fields
n Professor Kusumlata Kedia
1.

2.

3.

Agriculture field Bharat has always been at the top in

the agriculture field and is intense rich in the traditional
agriculture related information and knowledge. We
have in-depth knowledge of different crops, seeds,
varieties of soil, different irrigation systems, fertilizers,
process of collection and storage of grains, knowledge of
asterism (nakshatra) and sky, climate and atmosphere,
the infrastructure and geographical knowledge. In fact,
we produce maximum variety of grains in the world
with the maximum variation of farming.
Forest produce and Forest management area Bharat
is, since decades following the glorious tradition of
protecting and conserving forests. We are immensely
knowledgeable as far as forest produces are concerned.
None of the country has such variety of forest produces.
Area of medicine and Ayurveda: Ayurveda has been
popular in India since ancient period. Such elaborated
and descriptive information on food, diet, eatery
habits is not available anywhere in the world. Even
the inhabitants of the small villages or heads of small
24 SeptemberU 2015

4.

residential groups are aware of the medicinal plants,

which are available in the nearby regions besides the
forest produces. The knowledge of Ayurveda has been
much advance in Bharat and now, it is attaining new
horizons under the leadership of Pujya Swami Ramdevji
and Acharya Balkrishna Ji Maharaj. It is known to the
entire world that in the field of Ayurveda, Bharat is
much knowledgeable and ahead as compared to any
other nation.
Area of spices: The varieties of spices and knowledge
of their produce and use has utmost variations in our
country. Earlier, the traders from England, Spain
and Portugal traded in black pepper, which made
them wealthy. Later, they got involved in other spices
trade, which turned their fortune. Indian spices were
demonstrated in the countries like England, France,
Sweden and Germany by the rich and wealthy people
in small cans in their houses, which was a prestige issue.
This situation prevailed till 19th Century. Bharat is
rich in the use of spices in the food, where maximum

numbers of different recipes are known and used. Thus

India has been an uncrowned leader in the field of
spices.
5. In food area: Bharat is the leader in the food. None of
the country in the world has such different varieties
of food, which is tasteful, nutritious and healthy.
Even the preparation process and recipes are the best.
The nutritious food, taken with the meals i.e. pickles,
`papad`, and other such items are helpful in digestion
and health. Thus, Bharat is ahead in the food area. In
many countries, Indian food is in high demand and
Indian dishes are much popular.
6. Area of digestive powders (churna): Since ancient
period society in Bharat is using digestive powders.
From the top layer of the society i.e. ruler to down the
line, a common man were using the digestive powders
and thousands of varieties of such powders were
prepared in our country. In none of the country, such
digestive powders were prepared. It is the specialized
area of Bharat.
7. Area of hair-style: Since ancient period, hundreds of
hair-styles were popular in Bharat. It is clearly visible,
when we see age-old idols of monuments. Some fools
made hue and cry on the veil (ghunghat) system, which
prevailed in a small portion of the country, that too for
short span. And due to such chest-beating, this fact
disappeared that Bharat is immensely rich in the hair
style, pattern, which were widely used by the queens,
wives of wealthy people and even a common woman.
When we see old idols, it is clearly visible that attractive
hair style is one point of attraction among the woman.
The Indian woman used different flowers plucked
in their hair; festoon and our literature and history
have hundreds of such examples. The hair style bore
importance from the marital life to public life.
8. Area of cosmetics and decoration: Bharat is immensely
rich in cosmetics and beauty products. Empasm and
scent coating has been part of our beauty efforts. None
of the country has much information in this connection
but we are rich since years.
9. Area of perfumes and fragrance: In the region of
perfumes and fragrances, Bharat has been the leader
since decades. A few of the nations have, though, gained
some information of late but still, whatever information

we have, none could reach such level. In any of the

society of the world, such prevalence of perfumes and
fragrance has been observed. In marriage, worship,
public programmes and other ceremonies, fragrance is
an essential ingredient and millions of the people are
using it.
10. Textiles preparation area: Be it any variety of cloth, cotton,
woolen or silk, since decades, we are preparing it, may
be at small scale production in domestic industries or
at a large scale in big industries. Even `Vedas` found
mention of it. In fact, it is said that Bharat was the bird
of gold (some ki chidiya) and we have mines of gold and
silver was nothing but what we received in exchange of
sale of beautiful and excellent quality of cloths. Till
19th Century, Before Christ, different countries did not
have any currency, which could be given in exchange of
the purchase of different produces, which come from
India, including cloths. Thus, they pay gold and silver
in exchange. India is still top in the field of textiles and
garments business.
11. Architectural and building design technology: It is a
well-known fact that Bharat has always remained ahead
in the field of architecture and building craft. Bharat has
taught the world, the process of steel preparation. We
have taught the world, how to make strong buildings as
we knew the art since decades.
12. Sculpture preparation: Though, sculpture and idol
preparation has been prevalent in various countries
but we have the most advance art in this connection.
The idol and sculpture preparation has been popular
in India since thousands of years and the beautiful,
attractive, grand and magnificent temples in different
parts and their artistic decoration are testimony to it.
13. Trade and Commerce: Ancient books are enough to
prove that Bharat had been the global leader in trade
and commerce. The traders from our country used to
travel long distances through sea route or land route.
They used bullock-carts and even ships to travel within
the country or even abroad. The evidences show that
Bharatiya traders visited African countries to Rome.
To travel such a long distance, thus security measures
were necessary and hence Bhartiya traders and rulers
were ahead in making security arrangements of the
navigators, traders and coachman. And Bharat was

25 SeptemberU 2015

National pride
ahead in evolving the best procedure of trade and
commerce and to distribute the profit among different
cross-sections of the society. Due to transformation
of power, some people made efforts to publicise some
groups of leaders and officers as the trade expert but
failed miserably in the efforts. They tried to push
public sector as a trade, which is completely false and
misleading. And finally, their efforts proved nonprofitable and failure. They continued the rules of trade,
framed by the British people. It is a point of common
sense that a society, which has rich experience of trade of
millions of years, is being governed by the rules and laws
framed by another society, which sparkled for a while
and then extinguished. It is ridiculous and laughable.
Despite all the adverse circumstances, our traders have
shown that Bharat is moving ahead on the route of
becoming economical global world power. This, again
proves that how intelligent, talented and efficient are
the people of India in the field of trade and commerce.
14. Bravery and Army area: In the area of bravery and
gallantry, Bharat is way ahead since decades. The people
of Bharat have been a brave tribe, who were always rated
as great warriors. In villages, the tradition of bravery
and courage is a part of their life. Indian army has been
one of the oldest forces of the world. Documents are
available describing their courage since Mahabharata
era to this century. In the first and second world war,
only Indian forces saved British and French forces
or else Germany would have dismantled their entire
generation. It is a fact widely admitted by the historians
that it was because of Indian warriors that British
could win against Germany. Even the women were
great fighters since decades and history is a testimony
to it. From Maharani Kaikai to Maharani Laxmi Bai,
our history has seen many such great woman stalwarts.
Indian women have been experts in operating arms with
courage. The people, who ruled due to the transference
of power made every possible effort to keep women
away from arms training and to disarm them but did not
succeed. In the field of bravery and efficient manpower
we are far ahead, though efforts were made to hide the
truth and propagate the falsehood but all such attempts
bit the dust. If our tradition of bravery is kept intact, no
one can challenge us.

26 SeptemberU 2015

15. Areas related to aspects of life and worship: The different

forms of life and worshipping prevailing are unparallel.
Indians have always been considered to be rich in
heritage, living style and worshipping.
16. Area of religious independence: It is not exaggerated
to say that Bharat is only one such place in the world,
which has inclusive society, embracing all the religions.
The people have liberty of religion. Albeit, the rulers
made all efforts to create difference with their narrow
mindedness but to no avail. A well-oiled effort was
made to transform and convert the Indian society. But
still Bharat has religious independence in the general
society and such example cannot be seen in any part
of the world. Bharat is the lone country in the world,
where religious freedom is in the culture.
Thus, it is clear that Bharat has been the leader in these 16
points and despite it, the fact that the country being the
spiritual leader has been suppressed and pushed under the
carpet. So-called leaders, officers, modern intellectuals and
people holding prime positions in media have, knowingly
or unknowingly, tried to put veil on the strength of the
country. In fact, the present politics has been a major hurdle
in establishing the country as a world leader. Now, after the
political change, we are hopeful that Bharat will re-emerge as
a strong state and re-gain its status of being the world leader.
Under the present leadership, nobody can stop us being the
global leader. It is the time that we all much join hands to
uplift the country. Patanjali Yogpeeth is making efforts in
this connection.
Executive Director, Gandhi Vidhya Sansthan,
Rajghat, Varanasi.

2015 27

Principles of health

Why worry for snoring,

epilepsy or cataract?
U

n Dr Nagendra Neeraj, Director, Patanjali Yoggram

is scared of the word disease. The formula prevalent is `more the fear of the disease, heavier is the medical
expense`. The Patanjali Yogpeeth works on the concept that if the patient is freed from the fear of the disease,
trust that he is two third cured. There are many such diseases, which have easy and usable treatments in Ayurveda, which
includes use of natural herbals, yoga and pranayam. The present article carries some domestic treatments for epilepsy, eye
related troubles, snoring, cataract, sputum and kidney related diseases.

Everybody

Epilepsy disease
Yoga exercises like `anulom-vilom`, `bhramri`,
`pranayam` and concentrating on breaths gives
immense benefit. It stops dizziness. Medhavati
cures epilepsy comely. You can also go for natural
treatment and use linseed and `Medhavati`,
which cure epilepsy.

For platelets
Use wheat grass, aloevera and giloy, which are
immensely useful in this purpose. Even the
leaves of papaya are also useful. They can be
taken collectively. When platelets decrease in
Dengue, the four items mentioned above are
useful. Take their juice at the interval of 2-2
hours, which increase platelets. Pranayam,
anulom-vilom, kapal bhati also help increasing
platelets. For increasing platelets, pranayam is
the best treatment.

Eye related disease

28 SeptemberU 2015

For the eye related troubles, `Drishti` eye-drop

is beneficial besides anulom-vilom. Papaya is
rich in vitamin-A, which makes eyes healthy.
The pigments, which help in the health of eyes
are enough in red, green and yellow diets. Uses
of such natural products are beneficial for the
health of eyes. The juice of spinach, radish leaf
and carrot also benefit in eye-related troubles.

Special
Take A i.e. aola (myrobalan) 100 grams, B i.e.
beetroot (chukandar) 75 grams, C means carrot
250-300 grams, T i.e. turmeric means tender
turmeric 20 grams, and G means ginger 4 grams
when all the products are mixed in juicy form
and drunk, it gives miraculous effects.

Cataract
If the cataract is in the initial state, only pranayam
could cure it, which normalize the pressure on
glaucoma. For the better vision mix almonds
and fennel in powder form and take with water
in morning and evening, twice a day.

Snoring
Kapalbhati and Ujjaini pranayam when
performed 7 to 11 and 21 times it relaxes trachea
and larynx. But mind that `kapha` should not
be increased. Obesity, kapha, larynx and trachea
should be relaxed to get rid of snoring. Hence
control obesity. Warm water is beneficial,
reduce use of cold water. Take `trikuta` powder
with honey, half grams, which is helpful in the
treatment of snoring.

Sputum
Banana, ground nut, milk, ghee, oil, curd and

roasted and fried items produce sputum. For the

treatment, take juice of tender turmeric, basil
and ginger and add one spoon-full of honey
in an equal quantity of the juice, which gives
immediate relief. If the problem is serious, use
bran soup empty stomach. The patient vomits all
the sputum deposition in the body. To prepare
bran soup, take 50-100 grams of bran, mix 250300 grams of water and boil. When it is reduced
to half, filter and give to the patient.
`Shvasari quath` cleans the lungs and treat the
problem. If the `kapha` of some person has dried
due to Shvasari quath, then give him liquorice or
sweet root juice. Besides, milk mixed in turmeric,
saffron (kesar) and shilajit gives strength to the
lungs. When problem of sputum occurs dont
drink cold water.
In dry cough problem, take `bafara` of `divya
dhara` or eucalyptus leaf and celery seeds, mixed
in warm water. In cough problem `kapal bhati`
is the miracle.

Kidney related diseases

In kidney problem, perform kapalbhati and
anulom-vilom regularly in the morning and
evening. Reduce protein related diet in the food.
To struggle weakness, take raisin. Take lentils,
milk and whey in small quantity and when the
creatinine level increases, limit the use of water.
Hot, cold suppression is also beneficial. Take 3
minutes hot and 1 minute cold suppression to
the body. Perform kapalbhati and pranayam,
regularly for half an hour each.

Fever
The best medicine available for fever in the
clinical world is giloy. Better to have giloy, basil
and aloe-vera in earthen pots at home.
29 SeptemberU 2015

Language-culture
the British came to India, they were totally unaware of Hindi language but anyhow, they made contact
with the people and moved ahead in trade and business. Later, to rule the country properly and in the final
phase of their influence, they made every effort to demoralize Indians and hence, made English an important language.
Resultantly, our regional languages, including Hindi grew weak gradually. To establish the English language, falsehood
was spread to establish the glory of English. British left the country but left their mentality here in the people left in the
country. Ved Prakash Lamba made serious analysis of the facts to take the facts from the public to the Government.

When

The truth of English being the global language

n

Ved Prakash Lamba

ue to the scientific pronunciation and spontaneity, Hindi language has its own place in the global
languages. But it is a fact that the extent of damage
done to Hindi language has been immense and not a small
fraction of damage has been done by others. Observing Hindi
week or Hindi fortnight once in a year is an insult to the language, same as Mothers day is observed once a year. Old people remember one weekly news based magazine Dinman and
its cover page carried a picture of a demonstration held by Jansangh (the old avatar of Bhartiya Janata Party) in which two
women, belonging to rural background were trying to save
themselves from the scorching sun, with the help of a placard,
on which it was written `We want Hindi`.
The so-called English supporters propagate English in
such a manner that if English will not be there, the country
will be nowhere. We should remember that Swami Ramdevji
Maharaj, who has popularity at the global level, has visited
the country on many occasions but he always addresses the
people in Hindi. Even, when he visited foreign nations, he did
not need interpreters.
The present TV channels are damaging Hindi and think
that it is their birth right. The news is basically sent in English,
which is then translated in Hindi language and what blunders are made in the translation, is another long and sorrowful story. Whenever the history of Hindi will be written, the
present Hindi newspapers will be underlined as the biggest
enemies of the language. Just go on reading from front page
to the last page and every day you will find experiments of
some new English word, encroaching in Hindi vocabulary. In
the language of general discussion, the regularly used words

30 SeptemberU 2015

are now mentioned in English. The press

conference is abbreviated as PC and post
mortem as PM. Not only this, the supplements being published on a daily basis are
titled in English in Roman script.
It is a matter of shame for all of us that a
Hindi language newspaper is teaching, how to
pronounce English correctly in its weekly column.
The condition of the educational institutions is even
worse. Today, the students attending classes in such institutions are not nationalistic or patriotic. The education, which
is being granted to the students, is teaching them to consider
their country, parents, family, country and religion as inferior.
The situation is going to be explosive in near future. The news
channels are clear examples of it. The anchors, with deep inane make-up and scanty cloths try to prove that they are the
most intelligent person and they know each and every thing
in this globe. Most of them are taught in English medium
schools and are slaves of the language.
I want to remember you here that a German scientist did
a surprising experiment. He designed scripts of all the important languages of the world, with the help of clay. All the
designs were hollow from inside and have holes at both the
ends. The design was same as we get in our village fairs, having
parrot and `maina` at two ends of a toy and when, you blow
from one end, the other end will have whistling. Then experiment began with different languages and when the designs
were blown from one end, it was only `Devnagari` script,
which gave the same result at the other end, when blown at
one end.

In fact two Indian youths, Satish and Prabhakar travelled

the world, with not a single penny in their pocket and later,
wrote their memoirs in the form of a book, titling the same.
They wrote that when they reached America, the President
Kennedy was killed and when they returned to India, Nehruji
had died.
In their memoirs, the youths also exposed the false
claim that English is a language with international repute. They wrote that in many countries they found people, who not only speak
but also understand Hindi. Furthermore,
in European nations, they found many
people, who were unaware of English
language.
In fact language is the carrier of culture (Sanskriti) and hence, it was identified as Sanskrit. Bible has clearly written
that in entire world, a single language was
being spoken. Obviously, it would have been
Sanskrit and no other language. The dialects at
the local level were different. It is a scientific fact that
if you could understand and speak Sanskrit, it is easy to control different dialects. The Valmiki Ramayan has described
that when Hanuman Ji appeared before Sita Ji in Ashoka Vatika, he discussed in local dialects, which was spoken in and
around Ayodhya. He did not talk in Sanskrit as Sita Ji should
not feel that she is talking to some learned scholar and furthermore, the local dialect generates a feeling of congeniality.
There was a period, when Hindi films were considered as
disseminator of Hindi language in the world. In that period,
whichever films were produced with story of an orphan boy,
the person who will take care of his will be either Muslim or
a Christian. And today, the language of the films in Hindi
is neither Hindi nor even Hindustani. Frankly, it is not even
Hinglish as even in Hinglish, Hi of Hindi comes first. The
titles of the films are in English. If some title is in Hindi, it will
be explained in English as well. And why should it not happen? Now the Hindi movies are not for the entertainment of
the common man but it is produced by the English inclined
people for the English inclined viewers.
Earlier, it was very much difficult to identify educational
institutions, where education was imparted in English. But
now even the primary school of a dusty village is giving edu-

cation in English language. The shameful and ironical situation is that even the names of the hockey, cricket and football
teams are placed in English like Rider, Blaster or Fighter. The
logic given is that it will give new energy and fastness to the
players. In fact, if such people are given all decision making
powers, they will say all asses as donkeys and dogs as doggies.
Today even the protagonists of Hindi sign in English language. The name plate appearing before their house will be in
English language. On any auspicious occasion at home, the
invitation will be in English language. The hoardings, banners of their shops, offices, ancillaries or industries remain in
English although, they know it very well that their customers
will be Indians, who have adequate knowledge of Devnagari
script.
I am not an opponent of English but it is a common sense
that the people living in this county should also think of our
national language. But the fact is that when a person has mentality of English language, expecting service to Hindi by such
group is searching needle in the haystack. Just think how a
few words of English could become a phrase? Is it not mental
slavery of English and its culture?
After independence, such scene has been created, where
people speak of Hindi but practice English. Furthermore, in
the mutual discussion, they support essentiality of English
and its qualities. It is my advice that if you want to do something for Hindi, remove the binding of English at the centre
and in all the BJP-ruling states for Government jobs. Whatever information, the Government of India wants to share with
public, advertise it in Hindi. Stop giving advertisements to
English newspapers and mediums. The Government should
ask the official broadcaster Doordarshan to start news, giving
priority to not only English but all the prominent languages
of the world.
I firmly believe that such step is sufficient and Hindi will
re-gain its position. The Government will not have to spend
additional budget on it and the biggest point that none will
oppose such move.
Thus, I hope that the present Government will take the
suggestions seriously and take firm steps. Mind it, it is associated with the self-respect and dignity of millions of Indians
and our nation i.e. Bharat. So, I hope the Prime Minister, who
is taking many steps to restore the lost glory of the nation will
take the issue very seriously.
31 SeptemberU 2015

Inspirational satire

When we gulp bottle

of foreign brand
cold drinks!

very human being feels pride of the nation, in which

he lives. We all also love our motherland and hence,
people have given a slogan full of national self-respect - Say with pride, we are Indians ( Garva se kahe hum
Bhartiya hai).
We are born in India and we have every right to say ourself
Indian. Repeatedly, we can say ourself Indian. Till we dont
feel tired, we will continue saying ` We are Indians`. And why
not we should say it repeatedly? Our history is 5,000 years
old. We invented zero, we gave the prime gift of Ayurveda and
Yoga to the world. It is enough, as more had we given; the
people would have taken it as extravagance.
The history is a testimony that we always stuck to the religion of being an Indian. The wars of the border are meaningless for us and we were busier in bettering our other world.
To fight against invaders was just wastage of time for us. Yes,
propagating non-violence was necessary for us. Blood shedding for just small pieces of land was a poor thought for us.
But suddenly, what happened that our pride crushed to rock
bottom. Since past 60-65 years, our beloved country was rated as most backward nation, burdened with loans and debts.
In a nation, where 2.5 lakh farmers committed suicide, in
the country, where number of deaths of mal-nutritious children is the highest and the country, where lakhs of people
sleep hungrily, where is the point of pride? It is not just by
32 SeptemberU 2015

chance. Frankly speaking, we all are responsible for the state.

The community, which do not learn lesson from the past
experience of slavery will be enslaved again for sure. We did
not call Mougals, but they invaded us and ruled for over 600
years. British people came to India and rules for good 200
years. We cant imagine, how many years, the multi-nationals
we are inviting, will rule on us in future.
Extreme poverty, poor living standard and fearsome people of the country cant say that they are proud of being an
India in the present circumstances. Very clearly and frankly,
the Governments, political leaders and the bureaucracy are
responsible for the poor state of situation, which have always
been more than eager to sell the nation shamelessly and in full
swing. When we gulp one bottle of international company
produce cold drink, 7 rupees goes to foreign nation. Means,
we gulp lakhs of tones of cold drinks and make ourself poor.
We prefer mineral water, made by foreign brands and hence,
when Indians drink water, the richer becomes America.
Our food style, living style, imagination style, almost everything has been captured from the foreign countries and surprising fact is that entire media and system is standing with
them. The industrialists of our country are taking their side.
If we really want to say ourself a true Bhartiya, start from own
house. Just shut the door for the foreign company products.
When the supply line will be blocked, it will be easier to won
the battle. Another important aspect is if we want to won the
battle, we will have to glorify the place, where such decisions
are being taken. The political parties play an important role
in such decisions. We should always support, the party which
declares to drive multi-national companies out of the country,
whether the election held at panchayat, state or national level.
Today, the name of East India Company has changed,
which has become Eat India Company. In a recently held
seminar in New Delhi, a senior office bearer of an International Trade organization said We are thankful to the people of India that over 4,000 multi-national companies are
working here. Had the people of India not supported us, it
was not possible to achieve such a milestone. Now just see the
number, it is 4,000 foreign companies.
Although, out administrators are not going to listen but
still, here is a couplet
``Barbad gulita karne ko, bas ek hi ullu kafi tha,
Har shakh pe ullu baitha hai, ab legulista kya hoga``.

(GLEOH3URGXFWV
<RJDDQGSXUHIRRGZLWKRXWDGXOWHUDWLRQDUHWKHEDVHRIVHUHQHLGHDVSXUHFKDUDFWHU
DQGEHKDYLRUDQGKHDOWK\OLIH+HQFHGR<RJDGDLO\DQGHDWJXDUDQWHHGFHQWSHUFHQW
SXUHC6DWYLNCIRRG
C*KHHC2LO)ORXU*UDP)ORXU)DVW)RRGDQG&ROG'ULQNV6SLFHV3XOVHVDQG5LFH
KDYH DGXOWHUDWLRQ GXH WR ZKLFK WKH ERG\ DEVRUEV SRLVRQ VORZO\ ZKLFK JHWV
GHSRVLWHGWKXVZHVXIIHU&DQFHU2EHVLW\6XJDU%ORRG3UHVVXUH/LYHU.LGQH\DQG
+HDUWSUREOHPV
+HQFHIROORZ3HU&HQW3DWDQMDOLSURGXFWVZKLFKDUHJXDUDQWHHGSXUHDQG
VDYH\RXUFKLOGUHQDQGEHORYHGRQHVIURPWKHSRLVRQRIDGXOWHUDWLRQ

2XUSOHGJH:RUOG&ODVV4XDOLW\/RZ&RVWDQG&KDULW\IURP3URWV
6XFK3ODWRQLFZRUNZLWKJUHDWGLYLQLW\FDQEHGRQHRQO\DQGRQO\E\DWUXH
<RJL

6DQ\DVL


Message
of
Sansthan

Guruparva organised at Patanjali Yogpeeth with a

pledge of rebuilding the nation

Respected Swami ji and Acharya ji sharing dais with their Guru

Many many gratitude to mothers

Temyah sri guruve namah

34 SeptemberU 2015

n IAS topper Kumari Ira Singhal joined celebration of Guruparva in

the presence of Swami ji and Acharya ji:
Haridwar: July 31: Guruparva was held at Patanjali Yogpeeth with a
vow to upgrade the national environment. On the occasion of herbs
day and Guruparva more than 5000 Sadhaks thronged there with
the feeling of nationalism and respect for their mentors. They paid
respect for the efforts of Swami ji and Acharya ji to build the nation.
They also vowed contribute in the best way. Respected Swami ji and
Acharya ji too paid respect to their Guru with great reverence.
Speaking on this occasion, Swami ji said that Guru is an absolute
term, when have the feelings for Guru, then we have realisation of
dignity for life. A feeling of greatness arises in the heart which propel
a Sadhak to work with full confidence for national interest, nationality, a feeling to sacrifice for the country and the society.
Acharya ji said, a student has to be filled with the feelings of sacrifice and when a student is aroused in a Sadhak, then his personal
interest seem for him to be a trivial thing, he further added that such
persons able to understand the pains of others and he lives and dies
for it.
Miss Ira Singhal said on the occasion that we have to do many
important works for the nation, adding that she was greatly inspired
by the movements of Swami ji and Acharya ji. She also defined Patanjali as an institution which has dedicated itself for the sake of the
society and the nation. The celebration of Guruparva here is the reflection of our resolution.

Herbs day was held with great joy at

Patanjali Yogpeeth
n Acharya Balkrishna's Ayurved Siddhant Rahasya was released
in 12 languages like English, Spanish, Japanies, Italian, Japanese,
Russian,German are the six foreign languages and six Indian languages like Tamil, Nepali, Kannada, Gujarati, Marathi and Punjabi.
n Students of Patanjali Yogpeeth planted three lakh herbal plants
to pay their respect to Acharya ji on the occasion of his birth anniversary.
n For nutrition, the Government will work with Patanjali Yogpeeth to
provide food supplements instead of medicines: Jual Oram
Haridwar, O4 August: Herbs festival began at Patanjali Yogpeeth in
the ambience of Yagna. Moreover, Patanjali Yogpeeth's general secretary and vice chancellor of Patanjali University Acharya Balkrishna ji
was also celebrated on this occasion with great joy. Respected Swami
ji, all Guru Matas, Sevavrati brotehrs and Sisters of Patanjali, small students of Acharyakulam, officer bearers and workers of Bharat Swabhiman movement wished long and happy life ahead for Acharya ji. Those
who wished him on this occasion included the Union Minster Jual
Oram, respected sages of Haridwar including head of Junagarh Akhara Awadheshanand Ji Maharaj , Udasin Akhara chief sri Vishweshwara
Nand Giri ji, Dr Pranav Pandya of Akhil Vishwa Shanti Kunj Haridwar, Paramarth Ashram chief Sri Chidanand Muni ji Maharaj.

Respected Swami ji and Mata ji felicitating Acharya ji

on his birth anniversary

Lets come together and light the lamp to remove darkness

Ayurved Siddhant Rahasya released in 12

languages including 6 foreign languages:
On this occcasion Acharya ji's Ayurved Siddhant Rahasya was released
in 12 languages. It has been released in following languages- English,

Moments of immense affection, may you live long

35 SeptemberU 2015

Message
of
Sansthan

On herbs day, respected Swami ji, Acharya ji,

Guru ji and Shastri ji planting trees.

Spanish, Japanies, Italian, Japanese, Russian,German are the six foreign

languages and six Indian languages like Tamil, Nepali, Kannada, Gujarati, Marathi and Punjabi. The book was released in the presence of
Acharya ji, Swami ji, Union Minister Jual Oram and respected sages of
Haridwar including head of Junagarh Akhara Awadheshanand Ji Maharaj , Udasin Akhara chief sri Vishweshwara Nand Giri ji, Dr Pranav
Pandya of Akhil Vishwa Shanti Kunj Haridwar, Paramarth Ashram
chief Sri Chidanand Muni ji Maharaj. Many manuscripts related to
Indian culture were also released on this occasion.

More than 3 lakh herbal plants were planted:

On the occasion of herbs day, workers of Patanjali Yogpeeth across the
country planted nearly three lakh herbal plants to greet Acharya ji on
this occasion. The plantation drive started with Swami ji and Acharya
ji planting Neem plant in the premises of the Ashram. Children from
Darjeeling and the students of Acharyakulam gave presentation with
regard to building the nation and the world as well.
Daughters of Acharyakulam applying smear on the forehead of
Acharya ji on his birth anniversary

Completion of Yajurved and Sam Ved based yagna

36 SeptemberU 2015

Union Tribal Affairs Minister Jual Oram

In his address, said that Swami ji and Acharya ji's
names will always be remembered for their contribution to revive Yoga and Ayurved which were almost
on the brink of extinction. He also hailed the medicinal research of Patanjali Yogpeeth for its efforts
to save lives of the people. He also said that both the
Patanjali and the Government would work together for better nutrition of the people by providing them food supplements in stead of
medicines.

Swami Ramdev's pledge ended inertia, poverty, stubborness:

Swami Awadheshanand Giri Ji Maharaj(Mahamandaleshwar and chief of Juna Akhara)
visited here on the occasion to wish Acharya ji.
Swami Awadheshanand Giri ji Maharaj (chief of Juna Akhara, Mahamandaleshwar), visited Patanjali Ashram to greet Acharya ji on the occasion of his birth anniversary. He called
Acharya ji the soul, energy, spirit and innovative Acharya of Patanjali Yogpeeeth and said
that Acharya ji is has all the qualities of great sages. He added that Acharya ji's qualities has
impressed the world in a great way. He also called Swami ji as the biggest power of breath. He said that Swami
ji has looked into the eyes of crores of people and helped them to get rid of their problems. He also said that
Swami ji's pledge to serve people has destroyed inertia, deprivation, stubbornness, etc from people's life and
filled a new kind of confidence in people's life. He also said that if UNO is impressed by India's divinity, there
is the efforts of many sages behind it and Swami ji's contribution in all this has been of paramount importance. He also said that Swami ji is a driving force who makes the whole world function with him.
Awadheshanand ji also said that if in the eyes of crores of people is looked, it will be known that it is Swami
ji who made a record by serving humanity. He, through his workshops, yoga camps, food march, etc has done
amazing work. Awadheshanand ji also called Swami ji a voice to make people wake up early in the morning.
He said that it is Swami ji who made people wake up in the morning and improve their quality of life. This is
the reason why Swami ji stays in the heart of people across the world.
By pointing at Acharya ji , Awadheshanand ji said that he is such a closed person to Swami ji who worked in
a very tough and adverse circumstances and his creative thinking, behaviour, played a vital role in executing
creative ideas. Awadheshanand ji saw in him a divine soul who along with Swami ji has done revolutionary
works all around. They will continue to transform the world.
He also called Patanjali Ashram as a centre of divinity , adding that he sees divine qualities turning into a
reality here. He said that here has been simplicity, divinity, best human qualities, selflessness, thought process,
good behaviour etc. Here one can have a realisation of divinity. The patients who visit here are impressed by

37 SeptemberU 2015

Message
of
Sansthan

the efforts of Swami ji and Acharya ji as the two have touched the hearts of the people directly. And they were
naturally drawn towards them. He has towards these patients a view of considering them an amalgamation of
sensitivity. He said that there is a huge concept working behind the concept of Patanjali, a network, a teamwork, a resolution of success works into it.
Awadheshanand ji also said that as the army of Lord Ram comprising of monkeys was not a simple army
against Ravan but a force inspired by resolution, discipline, and a pledge for victory , the same way a force
is there working at Patanjali Ashram and it it just a beginning. And in future, the dreams of great sages like
Acharya Sri Ram Sharma who wished to establish Indian culture and traditions at its zenith, will be fulfilled
through Patanjali.
By again pointing at Swami ji and Acharya ji , he said that the sages have not only to ensure revolution but
they will ensure complete transformation in the world and they will destroy evasive and devil forces, they will
make the whole world happy and permanent solution to the country's problems will be found out.
He compared Patanjali Ashram with the ancient centres of education like Taxila and Nalanda that when
there will be no successor, Patanjali will provide them. He said he is seeing new India's future being born here.
Those students read Mahabhashya here are amazing kids, When the world will not have scholars to lead the
humanity, they will be produced at Patanjali. It is producing the leaders for all walks of life like trade, politics,
national security, etc. The two great sages are producing leaders to build a new world. Here one can see both
- Charak and Patanjali working together in the form of Acharya ji and Swami ji. One of them is a thinking
power, another is a vocal power. One is visible power, second is hidden power. One is Vyavahar satta, second
one is yoga power. They are resolute and working together. Both aspects are complementary towards each
other.
He said that all of us are involved in teachings and imparting knowledge, but whenever anyone will ask
me that where is our ideological movement, our answer will be that it lies in Acharya ji and Swami ji. It
lies in the experiments of Patanjali Yogpeeth. Their joint voice is the voice of India. He added that a time
will come when sages will conduct research on the works and achievements of the two. Here is the future
of India.

38 SeptemberU 2015

Swami ji is like Maharshi Patanjali and Acharya ji like Charak

Dr Pranav Pandya (chief of Shanti Kun Haridwar and Chancellor of Dev Sanskriti University), expressed his feelings on divine achievements and experiments of Swami ji and
Acharya ji. He said, "The way Swami ji 's impact is growing all around, our views regarding his movement gradually changed. In both the experiments we saw greatness and divinity. It is not only us, but the whole world society is greatly impressed by their works
and contributions." He added that when Lord Ram came, a revolution took place, when
Krishna came, a revolution took place, now both the Ram-Krishna are here and in this situation, a big
revolution is bound to happen. By expressing his interest in herbs , Dr Pandya said that such works are
demand of time and dedication and Acharya ji dedicated himself to find the medicinal qualities of herbs
for the wellness of humanity and this way he has given greatest peace to my heart. Dr Pandya also added
that the kind of work is being done by Swamy ji in the field of yoga, similar work is being executed by
Acharya ji in the field of plant world. In this way, one is Maharshi Patanjali and another is Charak.
Pandya ji called Patanjali Yogpeeth as a medical hub, spiritual hub, knowledge hub, centre of education.
He also said that the way Patanjali Yogpeeth has attained success all around is really stunning. He said
that Haridwar is the spiritual capital of the world. He expressed for a cooperation between Gayatri Pariwar and Patanjali Yogpeeth.
He said that Prime Minister Modi is working on making smart city in the country while it is more important to develop spiritual cities in the country.

No surprise if herbs day in future will be celebrated as world herbs day:

Swami Chidanand ji Maharaj (chief of Parmarth Ashram, Haridwar), said that Swami ji ensured reach of yoga Vidya in every household while it was until recent decades a mistry for
many of them. By understanding the pulse of the people, a chemistry was established with a
sage, though such a connection was set up by our ancient sages but in the mid time, there ap-

39 SeptemberU 2015

Message
of
Sansthan

peared a gap and people forgot about yoga but it was Swami ji who as a great sage introduced yoga among people.
He said that it was for the first time that UN had a few days ago officially mourned the death of our former
President Dr APJ Abdul Kalam and his birth anniversary is celebrated as World Student day.
He added that when energetic Prime Minister Narendra Modi addressed UN General Assembly, the world
accepted his call and began to do yoga. Speaking on the specialities of the book- Ayurved Siddhant Rahasya he
said that the book has been published in 12 languages and with this it is hoped that in future the herbs day will
be celebrated as World Herbs Day or World Ayurved Day. I have no doubt in it, he concluded. He further said
that there are two main forces in the country- Rishi Shakti and Krishi Shakti. Krishi Shakti produced grains to
feed our people while Rishi Shakti uncovered the vast secrets. The tribals have preserved the vast treasures of our
culture in the form of herbs.
He also said that today infrastructure is build and broken but intra-structure is never destroyed. This country
need vast intra-structure. This country has not developed itself through internet but through inner-net. Both the
great souls are able to establish a connection between the two.
He also said that this way the nation needs the herbal medicine of patriotism. More over the nation also needs
the realisation of self-pride as it strengthens patriotism. With self-pride, a person does not only live for himself
but the whole nation becomes his own. By indicating towards Swami ji and Acharya ji, Muni ji said that Patanjali
is strengthening the roots of the nation. The two have lived for the nation and the world. They are simply great.
They are working for the sake of their motherland.

Respected yoga guru Swami Ramdev ji

Maharaj
Greeted Acharya ji on his birth anniversary and added
that it is Acharya ji who is working for Rishi Sanskriti, Vedic
culture, yoga- Ayurveda, yoga, Ayurveda and the vast shape
of Patanjali Yogpeeth. Acharya ji is a person of creative nature. Achievements of Patanjali Yogpeeth could be possible
only due to Acharya ji.

40 SeptemberU 2015

Respected Acharya Balkrishna ji Maharaj

said that whatever is auspicious in our life, it is
only due to blessings of almighty, Gurus and parents. He also said that tha plants enhance our affection. He called the workers, to plant trees and
herbs in every household and serve the motherland and mother earth.

Ayurveda Gaurav and Krishi Gaurav conferred

On this occasion , Patanjali's Professor Banwarilal Gaur received
Ayurved Gaurav award and Surajmal Punia and Rajesh Jain received
Krishi Gaurav award.

Pledge to plant herbs garden in every household

Amid this, thousands of plants were distribute from Patanjali Yogpeth and it was also decided to call people to plant 10 herbs garden
for which a drive was launched. Such herbs includes- Tulsi, giloy,
neem, amla, ghreetkumari, pattharchata, akarkara, brahmi, karela,
turmeric, etc.
Such initiatives will help in environment conservation in a great
way. The programme started at 6:45 on scheduled date with yagna,
thereafter students from Darjeeling gave cultural presentations in respect of mother India.
Guests arrived from across the country greeted Acharya ji. Most
revered Mata ji blessed Acharya ji with great affection. Workers of
Bharat Swabhiman, Patanjali Yog Samiti, Patanjali Mahila Yog Samiti and Patanjali Yogpeeth had special participation and contribution
for successful completion of the programme.
41 SeptemberU 2015

Herbs day

Release of Ayurved Siddhant Rahasya book in 12 languages

On August 4, 2015, herbs day was celebrated and on that day Acharya Balkrishna ji Maharaj's book Ayurved
Siddhant Rahasya was released in 12 languages in the presence of sages and honourable Union Minister for
Tribal Affairs Jual Oram.

Children of Acharya Kulam are displaying Ayurved Siddhant Rahasya in various languages in the guise of the
people of different countries of the world.

42 SeptemberU 2015

On his birth anniversary, Acharya Balkrishna ji is

receiving the blessings of following dignitaries

Honourable Swami Ramdev ji Maharaj

Respected Mata ji

Honourable Managing Director and workers

Dedicated sisters

Dedicated Brothers

Small children of Acharyakulam

43 SeptemberU 2015

Herbs day

On `Jadi-buti diwas`, the good wishes of `Vasudev Kudumbkam`

inspired in the company of divine `matra satta` and honourable saints.

The birthday of Acharya Shri being celebrated as `Jadi-buti Diwas` and the best wishes related to welfare of the
world communicated from `matra satta` and `guru satta`.

With the best wishes related to welfare of the nation

from Juna Peethadheeshwar Swami Avadheshanand
Giri Ji Majharaj and Pujya Swami Ji Maharaj.

44 SeptemberU 2015

Homourable Dr Pranav Pandya, the Chancellor, Dev

Sanskriti University and Shredhyey Acharya
Balkrishna Ji Maharaj, in mutual discussion.

.HVK.DQWL
8QGHUWKHDEOHJXLGDQFHDQG/HDGHUVKLSRI
$\XUYHGD6KLURPDQL
6KUHGK\H\$FKDU\D%DONULVKQD-LZKRKDVGRQH
UHVHDUFKDQGGLVTXLVLWLRQRQRYHUPHGLFLQDOSODQWVDQGKHUEDOVDQG<RJDULVKL6ZDPL5DPGHY-L0DKDUDM
WKHODUJHVW$\XUYHGLF,QVWLWXWLRQ3DWDQMDOLKDVIRU\RXUEHWWHUKHDOWKSUHSDUHGDQGLQWURGXFHGRYHUSXUH
KHDOWK\HGLEOHDQGEHDXW\SURGXFWVDQGRQHRIWKHVHSURGXFWLVC.HVK.DQWLC
)RUWKHQDWXUDOVDIHW\DQGSURWHFWLRQRIKDLUVXVH.HVK.DQWLRLO.HVK.DQWL6KDPSRRDQG.HVK.DQWLKDLU
FRQGLWLRQHUZKLFKKDYHDQWLGDQGUXIISURSHUW\ZKLFKVWRSKDLUORVVDQGJUD\LQJRIKDLU,QIDFWWKLVSURGXFWLV
RQHVROXWLRQVWRSIRUHYHU\KDLUSUREOHP,WLVSUHSDUHGRIQDWXUDOKHUEDOVDQGPHGLFLQDOSODQWVZLWKRXW
3DUDIQ6RXVHLW\RXUVHOIDQGWHOO\RXUQHDUDQGGHDURQHV

2XUSOHGJH:RUOG&ODVV4XDOLW\/RZ&RVWDQG&KDULW\IURP3URWV
6XFK3ODWRQLFZRUNZLWKJUHDWGLYLQLW\FDQEHGRQHRQO\DQGRQO\E\DWUXH
<RJL

6DQ\DVL


2015 45

Disease Special

30 medicinal plants and 20 `yogasans`

useful in diabetes
n

Dr. Udaibhan Prajapati, Dr. Anupam Shrivastava and Dr Bhaskar Joshi

Patanjali Jadi-buti Research department, Patanjali Yogpeeth, Haridwar

iabetes disease is caused by lack of insulin hormone in the body. This hormone is being released
by the `Agnashaya` gland, which is located just
below the stomach and above the duodenum. Its beta cells
produce insulin, which controls glucose in the blood. According to the World Health Organization (WHO) an
estimate of 18 crore people in the world are affected due
to diabetes. Diabetes disease exist since decades and its
description is found in `prahmeh` and Ayurvedic doctors
were aware of the disease around 3000 years ago.
Diabetes Mellitus word has been derived from the Greek
word diabetes, which means siphoning i.e.flowing and mellitus means sweet.

Types of diabetes
Type one is Insulin dependent diabetes mellitus: This category of diabetes attacks mostly children and tender-aged
children. In this category, the percentage of insulin in the
blood is negligible and hence, the sugar percentage increases
in the blood, to control which insulin injections are needed
or the patient falls unconscious and later slip into coma.
This condition is said to be diabetic coma. Its original reason is still not known.
Type two is non-Insulin dependent diabetes mellitus:
This disease is less serious as compared to Insulin dependent diabetes mellitus. It is mostly found in adults. Among all
diabetes patients, non-Insulin dependent diabetes mellitus
is found in 2/3rd of the total patients. The chief reason is
insufficient insulin hormone availability in the body or despite its adequate presence cells are unable to use it.
46 SeptemberU 2015

Reasons of diabetes
1. Obesity and lavish life style
2. Hereditary problem descending to children from the
parents
3. Excessive mental tension
4. Excessive use of anti-pregnancy tablets, steroids and
other such medicines.

Symptoms of diabetes
Repeated urination, excessive thirst, more hunger, decrease in weight, laxity and tiredness, dryness of the mouth,
time taking healing of the injuries, blurred vision, increase
in the lens power, itching around private parts, numbness
in hands, legs and sometimes feeling the movement of ants,
problem in skin and jaws, collection of ants near urine, sexual weakness and impotency, unconsciousness and gangrene
trouble.

Medicinal plants useful in diabetes:

1. Gorh Vach
Botanical name - Acorus calamus L
Family Acoraceae
Useful Rhizome
2 Bel
Botanical name Aegle Marmelos (L) Correa
Family Rutaceae
Useful Leaves.

9.
Aonla
Botanical name Phyllanthus emblica l
Family Phyllanthaceae
Useful Fruit
10. Neem
Botanical name Azadirachta Indica A Juss
Family Meliaceae
Useful Leaves and Seeds
3. Onion
Botanical name Allium Cepa L
Family Amaryllidaceae
Useful Juice of the bulb

11. Vat
Botanical name Ficus benghalensis
Family Moraceae
Useful Bark

4. Garlic
Botanical name Allium sativum
Family Amaryllidaceae
Useful bulb

12. Pipal
Botanical name - Ficus religiosa
Family Moraceae
Useful Root

5. Aloevera
Botanical name Aloevera (L) Burm
Family Xanthorrhoeaceae
Useful Exudates of leaves

13. Ramtil
Botanical name - Guazuma ulmifolia lam
Family Sterculiaceae
Useful - Fruit and leaves

6.
Sharifa
Botanical name Annona squamosa L
Family Annonaceae
Useful Leaves

14. Gurhal
Botanical name - Hibiscus rosa-sinensis
Family - Malvaceae
Useful - Roots and buds

7.
Lajalu
Botanical name Biophytum sensitivum (l) Dc
Family Oxalidaceae
Useful Whole plant

15. Kali sariva

Botanical name - Ichnocarpus frutescens
Family Aapocynaceae
Useful Roots

8.
Sadabahar
Botanical name Catharanthus roseus (l.) G.Don
Family Apocynaceae
Useful Whole plant

16. Bagharen, Jangli arandi

Botanical name Jatrophacurca
Family - Euphorbiaceae
Useful - Aerial Part

47 SeptemberU 2015

Disease Special
17. Sandan, Tinsa
Botanical name - Desmodium oojeinense (Roxb.) H.ohashi
Family Fabaceae
Useful - Fruit and leaves.

25. Harada
Botanical name - Terminalia chebura Retz.
Family - Combretaceae
Useful Seed powder

18. Pachi
Botanical name - Phyllanthus reticulatus Poir
Family Phyllanthaceae
Useful - Fruit and leaves

26. Methi
Botanical name - Trigonella foenum-graecum l
Family Combretaceae
Useful - Seed Power

19. Amrood
Botanical name - Psidium guajava l
Family Myrtaceae
Use - Fruit and leaves

27. Bhindi
Botanical name - Abelmoschus esculentus (l.) moench
Family Malvaceae
Useful - Seed and aerial Part

20. Kuina
Botanical name - Cinchona officinalis l
Family Rubiaceae
Useful Bark

28. Khair
Botanical name - Acacia catechu (L.f.) willd
Family Fabaceae
Useful Bark.

21.Turmeric
Botanical name - Curcuma longa l
Family Zingiberaceae
Useful Rhizome

29. Bhunimb, Kalmegh

Botanical name Andrographis paniculata (burm.f.) Nees
Family Acanthaceae
Useful - Whole Plant

22. Black Pepper

Botanical name - Piper nigrum l
Family Piperaceae
Useful - Whole Plant

30. Chirayita
Botanical name - Swertia chirayita (Roxb.) buch.-Ham.
ex C.b. Clarke
Family Gentianaceae
Useful Whole plant.

23.Jamun
Botanical name - Syzygium cumini (l.) Skeels
Family Myrtaceae
Useful - Seed and bark
24. Bahera
Botanical name - Terminalia bellirica (Gaertn.) Roxb
Family Combretaceae
Useful - Whole Plant

48 SeptemberU 2015

Useful asans in Diabetes

Surya Namaskar, Janushirshasan, Ardha-matsayendrasan, Vajrasan, Dhanurasan, Pashchimottanasa, Chakki
Chalan asan, Chakrasan, Shalbhasan, Bhujangasan, Naukasan, Taramatyasan, Sarvanganasan, Halasan, Karnapeedasan, Mayurasan, Bhastrika, Anulom vilom, Dirgha
shavasan and Suryabhedi pranayam.

6SHFLDO&K\DZDQSUDVK

)RUWKHWKRXVDQGVRI\HDUVRXUROGVDLQWVVHHUVGLGUHVHDUFKRQKHUEDOVDQGIRURXUEHWWHUOLIH
DQG KHDOWK\ IXWXUHJLIWHG
WKHLQYDOXDEOH NQRZOHGJH RI$\XUYHGD ,QWKHVFDUHG GLYLQH WUDGLWLRQ RI
IXWXUHJLIWHGWKHLQYDOXDEOH
VDLQWV$\XUYHGD6KLURPDQL$FKDU\D%DONULVKQD-L0DKDUDMLVLQYROYHGLQGHHSDQGLQWHQVHUHVHDUFKRI
RYHU  VFDUFH KHUEDOV )URP WKH ORQJ OLVW RI OLIHVDYLQJ KHUEDOV  KDYH EHHQ SLFNHGXS WR
SURGXFHWKHJOREH
VEHVW3DWDQMDOL6SHFLDO&KD\DZDQSUDVKZLWKDGGHGC.DVKPLUL.HVDUC
1RZMXVWTXLWWKHVXEVWDQGDUGDGXOWHUDWHGFK\DZDQSUDVKDYDLODEOHLQWKHPDUNHWDQGDGRSW
RULJLQDO3DWDQMDOL&KD\DZDQSUDVKDQGJDLQLPPHQVHSRZHUDQGLPPXQLW\WRJKWRXWVHULRXV
DLOPHQWVDQGGLVHDVHVDQGHQMR\ORQJKHDOWK\OLIH

2XUSOHGJH:RUOG&ODVV4XDOLW\/RZ&RVWDQG&KDULW\IURP3URWV
6XFK3ODWRQLFZRUNZLWKJUHDWGLYLQLW\FDQEHGRQHRQO\DQGRQO\E\DWUXH
<RJL

6DQ\DVL


2015 49

Principles of health

Naturopathy of
Patanjali Yoggram

he naturopathy means expelling toxic material from the

body, thus giving strength
to the body parts. Also, fight out impure thoughts and have purity in diet.
In our body, some parts get week due
to toxic, oxidants and negative energy
and the diseases related to the that
particular part attack the body. In Patanjali yogpeeth, many exercises based
on naturopathy are being performed
to keep the body pure. The first one
is `shat karma`, which includes `dhaiti` process. `Dhaiti`
is much useful in cough and respiratory problems. `Neti`
is another process to clean the body. In `neti, jal neti, sutra
neti, tel neti` and `ghrit neti` are prominent. Take the
water inside from one nostril and expel from the other after taking deep breath from the mouth, is jalneti. In sutra
neti, first day mustard oil, almonds `rogan` or cows ghee
is put in little quantity in the nose. It opens-up the nose,
which treats cold and cough. People with mucus or sinus
problem, should put a little almonds rogan or cows milk
with dropper, which keeps mind and brain healthy. This is
`shatkarma`. Alike is `panchkarma`.

`Panchkarma experiment`
In `panchkarma`, it is lubrication, diaphoresis, purgation and emesis. These

50 SeptemberU 2015

activities are being performed at

`Panchkarma` department of Patanjali Yogpeth and Yoggram, both
the places. For the health of eyes,
` Akshaya tarpan` is the best remedy. If the impurity increases in the
body, massage is also an option. Dry
massage, oil massage, hot and cold
compression and steam of different
herbals are given. As for skin diseases, different medicines will be applied. For joint pain and for swelling, separate medicines and steam bath is given, with
the help of different herbs. The persons, with critical
problems could be immensely beneficial with the above
activities.
Besides `shankh abstersion` is much useful for the
people, suffering with old constipation, obesity, sugar, skin diseases and stomach related ailments. In this
exercise, lemon water is drunk, following which five
`asans` are asked to perform. The people, suffering
with Asthma and have problem with lemon are asked
to take warm water, empty stomach. The BP patients
are not given salt and are asked to drink warm water.

They are asked to perform asans, which start cleaning

of stomach. Light food like mush or fruits is provided
in the dinner.
People, who have serious constipation are provided
`trifla` or `harad` powder so that the stomach starts
cleaning-up. It takes 3-4 hours, which washes-up all the
impurities deposited since years. The water of myrobalan is also useful here, which gives immense benefits and
ahs no side-effects.
For Migraine, anulom-vilom, pranayam, jalneti or
sutraneti are beneficial. Medhavati, almonds rogan,
anulom-vilom pranayam give 100 percent benefits. In
case of heart enlargement, pranayam gives 100 percent
benefits. `Hirdayamrit` and Arjun bark are also beneficial. We all know it very well that every herbal or diet
has immense power to keep a human body health. In
fruits, cereals, medicines, vegetables, why there is different scent? The source of scent is this earth. All juices
come from water. All forms emerge from fire. The seers
investigated each and every element and gave the principle that every element has energy, power, strength and
also proved that in vegetables and medicines, same powers exist.
Patanjali Yogpeeth worked on the same concept and
associated patient with the herbals and gave miraculous results. Patanjali Ayurveda claims regarding some
of the medicines that if given in proper proportion,
the departure of the disease is for sure. For the diseases related to brain, use of Brahmi, Shankhpushpi,
Ashvagandha medicines, myrobalan for eyes, aloevera,
brasil and neem for skin, neem and other medicines
for teeth, Arjuna for heart, for liver brown myrobalan, McCoy, Nishodh and Punarnava are useful. For
kidney bunions and varun bark are helpful. Thus, for
heart, lungs, bones different medicines are used. In the
Patanjali yogpeeth expert docutrs perform the treatment. Pranayam is also an integral part of Ayurveda
and totally in accordance with the science. Whatever
strengths medicines and herbals receive, is from `prana`. The source of all powers is `prana`. If a human be-

ing uses `prana` properly, there is no need to eat medicines or for the strength of `prana`, medicines, herbals
are useful. The yog-gram cell of Patanjali works on the
same principle.
51 SeptemberU 2015

World Building

The world on
the way of
reconstruction
n

Dr. Ved Pratap Vedic

An effective decision on the way of

women's empowerment
The Supreme Court of India has given a path breaking decision according to which the child of an unmarried woman can get the name of his or her mother at the
time of school admission instead of father's name. Such
children are not required to be identified by the name
of their father. After reading this verdict, it came to my
mind that why not every one should always write his or
mother's name instead of father's name. Of course, those
who want to write their father's name for official purposes should be allowed to do so but why not mother's
name? For a child, both his or her mother and father's
name are important but it is also important to note that
mother is a reality, however, father's name is just a speculation.
Why should one give more importance to speculations than reality? Is it so because we come from a patriarchal society? This highlights the mind set that every
mother is a woman and a woman is the door way to hale.
It is this mentality which considers her as the assets or
property of men. She has no rights but duty. Whether it
be the western world or eastern world all are having the
same sick mentality to have a child recognised by his or
her father's name. However, if we go in past, brave men
in the society were know by the names of their mother. Kunti's sons were called Kanutey and Sumitra's son
Lakshman ji was also known as Saumitra. Jabala's son
Satyakam was known as Jabal. Why do we call Sita-Ram
52 SeptemberU 2015

or Radha - Krishna? It is so because this was the greatness of Indian culture. People of India don't call their
country as their fatherland but they prefer to call it their
motherland. In Vedas, earth has been termed as mother.
Mata Bhumih, Putroaham Prithivyah I Among teachers
of a child, mother is counted before his or her Guru and
father. "Matriman, Pitriman, Acharyavan Purusho Ved".
Why did we put our mothers on back burner like that of
western culture.
When every citizen of India will start writing the
names of their mother, it will mark the beginning of a
new revolution. I will try to move a petition in the Supreme Court seeking to make it necessary for every citizen to use the name of his mother instead of his father.

Signs of India's new global role:

Iran's nuclear deal with fiver Security Council members and Germany is such a development which will be
remembered for longest period of time owing to numerous reasons. First, Iran is the first brave nation of
which supreme leader Ayatullah Khomaini was termed
by Americans as world's biggest demon and Russia as
world's small demon. Such courage was not shown by
any other country of the world. The US would call it
the axis of evil. Jimmy Carter Government had once
tried to interfere into the affairs of Iran and rumour was
rife that Israel was preparing for nuclear attack on Iran.
Despite all such instances of distrust the two countries
have agreed to settle all their issue and normalise their

relationship. It is most likely that with recent accord between the two sides, the era of 40-year old tension will
be over. Another major development is that Iran has
agreed international monitoring on its nuclear installations hence it won't be able to develop nuclear weapons
henceforth. The kind of pressure Iran incurred in the recent years due to sanctions by the six nations, the other
countries of the world will learn a lesson and they will
desist from nuclear adventure. It is a great development
in the direction of nuclear disarmament. Fourth, with
normalisation of relation between the US and Iran, now
it will be possible that the whole south Asia, Iran, India and the US will work together. They will share joint
strategy, joint trade tax, etc. With normalisation of Iran
and the US, now India will have even wider opportunities for its own development in all sectors. India is developing Iran's Chahbahar port, from where there will be a
direct route to Central Asia, and hence the US will now
help India even more to enhance its influence.
Sixth, now India, Iran, the US, and other countries of
the world can even more effectively deal with Taliban,
they can build a stronger Afghanistan. Seventh, India
has now a much better relation with Saudi Arabia, Israel
and Iran, now India is required to develop a new threepronged strategy. The duty which is to be executed by
the US is now to be done by India itself. Eighth, now Iranian oil will help reduce the price of oil in international
market. India imports 80 percent of the oil of its needs.
Now it will have benefit of billions of rupees. Moreover,

it will be easier to bring gas from Turkmenistan and Iran

to India. Ninth, with lifting of international sanction
from Iran , its economy is set to grow exponentially, it is
expected to rise as a new economic power, its activeness
in the West Asian countries like Iraq, Lebanon, Syria and
others is expected to increase, internal conflict will rise,
in this situation India has a vital role to play as a mediator in relation among these countries.
India-Pakistan can move in the direction of normalising their relations: The meeting between Prime Minister
Narendra Modi and his Pakistani counterpart Nawaz
Sharif in Russia recently is being criticised by opposition
in both the countries, first and foremost, let us take a
view of the reaction of Pakistani political parties, mediaTV and Print. They are not talking of Modi's invitation
to Sharif to visit India, they have mainly focused on trivial issues like the size of room where the two leaders met
and Sharif had to walk more to meet Modi.
They ignored the reality that the moment Modi saw
Nawaz entering into the room, he got up and welcomed
him warmly. It is reflection of Modi's sincerity that
45-minute scheduled meeting lasted for 1 hour 30 minutes. It is my request to Pakistani politicians and media
that they should display a little bit of patience and wait
for further developments.
They another contention is that why the issue of Kashmir was not included in the joint statement of the two
leaders. Though the answer to this question was rightly
given by Sartaz Aziz, Pakistani NSA. He said that the
issues like this will be discussed under track 2 diplomacy in the presence of the experts. Even in India it is
being questioned that why Modi did not raise the issue
of Pak Occupied Kashmir. It is important to note that
just making a statement on one or other issue will not
find a foolproof solution to this issue. These issues are
almost seven decades old and no one knows when they
will be settled. At present it will be better to confine bilateral talks to tackling terrorism. Focus should be given
on increasing bilateral talks. People should be allowed
to go to other countries through each-other's territories.
When the two sides will arrive at conclusion over these
issues, it will pave the ways for resolution of Kashmir issue permanently.
53 SeptemberU 2015

Village Matters

For the best scale of rural development,

appropriate vision is necessary
n

Vaidhya Rajesh Kapoor

of our population, still lives in village and the development of India means, the develop-

Majority ment of the villages. But the problem is that we want to adopt Western culture for the

development of the villages. We should not forget that the civilization of the Western period is just
200-300 years old. The society and the culture are still experimenting. They could not develop any
model system or arrangement, which can be followed for the benefit of the society. Their system and
arrangements are proving detrimental for themselves. From socialism to capitalism, they have been
proved to be miserable failure and passed through the phase of confusion thus finding some proper
solution for them itself. In fact all the philosophers of the world are finding solution of their problem
in Indian culture, tradition and ideology. Thus for the all-round development and self dependency of
the villages, we will have to rely on the decades-tested `swadeshi` formula and traditions, which have
to be mould in accordance with the modern era so that our own model could be developed.
54 SeptemberU 2015

Failure of the Government

development model
The incomplete vision towards development has given very
bad results and every social worker is aware of it. One IIT
holder social worker Somdev Tyagi brought economical reforms in a tribal village with sustained efforts of 2-3 years
but the result was that the village men started consuming Indian Made Foreign Liquor (IMFL) replacing country made
liquor. The society became drunkard, poor character with
regular complaints of mutual fights. Tyagi ji had a very bitter
experience in it, which amended his thoughts too. Economical development is not the only scale of development as it
could improve GDP but the society falls further. It has to
be understood as what are the reasons behind failure of the
Government run development models and even if, they succeed in improving a segment of the society economically, the
society sees fall on social scale, with more criminal activities
coming-up. Hence, it has to be understood that as long as
we do not develop good culture, the dream of a better society cant become a reality. If we think of happy, civilized and
prosper civil society and plan in this direction, we will have
to plan to develop culture among them.
We will have to teach them yoga, pranayam, ideal stories
of big personalities, cultural stories, constructive art, music, plays and all aspects, which makes them culturally rich
and if possible arrangement of `Bhajan` group and regular
`bhajans` recitation should also be made. Of course for different followers of different religions, separate guidelines
could be developed. But in the name of culture, vulgar or
obscene dance, songs should not be promoted at any cost.
In fact, after making arrangements for values in the society,
other aspects of rural development could be taken in hands,
which could be as follows -

Agriculture related development:

We could make immense development on the economical and industrial level but everyone needs food. And food
should be toxin free, chemical free and only then the dream
of healthy society could be realized. Thus, when we think
of economical development of the villages, we will have to
take agriculture at the top-most priority. And agriculture
without cow is impossible. Or else, the farming will be toxic
and with chemicals, the dangerous results of which, entire

country is facing currently. Thus, it is important that focus is

on toxin-free domestic fertilizer so that the concept of agriculture improves.

Indigenous fertilizer:
If we use fertilizer prepared of cow dung and vegetable
waste, the country could save lakhs, crores of rupees, which
is being used in chemical fertilizers. Experiments in many
countries, including India have proved that such domestic
fertilizer increases productivity and not decreases.

Supply of fuel:
Methane gas, which is prepared of cow dung could easily
fulfill the need of fuel of more than half of the population.
In world, at many places, the gas production plants in plastic
tubes are running successfully, which could easily save lakhs,
crores of rupees, spent on fuel. The domestic plant could be
installed for just Rs 5-10,000 and is not unsuccessful like cow
dung gas plant of cement. At little large scale, with small generators, power could be generated, which is being used at some
places in our country. 8-10 cows are sufficient for the purpose.

Seed Bank is also necessary:

Without seeds proper farming is not possible. Thus, in
every village seed bank (One big and another small room)
55 SeptemberU 2015

Village Matters
could be set-up with proper training to the village men. The
poor effects of GM seeds have already been observed and
almost all the countries have rejected them. Only India is an
exception. But of late, we will have to rely on domestic seeds
as impotence seeds are making our youths impotent, is what
many people presume. Thus, without protecting domestic
seeds, village and national growth is not possible.

Water management:
India had been the best in water management including
collection and conservation. A book on this subject `Abhi
bhi khare hai talab` and discussion with Ravidra Guru give
adequate guidelines in this connection. If we properly implement such technologies with intelligence at village level,
for sure good results will come.

`Panchgavya` products:
A two-day workshop on Panchgavya, arranged under
the aegis of AYUSH department i.e. Central Ayurveda and
Research Council of Government of India, held in New
Delhi, recently. On the occasion, a research tract of 500
pages, titled `Panchgavya chikitsa` was released. According to medical experts, complete treatment with the help of
`Panchgavya` is possible. The medicines could be prepared
at village level. In fact, a farmer could produce medicines at
the corner of his house for his family thus, saving his beloved ones with the ill-effects of medicines besides unnecessary
spending money, efforts and time.
The use of cow dung incense sticks is also gaining popularity and anybody could easily learn the technique and prepare incense sticks. Apart from the domestic use, it could be
sold in the urban areas. The demand of cow urine infusion,
`ghanvati` is also on rise. Cow dung, cow urine and cows
ghee safeguard a person from the risk of cancer and researches have certified it. America and other countries have
patent some of the `Panchgavya` products. Thus, till license
permission and selling system, they could experiment it at
their home so that the health of their beloved ones is saved.

Only domestic cow:

Many researches have proved that foreign breed cows
give products having A-1 toxic proteins, which cause many
incurable diseases. In contrast, Indian domestic cows have
56 SeptemberU 2015

A-2 protein means the product is highly healthy. Thus, essentially we should shelter and protect domestic cows and
its rearing should be promoted. The Ayurveda Research
Council and Karnal located NBAGRK scientists have the
same opinion.

Solar energy related experiments:

In the rural households in Nepal, many people use solar
cookers, with the help of cardboard and aluminum foils or
metallic paper and prepare food in the sun-light. In many
countries, many societies are using solar energy for domestic applications. Under sunlight it saves energy and fuel.

Agnihotra:
Peru, Chile, Poland, Germany, France and many other
countries of the world are relying on `agnihotra` to improve
production and treatment of incurable diseases of crops. On
December 16, 2012, an MD doctor, who had come from
Peru gave presentation on agnihotra in Patanjali Yogpeeth
and said that in his farms, he is taking production of 84 tons
of mangoes per acre, due to the use of agnihotra, which was
just 10 tons previously. We have, using chemical fertilizers
taken 15 tones of mangoes, per acre of land. Most of the
people from different countries cant pronounce agnihotra
properly and hence, they re-named it as homa.
This process of 5-10 minutes time can be easily taught to
the farmers. The process is much easy and result-oriented.
It treats the pollution of water, soil, air and increase the
productivity manifolds.
In Maharashtra, farmers started production of grapes.
The germination of seeds was taking place in 6-9 months
but with agnihotra, seeds germinated in just 21-28 days. In
Maharashtra, many farmers are still utilizing the technique.
Many experiments, held world-wide proved that agnihotra generates positive energy. Drug addicts leave the
habit and become peaceful and good character person.
So, the need is to train groups of good values. Following
the above said principles, we could develop some of the
villages as model villages, so that other people could also
be motivated and inspired and the country starts growing
faster on agriculture based economy. I am hopeful that the
common man will understand the facts and move ahead
in this direction to contribute in the growth of the nation.

Natural fertiliser

Some domestic methods

for protecting agriculture:

half kg wheat flour. Dilute this preparation and sprinkle

it on gram crop. One more thing, treat the gram in butter milk for 4 hours before sowing. It will cure Ukatha
disease.
l

1955, only 2000 mt pesticides were used in India, now 8300 mt is used in the country. They
adversely impact the environment. Various fruits, vegetables,
cattle food, etc are mediums which carry harmful chemicals
inside the human and animal body and drastically hit their
health. Given these realities, it is important to use more
and more domestic stuffs to control pests and Patanjali has
launched an intense research drive in this direction. Other
institutes too have started moving in this direction, but it is
equally important to spread awareness among farmers. The
aim is to promote the use of herbal fertilisers so that they
could be prepared at domestic levels and with this the whole
agricultural world would benefited.

Till

Use of Neem
l

Use of Matka fertiliser:

Take 15 kg fresh cow dung, 15 litre fresh urine of Desi
cow, take 15 litre water and mix it well in clay, add some
jiaggery in it, and finally pack the pot with jut and soil.
After 5-7 days, add 250 litre water into it, to be sprinkled
in one acre of land. It has to be sprinkled 15 days after
sowing of the seeds. Repeat it after seven days, in normal
fruits and vegetable crops of short life time, use it for 3-4
times while in the vegetables and fruits of long duration,
sprinkle the preparation for 8 times. You will observe a
positive effect on the crops.

Use of cow dung and Neem:

Let one kg Neem leaves to be decayed in 3-10 litre cow
urine kept in a copper pot. Boil it till the half of it gets
evaporated and let it to cool. Now add 500 litre water
into it and sprinkle it in the crop.

Before planting the crops of tomato, soak it in water mixed with Neem khali. It use will prevent the
danger caused by many worms.
Take 5 litres of water and add 1 kg Neem Khali
and leave them together for a week and keep shaking them on and off. Later filter it and add 10 litre
of water and sprinkle it on your crops. It will protect the crops from many pest and insects.
Mix one kg Nimbauli powder in per 100 kg of
each of the grains of Moong, gram, peanuts and
other pulses to protect them from damage from
insects for 6-12 months.
Keep Nimbauli in an earthen pot and fill it with
water and cover the pot for a month's time. Sprinkling this preparation on crops by adding water
into it will protect from pests and insects.

Pumpkin: An experimental treatment

l

Butter milk:
Take 10-15 days old butter milk made of the Desi cow
milk. Sprinkle it after adding 15 litre of water. It will
control pests and diseases in pulses. Moreover, store 10
litre butter milk in an earthen pot for a month, later add

Boil one kg tobacco leaves in 10 litre water for half

an hour and after it cools down, let it to be soaked in
cool water and later filter it well. Add 30 litre water
into it and sprinkle it on the crop as it will protect
the crop from many diseases.
Take one kg tobacco and soak it in 2 kg lime water
for the whole day and filter it later. Add 100 litre
water into it and sprinkle on crops to protect them
from white flies and other such pests.

Pumpkin's seeds, leaves, root, etc have property to

control pests. Take extract of 2 kg pumpkin seeds
and mix it in 200 litre water to be sprinkled in
one acre of land. This will protect the crops of
tomato, chilly, little finger and gram.
Make paste of 2-5 kg garlic and soak it in 500
litre water. Filter it with the help of cotton and
sprinkle on the crops. It will also be an effective
protection.
57 SeptemberU 2015

Important message for the

readers of Yog Sandesh
number. The new subscribers should also write clearly on the
money order coupon as new customers. Those, who do not
wish to continue their membership, please communicate their
decision.

13, 01

UUmUU- U 25

U 2015

, , ,S SU
U

15/-

U S U UUU U
U (USU) UUmU mUU

5.

The membership of Yog Sandesh is always opened. But the

customers are expected that they fill the gap in such a manner
that their membership continues till December 2016 so that we
will have convenience in maintaining the membership record.
The files of the customers will also be not incomplete. Also, the
customers whose membership deposit is ending in between
sometimes are also requested to send subscription fees so that
the circle gets completed.

6.

If any of our beloved customers wants change in address,

he should clearly mention old and the new address. Merely
mentioning the new address makes it difficult to make relevant
changes.

7.

From here, every month, after doubly checking Yog Sandesh

magazine is send to you and if still, you are not getting any issue,
please inform the same month. If the information reaches after
two months or later, it becomes difficult to send the copy as old
copies do exhaust very soon.

8.

Adding on the customers for Yog Sandesh, means sapling a

plant of divine qualities. It on one hand clarifies the way for
the self-welfare, peace and prosperity of the people and on the
other, when the strength of Yog Sandesh increase, it indirectly
helps in the campaign launched with the inspiration of the
almighty god and seers. This helps in completing the work of
social service and public welfare with greater pace successfully.

U U L
S U UcU U

1.

2.

3.

4.

The readers whose subscription

deposit has exhausted with
this edition are requested to
send membership fees through
money order or bank account
immediately.
The November issue of Yog
Sandesh will be a special edition
on Ayurveda. For a disease
free, happy and healthy life,
Ayurveda has special place. This
issue is valuable for the people,
who aspire to live healthy and
progressive life. There is strong
possibility that there could be
shortage of this issue as well.
Write your membership number,
full address in English or Hindi
on the money order coupon
should be written in neat and
clear handwriting. Illegible or
scribbled writing could create
confusion and the magazine may
reach to wrong address.
Old subscribers should clearly
mention their membership
58 SeptemberU 2015

Thus, helping addition of new subscribers is a pious task. We

request all our customers to make suitable and fruitful efforts in this
direction with full strength.
Manager, Yog Sandesh office,
Patanjali Yogpeeth, Haridwar.

6DYHWKHFRXQWU\IURPHFRQRPLFVODYHU\DQGSRYHUW\
%ULQJWKHEHVWCVZDGHVKLCSURGXFWVRI3DWDQMDOLDWKRPH
:KHQZHXVHIRUHLJQFRPSDQ\SURGXFWVRXUPRQH\LVRZQWRIRUHLJQFRXQWULHVRXU
QDWLRQDQGWKHVRFLHW\VORZO\JURZZHDNHUHFRQRPLFDOO\:KHQWKHFRXQWU\ZHDNHQVLW
XOWLPDWHO\EHFRPHVVODYHRIIRUHLJQQDWLRQ
7KXVWRPDNHWKHFRXQWU\VXSHUSRZHUHFRQRPLFDOO\DQGVSLULWXDOO\DGRSWDQGIROORZ
3DWDQMDOL<RJDDQGC6ZDGHVKLC
7KHSURWHDUQHGE\WKH3URGXFWVLVFHQWSHUFHQWXWLOL]HGIRUWKHSURPRWLRQRI<RJD
$\XUYHGD(GXFDWLRQ+HDOWK&RZVHUYLFHC*XUXNXOCDQGVHUYLFHWRWKHQDWLRQ7KH
3DWDQMDOLFDPSDLJQLVQRWIRUWKHSURVSHULW\DQGSOHDVXUHRIDQ\LQGLYLGXDOEXWLWLVIRUWKH
FROOHFWLYHSURVSHULW\DQGKDSSLQHVVRIWKHFRXQWU\DQGWKHVRFLHW\

2XUSOHGJH:RUOG&ODVV4XDOLW\/RZ&RVWDQG&KDULW\IURP3URWV
6XFK3ODWRQLFZRUNZLWKJUHDWGLYLQLW\FDQEHGRQHRQO\DQGRQO\E\DWUXH
<RJL

6DQ\DVL


2015 59

60 SeptemberU 2015

With the
strength of
Yoga
By waking up at dawn,
lets focus in the feet of almighty I
With the strength of yoga,
Lets make our lives sacred I
With the endowments of dawn,
Let us make our life complete I
By getting benefitted from divine
yoga,
Lets get healthy body and mind I
By doing Surya Pranama every
morning,
Lets enhance our inner energy I
With Asana, Pranayam and Niyam,
Lets make ourselves fresh and active I
To deprived and troubled people,
lets hug them with love and
affection I
To every individual of this world,
lets inspire to do yoga I
Auspicious and best method,
Let us make a prosperous and happy
society I
Laziness, frustration and
hopelessness,
lets get rid of all these things I
With the strength of Yoga
LET US MAKE OUR LIVES
SACRED I
Ram Kishore Shukla

The souls
which became
decayed in five
fundamental
elements
Sacrificed all their comforts for the world,
They are now remembered and revered as deities I
By sacrificing their own blood for the world,
Fought on the frontiers our brave soldiers,
The life which becomes prosperous due to their sacrifices,
Never were they envious, even a bit,
The sacred thoughts, they did not ever show arrogance.
They became eternally famous, by sacrificing their lives,
They smeared the motherland with their own blood,
Their only dream was to see the motherland prosperous,
They went for heavenly abode,
by praying the motherland,
O I Nationalists ,
lets come to remember their contribution,
Those who after sacrificing lives, are proud,
To ensure no politician could loot the nation,
People of the nation should not be
harmed because of them,
Rein in atrocious, terrorist elements,
Promote brave and courageous forces,
could take charge of the nation,
No more bleeding due to terror elements,
Send the message to enemies of humanity,
Disturbing elements have been spotted,
The brave sons of this country by sacrificing their lives,
Their sacrifice should never go waste,
O nationalists , lets pray in their respect,
Those who have sacrificed their life, shown bravery

61 SeptemberU 2015

Patanjali toxin-free farming 17

Take maximum production of

chilli with Patanjali process
n

Rajesh Jain

is an old saying that when any problem assumes serious dimensions, return to the basics. Many farmers are committing suicide in India and the incidents are sufficient to say return to
the basics. When chemical and toxic fertilizers were not available, still
farming was done and the produce was better. The farmer was happy.
Azadirachta indica or neem, insecticides made-up of cow urine were
playing efficient role in controlling the diseases. But as the use of chemical, poisonous fertilizers increased, the problems of the farmers too increased in the same proportion. In such adverse circumstances, the drive
for toxin-free farming being launched by Patanjali Yogpeeth will definitely show the light.

IT

62 SeptemberU 2015

oday, chilli is at the top

among the products, which
are high-quality and without chemicals. But here too, toxic
chemicals are being used. So, Patanjali toxin free Agriculture cell is
presenting the process of producing
toxin free chilli farming.
Although, chilli is produced in
tropicopolitan area normally but
now it is being produced in different regions of the country including
Andhra Pradesh, Telangana, Tamilnadu and Karnataka, where the climate is appropriate for its production.

Climate for the chilli crop

Chilli is the crop of warm and

semi-warm areas but for its production warm and humid climate is the
best. Area having around 700 mm of
annual rainfall is the best region for
its production.

Soil and farm

preparation
For the production of chilli, loam
soil with proper drainage of water is
the best option. The PH of the soil
should be around 6-7. The acidic soil
is not good for the production. For
the production of chilli, take 2000
liter of biogas slurry or Sanjeevak
fertilizer for every acre of land and
do deep plowing. Later pour 25 kgs
of Patanjali granular fertilizer. Thereafter, perform light double plowing
and then divide the farm in small
seed-plot. The area should not be
more than 10X10 meters.

The nursery of chilli

In the farming of chilli, the most
important point is the preparation
of the nursery. In monsoon season,
the beds should be prepared 20 cms
above the ground so that the plants

could be saved from excessive water and moisture. Put 200 liters of Sanjeevak fertilizer of biogas slurry one week before sowing. For one acre of land,
100 square meters of area and 450 grams of chilli seeds are sufficient for
sowing chilli seeds. But before sowing the seeds in the nursery, its purification is necessary. Now for the purification, take 2 liters bitter butter-milk
and mix 10 grams of asafetida in 5 liters of water to prepare a solution. Dip
chilli seeds in the solution for 30 minutes and then take it out and dry in
shadow. Following this process, sow the seeds.
During sowing, make lines at the distance of 5-6 cms. After sowing, cover
the lines with thin layer of rotten cow manure and put light layer of straw.
When the plats germinate, remove straw layer.

Transplantation of plants
The plants of chilli prepare
in 25-28 days in summer and
50-55 days in winter. The plants
should be sown at distance of
45x30 cms.

Prominent species
of chilli
1.
2.
3.
4.
5.
6.
7.
8.

LG 1 (Pusa Sadabahar)
Bhagya Laxmi
Jawahar chilli 128
X-235
K-5452
Pusa Jwala
Pant-C 1
Punjab Gucchedar

63 SeptemberU 2015

Patanjali toxin-free farming 17

Nutrition and management

The nutritious elements should essentially remain available in the chilli
crop.
For the purpose, after 20 days of transplantation, use 1000 liters of Sanjeevak fertilizer or bio-gas slurry or 20 kgs of Patanjali granule fertilizer per acre.
Second time, when buds start coming out, again use 1500 liter Sanjeevak
fertilizer of bio-gas slurry during irrigation.
Third time, when the chilli is plucked of, put 1000 liters of Sajeevak or
Patanjali NPK 5 Kg, at the rate of per acre, which increases the produce and
also life-cycle of the plant is extended.

Diseases and pest control

Prips: These pests suck the juice of the tender leaves so that its growth
stops and the quantity of the produce is also decreased.
Treatment: For the safety of the crops take 10 liters of sour `lassi` and add
1 kgs of old jiggery. Mix it in 20 liters of water. Repeat the process after 3 days
and the crop will be free from the pests.
Chempa: The moths suck tender parts of the plants including leaves, making plants too weak. They also spread virus on the plants and hence, they
should be destroyed for the better production.
Treatment: To counter this problem, Abhimanyu of Patanjali Bio-Research Institute is much effective. Add 60 ml of Patanjali Abhimanyu in 40
liters of water, which is sufficient to sprinkle on one acre of the area.
White flies: The insects are much dangerous for the crops. Their attack
reduces the production drastically. The size of the pod also decreases.
Treatment: For the prevention, Patanjali Nimbadi insecticide should be
used. Add 5 liters of Nimbadi in 30 liters of water and sprinkle on the crop,
which saves the produce from white flies.
Fusarium wilt: It is a common vascular wilt fungal disease, exhibiting
symptoms similar to Verticillium wilt. The pathogen that causes Fusarium
wilt is Fusarium oxysporum (F. oxysporum). The species is further divided
into forma specialis based on host plant. The leaves turn yellow and take curvature shape.
Treatment: For the prevention of this disease add sour `lassi` in Patanjali
Abhimanyu and sprinkle on the crop every week for three or four weeks. For
one acre of the area add 5 litres of sour `lassi` in 100 ml of Abhimanyu in 30
litres of water.
Fruit rottenness: This disease excessively damages the crop. This disease is
caused by Colletorichum Capsici.
Treatment: To keep the crop free from the disease keep sour `lassi` in cop64 SeptemberU 2015

per vessel for 40 days. Then add 2

liters of sour buttermilk in 20 grams
of asafetida in 20 liters of water.
Sprinkle it on every week, which
saves the crop.
Plucking of chilli : The plucking
of the fruits depends on its ripening
condition, quality and the purpose
of production. When the fruit attains its natural development, then
only it should be plucked. For drying, the produce should be plucked,
when it turns red chilli. For vegetable the crop gets readied in 2.5
months.
Produce: If the above said suggestions are followed properly, per
acre produce of 40-50 quintals
could be taken.

&KLNLWVDOD\DDQG$URJ\D.HQGUD
0DKDUVKL &KDUDN 6XVKUXW 'KDQYDQWDUL DQG 3DWDQMDOL HWF PDQ\
ODLGWKHIRXQGDWLRQRI0HGLFDO6FLHQFHWKRXVDQGVODNKVRI
EDFN )ROORZLQJ WKH VDPH WUDGLWLRQ $\XUYHGD 6KLURPDL
$FKDU\D%DONULVKQD-LLVGRLQJGHHSUHVHDUFKRQRYHU
6KUHGK\H\$FKDU\D%DONULVKQD-LLVGRLQJGHHSUHVHDUFKRQRYHU
KHUEDOV DQG PHGLFLQDO SODQWV <RJDULVKL 6ZDPL 5DPGHYML
DQG6KUHGK\H\$FKDU\D%DONULVKQD-LKDYHVDYHGQRWRQO\
0DKDUDMDQG6KUHGK\H\$FKDU\D%DONULVKQD-LKDYHVDYHGQRWRQO\
EXWPLOOLRQVRIOLIHWKURXJK<RJDDQG$\XUYHGD
:HVKRXOGQRWIDOOLOODWWKHUVWSODFHDQGHYHQLIZHIDOOLOOZKDWPHGLFLQHVZHVKRXOGWDNH:HKDYH
VXUHVKRWVFLHQWLFDOWHUQDWLYHRIGLVHDVHVWREHFXUHGSHUPDQHQWO\WKURXJK<RJDDQG$\XUYHGD7KH
WUHDWPHQWRI$\XUYHGDLVEHQHFLDOLQ2EHVLW\'LDEHWHV+LJK%ORRGSUHVVXUH+HDUWDLOPHQWV6NLQ
WURXEOHV$VWKDPDZDLVWDQGMRLQWSDLQVOLYHUDQGNLGQH\UHODWHGGLVHDVHVDXWRLPPXQHGLVHDVHVDQG
HYHQ&DQFHU
0DQ\3DWDQMDOLKRVSLWDOVDQG&XUHFHQWUHVDUHEHLQJUXQZKHUHDOOSRZGHUVC9DWLCC$YDOHKCRLO
C3DNCDVKHVC*XJJDOCC$ULVKWDCDQGRWKHUVDQGSDWHQWPHGLFLQHVOLNHC0XNWDYDWLCC0DGKXQDVKLQLC
DQGC+LUG\DPULWCZKLFKKDYHEHHQSUHSDUHGDIWHUDJJUHVVLYHDQGORQJUHVHDUFKDUHDYDLODEOH
7DNHIUHHPHGLFDODGYLFHIURPWKH3DWDQMDOL<RJSHHWK+DULGZDURUWKHKRVSLWDOORFDWHGLQ\RXUGLVWULFW

,QFOXGH<RJDDQG$\XUYHGDLQ\RXUOLIHVW\OH
$QGHQMR\GLVHDVHWHQVLRQIUHHKHDOWK\SHDFHIXODQGKDSS\OLIH

2XUSOHGJH:RUOG&ODVV4XDOLW\/RZ&RVWDQG&KDULW\IURP3URWV
6XFK3ODWRQLFZRUNZLWKJUHDWGLYLQLW\FDQEHGRQHRQO\DQGRQO\E\DWUXH
<RJL

6DQ\DVL


2015 65

Poem
3
Become a member of

Yog Sandesh a monthly magazine

published by Divya Yog Mandir (Trust)
2IFH3DWDQMDOL<RJSHHWK0DKDUVKL'D\DQDQG*UDP'HOKL
Haridwar national highway, near Bahadarabad, Haridwar
3KRQH
)D[
HPDLOGLY\D\RJD#UHGLIIPDLOFRP

Yog Sandesh monthly magazine is available in following

12 Languages
+LQGL(QJOLVK*XMDUDWL0DUDWKL%DQJOD3XQMDEL2UL\D
$VVDPHVH7HOXJX.DQQDGD1HSDOL7DPLO

AROGYA GURU MY SALUTE TO YOU

The knowledgeable philosopher, a serious personality,
You are as simple as a child but at the same time a great person,
Accept my obeisance.
You are scientist, seer and a visionary,
A down-right person, which is your prestige,
You make possible to impossible,
Your personality is like a magnet, which attracts everybody,
For you, none is alien and all are yours
You inspire everyone for the collective efforts,
You have miraculous capacity, which makes you victorious.
You are the knowledgeable person of herbs and shrub,
You have in-depth knowledge of religious tracts.
You are such a creative personality
You have immense love for Ayurveda.
You believe in `Vasudhev Kutumbakam`
And you do, what you preach,
You have towering personality,
You are teacher, preacher and a king,
You are working for the welfare of others, a social worker,
You are the protagonist of Ayurveda, Yoga and Veda,
You are a thinker, philosopher,
A great teacher, who always do research on herbals,
You will be the ideal personality for decades to come,
And you will remain victorious in the task you have taken in
hands,
You always preach truth,
Accept my obeisance, oh great guru.
- Ved Bhushan Tripathi.
66 SeptemberU 2015

Sir,
I hereby pay Rs. ................ as the annual /
YH \HDUV (OHYHQ <HDUV VXEVFULSWLRQ IHH IRU
Yog

Sandesh

.......................

by
dated

cash/M.D./D.D./Payslip
....................

Therefore

please send me Yog Sandesh in ..........................

language

every

month

at

the

address

given

below.
Name .............................................................
Father/Husband name .......................................
Address ...........................................................
........................................................................
........................................................................
........................................................................
3RVW2IFH
District ....................... State .............................
Pin Code...................... Phone ..........................
email ...............................................................

(Special rules)
1. Subscriprion fee-1 year-150/- 5 years-700/- 11 years1500/2. D.D. should be in favour of Yog Sandesh payable in
Haridwar.
3. The D.D. payable on other places than Haridwar send
Rs. 70 extra.
3OHDVHOO\RXUQDPHDQGDGGUHVVLQQHDW FOHDQKDQGwriting
5. The subscription in abroad initially for one year. The
subscription fee for such members Rs. 800/- or USD
20/- or GBP 10/6. Subscription fee may be deposited in the A/c no.
30721914467 (SBI Patanjali Yogpeeth, Shantarshah,
Bahadarabad, Haridwar).
 0HPEHUVKLSIRUPPXVWEHOOLQ+LQGLRU(QJOLVKRQO\

&RZ
V3XUH*KHH
:H KDYH HVWDEOLVKHG D PDVVLYH ELJ DQG RUJDQL]HG FKDLQ IURP 0DKDUDVKWUD WR
.DUQDWDNDLQHQWLUH6RXWK,QGLDSUHFLRXVO\IRUWKHFROOHFWLRQRIPLONIURPZKHUHWKHFRZ
V
PLON LV FRQYHUWHG LQ EXWWHU ZLWK FHQW SHUFHQW JXDUDQWHHG SXULW\ DQG FHUWLFDWLRQ DQG
WUDQVSRUWHG WR +DULGZDU +HUH SXUH CGHVLC JKHHFODULHG EXWWHU LV SUHSDUHG ZKLFK
UHDFKHVWR\RX
(DWSXUHCGHVLJKHHCRIFRZDQGVDYH\RXULQQRFHQWFKLOGUHQDQGIDPLO\IURPDGXOWHUDWLRQ

PO

PO

OW

OW

OW

C6KDVWDP'KLVPULWLPDLQGKJQLEDODX6KXNUDFKDNVKXQDP
%DOYULGKDSUDMDNDQWLVDXNXPDU\DVWKLUDUWKLQDPD'KDQYDQWDUL1LJKDXQWX,,,,
&RZ
VPLONLPSURYHV,QWHOOHFWPHPRU\YLJRUHQKDQFHVSRZHUDJHDQG\RXWKIXOQHVVLPSURYHVH\HYLVLRQEHQHFLDO
IRUFKLOGUHQDQGROGHUDOLNHKHOSVLQIHUWLOLW\LPSURYHVIDFLDOJORZDQGVDYHVWKHERG\IURPWKHROGDJHHIIHFWV
6FLHQWLFIDFW 7KHFRZ
VPLONKDV  JJ.HURWLQHHOHPHQWZKLFKLVQRWDYDLODEOHLQEXIIDORHV

CJKHHC7KLVHOHPHQWKDVPDJLFDOWHQGHQF\WRNHHSH\HVKHDOWK\,QWHUQDWLRQDO-RXUQDORI'DLU\7HFKQRORJ\SDJH
CJKHHC7KLVHOHPHQWKDVPDJLFDOWHQGHQF\WRNHHSH\HVKHDOWK\,QWHUQDWLRQDO-RXUQDORI'DLU\7HFKQRORJ\SDJH


2XUSOHGJH:RUOG&ODVV4XDOLW\/RZ&RVWDQG&KDULW\IURP3URWV

6XFK3ODWRQLFZRUNZLWKJUHDWGLYLQLW\FDQEHGRQHRQO\DQGRQO\E\DWUXH
<RJL

6DQ\DVL


2015 67

YOG SANDESH ()

RNI No. DELENG/2006/16626

3DWDQMDOL
$QLPDOIHHG%LRIRRG
DQGDQLPDOSURWHFWRU
)RU WKH SHUIHFW KHDOWK DQG PD[LPXP PLON SURGXFWLRQ IURP WKH PLOFK DQLPDOV XVH C3DWDQMDOL
'XJGKDPULWCDEDODQFHGDQLPDOGLHWJHWRQHFDOIHYHU\\HDUDQGIRUGD\VHQMR\VWUHDPRIPLON
C3DWDQMDOL'XJGKDPULWCULFKLQE\SDVVSURWHLQSURELRWLFYLWDPLQPLQHUDOVDQGKHUEDOVZLWKRXW
XUHD$SURSHUDQLPDOIHHGZKLFKJLYHVKHDOWKWRWKHFDWWOHDQGSURVSHULW\WRWKHIDUPHU
$IWHUGHOLYHU\IRUWKHSURWHFWLRQDQGFXOWXUHRIXWHUXVRIWKHDQLPDO C3DWDQMDOL*DUEKDQMDOLC )RU
PXOFKLQJDQLPDOSUHJQDQWDQGIRUWKHJURZLQJFDWWOHC3DWDQMDOL6DPYULGKLCDQGC3DWDQMDOL6DPYULGKL
%ROXVC7RLPSURYHDQGVWUHQJWKHQGLJHVWLYHV\VWHP C3DWDQMDOL%DWWLVD3URC )RULPSURYHPHQWLQ
XGGHUDQGPLONFHOOV
3DWDQMDOL0XOWLYLWDPLQV
ZKLFKDOVREHWWHUVLPPXQHV\VWHPRIWKHFDWWOH)RU
KXQJHU GLJHVWLYH SRZHU DQG FRPSOHWH OLYHU DFWLYDWLRQ
3DWDQMDOL <DNULWDPULW
 )RU EHWWHU PLON
SURGXFWLRQFXUELQJRINHWRVLVDQGDFWLYDWLRQRIWKHFDWWOHC3DWDQMDOL6KDNWLGKDUDC
7KURXJK3%5,XVHIRUWR[LQIUHHDJULFXOWXUHC3DWDQMDOL*UDQXODUIHUWLOL]HUCC3DWDQMDOL%LRIHUWLOL]HUC
DQG C3DWDQMDOL6XUDNVKDCDQG C3DWDQMDOL1HHPCZKLFKUHVWULFWVXVHRIWR[LQFKHPLFDOFRQWDLQLQJ
IHUWLOL]HUVLQVHFWLFLGHVDQGVDYHSHRSOHIURPEHFRPLQJFDQFHURXV

)RUWKHVDOHRI3DWDQMDOL$QLPDOIHHG)HHGVXSSOHPHQW%LRIHUWLOL]HUDQGDQLPDOSURWHFWRUC.LVDQ6HZD.HQGUDC
KDYHEHHQHVWDEOLVKHGDFURVVWKHFRXQWU\)RURSHQLQJQHZFHQWHUVDWYDFDQWSODFHV3HDVHFRQWDFW
3KRQH1XPEHUV
(PDLOLQIR#SDWDQMDOLJUDPRGK\RJQ\DVFRP:HEVLWHZZZSDWDQMDOLJUDPRGK\RJQ\DVFRP

68 U 2015