You are on page 1of 138

Notices

4102 -- 4226/23

ADMIRALTY
NOTICES TO MARINERS
Weekly Edition 46
16 November 2023
(Published on the ADMIRALTY website 06 November 2023)

CONTENTS

I Explanatory Notes. Publications List


II ADMIRALTY Notices to Mariners. Updates to Standard Nautical Charts
III Reprints of NAVAREA I Navigational Warnings
IV Updates to ADMIRALTY Sailing Directions
V Updates to ADMIRALTY List of Lights and Fog Signals
VI Updates to ADMIRALTY List of Radio Signals
VII Updates to Miscellaneous ADMIRALTY Nautical Publications
VIII Updates to ADMIRALTY Digital Services

For information on how to update your ADMIRALTY products using ADMIRALTY Notices to
Mariners, please refer to NP294 How to Keep Your ADMIRALTY Products Up--to--Date.
Mariners are requested to inform the UKHO immediately of the discovery of new or suspected
dangers to navigation, observed changes to navigational aids and of shortcomings in both paper
and digital ADMIRALTY Charts or Publications.
The H--Note App helps you to send H--Notes to the UKHO, using your device’s camera, GPS and
email. It is available for free download on Google Play and on the App Store.
The Hydrographic Note Form (H102) should be used to forward this information and to report any
ENC display issues.
H102A should be used for reporting changes to Port Information.
H102B should be used for reporting GPS/Chart Datum observations.
Copies of these forms can be found at the back of this bulletin and on the UKHO website.
The following communication facilities are available:
NMs on ADMIRALTY website: Web: admiralty.co.uk/msi
Searchable Notices to Mariners: Web: www.ukho.gov.uk/nmwebsearch
Urgent navigational information: e--mail: navwarnings@ukho.gov.uk
Phone: +44(0)1823 353448
+44(0)7989 398345
Fax: +44(0)1823 322352
H102 forms e--mail: sdr@ukho.gov.uk
(see back pages of this Weekly Edition) Post: UKHO, Admiralty Way, Taunton,
Somerset, TA1 2DN, UK
All other enquiries/information e--mail: customerservices@ukho.gov.uk
Phone: +44(0)1823 484444 (24/7)
 Crown Copyright 2023. All rights Reserved. Permission is not required to make analogue or PDF copies
of these Notices, but such copies may not be sold without the permission of the UKHO. For permission to
sell copies of the Notices or to make (non -- PDF) digital copies please email
intellectual.property@ukho.gov.uk
I

GUIDANCE NOTES FOR THE USE OF ADMIRALTY NOTICES TO MARINERS


ON THE UKHO WEBSITE

The Weekly Notices to Mariners (NM) updates for paper Charts and Publications can be accessed via
admiralty.co.uk/msi or the searchable NM Website www.ukho.gov.uk/nmwebsearch The latest
digital NM Weekly update is available 10 days prior to the paper publication date; there are no
subscription fees for access to the UKHO Notices to Mariners Website.

NB: The NM database includes historical NM data from 1 January 2000, for NMs prior to 2000 the
Cumulative List of Notices to Mariners (NP234B-00) must be used.

Software required:

Adobe Acrobat Reader (Version 6.0 or later). Reader software can be obtained direct from the Adobe
website (www.adobe.com).

SEARCHABLE NOTICES TO MARINERS

Enter the www.ukho.gov.uk/nmwebsearch website and select the search option that you require
following the on screen instructions:

ƒ Search NMs by - Chart Number only


ƒ Search NMs by - Chart Number + Previous NM Number/Year
ƒ Search NMs by - Chart Number + Between Previous and Present Dates
ƒ Search for Single NM by NM Number/Year

To view the NM, NM Note or full-colour NM Blocks, click on the relevant link.

NOTICES TO MARINERS ON-LINE

Enter the admiralty.co.uk/msi website, and then select Notices to Mariners. This will give you access
to the following range of Notice to Mariners services:
- ADMIRALTY NM Web Search
- Weekly NMs
- NM Block, Notes and Diagrams
- Annual NMs
- Cumulative NM List

FURTHER GUIDANCE NOTES

For further details of the online NM facilities please see the NM Guidance Notes on the website,
additional detail includes:
ƒ File content and description
ƒ PC and printer specifications

CUSTOMER SERVICE

If you experience any difficulties, please contact the UKHO Customer Services Team in the UK on:

Tel: +44 (0) 1823 484444 (office hours Monday-Friday 6am-10pm GMT and an on call service for
emergency permits operated 24/7)
Email: customerservices@ukho.gov.uk

Our Singapore team can also be contacted outside of UK hours on:


Tel: +65 6424 4200

Wk46/23 1.2
,

ADMIRALTY NOTICES TO MARINERS


7KLV $'0,5$/7< 1RWLFHV WR 0DULQHUV %XOOHWLQ $10%  LV SXEOLVKHG E\ WKH 8.
+\GURJUDSKLF2IILFH 8.+2 7KH8.0DULWLPHDQG&RDVWJXDUG$JHQF\DFFHSWVWKDWERWK
WKH SDSHU DQG GLJLWDO IRUPV RI WKH $10% FRPSO\ ZLWK FDUULDJH UHTXLUHPHQW IRU 1RWLFHV WR
0DULQHUV ZLWKLQ 5HJXODWLRQ  RI WKH UHYLVHG &KDSWHU 9 RI WKH 6DIHW\ RI /LIH DW 6HD
&RQYHQWLRQ DQG WKH 0HUFKDQW 6KLSSLQJ 6DIHW\ RI 1DYLJDWLRQ  5HJXODWLRQV ERWK RI ZKLFK
FDPHLQWRIRUFH-XO\

:KLOHHYHU\HIIRUWLVPDGHWRHQVXUHWKDWWKHGDWDSURYLGHGWKURXJKWKH1RWLFHVWR0DULQHUV
VHUYLFHLVDFFXUDWHWKHXVHUQHHGVWREHDZDUHRIWKHULVNVRIFRUUXSWLRQWRGDWD,WLVLPSRUWDQW
WKDWWKHXVHUVKRXOGRQO\XVHWKHGDWDRQVXLWDEOHHTXLSPHQWDQGWKDWRWKHUDSSOLFDWLRQVVKRXOG
QRW EH UXQQLQJ RQ WKH XVHU¶V PDFKLQH DW WKH VDPH WLPH 8VHUV VKRXOG H[HUFLVH WKHLU
SURIHVVLRQDOMXGJHPHQWLQWKHXVHRIGDWDDQGDOVRFRQVXOWWKH0DULQHUV¶+DQGERRN 13 
IRUIXUWKHUGHWDLOV

7KH XVHU QHHGV WR EH DZDUH WKDW WKHUH LV D SRVVLELOLW\ WKDW GDWD FRXOG EH FRUUXSWHG GXULQJ
WUDQVPLVVLRQRULQWKHSURFHVVRIGLVSOD\RUSULQWLQJRQWKHXVHU¶VHTXLSPHQWRULIFRQYHUWHG
WR RWKHU VRIWZDUH IRUPDWV DQG LV DFFRUGLQJO\ DGYLVHG WKDW WKH 8.+2 FDQQRW DFFHSW
UHVSRQVLELOLW\ IRU DQ\ VXFK FKDQJH RU DQ\ PRGLILFDWLRQV RU XQDXWKRULVHG FKDQJHV PDGH E\
OLFHQVHHVRURWKHUSDUWLHV

Planning for the future


Plan with ADMIRALTY Maritime Data Solutions, brought to you by the United Kingdom Hydrographic Office.

Admiralty Way, Taunton, Somerset


TA1 2DN, United Kingdom
Telephone +44 (0)1823 484444
customerservices@ukho.gov.uk
gov.uk/ukho

Find out more about our market-leading


ADMIRALTY Maritime Data Solutions:
admiralty.co.uk

and are trademarks of the Secretary of State for Defence

© Crown Copyright 2020. All rights reserved. Correct at the time of publishing.

 Wk46/23
I

EXPLANATORY NOTES
Dating
Weekly Notices are dated for the Thursday appropriate to the week that the printed version is despatched from the UKHO.
They are available earlier from the UKHO website.
Section I - Publications List
At the beginning of the Publications List is an index of ADMIRALTY Charts affected by the Publications List. Thereafter
there are a number of standard lists which contain details and announcements concerning charts and publications relevant for
the particular Weekly Notice. Full details of how to use the various lists contained in Section I are available in NP294.
Special Announcements and Errata are occasionally included at the end of this Section.
Section IA - Temporary and Preliminary (T&P) Notices
A list of T&P Notices in force (along with a list of those cancelled during the previous month), is included in the Weekly NM
each month (see below).
Section IB - Current Nautical Publications
Information about Publications including the current edition numbers is included in the Weekly NM at the end of March,
June, September and December.
Section II - Updates to Standard Nautical Charts
The notices in Section II give instructions for the updating of standard nautical charts and selected thematic charts in the
ADMIRALTY series. Geographical positions refer to the horizontal datum of the current edition of each affected chart
which is stated in the notice alongside the appropriate chart number. Positions are normally given in degrees, minutes and
decimals of a minute, but may occasionally quote seconds for convenience when plotting from the graduation of some older-
style charts. Where Leisure Products are referred to different horizontal datums from the standard nautical charts for that
geographical area, positions in the notices cannot be plotted directly on these products. Bearings are true reckoned clockwise
from 000° to 359°; those relating to lights are from seaward. Symbols referred to are those shown in NP5011. Depths and
heights are given in metres or fathoms and/or feet as appropriate for the chart being updated (abbreviated where necessary to
m, fm and ft respectively). Blocks and notes accompanying notices in Section II are placed towards the end of the section.
T&P Notices. These are indicated by (T) or (P) after the notice number and are placed at the end of Section II. They are
printed on one side of the paper in order that they may be cut up and filed. To assist in filing, the year is indicated after the
notice number and an in-force list is published monthly. Information from these notices is not included on charts before
issue; charts should be updated in pencil on receipt. Associated diagrams are reproduced with Blocks at the end of Section II.
Original Information. A star (*) adjacent to the number of a notice indicates that the notice is based on original
information.
Section III - Navigational Warnings
NAVAREA I Navigational Warnings in force at the specified time quoted in the header are reprinted in Section III. It is
recommended that this reprint should be kept in a file or book, followed by subsequent weekly reprints. Only the most
convenient ADMIRALTY Chart is quoted. The full text of all Warnings in force is included in Weeks 1, 13, 26 and 39 each
year.
Section IV - Sailing Directions
Updates to all Sailing Directions are given in Section IV of ADMIRALTY Notices to Mariners. Those in force at the end of
the year are reprinted in NP247(2) Annual Summary of ADMIRALTY Notices to Mariners Part 2. A list of updates in force is
published in Section IV of the Weekly Edition quarterly. Full details of how to keep Sailing Directions up-to-date can be
found in NP294 How to Keep Your ADMIRALTY Products Up-to-Date.
In 2018, the UKHO began the process of removing AIS and Racon information from ADMIRALTY Sailing Directions, as
this is held in greater detail within ADMIRALTY Radio Signals publications. During this transition, AIS and Racon
information will be removed from new editions of each Sailing Direction volume, and AIS and Racon information present in
existing Sailing Direction volumes will no longer be updated. For accurate, up-to-date information on AIS and Racons, refer
to ADMIRALTY Radio Signals publications.
Section V - Lights
Updates to all the List of Lights are given in Section V and may be published in an earlier edition than the chart-updating
notice. The entire entry for each light updated will be printed (including minor changes) and an asterisk (*) will denote which
column contains a change. In the case of a new light, or where a new sequence is added below the main light, an asterisk (*)
will appear under all columns. All Section V entries are intended to be cut out and pasted into the appropriate volume. It is
emphasised that the List of Lights is the primary source of information on lights and that many alterations, especially those of
a temporary but operational nature, are promulgated only as updates to the List of Lights. Light positions should be
regarded as approximate and are intended to indicate the relative positions of lights only. Charts should be consulted for a
more authoritative position. When a light is affected by a separate chart-updating notice, its Light List number is always
included in the relevant text contained in Section II. The range of a light is normally the nominal range, except when the
responsible authority quotes luminous or geographical range - see special remarks for ranges used by each country.

Wk46/23 1.4
,

6HFWLRQ9,5DGLR6LJQDOV
8SGDWHVWRDOOWKH5DGLR6LJQDOVDUHJLYHQLQ6HFWLRQ9,:KHQDFKDUWXSGDWLQJQRWLFHLVLVVXHGIRULQIRUPDWLRQWKDWLVDOVR
LQFOXGHG ZLWKLQ WKH 5DGLR 6LJQDOV WKH DSSURSULDWH YROXPH UHIHUHQFH QXPEHU LV TXRWHG IROORZHG LQ SDUHQWKHVHV E\ WKH
QXPEHURIWKH:HHNO\(GLWLRQFRQWDLQLQJ LQ6HFWLRQ9, WKHFRUUHVSRQGLQJXSGDWHWRWKHVHUYLFHGHWDLOV7KHXSGDWHVLQ
6HFWLRQ9,VKRXOGEHFXWRXWDQGSDVWHGLQWRWKHDSSURSULDWHYROXPHV
6HFWLRQ9,,0LVFHOODQHRXV3XEOLFDWLRQV
8SGDWHVWRWKHIROORZLQJVHOHFWHGPLVFHOODQHRXV1DXWLFDO3XEOLFDWLRQVDUHFRQWDLQHGLQ6HFWLRQ9,,
13 7KH0DULQHU¶V+DQGERRN
13$ 3DSHU&KDUW0DLQWHQDQFH5HFRUG
13& (1&0DLQWHQDQFH5HFRUG
13 $'0,5$/7<*XLGHWRWKH3UDFWLFDO8VHRI(1&V
13 $'0,5$/7<*XLGHWR,PSOHPHQWDWLRQ3ROLF\DQG3URFHGXUHV
13 +RZWR.HHS\RXU$'0,5$/7<3URGXFWV8SWRGDWH
13   $'0,5$/7<2FHDQ3DVVDJHVIRUWKH:RUOG±$WODQWLF2FHDQ
13   $'0,5$/7<2FHDQ3DVVDJHVIRUWKH:RUOG±,QGLDQDQG3DFLILF2FHDQV
13   $'0,5$/7<'LVWDQFH7DEOHV±$WODQWLF2FHDQ
13   $'0,5$/7<'LVWDQFH7DEOHV±3DFLILF2FHDQ
13   $'0,5$/7<'LVWDQFH7DEOHV±,QGLDQ2FHDQ
13 ,$/$0DULWLPH%XR\DJH6\VWHP
13 6\PEROVDQG$EEUHYLDWLRQVXVHGRQ$'0,5$/7<3DSHU&KDUWV
13 $'0,5$/7<*XLGHWR(1&6\PEROVXVHGLQ(&',6
$OO7LGHV3XEOLFDWLRQV
1DXWLFDO$OPDQDF3XEOLFDWLRQVLQFOXGLQJ6LJKW5HGXFWLRQ7DEOHV
6HFWLRQ9,,,±$'0,5$/7<'LJLWDO6HUYLFHV
,QIRUPDWLRQUHOHYDQWWR$'0,5$/7<'LJLWDO6HUYLFHV
)XUWKHU*XLGDQFH
7KH0DULQHU¶V+DQGERRN 13 JLYHVDIXOOHUH[SODQDWLRQRIWKHOLPLWDWLRQVRIFKDUWVDQGGHWDLOVRIWKH8.+2SROLF\IRU
WKHSURPXOJDWLRQDQGVHOHFWLRQRIQDYLJDWLRQDOO\VLJQLILFDQWLQIRUPDWLRQIRUFKDUWV'HWDLOVRIFKDUWXSGDWLQJPHWKRGVFDQEH
IRXQG LQ ³+RZ WR .HHS <RXU $'0,5$/7< 3URGXFWV 8SWRGDWH´ 13  $OO XVHUV DUH DGYLVHG WR VWXG\ WKHVH
SXEOLFDWLRQV
&$87,21$5<127(6
8SGDWLQJ
8SGDWLQJ LQIRUPDWLRQ LV SXEOLVKHG E\ :HHNO\ 1RWLFHV WR 0DULQHUV VXSSOHPHQWHG E\ QDYLJDWLRQDO ZDUQLQJV IRU LWHPV RI
LPPHGLDWHLPSRUWDQFH,WVKRXOGEHERUQHLQPLQGWKDWWKH\PD\EHEDVHGRQUHSRUWVZKLFKFDQQRWDOZD\VEHYHULILHGEHIRUH
SURPXOJDWLRQDQGWKDWLWLVVRPHWLPHVQHFHVVDU\WREHVHOHFWLYHDQGSURPXOJDWHRQO\WKHPRUHLPSRUWDQWLWHPVWRDYRLG
RYHUORDGLQJXVHUVWKHUHPDLQGHUEHLQJLQFOXGHGLQUHYLVHGHGLWLRQVRIWKHFKDUWVDQGSXEOLFDWLRQVFRQFHUQHG
/DZVDQG5HJXODWLRQV
:KLOHLQWKHLQWHUHVWVRIWKHVDIHW\RIVKLSSLQJWKH8.+2PDNHVHYHU\HQGHDYRXUWRLQFOXGHLQLWVSXEOLFDWLRQVGHWDLOVRIWKH
ODZVDQGUHJXODWLRQVRIDOOFRXQWULHVDSSHUWDLQLQJWRQDYLJDWLRQLWPXVWEHFOHDUO\XQGHUVWRRG
a WKDWQROLDELOLW\ZKDWVRHYHUFDQEHDFFHSWHGIRUIDLOXUHWRSXEOLVKGHWDLOVRIDQ\SDUWLFXODUODZRUUHJXODWLRQDQG
b WKDWSXEOLFDWLRQRIWKHGHWDLOVRIDODZRUUHJXODWLRQLVVROHO\IRUWKHVDIHW\DQGFRQYHQLHQFHRIVKLSSLQJDQGLPSOLHVQR
UHFRJQLWLRQRIWKHLQWHUQDWLRQDOYDOLGLW\RIWKHODZRUUHJXODWLRQ
5HOLDQFHRQ&KDUWVDQG$VVRFLDWHG3XEOLFDWLRQV
:KLOH HYHU\ HIIRUW LV PDGH WR HQVXUH WKH DFFXUDF\ RI WKH LQIRUPDWLRQ RQ $'0,5$/7< FKDUWV DQG ZLWKLQ QDXWLFDO
SXEOLFDWLRQVLWVKRXOGEHDSSUHFLDWHGWKDWLWPD\QRWDOZD\VEHFRPSOHWHDQGXSWRGDWH7KHPDULQHUPXVWEHWKHILQDOMXGJH
RIWKHUHOLDQFHKHFDQSODFHRQWKHLQIRUPDWLRQJLYHQEHDULQJLQPLQGKLVSDUWLFXODUFLUFXPVWDQFHVORFDOSLORWDJHJXLGDQFH
DQGWKHMXGLFLRXVXVHRIDYDLODEOHDLGVWRQDYLJDWLRQ
&KDUWV
&KDUWVVKRXOGEHXVHGZLWKSUXGHQFH WKHUHDUHDUHDVZKHUH WKHVRXUFHGDWDDUHROG LQFRPSOHWHRURISRRUTXDOLW\7KH
PDULQHUVKRXOGXVHWKHODUJHVWVFDOHDSSURSULDWHIRUKLVSDUWLFXODUSXUSRVHDSDUWIURPEHLQJWKHPRVWGHWDLOHGWKHODUJHU
VFDOHVDUHXVXDOO\XSGDWHGILUVW:KHQH[WHQVLYHQHZLQIRUPDWLRQ VXFKDVDQHZK\GURJUDSKLFVXUYH\ LVUHFHLYHGVRPH
PRQWKV PD\ HODSVH EHIRUH LW FDQ EH IXOO\ LQFRUSRUDWHG LQ SXEOLVKHG FKDUWV 2Q VPDOO VFDOH FKDUWV RI RFHDQ DUHDV ZKHUH
K\GURJUDSKLFLQIRUPDWLRQLVLQPDQ\FDVHVVWLOOVSDUVHFKDUWHGVKRDOVPD\EHLQHUURUDVUHJDUGVSRVLWLRQOHDVWGHSWKDQG
H[WHQW8QGLVFRYHUHGGDQJHUVPD\H[LVWSDUWLFXODUO\DZD\IURPZHOOHVWDEOLVKHGURXWHV
6DWHOOLWH'HULYHG3RVLWLRQVDQG&KDUW$FFXUDF\
0DULQHUVPXVWQRWDVVXPHWKDWFKDUWVZKLFKDUHUHIHUUHGWR:*6'DWXPRUWKRVHIRUZKLFKVKLIWVWR:*6'DWXPDUH
SURYLGHGKDYHEHHQVXUYH\HGWRPRGHUQVWDQGDUGVRIDFFXUDF\2QVRPHFKDUWVRZLQJWRWKHDJHDQGTXDOLW\RIWKHVRXUFH
LQIRUPDWLRQVRPHRIWKHFKDUWHGGHWDLOPD\QRWEHSRVLWLRQHGDFFXUDWHO\,QVXFKFDVHVPDULQHUVDUHDGYLVHGWRH[HUFLVH
SDUWLFXODUFDXWLRQZKHQQDYLJDWLQJLQWKHYLFLQLW\RIGDQJHUVHYHQZKHQXVLQJDQHOHFWURQLFSRVLWLRQLQJV\VWHPVXFKDV*36
)RUIXUWKHUGHWDLOVVHH7KH0DULQHU¶V+DQGERRN 13 7KLVDSSOLHVWRERWKSDSHUDQGGLJLWDO $'0,5$/7<5DVWHU
&KDUW6HUYLFHDQG(1& YHUVLRQVRIFKDUWV

 Wk46/23
I
[46/23]
ADMIRALTY Charts affected by the Publication List

ADMIRALTY Charts ADMIRALTY Charts International Charts ADMIRALTY Publications

208 5128(1) INT 1466 NP 131


30 5128(2) INT 1663 NP 207
798 5128(3) INT 1707
1110 5128(4) INT 1722
1267 5128(5) INT 1857
1282 5128(6) INT 12992
1415 5128(7)
1447 5128(8)
1613 5128(9)
1900 5128(10)
2028 5128(11)
2029 5128(12)
2136 5602_9
2453 5602_10
2648 5602_18
3479 5606_4
3658 5606_5
4035 5606_6
4036
4037
4410

PAPER CHART SUNSET

The UKHO has announced its intention to withdraw from paper charts. This decision has been taken to
allow us to focus on our digital navigation products and services that meet the needs of today’s and
tomorrow’s seafarers.

We expect that we continue to provide paper charts until at least 2030. We will provide more
information in this bulletin when we begin the process.

For more information about our decision, timetable, and the impacts, please visit

https://www.admiralty.co.uk/sunsetting-paper-charts

UKRAINE NAVIGATIONAL INFORMATION

Owing to insufficient information, it is not always possible to ensure that ADMIRALTY Nautical
Publications are completely up-to-date for new dangers or changes to aids to navigation.

Mariners are therefore advised to exercise particular caution when navigating in Ukrainian waters.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk46/23 1.6
I

BALTIC SEA CHART DATUM 2000 (BSCD2000)

UKHO Products and Services, including foreign charts, in the Baltic Sea region are changing to a
new vertical reference system for depth and height information. During this transition period,
Charts may be referred to either mean sea level or the new BSCD2000. For further information
please contact the national charting authority and see ADMIRALTY Sailing Directions.
This note is to be reviewed in 2026.

PHOTOGRAPHY

ADMIRALTY publications utilise imagery from a wide variety of sources, mariners, port authorities and
other users. The UK Hydrographic Office (UKHO) welcomes new imagery of navigational aids, landmarks,
coastline, approaches to and from ports and berths. Imagery from the mariner's point of view is especially
helpful. Images can be sent to the UKHO using the email publications.queries@ukho.gov.uk.
Please include the name and location of the feature in the image and how the image should be accredited
within ADMIRALTY publications.

ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE

NEW ADMIRALTY CHARTS AND PUBLICATIONS

New ADMIRALTY Charts published 16 November 2023

Chart Title, limits and other remarks Scale Folio 2023 Catalogue page

3479 United Arab Emirates, Dibba Port. 1:12,000 40 62


25°34’·64 N — 25°38’·80 N., 56°16’·70 E— 56° 23’·73 E

A new chart providing improved coverage of Dibba port.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.7 Wk46/23
I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

New Editions of ADMIRALTY Charts published 16 November 2023

Chart Title, limits and other remarks Scale Folio 2023 Catalogue
page

30 International Chart Series, England - South Coast, Plymouth Sound and 1:12,500 1 22
INT 1722 Approaches.

Includes changes to depths from the latest British Government surveys.

Note: On publication of this New Edition former Notice 449(P)/23 is


cancelled. This chart is to be deleted from the list of charts affected by
Notice 436(P)/23.

798 Sweden - East Coast, Gotland - Northern Part. 1:120:000 10 36


A Fårösund. 1:50,000
B Slite Approaches. 1:50,000
C Kappelshamnsviken. 1:25,000
D Ports of Fårösund. 1:12,500
E Slite. 1:10,000
F Visby. 1:10,000

Includes changes to depths and dredged areas. (A modified reproduction of


Chart SE731 published by Sweden.)

Note: This chart remains affected by Notices 5123(T)/22, 1663(T)/23 and


3364(T)/23.

1267 England - South Coast, Falmouth to Plymouth. 1:75,000 1 22

Includes updates to hydrography from the latest British Government


Surveys.

Note: This chart remains affected by Notice 1804(T)/23 and 1953(T)/23.


This chart is to be deleted from the list of charts affected by Notice
436(P)/23.

1613 England - South Coast, Eddystone Rocks to Berry Head. 1:75,000 1 20, 22
Eddystone Rocks. 1:7,500

Includes changes to depths from the latest British Government surveys.

Note: This chart is to be deleted from the list of charts affected by Notice
436(P)/23.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk46/23 1.8
I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

New Editions of ADMIRALTY Charts published 16 November 2023 (continued)

Chart Title, limits and other remarks Scale Folio 2023


Catalogue
page

1900 England - South Coast, Whitsand Bay to Yealm Head including Plymouth 1:25,000 1 22
Sound.

Includes changes to depths from the latest British Government surveys.

Note: This chart is to be deleted from the list of charts affected by Notice
436(P)/23.

2453 International Chart Series, Baltic Sea – Poland, Świnoujście. 1:10,000 10 34


INT 12992 A Continuation of Świnoujście. 1:10,000

Includes significant safety-related information as follows: changes to depths,


fairways, wrecks and coastline.

Note: On publication of this New Edition former Notice 2756(P)/23 is


cancelled. This chart remains affected by Notice 2974(T)/23 and 3187(T)/23.

5128(1) Routeing Chart South Pacific Ocean. (January) 1:20,000,000 - 142

5128(2) Routeing Chart South Pacific Ocean. (February) 1:20,000,000 - 142

5128(3) Routeing Chart South Pacific Ocean. (March) 1:20,000,000 - 142

5128(4) Routeing Chart South Pacific Ocean. (April) 1:20,000,000 - 142

5128(5) Routeing Chart South Pacific Ocean. (May) 1:20,000,000 - 142

5128(6) Routeing Chart South Pacific Ocean. (June) 1:20,000,000 - 142

5128(7) Routeing Chart South Pacific Ocean. (July) 1:20,000,000 - 142

5128(8) Routeing Chart South Pacific Ocean. (August) 1:20,000,000 - 142

5128(9) Routeing Chart South Pacific Ocean. (September) 1:20,000,000 - 142

5128(10) Routeing Chart South Pacific Ocean. (October) 1:20,000,000 - 142

5128(11) Routeing Chart South Pacific Ocean. (November) 1:20,000,000 - 142

5128(12) Routeing Chart South Pacific Ocean. (December) 1:20,000,000 - 142

Includes general updating of all meteorological and oceanographic data


(excluding currents). Also includes changes to routes. (All twelve monthly
versions of the chart are being published simultaneously).

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.9 Wk46/23
I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

ADMIRALTY Publication

NP No. Title and other remarks Date Remarks

NP207 ADMIRALTY Tide Tables 16/11/2023 New Edition.


South West Atlantic Ocean and South America
Volume 7, 2024 Edition.

ISBN Number: 978-0-70-772-2627

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk46/23 1.10
I
ADMIRALTY CHARTS AND PUBLICATIONS TO BE PUBLISHED

ADMIRALTY CHARTS TO BE PUBLISHED 30 NOVEMBER 2023

New Editions of ADMIRALTY Charts


Charts to be 2023
Chart Title, limits and other remarks Scale WITHDRAWN Folio Catalogue
page

208 International Chart Series, Netherlands, Rotterdam Nieuwe Maas 1:20,000 208 9 24
INT 1466 and Oude Maas. INT 1466

Includes changes to depths, lights, coastline and restricted areas.


(Published jointly by the UKHO and by the Hydrographer of the
Royal Netherlands Navy).

1110 International chart series, Spain - North West Coast, La Coruña and 1:10,000 1110 18 40
INT 1857 Approaches. INT 1857

Includes significant safety related information as follows: changes to


depths, aids to navigation, leading lines and legends (A modified
reproduction of INT1857 published by Spain.)

1282 China - Bo Hai, Bayuquangangqu Gangchi. 1:16,000 1282 52 82

Includes significant safety-related information as follows: changes


to depths and coastline.

1415 International Chart Series, Ireland - East Coast, Dublin Bay. 1:25,000 1415 3 26
INT 1663 Howth. 1:7,500 INT 1663

Includes changes from the latest Irish Government, and Dublin Port
Company Surveys.

1447 Ireland - East Coast, Dublin and Dun Laoghaire. 1447 3 26


A Port of Dublin. 1:7,500
B Port of Dublin Entrance Channel. 1:7,500
C Dun Laoghaire Harbour. 1:7,500

Includes changes to depths from the latest Dublin Harbour


Company and Dun Laoghaire Harbour Company surveys.

2028 France - North Coast, Île de Bréhat to Plateau des Roches Douvres. 1:48,600 2028 16 20, 24

Includes significant safety related information as follows: changes to


depths, lights, windfarms and buoyage. (A modified reproduction of
Chart 7153 published by France.)

2029 France - North Coast, Île de Bréhat to Cap Fréhel. 1:48,000 2029 16 20, 24
Port Saint-Brieuc le Légué. 1:10,000

Includes significant safety-related information as follows: changes


to a wind farm, buoyage, and depths. (A modified reproduction of
Chart 7154 published by France.)

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.11 Wk46/23
I
ADMIRALTY CHARTS AND PUBLICATIONS TO BE PUBLISHED

ADMIRALTY CHARTS TO BE PUBLISHED 30 NOVEMBER 2023

New Editions of ADMIRALTY Charts (continued)


Charts to be 2023
Chart Title, limits and other remarks Scale WITHDRAWN Folio Catalogue
page

2136 France - North Coast, Pointe De La Percée To Ouistreham. 1:48,100 2136 16 24

Includes significant safety related information as follows: new


submarine cables, entry prohibited area, depths and aids to
navigation. (A modified reproduction of chart 7421 published by
France).

2648 International Chart Series, France - North Coast, Roches de Portsall 1:156,300 2648 16 20, 24
INT 1707 to Plateau des Roches Douvres.

Includes significant safety-related information as follows: changes


to a wind farm, navigational controlled channel, restricted areas
and obstructions. (A modified reproduction of INT1707 published by
France.)

3658 Taiwan - North Coast, Chiu-Kang P'o-Ti to Kuei-Shan Tao. 1:150,000 3658 50 80

Includes significant safety-related information as follows: new aids


to navigation and precautionary area and changes to Traffic
Separation Scheme.

4035 Port of Singapore, Western Anchorages, Jong Fairway and Cruise 1:10,000 4035 45 68
Bay.

Includes changes to depths, obstructions, berths and buoyage. This


chart is published jointly by the UKHO and the Maritime and Port
Authority of Singapore.

4036 Port of Singapore, Raffles Lighthouse to the Sisters. 1:10,000 4036 45 68

Includes changes to depths, wreck, obstructions, buoy, fouls, fairway


and berths. This chart is published jointly by the UKHO and the
Maritime and Port Authority of Singapore.

4037 Port of Singapore, Keppel Harbour, Tanjong Pagar Terminal and 1:10,000 4037 45 68
Approaches.

Includes changes to depths, wrecks, obstructions, fouls and berths.


Published jointly by the UKHO and by the Maritime and Port
Authority of Singapore.

4410 Philippine Islands and Taiwan, Luzon Strait. 1:500,000 4410 48 76, 80

Includes significant safety-related information as follows: new


marine reserve.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk46/23 1.12
I
ADMIRALTY CHARTS AND PUBLICATIONS TO BE PUBLISHED

ADMIRALTY CHARTS TO BE PUBLISHED 30 NOVEMBER 2023

New Editions of ADMIRALTY Small Craft Charts


Charts to be NP109A
Chart Title and other remarks Scale WITHDRAWN Catalogue
page

5602_9 A Dartmouth. 1:6,250 5602_9 7


B Higher Noss Point to Blackness Point. 1:6,250

Includes full updates for New Edition and Notices to Mariners


affecting source charts.

5602_10 Approaches to the River Dart. 1:6,250 5602_10 7

Includes full updates for New Edition and Notices to Mariners


affecting source charts.

5602_18 Upper Reaches of River Dart, River Yealm and Looe. 5602_18 7
A Blackness Point to Totnes. 1:12,500
B River Yealm. 1:12,500
C Looe. 1:15,000

Includes full updates for New Edition and Notices to Mariners


affecting source charts.

5606_4 Gull Stream to Princes Channel. 1:50,000 5606_4 15

Includes full updates for New Edition and Notices to Mariners


affecting source charts.

5606_5 Princes Channel to Medway Approach Channel. 1:50,000 5606_5 15

Includes full updates for New Edition and Notices to Mariners


affecting source charts.

5606_6 Whitaker Channel to West Swin. 1:50,000 5606_6 15

Includes full updates for New Edition and Notices to Mariners


affecting source charts.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.13 Wk46/23
I
ADMIRALTY CHARTS AND PUBLICATIONS PERMANENTLY WITHDRAWN

ADMIRALTY Charts

Chart to be On publication of
WITHDRAWN Main Title New Chart/New Edition

30 International Chart Series, England - South Coast, Plymouth Sound and 30
INT 1722 Approaches. INT 1722

798 Sweden - East Coast, Gotland - Northern Part. 798

1267 England - South Coast, Falmouth to Plymouth. 1267

1613 England - South Coast, Eddystone Rocks to Berry Head. 1613

1900 England - South Coast, Whitsand Bay to Yealm Head including Plymouth 1900
Sound.

2453 International Chart Series, Baltic Sea – Poland, Świnoujście. 2453


INT 12992 INT 12992

5128(1) Routeing Chart South Pacific Ocean. (January) 5128(1)

5128(2) Routeing Chart South Pacific Ocean. (February) 5128(2)

5128(3) Routeing Chart South Pacific Ocean. (March) 5128(3)

5128(4) Routeing Chart South Pacific Ocean. (April) 5128(4)

5128(5) Routeing Chart South Pacific Ocean. (May) 5128(5)

5128(6) Routeing Chart South Pacific Ocean. (June) 5128(6)

5128(7) Routeing Chart South Pacific Ocean. (July) 5128(7)

5128(8) Routeing Chart South Pacific Ocean. (August) 5128(8)

5128(9) Routeing Chart South Pacific Ocean. (September) 5128(9)

5128(10) Routeing Chart South Pacific Ocean. (October) 5128(10)

5128(11) Routeing Chart South Pacific Ocean. (November) 5128(11)

5128(12) Routeing Chart South Pacific Ocean. (December) 5128(12)

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk46/23 1.14
I

ADMIRALTY DISTRIBUTOR INFORMATION

NP131 - ADMIRALTY Maritime Data Solutions Catalogue, 2023 Edition


Amendments to Part 1, Authorised ADMIRALTY Distributors
Page 6, Distributor Section,

Insert:

Novaco Navigation Limited


Dirac Crescent
Bristol
BS16 7FR
United Kingdom
T: +44 1279 882349
www.unitednavigation.com
Paper, Digital

Delete:

Novaco Navigation Limited


55 Crown Street
Brentwood
Essex
CM14 4BD
T: +44 (0)1279 882581
ops@unitednavigation.com
www.unitednavigation.com
Paper, Digital

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.15 Wk46/23
II

GEOGRAPHICAL INDEX

(1) Miscellaneous . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.8


(2) British Isles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.8 – 2.9
(3) North Russia, Norway, The Færoe Islands and Iceland . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(4) Baltic Sea and Approaches . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.10 – 2.13
(5) North Sea and North and West Coasts of Denmark, Germany, Netherlands and Belgium . . . . . . . . 2.13 – 2.17
(6) France and Spain, North and West Coasts, and Portugal . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.17 – 2.18
(7) North Atlantic Ocean. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(8) Mediterranean and Black Seas. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.18 – 2.20
(9) Africa, West Coast and South Atlantic . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(10) Africa, South and East Coasts, and Madagascar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.21
(11) Red Sea, Arabia, Iraq and Iran. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.22 – 2.23
(12) Indian Ocean, Pakistan, India, Sri Lanka, Bangladesh and Burma . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.24 – 2.25
(13) Malacca Strait, Singapore Strait and Sumatera . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.26
(14) China Sea with its West Shore and China . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.26 – 2.29
(15) Japan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.29 – 2.30
(16) Korea and the Pacific Coasts of Russia . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.30
(17) Philippine Islands, Borneo and Indonesia except Sumatera . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.31
(18) Australia and Papua New Guinea . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(19) New Zealand . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(20) Pacific Ocean . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.32
(21) Aleutian Islands, Alaska and West Coast of North America including Mexico . . . . . . . . . . . . . . . . . 2.32 – 2.33
(22) West Coasts of Central and South America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.33 – 2.34
(23) Antarctica. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(24) East Coast of South America and The Falkland Islands . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.34 – 2.35
(25) Caribbean Sea, West Indies and the Gulf of Mexico. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.35 – 2.36
(26) East Coast of North America and Greenland . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.36 – 2.38
(27) T & P Notices . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.39 – 2.59

2.1
Wk46/23
II

INDEX OF NOTICES AND CHART FOLIOS

Notice No. Page Admiralty Chart Folio Notice No. Page Admiralty Chart Folio
4102 2.10 11 4159(T)/23 2.47 32
4103(P)/23 2.48 24, 25, 32, 34, 35, 36, 38 4160(T)/23 2.41 10
4104(T)/23 2.43 18 4161(T)/23 2.40 2, 3
4105(T)/23 2.47 34 4162(T)/23 2.40 2, 5
4106 2.13 2, 7, 9 4163 2.33 91
4107(T)/23 2.44 19 4164(P)/23 2.40 1, 2
4108(T)/23 2.45 19 4165 2.22 40
4109 2.18 26 4166* 2.10 10
4110* 2.26 47 4167 2.36 87
4111* 2.15 9 4168(T)/23 2.44 18
4112(T)/23 2.47 20 4169 2.8 40
4113* 2.16 9 4170(T)/23 2.42 10
4114* 2.8 1 4171 2.37 81
4115 2.32 73 4172(T)/23 2.42 10
4116 2.34 96 4173 2.27 50
4117 2.32 90 4174 2.11 11
4118 2.31 47, 48 4175 2.28 52
4119 2.35 83 4176(P)/23 2.54 52
4120 2.34 95 4177 2.30 56
4121* 2.8 7 4178* 2.9 1, 2
4122 2.34 95 4179(P)/23 2.53 41
4123 2.33 98 4180 2.33 90
4124(P)/23 2.58 73 4181 2.38 81
4125* 2.33 89 4182 2.19 27
4126 2.27 47 4183 2.29 47
4127(P)/23 2.43 18 4184 2.19 30
4128 2.34 98 4185(P)/23 2.55 52
4129 2.35 95 4186 2.30 52
4130 2.10 11 4187 2.36 86
4131 2.33 90 4188 2.16 9
4132 2.36 79 4189 2.29 47
4133 2.36 83 4190 2.16 9
4134 2.37 81 4191 2.29 55
4135 2.37 81 4192 2.29 54
4136(P)/23 2.52 41 4193 2.30 53
4137 2.17 18 4194(T)/23 2.56 55
4138 2.18 26 4195(T)/23 2.56 55
4139 2.17 18 4196(T)/23 2.57 55
4140 2.17 18 4197(T)/23 2.57 53
4141* 2.8 3 4198(T)/23 2.57 53
4142 2.18 18 4199(T)/23 2.57 54
4143* 2.9 5 4200(T)/23 2.58 53
4144 2.22 40 4201 2.11 10
4145 2.18 29 4202 2.30 52
4146 2.26 45 4203 2.11 10
4147 2.19 31 4204 2.35 96
4148 2.36 88 4205 2.21 35
4149(P)/23 2.41 11 4206 2.11 10
4150 2.27 50 4207 2.20 25
4151(T)/23 2.43 9 4208 2.12 11
4152(P)/23 2.39 6 4209 2.12 10
4153(T)/23 2.58 98 4210 2.20 26
4154(T)/23 2.39 1, 2 4211 2.31 58, 60
4155 2.19 26 4212(T)/23 2.45 25
4156 2.35 95 4213 2.13 10
4157(T)/23 2.45 31 4214 2.25 41
4158 2.24 42 4215 2.23 32

2.2
Wk46/23
II

INDEX OF NOTICES AND CHART FOLIOS

Notice No. Page Admiralty Chart Folio Notice No. Page Admiralty Chart Folio
4216(T)/23 2.40 2
4217(P)/23 2.59 95
4218(P)/23 2.45 27
4219(T)/23 2.58 52, 53, 56
4220* 2.17 9
4221(T)/23 2.41 2, 5
4222(P)/23 2.56 47
4223 2.23 32, 35, 42
4224(T)/23 2.54 38
4225 2.29 47
4226(T)/23 2.56 47

2.3
Wk46/23
II

INDEX OF CHARTS AFFECTED

Admiralty Chart No. Notices


Notices Admiralty
Admiralty Chart
Chart No.
No. Notices

6 4103P, 4223 999 4225


12 4159T 1036 4110, 4183
32 4178 1045 4167
73 4139 1057 4145
110 4188 1059 4222P
116 4190 1127 4162T
120 4151T, 4190 1180 4103P
122 4188 1191 4121
128 4151T, 4190 1196 4103P
130 4106 1249 4175
143 4103P 1255 4175
151 4103P 1258 4186
153 4103P 1269 4165
154 4178 1275 4147
157 4103P 1278 4148
158 4103P 1320 4161T
159 4103P 1325 4120
167 4103P 1338 4118
171 4103P 1346 4161T
240 4103P 1382 4124P
246 4184 1408 4106
247 4184 1436 4115
264 4103P 1446 4152P
265 4103P 1495 4224T
303 4105T 1545 4182, 4218P
327 4103P 1552 4141
343 4226T 1630 4106, 4188
349 4226T 1631 4106
351 4210 1632 4106
355 4155 1633 4106
431 4122 1655 4158
433 4129 1663 4112T
452 4103P 1664 4112T
453 4103P 1701 4207, 4212T
517 4167 1704 4103P, 4207
518 4212T 1705 4103P
540 4156 1734 4142
562 4212T 1759 4150
607 4112T 1760 4173
616 4103P 1764 4142
644 4103P 1795 4162T
646 4103P 1796 4162T
666 4103P 1826 4161T
671 4103P 1844 4118
674 4103P 1895 4108T
716 4103P 1925 4103P
717 4103P 1926 4103P
721 4103P 1946 4125
722 4103P 1959 4107T
740 4103P 1967 4114
742 4103P 2079 4187
792 4146 2083 4174
800 4213 2094 4161T
802 4213 2098 4130
803 4213 2106 4166
810 4213 2109 4118
811 4170T 2111 4118
820 4170T, 4172T 2116 4103P
846 4203 2122 4103P
858 4209 2123 4103P
882 4219T 2124 4103P
887 4160T, 4206 2133 4215
888 4160T 2161 4177
896 4202 2171 4221T
914 4138 2182A 4106
916 4138 2182B 4106
953 4109 2218 4102
961 4217P 2230 4157T
964 4103P 2232 4157T

2.4
Wk46/23
II

INDEX OF CHARTS AFFECTED

Admiralty Chart No. Notices


Notices Admiralty
Admiralty Chart
Chart No.
No. Notices

2253 4164P 3853 4133


2282 4157T 3864 4149P
2319 4153T 3874 4126
2347 4219T 3877 4103P
2409 4173 3878 4103P
2441 4144 3890 4189
2442 4144 3944 4146
2456 4134 4071 4223
2472 4211 4072 4223
2529 4143 4140 4106
2532 4201 4146 4103P
2573 4103P 4148 4103P
2574 4103P 4150 4103P
2578 4103P 4151 4103P
2611 4154T 4152 4103P
2612 4208 4156 4103P
2635 4162T 4157 4103P
2642 4185P 4169 4103P, 4205
2644 4176P 4171 4103P, 4205
2650 4176P 4177 4103P
2652 4221T 4178 4103P
2771 4221T 4179 4103P
2799 4128 4180 4103P
2809 4181 4237 4123
2837 4144 4508 4118
2839 4131 4703 4223
2846 4119 4704 4223
2850 4135 4705 4223
2858 4144 4768 4132
2887 4144 4923 4163
2889 4144 4942 4163
2890 4134 4954 4117
2921 4135 4955 4117
2926 4103P 4965 4180
2930 4103P 5601_11 4154T
2949 4103P 5602_5 4178
2954 4211 5602_9 4164P
2964 4103P, 4223 5603_13 4178
2968 4103P 5611_11 4221T
2976 4137 5611_21 4221T
2996 4119 5613_2 4161T
3171 4169 5613_21 4161T
3175 4144 5614_25 4106
3227 4104T 5616_12 4162T
3228 4168T 5616_13 4162T
3231 4173 5616_14 4162T
3237 4193 5616_27 4162T
3258 4140 5620_12 4216T
3259 4127P 5620_13 4216T
3260 4127P
3274 4216T German
3275 4216T Notices
3310 4103P Chart No.
3330 4116
3331 4204 DE 4 4113
3361 4103P DE 20 4113
3409 4144 DE 37 4166
3459 4171 DE 50 4111
3480 4219T DE 87 4220
3483 4118
3520 4169 Indian
3690 4175 Notices
Chart No.
3697 4175
3795 4103P, 4205 IN 203 4179P
3797 4103P, 4205 IN 211 4214
3800 4149P IN 255 4214
3818 4102 IN 263 4158
3839 4208 IN 2001 4136P
3852 4133 IN 2015 4136P

2.5
Wk46/23
II

INDEX OF CHARTS AFFECTED

Indian
Admiralty Chart No. Notices International
Admiralty Chart No. Notices
Notices
Chart No. Chart No.
IN 2016 4214 INT 1478 4151T, 4190
IN 2033 4179P INT 1479 4151T, 4190
IN 2076 4136P INT 1507 4121
IN 2083 4179P INT 1542 4152P
INT 1607 4161T
Japanese INT 1626 4162T
Notices INT 1627 4162T
Chart No. INT 1641 4141
INT 1650 4216T
JP 64A 4196T INT 1651 4216T
JP 65 4195T INT 1719 4178
JP 87 4197T INT 1720 4178
JP 90 4198T INT 1723 4164P
JP 101A 4199T INT 1726 4154T
JP 101B 4199T INT 1771 4213
JP 129 4192 INT 1772 4213
JP 187 4193 INT 1773 4213
JP 213 4193, 4200T INT 1775 4160T, 4206
JP 1061 4198T INT 1776 4160T
JP 1086 4198T INT 1871 4140
JP 1155A 4194T INT 1872 4104T
JP 1162A 4191 INT 1880 4127P
JP 1222 4193 INT 1881 4127P
INT 1901 4139
International INT 1953 4112T
Notices INT 1954 4112T
Chart No.
INT 2053 4103P
INT 71 4223 INT 2551 4105T
INT 72 4223 INT 2670 4103P
INT 140 4106 INT 2680 4103P
INT 305 4103P INT 2681 4103P
INT 508 4118 INT 3172 4212T
INT 551 4118 INT 3173 4212T
INT 703 4223 INT 3184 4103P
INT 704 4223 INT 3185 4103P
INT 705 4223 INT 3195 4103P
INT 750 4144 INT 3196 4103P
INT 758 4103P, 4223 INT 3362 4155
INT 1042 4106 INT 3500 4103P
INT 1043 4106 INT 3502 4103P
INT 1045 4111 INT 3549 4103P
INT 1061 4162T INT 3550 4103P
INT 1065 4162T INT 3660 4184
INT 1139 4208 INT 3794 4184
INT 1150 4149P INT 5355 4202
INT 1152 4149P INT 7000 4103P
INT 1159 4102 INT 7005 4103P
INT 1207 4174 INT 7006 4103P
INT 1209 4130 INT 7008 4103P
INT 1229 4203 INT 7010 4103P
INT 1238 4170T, 4172T INT 7017 4144
INT 1239 4170T INT 7050 4103P
INT 1250 4102 INT 7051 4103P
INT 1303 4166 INT 7052 4103P
INT 1316 4209 INT 7054 4103P
INT 1356 4166 INT 7055 4103P
INT 1373 4201 INT 7056 4103P
INT 1413 4220 INT 7060 4103P
INT 1416 4106, 4188 INT 7061 4103P
INT 1417 4106 INT 7114 4103P
INT 1418 4106 INT 7115 4103P
INT 1420 4106 INT 7116 4103P
INT 1423 4106 INT 7117 4103P
INT 1424 4113 INT 7119 4103P
INT 1457 4113 INT 7122 4103P
INT 1472 4188 INT 7139 4215
INT 1473 4188 INT 7142 4159T
INT 1477 4190 INT 7145 4103P

2.6
Wk46/23
II

INDEX OF CHARTS AFFECTED

International
Admiralty Chart No. Notices Admiralty Chart No. Notices
Notices
Chart No.
INT 7200 4169
INT 7211 4144
INT 7212 4144
INT 7232 4144
INT 7233 4144
INT 7299 4165
INT 7319 4179P
INT 7334 4214
INT 7336 4214
INT 7337 4136P
INT 7338 4136P
INT 7339 4179P
INT 7341 4179P
INT 7383 4158
INT 7387 4158
INT 7530 4103P
INT 7531 4103P
INT 7560 4103P, 4205
INT 7563 4103P, 4205
INT 7580 4103P
INT 7581 4103P
INT 7660 4103P
INT 7690 4103P
INT 7691 4103P
INT 7700 4103P
INT 7702 4103P
INT 7736 4224T
INT 7740 4103P
INT 7741 4103P
INT 7742 4103P

2.7
Wk46/23
II
4169 MISCELLANEOUS UPDATES TO CHARTS

Source: UKHO

Chart Previous Update Details

3171 300/23 Effective from 16/11/2023


Insert magenta limit and chart number, 3479, as follows:

North: 25° 38´·80N. East: 56° 23´·73E.


South: 25° 34´·64N. West: 56° 16´·70E.

3520 300/23 Effective from 16/11/2023


INT 7200 Insert magenta limit and chart number, 3479, as follows:

North: 25° 38´·80N. East: 56° 23´·73E.


South: 25° 34´·64N. West: 56° 16´·70E.

4114* ENGLAND - South Coast - Light.


Source: UKHO

Chart 1967 [ previous update 2421/23 ] ETRS89 DATUM


Delete sector at light as follows: 50° 20´·072N., 4° 09´·523W.
Iso.W 033°- 037° (4°)
Remaining sectors unchanged

4121* ENGLAND - East Coast - Foul.


Source: SSE Renewables

Chart 1191 (INT 1507) [ previous update 3356/23 ] ETRS89 DATUM


Insert
« 54° 44´·74N., 0° 17´·62E.

4141* ENGLAND - West Coast - Legends. Note.


Source: ABP Fleetwood

Chart 1552 (INT 1641) (Panel C, Fleetwood) [ previous update 3661/23 ] ETRS89 DATUM
Insert legend, Depths (see Note on Plan B), centred on: 53° 54´·954N., 3° 00´·619W.
Amend legend to, Depths (see Note on Plan B), centred on: 53° 55´·816N., 3° 00´·609W.
Delete legend, 5·5m, centred on: 53° 54´·835N., 3° 00´·942W.
53° 55´·033N., 3° 00´·676W.

Chart 1552 (INT 1641) (Panel B, Approaches to Fleetwood) [ previous update 3661/23 ] ETRS89 DATUM
Amend legend to, Depths (see Note), centred on: 53° 57´·65N., 3° 02´·34W.
Replace the existing note, CHANNEL DEPTHS, with the
accompanying note,DEPTHS, centred on: 53° 51´·49N., 2° 59´·63W.

2.8
Wk46/23
II

4143* SCOTLAND - Hebrides - Wreck.


Source: Stornoway Port Authority Notice 7/23

Chart 2529 (Panel, Stornoway Harbour) [ previous update 2831/23 ] ETRS89 DATUM
Delete
6(+ Wk 58° 11´·856N., 6° 22´·797W.

4178* ENGLAND - South Coast - Depths. Obstructions.


Source: Falmouth Harbour Port Authority

Chart 32 (INT 1720) [ previous update 2484/23 ] ETRS89 DATUM


Insert
5&+Obstns (a) 50° 09´·095N., 5° 02´·206W.
Delete depth, 59, close NW of: (a) above
Replace depth, 55 with depth, 53 50° 09´·295N., 5° 02´·184W.

Chart 154 (INT 1719) [ previous update 152/23 ] ETRS89 DATUM


Insert depth, 53 50° 09´·30N., 5° 02´·18W.

5&+Obstns (a) 50° 09´·10N., 5° 02´·21W.


Delete depth, 59, close NW of: (a) above

Chart 5602_5 (Panel A, Falmouth Harbour) [ previous update 2484/23 ] ETRS89 DATUM
Insert
5&+Obstns (a) 50° 09´·095N., 5° 02´·206W.
Delete depth, 59, close NW of: (a) above
Replace depth, 55 with depth, 53 50° 09´·295N., 5° 02´·184W.

Chart 5603_13 (Panel A, Falmouth Harbour) [ previous update 2484/23 ] ETRS89 DATUM
Insert
5&+Obstns (a) 50° 09´·095N., 5° 02´·206W.
Delete depth, 59, close NW of: (a) above
Replace depth, 55 with depth, 53 50° 09´·295N., 5° 02´·184W.

2.9
Wk46/23
II

4102 FINLAND - South Coast - NM Block. Lights. Leading line. Buoy. Maximum authorised draughts.
Source: Finnish Notice 20/151/23

Chart 2218 (INT 1159) [ previous update New Edition 23/03/2023 ] WGS84 DATUM
Insert the accompanying block, centred on: 60° 10´·7N., 24° 58´·2E.

Chart 3818 (INT 1250) [ previous update 470/23 ] WGS84 DATUM


Delete
KIso.R.6s (a) 60° 10´·95N., 24° 57´·67E.
60° 10´·90N., 24° 57´·74E.
leading line, pecked line, extending in direction 144·9°, from: (a) above
recommended track, solid line, with maximum authorised
draught, <9,0m>, joining: 60° 10´·38N., 24° 58´·48E.
60° 10´·51N., 24° 58´·28E.
recommended track, solid line, with maximum authorised
draught, <8,0m>, joining: 60° 10´·70N., 24° 58´·69E.
60° 10´·63N., 24° 58´·66E.

JW 60° 10´·75N., 24° 57´·88E.

4130 FINLAND - West Coast - Recommended tracks. Maximum authorised draughts.


Source: Finnish Notice 22/162/23

Chart 2098 (INT 1209) [ previous update 3377/23 ] WGS84 DATUM


Insert recommended track, firm line, with maximum authorised
draught, <10,0>, joining: 65° 20´·18N., 23° 56´·58E.
(a) 65° 23´·07N., 24° 03´·35E.
Delete former recommended track, firm line, with maximum
authorised draught, <10,0>, joining: (a) above
65° 21´·40N., 23° 58´·20E.

4166* GERMANY - Baltic Coast - Restricted area. Legend.


Source: WSA Ostsee 332/23

Chart DE 37 (INT 1356) [ previous update New Chart 15/12/2022 ] WGS84 DATUM
Insert circular limit of restricted area, radius 300m,
ÇÅÆÇ , centred on:
(a) 54° 06´·69N., 11° 00´·98E.
legend, Foul (Explosives), close W of: (a) above

Chart 2106 (INT 1303) [ previous update 3453/23 ] WGS84 DATUM


Insert circular limit of restricted area, radius 300m,
ÇÅÆÇ , centred on:
(a) 54° 06´·69N., 11° 00´·98E.
legend, Foul (explosives), close W of: (a) above

2.10
Wk46/23
II

4174 SWEDEN - East Coast - NM Block.


Source: Swedish Notice 985/18005/23

Chart 2083 (INT 1207) [ previous update 4018/23 ] WGS84 DATUM


Insert the accompanying block, centred on: 62° 36´·2N., 18° 05´·5E.

4201 DENMARK - Islands - Measuring instruments.


Source: Danish Chart Correction 19/167/23

Chart 2532 (INT 1373) [ previous update 3293/23 ] WGS84 DATUM


Insert o Rec. St. 55° 00´·70N., 10° 30´·06E.
54° 56´·69N., 10° 27´·14E.

4203 SWEDEN - East Coast - Buoyage.


Source: Swedish Notice 985/17996/23

Chart 846 (INT 1229) (Panel F, Arkö) [ previous update 4389/22 ] WGS84 DATUM
Replace
Jbwith JqV 58° 29´·54N., 16° 56´·36E.

Jdwith JUm 58° 29´·53N., 16° 56´·36E.

4206 SWEDEN - East Coast - Depths.


Source: Swedish Notice 985/17929/23

Chart 887 (INT 1775) [ previous update 3488/23 ] WGS84 DATUM


Insert depth, 43, and extend 6m contour W to enclose (a) 59° 34´·57N., 18° 59´·70E.
Delete depth, 103, close W of: (a) above
Insert depth, 52, enclosed by 6m contour 59° 33´·96N., 18° 59´·36E.
Amend 6m contour, joining: 59° 34´·18N., 18° 59´·11E.
59° 34´·20N., 18° 59´·25E.
59° 34´·20N., 18° 59´·43E.
59° 34´·10N., 18° 59´·39E.
59° 34´·06N., 18° 59´·11E.
Delete depth, 77 59° 34´·27N., 18° 59´·46E.

2.11
Wk46/23
II

4208 FINLAND - West Coast - Beacons. Leading line.


Source: Finnish Notice 22/159/23

Chart 2612 (Panel C, Vaasa) [ previous update New Edition 16/02/2023 ] WGS84 DATUM
Delete
K 63° 03´·87N., 21° 31´·10E.
(a) 63° 03´·71N., 21° 31´·38E.
leading line, pecked line, extending in direction 321,3°, from: (a) above

Chart 3839 (INT 1139) [ previous update New Edition 16/02/2023 ] WGS84 DATUM
Delete
K 63° 03´·87N., 21° 31´·10E.
(a) 63° 03´·71N., 21° 31´·38E.
leading line, pecked line, extending in direction 321,3°, from: (a) above

4209 SWEDEN - West Coast - NM Block. Spoil grounds. Legends.


Source: Swedish Notices 985/17903/23 and 985/17933/23

Chart 858 (INT 1316) [ previous update 3992/23 ] WGS84 DATUM


Insert the accompanying block, centred on: 57° 35´·5N., 11° 48´·8E.
limit of spoil ground, pecked line, joining: (a) 57° 37´·49N., 11° 34´·16E.
(b) 57° 37´·27N., 11° 34´·59E.
(c) 57° 37´·07N., 11° 34´·24E.
(d) 57° 36´·69N., 11° 34´·95E.
(e) 57° 36´·24N., 11° 34´·03E.
(f) 57° 35´·91N., 11° 33´·88E.
(g) 57° 35´·91N., 11° 32´·91E.
(h) 57° 37´·04N., 11° 33´·30E.
legend, Spoil Ground, within: (a)-(h) above
legend, Spoil Ground (disused), centred on: 57° 36´·53N., 11° 35´·10E.
Delete former limit of spoil ground, pecked line, and associated
legend, Spoil Ground, joining: 57° 36´·33N., 11° 34´·21E.
57° 36´·64N., 11° 33´·50E.
57° 37´·26N., 11° 34´·45E.
57° 37´·23N., 11° 34´·52E.

2.12
Wk46/23
II

4213 SWEDEN - East Coast - Lights. NM Block.


Source: Swedish Notices 985/17982/23, 985/17998/23, 985/18014/23, 985/18039/23 and 985/18041/23

Chart 800 (INT 1773) [ previous update New Edition 13/07/2023 ] WGS84 DATUM
Amend Bogen light to, Iso WRG 3s 59° 27´·10N., 16° 09´·54E.

Chart 802 (INT 1772) [ previous update New Edition 19/10/2023 ] WGS84 DATUM
Insert the accompanying block, centred on: 59° 31´·3N., 17° 06´·7E.

Chart 803 (Panel A, Aggarösundet) [ previous update 2577/23 ] WGS84 DATUM


Amend Snesarboudde light to, Fl(2) WRG 3s 59° 30´·959N., 16° 44´·905E.

Chart 810 (INT 1771) [ previous update 3946/23 ] WGS84 DATUM


Amend Oknö Hälludde light to, Iso WRG 3s 59° 31´·37N., 17° 06´·98E.
Kurön light to, Iso WRG 3s 59° 20´·06N., 17° 29´·34E.
Gåsholm light to, Fl(2) WRG 3s 59° 19´·28N., 17° 31´·68E.

4106 NETHERLANDS - Platforms. Wells. Restricted areas. Fog signal.


Automatic Identification System.
Source: Netherlands Notice 41/311/23

Chart 130 (INT 1423) [ previous update 2565/23 ] WGS84 DATUM


Replace
¼{ Mo(U)15s Horn Mo(U)30s P11-E and associated
Automatic Identification System, AIS, with åWell
(a) 52° 21´·27N., 3° 35´·19E.
Delete circular limit of restricted area, Ç, centred on:
(a) above

Chart 1408 [ previous update 3929/23 ] WGS84 DATUM


Replace
¼{ and associated Automatic Identification System, AIS, with
åWell 52° 21´·3N., 3° 35´·1E.

¼{ with åWell 53° 33´·8N., 4° 34´·0E.


53° 35´·0N., 4° 28´·2E.
52° 42´·0N., 3° 43´·5E.
52° 44´·2N., 3° 48´·2E.
52° 58´·3N., 4° 06´·4E.

Chart 1630 (INT 1416) [ previous update 3249/23 ] WGS84 DATUM


Replace
¼{ P11-E and associated Automatic Identification System,
AIS, with åWell
(a) 52° 21´·27N., 3° 35´·19E.
Delete circular limit of restricted area, Ç, centred on:
(a) above

2.13
Wk46/23
II
4106 NETHERLANDS - Platforms. Wells. Restricted areas. Fog signal.
Automatic Identification System. (continued)

Chart 1631 (INT 1418) [ previous update 3929/23 ] WGS84 DATUM


Replace
¼{ Haven A and associated circular limit of restricted area,
Ç, with åWell 52° 58´·33N., 4° 06´·37E.

¼{ P6-B and associated circular limit of restricted area, Ç,


with åWell
52° 44´·24N., 3° 48´·22E.

¼{ P6-D and associated circular limit of restricted area,


Ç, with åWell 52° 42´·03N., 3° 43´·54E.

¼{ P11-E and associated Automatic Identification System,


AIS, with åWell
(a) 52° 21´·27N., 3° 35´·19E.
Delete circular limit of restricted area, Ç, centred on:
(a) above

Chart 1632 (INT 1420) [ previous update 3928/23 ] WGS84 DATUM


Replace
¼{ L8-A and associated circular limit of restricted area,
Ç, with åWell 53° 35´·02N., 4° 28´·25E.

¼{ L8-H and associated circular limit of restricted area,


Ç, with åWell 53° 33´·84N., 4° 34´·00E.

Chart 1633 (INT 1417) [ previous update 3303/23 ] WGS84 DATUM


Replace
¼{ L8-A and associated circular limit of restricted area,
Ç, with åWell 53° 35´·02N., 4° 28´·25E.

¼{ L8-H and associated circular limit of restricted area,


Ç, with åWell 53° 33´·84N., 4° 34´·00E.

Chart 2182A (INT 1043) [ previous update 3295/23 ] WGS84 DATUM


Replace
¼{ and associated Automatic Identification System, AIS, with
åWell 52° 21´·3N., 3° 35´·1E.

¼{ with åWell 53° 33´·8N., 4° 34´·0E.


53° 35´·0N., 4° 28´·2E.
52° 41´·9N., 3° 43´·6E.
52° 44´·2N., 3° 48´·2E.
52° 58´·3N., 4° 06´·4E.

Chart 2182B (INT 1042) [ previous update 3887/23 ] WGS84 DATUM


Replace
¼{ with åWell 53° 35´·0N., 4° 28´·2E.
53° 34´·0N., 4° 34´·0E.

2.14
Wk46/23
II
4106 NETHERLANDS - Platforms. Wells. Restricted areas. Fog signal.
Automatic Identification System. (continued)

Chart 4140 (INT 140) [ previous update 3221/23 ] WGS84 DATUM


Replace
¼{ with åWell 53° 33´·8N., 4° 34´·0E.
53° 35´·0N., 4° 29´·0E.
52° 58´·3N., 4° 06´·4E.

Chart 5614_25 [ previous update 3117/23 ] WGS84 DATUM


Replace
¼{ and associated Automatic Identification System, AIS,
with, åWell
52° 21´·3N., 3° 35´·1E.

¼{ with åWell 53° 33´·8N., 4° 34´·0E.


53° 35´·0N., 4° 28´·2E.
52° 41´·9N., 3° 43´·6E.
52° 44´·2N., 3° 48´·2E.
52° 58´·3N., 4° 06´·4E.

4111* NORTH SEA - Wrecks. Rock. Fouls. Buoyage. Light.


Source: NL 39/298(P), 40/302/23; WSA Elbe-Nordsee 273–276, 278/23; WSA Weser-Jade-Nordsee 110/23
Note: Mast and AIS remains unchanged.

Chart DE 50 (INT 1045) [ previous update 3906/23 ] WGS84 DATUM


Insert
43, Wk 54° 39´·5N., 3° 21´·5E.

41, Wk 54° 36´·6N., 3° 26´·4E.

EfFl(4)Y.10s W-B 54° 09´·2N., 4° 00´·0E.

EfFl.Y.5s W-A 54° 04´·3N., 3° 59´·5E.

38,Ã Wk 54° 34´·1N., 5° 45´·8E.

«¾ 54° 31´·5N., 5° 44´·5E.


54° 31´·4N., 5° 45´·3E.

¯¾(40) 54° 33´·8N., 6° 07´·8E.

J;Fl(5)Y.20s
f ODAS 4 buoys
54° 22´·0N., 6° 10´·7E.
Delete legend, Mo(U)Y.15s22m and associated yellow light flare, at
mast 54° 00´·9N., 6° 35´·3E.

2.15
Wk46/23
II

4113* GERMANY - North Sea Coast - Depths. Beacon tower.


Source: WSA Weser-Jade-Nordsee, Survey LP9053/23 and WSA Weser-Jade-Nordsee 118/23

Chart DE 4 (INT 1457) [ previous update 3406/23 ] WGS84 DATUM


Insert depth, 81 (a) 53° 27´·70N., 8° 29´·40E.
Delete depth, 88, close S of: (a) above

Ll 53° 40´·63N., 8° 21´·42E.

Chart DE 20 (INT 1424) [ previous update 3181/23 ] WGS84 DATUM


Delete
Ll 53° 40´·63N., 8° 21´·42E.

4188 NETHERLANDS - Radar beacon.


Source: Netherlands Notice 42/322/23

Chart 110 (INT 1473) [ previous update 3637/23 ] WGS84 DATUM


Delete radar beacon, Racon(T), at lit platform 51° 55´·50N., 3° 40´·10E.

Chart 122 (INT 1472) [ previous update New Edition 31/08/2023 ] WGS84 DATUM
Delete radar beacon, Racon(T), at lit platform 51° 55´·50N., 3° 40´·10E.

Chart 1630 (INT 1416) [ previous update 4106/23 ] WGS84 DATUM


Delete radar beacon, Racon(T), at lit platform 51° 55´·50N., 3° 40´·10E.

4190 NETHERLANDS - Depths. Drying height.


Source: Netherlands Notice 42/323/23

Chart 116 (INT 1477) [ previous update 3637/23 ] WGS84 DATUM


Insert depth, 35, and extend 5m contour N to enclose (a) 51° 25´·18N., 3° 39´·13E.
Delete depth, 76, close SW of: (a) above
Insert depth, 16, enclosed by 2m contour and extend 5m contour N to
enclose 51° 25´·12N., 3° 39´·44E.

Chart 120 (INT 1479) (Panel A, Continuation to Nauw van Bath) [ previous update 2985/23 ] WGS84 DATUM
Insert drying height, 06, and extend 0m low water line, 2m contour
and 5m contour S to enclose (a) 51° 22´·33N., 4° 06´·31E.
Delete depth, 12, close NW of: (a) above

Chart 120 (INT 1479) [ previous update 2985/23 ] WGS84 DATUM


Insert depth, 35, and extend 5m contour N to enclose (a) 51° 25´·18N., 3° 39´·13E.
Delete depth, 76, close SW of: (a) above
Insert depth, 16, enclosed by 2m contour and extend 5m contour N to
enclose 51° 25´·12N., 3° 39´·44E.

Chart 128 (INT 1478) (Panel A, Baalhoek to Antwerp) [ previous update 4086/23 ] WGS84 DATUM
Insert drying height, 06, and extend 0m low water line, 2m contour
and 5m contour SW to enclose 51° 22´·33N., 4° 06´·31E.

2.16
Wk46/23
II

4220* GERMANY - North Sea Coast - Platform.


Source: (BSH O3 22/09/23) 43/23
Note: AIS remains unchanged.

Chart DE 87 (INT 1413) [ previous update 3773/23 ] WGS84 DATUM


Amend platform to, DOLWIN BETA DOLWIN KAPPA
Oc(3)Y.16s5M (R Lts) 53° 58´·71N., 6° 55´·39E.

4137 SPAIN - South West Coast - Automatic Identification Systems.


Source: Spanish Notice 13/103/23

Chart 2976 [ previous update 3489/22 ] WGS84 DATUM


Insert Automatic Identification System, AIS, at light 36° 48´·393N., 6° 20´·298W.
36° 48´·134N., 6° 20´·286W.

Chart 2976 (Panel, Río Guadalquivir Bonanza to Salina de Santa Teresa) [ previous update 3489/22 ] WGS84 DATUM
Insert Automatic Identification System, AIS, at light 36° 48´·393N., 6° 20´·299W.
36° 48´·134N., 6° 20´·286W.

4139 SPAIN - South West Coast - Coastline. Light.


Source: Spanish Notices 17/143/23 and 25/237(T)/23
Note: Former Notice 2069(T)/22 is cancelled.

Chart 73 (INT 1901) [ previous update 1854/23 ] WGS84 DATUM


Insert coastline, single firm line, joining: (a) 37° 09´·11N., 6° 52´·87W.
(b) 37° 09´·27N., 6° 53´·17W.
(c) 37° 09´·29N., 6° 53´·15W.
Delete charted detail, within: (a)-(c) above
Move
·Fl(4)G.10s, from: 37° 09´·10N., 6° 52´·87W.
to: 37° 09´·27N., 6° 53´·17W.

4140 PORTUGAL - West Coast - Buoyage.


Source: Portuguese Notice 4/152/23

Chart 3258 (INT 1871) [ previous update 3340/23 ] WGS84 DATUM


Insert
Ef Fl.Y.3·5s1M APDL 1 ODAS 41° 10´·46N., 8° 44´·84W.
Delete
EfFl(5)Y.20s2M APDL 1 ODAS 41° 10´·46N., 8° 44´·50W.

2.17
Wk46/23
II

4142 SPAIN - West Coast - Buoy. Superbuoy.


Source: Spanish Notice 20/171/23

Chart 1734 [ previous update 5535/19 ] WGS84 DATUM


Insert
GfFl(5)Y.20s
; ODAS
42° 32´·97N., 8° 56´·89W.
Delete
PfFl(5)Y.20s ODAS 42° 32´·85N., 8° 57´·12W.

Chart 1764 [ previous update 3743/23 ] WGS84 DATUM


Insert
GfFl(5)Y.20s
; ODAS
42° 32´·97N., 8° 56´·89W.
Delete
PfFl(5)Y.20s ODAS 42° 32´·85N., 8° 57´·12W.

4109 ITALY - West Coast - NM Blocks.


Source: Italian Notice 6.7/23

Chart 953 (Panel, Civitavecchia) [ previous update 1903/23 ] WGS84 DATUM


Insert the accompanying block A, centred on: 42° 07´·4N., 11° 45´·3E.

Chart 953 (Panel, Approaches to Civitavecchia) [ previous update 1903/23 ] WGS84 DATUM
Insert the accompanying block B, centred on: 42° 07´·4N., 11° 45´·3E.

4138 ITALY - West Coast - NM Blocks.


Source: Italian Notices 4.17-18/23

Chart 914 [ previous update 5375/21 ] WGS84 DATUM


Insert the accompanying block, centred on: 40° 49´·2N., 14° 06´·2E.

Chart 916 (Panel A, Baia and Pozzuoli) [ previous update 5375/21 ] WGS84 DATUM
Insert the accompanying block, centred on: 40° 49´·2N., 14° 06´·2E.

4145 TURKEY - West Coast - Lights.


Source: Turkish Notice 21/106/23

Chart 1057 (Panel B, Kuşadasi) [ previous update 1738/23 ] WGS84 DATUM


Move
¶ Fl.Y.5s8m3M from: 37° 51´·883N., 27° 15´·239E.
to: 37° 51´·918N., 27° 15´·190E.

¶ Fl.Y.5s8m3M from: 37° 51´·805N., 27° 15´·185E.


to: 37° 51´·833N., 27° 15´·150E.

2.18
Wk46/23
II

4147 TURKEY - Black Sea Coast - Buoy.


Source: Turkish Notice 21/104/23

Chart 1275 (Panel D, Ereğli) [ previous update 4026/23 ] WGS84 DATUM


Amend light-buoy to, Fl(3)G.12s 41° 16´·84N., 31° 23´·40E.

Chart 1275 [ previous update 4026/23 ] WGS84 DATUM


Amend light-buoy to, Fl(3)G 41° 16´·84N., 31° 23´·40E.

4155 ITALY - West Coast - NM Block.


Source: Italian Notice 6.2/23 and IT500055

Chart 355 (INT 3362) [ previous update 4481/22 ] WGS84 DATUM


Insert the accompanying block, centred on: 44° 23´·6N., 8° 56´·1E.

4182 ITALY - East Coast - NM Block. Note. Maritime limit.


Source: Italian Notice 9.8/23

Chart 1545 [ previous update 3841/23 ] WGS84 DATUM


Insert the accompanying block, centred on: 40° 39´·0N., 17° 57´·5E.
maritime limit, pecked line, joining: 40° 38´·735N., 17° 58´·236E.
40° 38´·978N., 17° 57´·822E.
Replace the existing note with the accompanying note, RESTRICTED
AREA, centred on: 40° 39´·768N., 17° 55´·804E.

4184 TURKEY - South Coast - Anchorage areas. Legends.


Source: Turkish Notice 23/117/23

Chart 246 (INT 3660) [ previous update 3264/23 ] WGS84 DATUM


Insert limit of anchorage area, pecked line, joining: (a) 36° 52´·00N., 36° 03´·35E.
(b) 36° 51´·33N., 36° 04´·28E.
(c) 36° 50´·62N., 36° 03´·35E.
(d) 36° 51´·33N., 36° 02´·75E.
legend, No 5B, within: (a)-(d) above
Delete former anchorage area, pecked line, and associated legend, No
5B, joining: 36° 52´·00N., 36° 05´·13E.
36° 51´·33N., 36° 06´·07E.
36° 50´·62N., 36° 05´·13E.
36° 51´·33N., 36° 04´·28E.

2.19
Wk46/23
II
4184 TURKEY - South Coast - Anchorage areas. Legends. (continued)

Chart 247 (INT 3794) [ previous update 962/23 ] WGS84 DATUM


Insert limit of anchorage area, pecked line, joining: (a) 36° 52´·00N., 36° 03´·35E.
(b) 36° 51´·33N., 36° 04´·28E.
(c) 36° 50´·62N., 36° 03´·35E.
(d) 36° 51´·33N., 36° 02´·75E.
legend, ½No 5B, within: (a)-(d) above
Delete formerlimit of anchorage area, pecked line, and associated
legend, No 5B, joining: (e) 36° 52´·00N., 36° 05´·13E.
(f) 36° 51´·33N., 36° 06´·07E.
(g) 36° 50´·62N., 36° 05´·13E.
(h) 36° 51´·33N., 36° 04´·28E.
symbol, dangerous cargo anchorage, within: (e)-(h) above

4207 SPAIN - Mediterranean Sea Coast - Outfall.


Source: Spanish Notice 7/52/23

Chart 1701 [ previous update 2164/23 ] WGS84 DATUM


Insert outfall, È, joining: 41° 08´·1N., 1° 23´·0E.
41° 07´·2N., 1° 23´·0E.

Chart 1704 [ previous update 3922/23 ] WGS84 DATUM


Insert outfall, È, joining: 41° 08´·1N., 1° 23´·0E.
41° 07´·3N., 1° 23´·0E.

4210 ITALY - West Coast - Beacons. Automatic Identification Systems. Buoyage.


Source: Italian HO

Chart 351 (Panel A, Golfo Tigullio (Golfo Marconi)) [ previous update 3847/23 ] WGS84 DATUM
Replace
G;Ff l.Y.4s6m4M and associated Automatic Identification
System, AIS, with KlÜ Fl.Y.4s6m4M and associated
Automatic Identification System, AIS 44° 18´·87N., 9° 13´·40E.
44° 17´·80N., 9° 13´·76E.

2.20
Wk46/23
II

4205 SOUTH AFRICA - East Coast - Submarine power cable.


Source: Alcatel Subarine Networks

Chart 3795 [ previous update 3879/23 ] WGS84 DATUM


Insert submarine power cable, ÉÊÉ, joining: 30° 02´·49S., 30° 53´·90E.
30° 03´·55S., 30° 54´·61E.
30° 03´·69S., 30° 54´·86E.
30° 03´·74S., 30° 55´·35E.
30° 03´·43S., 30° 56´·18E.
30° 03´·53S., 30° 56´·89E.
30° 05´·10S., 31° 01´·75E.

Chart 3797 [ previous update 3879/23 ] WGS84 DATUM


Insert submarine power cable, ÉÊÉ, joining: 30° 02´·49S., 30° 53´·90E.
30° 03´·55S., 30° 54´·61E.
30° 03´·69S., 30° 54´·86E.
30° 03´·74S., 30° 55´·35E.
30° 03´·43S., 30° 56´·18E.
30° 03´·53S., 30° 56´·89E.
30° 05´·11S., 31° 01´·78E.

Chart 4169 (INT 7563) [ previous update 3879/23 ] WGS84 DATUM


Insert submarine power cable, ÉÊÉ, joining: 30° 02´·49S., 30° 53´·90E.
30° 03´·55S., 30° 54´·61E.
30° 03´·69S., 30° 54´·86E.
30° 03´·75S., 30° 55´·10E.
30° 03´·74S., 30° 55´·35E.
30° 03´·46S., 30° 55´·94E.
30° 03´·43S., 30° 56´·18E.
30° 03´·49S., 30° 56´·79E.
30° 03´·80S., 30° 57´·53E.
30° 04´·92S., 31° 01´·28E.

Chart 4171 (INT 7560) [ previous update 3879/23 ] WGS84 DATUM


Insert submarine power cable, ÉÊÉ, joining: 30° 02´·5S., 30° 53´·9E.
30° 03´·5S., 30° 54´·6E.
30° 03´·7S., 30° 54´·9E.
30° 03´·7S., 30° 55´·3E.
30° 03´·4S., 30° 56´·2E.
30° 03´·5S., 30° 56´·9E.
30° 05´·1S., 31° 01´·7E.

2.21
Wk46/23
II

4144 IRAN - Light.


Source: Iranian Notice 11/23

Chart 2441 (INT 7233) [ previous update 3176/23 ] WGS84 DATUM


Amend light to, Fl(2)12s30m10M 25° 54´·27N., 54° 33´·06E.

Chart 2442 [ previous update 1146/23 ] WGS84 DATUM


Amend light to, Fl(2)12s30m10M 25° 54´·28N., 54° 33´·06E.

Chart 2837 (INT 7017) [ previous update 3322/23 ] WGS84 DATUM


Amend light to, Fl(2)12s10M 25° 54´·4N., 54° 33´·1E.

Chart 2858 (INT 750) [ previous update 3954/23 ] WGS84 DATUM


Amend light to, Fl(2)10M 25° 54´·1N., 54° 33´·2E.

Chart 2887 (INT 7232) [ previous update 3508/23 ] WGS84 DATUM


Amend light to, Fl(2)12s30m10M 25° 54´·3N., 54° 33´·1E.

Chart 2889 (INT 7211) [ previous update 3027/23 ] WGS84 DATUM


Amend light to, Fl(2)12s30m10M 25° 54´·3N., 54° 33´·1E.

Chart 3175 (INT 7212) [ previous update 3027/23 ] WGS84 DATUM


Amend light to, Fl(2)12s30m10M 25° 54´·31N., 54° 33´·10E.

Chart 3409 (Panel H, Sirrī Oil Terminal) [ previous update 2829/23 ] WGS84 DATUM
Amend light to, Fl(2)12s30m10M 25° 54´·31N., 54° 33´·10E.

4165 IRAN - Buoyage. Light-beacon.


Source: ENC IR403051

Chart 1269 (INT 7299) (Panel B, Bandar-E Emām Khomeynī and Approaches to Bandar-E Māhshahr) [ previous
update 4621/22 ] WGS84 DATUM
Insert
G;Ff l.Y.6s (a) 30° 27´·38N., 49° 01´·87E.
Delete
G;Ff l.Y.3s, close N of: (a) above
Move
JdFl(3)R.9s, from: 30° 25´·70N., 49° 03´·34E.
to: 30° 25´·68N., 49° 03´·38E.

ThFl.G.5s No 35, from: 30° 24´·59N., 49° 03´·35E.


to: 30° 24´·59N., 49° 03´·15E.

Chart 1269 (INT 7299) (Panel A, The Bar to Bandar-E Māhshahr) [ previous update 4621/22 ] WGS84 DATUM
Move
ThFl.G.5s No 35, from: 30° 24´·50N., 49° 03´·30E.
to: 30° 24´·59N., 49° 03´·15E.

2.22
Wk46/23
II

4215 EGYPT - Red Sea Coast - Submarine cable.


Source: ENC EG3GOS03

Chart 2133 (INT 7139) [ previous update 498/23 ] WGS84 DATUM


Insert submarine cable, É, joining: 29° 50´·19N., 32° 29´·58E.
29° 50´·09N., 32° 29´·60E.
29° 49´·63N., 32° 29´·67E.
29° 49´·26N., 32° 29´·66E.
29° 49´·04N., 32° 29´·63E.
29° 45´·47N., 32° 29´·11E.
29° 38´·68N., 32° 28´·31E.
29° 38´·22N., 32° 28´·30E.
29° 37´·60N., 32° 28´·43E.
29° 30´·78N., 32° 31´·35E.
29° 30´·76N., 32° 31´·36E.
29° 30´·15N., 32° 31´·77E.
29° 28´·68N., 32° 33´·22E.
29° 28´·18N., 32° 33´·66E.
29° 25´·86N., 32° 34´·96E.
29° 24´·06N., 32° 35´·89E.
29° 22´·50N., 32° 36´·79E.

4223 DJIBOUTI - Depths.


Source: French Notice 12/198/23

Chart 6 [ previous update 1321/23 ] WGS84 DATUM


Insert depth, 596 (a) 12° 37´·0N., 47° 13´·7E.
Delete depth, 920, close SW of: (a) above
depth, 758 Rep (1997), close NE of: (a) above
Insert depth, 532 12° 13´·2N., 45° 36´·6E.
depth, 646 12° 12´·7N., 45° 30´·3E.
depth, 424 12° 06´·5N., 45° 12´·5E.
depth, 460 (b) 12° 06´·5N., 45° 08´·2E.
Delete depth, 682, close N of: (b) above
Insert depth, 544 (c) 11° 58´·2N., 45° 07´·2E.
Delete depth, 619, close NE of: (c) above

Chart 2964 (INT 758) [ previous update 4409/22 ] WGS84 DATUM


Insert depth, 596 (a) 12° 37´·0N., 47° 13´·7E.
Delete depth, 758 Rep, close N of: (a) above
Insert depth, 532 12° 13´·2N., 45° 36´·6E.
depth, 424 12° 06´·5N., 45° 12´·5E.

Chart 4071 (INT 71) [ previous update 2905/22 ] WGS84 DATUM


Insert depth, 596 (a) 12° 37´·0N., 47° 13´·7E.
Delete depth, 854, close NE of: (a) above
Insert depth, 424 (b) 12° 06´·5N., 45° 12´·5E.
Delete depth, 521, close SE of: (b) above

2.23
Wk46/23
II
4223 DJIBOUTI - Depths. (continued)

Chart 4072 (INT 72) [ previous update 2905/22 ] WGS84 DATUM


Insert depth, 596 (a) 12° 37´·0N., 47° 13´·7E.
Delete depth, 854, close NE of: (a) above
Insert depth, 424 (b) 12° 06´·5N., 45° 12´·5E.
Delete depth, 521, close SE of: (b) above

Chart 4703 (INT 703) [ previous update 3549/22 ] WGS84 DATUM


Insert depth, 596 12° 37´·0N., 47° 13´·7E.
depth, 532, and extend 1000m contour N to enclose 12° 13´·2N., 45° 36´·6E.
depth, 424 (a) 12° 06´·5N., 45° 12´·5E.
Delete depth, 521, close SE of: (a) above

Chart 4704 (INT 704) [ previous update 3913/23 ] WGS84 DATUM


Insert depth, 532 12° 13´·2N., 45° 35´·0E.
depth, 424 (a) 12° 06´·5N., 45° 12´·5E.
Delete depth, 507, close SE of: (a) above

Chart 4705 (INT 705) [ previous update 1897/23 ] WGS84 DATUM


Insert depth, 596 12° 37´·0N., 47° 13´·7E.
depth, 532, and extend 1000m contour N to enclose 12° 13´·2N., 45° 36´·6E.
depth, 424 (a) 12° 06´·5N., 45° 12´·5E.
Delete depth, 521, close SE of: (a) above

4158 SRI LANKA - West Coast - Wrecks. NM Block.


Source: ENC LK4PG03D, SLNHS and UKHO

Chart IN 263 (INT 7383) [ previous update 4054/23 ] WGS84 DATUM


Insert the accompanying block, centred on: 7° 04´·8N., 79° 44´·0E.

Chart 1655 (INT 7387) [ previous update New Edition 20/10/2022 ] WGS84 DATUM
Insert
24,Wk (a) 6° 57´·54N., 79° 45´·74E.
Delete
18%, Wk PA , close NW of: (a) above

2.24
Wk46/23
II

4214 INDIA - West Coast - Bridge. Works. Wrecks. Dredged depth. Depths. Buoyage. Rock. Dredged area.
Legends. NM Block.
Source: ENCs IN62001U, IN52076N and IN52015B

Chart IN 211 [ previous update 1873/23 ] WGS84 DATUM


Insert bridge, double pecked line, width 50m, joining: 18° 59´·90N., 72° 51´·61E.
18° 59´·99N., 72° 52´·19E.
18° 59´·24N., 72° 54´·14E.
(a) 18° 59´·53N., 72° 57´·74E.
(b) 18° 59´·24N., 72° 58´·91E.
(c) 18° 58´·44N., 73° 00´·00E.
18° 58´·22N., 73° 00´·32E.
legend, Under construction (2023), along: (a)-(c) above
limit of dredged area, pecked line, joining: 18° 54´·73N., 72° 51´·77E.
(d) 18° 55´·43N., 72° 51´·29E.
Delete former limit of dredged area, pecked line, joining: 18° 55´·01N., 72° 51´·92E.
(d) above
Insert
´PA 18° 53´·71N., 72° 51´·80E.
Amend dredged depth to, 14,4m, centred on: 18° 56´·41N., 72° 55´·81E.
Replace depth, 79 , with depth, 6 18° 56´·04N., 72° 52´·84E.
Delete
´ 18° 55´·92N., 72° 52´·32E.

Chart IN 255 (INT 7334) [ previous update 1873/23 ] WGS84 DATUM


Insert bridge, double pecked line, width 50m, joining: 18° 59´·9N., 72° 51´·7E.
19° 00´·0N., 72° 52´·2E.
18° 59´·2N., 72° 54´·1E.
(a) 18° 59´·5N., 72° 57´·7E.
(b) 18° 59´·2N., 72° 58´·9E.
18° 58´·4N., 73° 00´·0E.
18° 58´·2N., 73° 00´·3E.
legend, Under construction (2023), along: (a)-(b) above
limit of dredged area, pecked line, joining: 18° 54´·7N., 72° 51´·8E.
(c) 18° 55´·4N., 72° 51´·3E.
Delete former limit of dredged area, pecked line, joining: 18° 55´·0N., 72° 51´·9E.
(c) above
Insert
´PA 18° 53´·7N., 72° 51´·8E.
Delete
´ 18° 55´·9N., 72° 52´·3E.

2.25
Wk46/23
II
4214 INDIA - West Coast - Bridge. Works. Wrecks. Dredged depth. Depths. Buoyage. Rock. Dredged area.
Legends. NM Block. (continued)

Chart IN 2016 (INT 7336) [ previous update 1679/22 ] WGS84 DATUM


Insert the accompanying block, centred on: 18° 56´·1N., 72° 54´·0E.
bridge, double pecked line, width 50m, joining: 18° 59´·90N., 72° 51´·61E.
(a) 18° 59´·99N., 72° 52´·19E.
(b) 18° 59´·24N., 72° 54´·14E.
(c) 18° 59´·53N., 72° 57´·74E.
18° 59´·24N., 72° 58´·91E.
18° 58´·44N., 73° 00´·00E.
legend, Under construction (2023), along: (a)-(b) above
(b)-(c) above

Gd 19° 00´·22N., 72° 56´·73E.

BdRELIANCE BUOY (d) 18° 59´·80N., 72° 55´·95E.


Delete
JdRELIANCE BUOY , close SE of: (d) above
Move
Jb’1’
] , from: 18° 59´·81N., 72° 56´·23E.
to: 18° 59´·75N., 72° 56´·19E.
Delete
Bd 19° 00´·25N., 72° 56´·98E.

4146 MALAYSIA - Peninsular Malaysia, West Coast - Buoy.


Source: Marine Department, Malaysian Notice 107/23

Chart 792 [ previous update 3666/23 ] WGS84 DATUM


Delete
HZIp so Vale Fairway 4° 08´·91N., 100° 32´·88E.

Chart 3944 [ previous update 1854/22 ] WGS84 DATUM


Delete
HZIp so 4° 08´·78N., 100° 32´·65E.

4110* VIETNAM - Bridge. Vertical clearance. Legends. Floating dock.


Source: VMS-South
Note: Former Notice 5109(P)/20 is cancelled.

Chart 1036 [ previous update 3720/23 ] WGS84 DATUM


Insert bridge, double firm line, width 40m, joining: (a) 10° 46´·85N., 106° 42´·48E.
(b) 10° 46´·75N., 106° 42´·65E.
symbol, vertical clearance, 11m, close S of: (a)-(b) above
legend, Ba Son Bridge, close E of: (b) above
Delete floating dock, centred on: (c) 10° 46´·81N., 106° 42´·53E.
legend, Floating Dock, close E of: (c) above

2.26
Wk46/23
II

4126 VIETNAM - Depths.


Source: VMS South Notice 177/23

Chart 3874 (Panel, Quy Nhon) [ previous update 3300/23 ] WGS84 DATUM
Insert depth, 63 (a) 13° 46´·81N., 109° 14´·80E.
Delete depth, 65, close SW of: (a) above

4150 CHINA - East Coast - Wreck.


Source: Chinese Notice 29/1034/23

Chart 1759 [ previous update 4100/23 ] CGCS 2000 DATUM


Insert
´Rep(2023) PA 29° 01´·9N., 121° 54´·9E.

4173 TAIWAN - Buoyage.


Source: UKHO

Chart 1760 [ previous update 3770/23 ] WGS84 DATUM


Insert
GsQX (9)15s 23° 56´·3N., 120° 08´·7E.
23° 52´·0N., 120° 05´·3E.

GrQ(3)10s
W 23° 55´·8N., 120° 12´·2E.
23° 51´·4N., 120° 08´·4E.
Delete
GsQX (9)15s 23° 58´·1N., 120° 12´·9E.

Chart 2409 [ previous update 4004/23 ] WGS84 DATUM


Insert
GXQs (9)15s 23° 56´·31N., 120° 08´·68E.
23° 51´·96N., 120° 05´·27E.

GrQW (3)10s 23° 55´·80N., 120° 12´·18E.


23° 51´·37N., 120° 08´·41E.
Delete
GsQ(9)15s
X 23° 57´·90N., 120° 12´·78E.

GqQV (6)+LFI.15s 23° 57´·18N., 120° 14´·16E.

Chart 3231 [ previous update 4004/23 ] WGS84 DATUM


Insert
GsQ(9)15s
X 23° 56´·31N., 120° 08´·68E.
23° 51´·96N., 120° 05´·27E.

GrQW (3)10s 23° 55´·80N., 120° 12´·18E.


23° 51´·37N., 120° 08´·41E.
Delete
GsQ(9)15s
X 23° 57´·90N., 120° 12´·78E.

GqQV (6)+LFI.15s 23° 57´·18N., 120° 14´·16E.

2.27
Wk46/23
II

4175 CHINA - Yellow Sea Coast - Radio reporting lines. Legends.


Source: Chinese Chart 11310

Chart 1249 [ previous update 4007/23 ] CGCS 2000 DATUM


Insert radio reporting line, inbound and outbound, pecked line
joining: 38° 51´·8N., 121° 41´·5E.
(a) 38° 45´·0N., 121° 41´·5E.
(b) 38° 45´·0N., 121° 58´·0E.
legend, Dalian VTS (see Note), along: (a)-(b) above
Delete former semi-circular limit of radio reporting line, inbound and
outbound, pecked line, and associated legend, Dalian VTS (see
Note), joining: 38° 51´·9N., 121° 32´·9E.
38° 40´·7N., 121° 58´·0E.

Chart 1255 [ previous update 2907/23 ] CGCS 2000 DATUM


Insert radio reporting line, inbound and outbound, pecked line
joining: 39° 01´·9N., 121° 57´·7E.
39° 00´·0N., 122° 06´·0E.
(a) 38° 45´·0N., 122° 06´·0E.
(b) 38° 45´·0N., 121° 41´·5E.
38° 51´·8N., 121° 41´·5E.
legend, Dalian VTS (see Note), along: (a)-(b) above
Delete former semi-circular limit of radio reporting line, inbound and
outbound, pecked line, and associated legend, Dalian VTS (see
Note), joining: 39° 03´·0N., 121° 58´·1E.
38° 51´·9N., 121° 32´·9E.

Chart 3690 [ previous update New Edition 01/10/2020 ] CGCS 2000 DATUM
Insert radio reporting line, inbound and outbound, pecked line
joining: (a) 39° 01´·868N., 121° 57´·756E.
(b) 39° 01´·359N., 122° 00´·000E.
legend, Dalian VTS (see Note), along: (a)-(b) above
Delete former semi-circular limit of radio reporting line, inbound and
outbound, pecked line, and associated legend, Dalian VTS (see
Note), joining: 39° 03´·016N., 121° 58´·141E.
39° 02´·001N., 122° 00´·000E.

Chart 3697 [ previous update 2813/23 ] CGCS 2000 DATUM


Insert radio reporting line, inbound and outbound, pecked line
joining: (a) 39° 01´·87N., 121° 57´·76E.
(b) 39° 00´·33N., 122° 04´·53E.
legend, Dalian VTS (see Note), along: (a)-(b) above
radio reporting line, inbound and outbound, pecked line
joining: (c) 38° 51´·84N., 121° 41´·50E.
(d) 38° 49´·00N., 121° 41´·50E.
legend, Dalian VTS (see Note), along: (c)-(d) above
Delete former semi-circular limit of radio reporting line, inbound and
outbound, pecked line, and associated legend, Dalian VTS (see
Note), joining: 39° 03´·01N., 121° 58´·14E.
38° 57´·56N., 122° 04´·52E.

2.28
Wk46/23
II

4183 VIETNAM - Alongside depth.


Source: VMS-South Notice 258/22

Chart 1036 [ previous update 4110/23 ] WGS84 DATUM


Insert alongside depth, ã(7) 10° 46´·06N., 106° 44´·17E.

4189 CHINA - South Coast - Buoy.


Source: Chinese Notice 34/1239/23

Chart 3890 [ previous update 3984/23 ] CGCS 2000 DATUM


Amend designation of buoy to, No 6A 20° 21´·09N., 110° 48´·58E.

4225 THAILAND - Gulf of Thailand Coast - Depths. Buoy.


Source: ENC TH400112

Chart 999 [ previous update New Edition 09/07/2020 ] WGS84 DATUM


Insert depth, 68 (a) 13° 34´·00N., 100° 34´·57E.
Delete depth, 75 , close N of: (a) above
Insert depth, 64 , enclosed by 10m contour (b) 13° 33´·74N., 100° 34´·46E.
Delete depth, 105 , close NE of: (b) above
Insert depth, 66 , and extend 10m contour N to enclose 13° 33´·51N., 100° 34´·61E.
depth, 39 , and extend 5m contour E to enclose (c) 13° 33´·35N., 100° 34´·53E.
Delete depth, 34 , close W of: (c) above
Insert depth, 46 , and extend 5m contour NE to enclose (d) 13° 32´·87N., 100° 34´·88E.
Delete depth, 54 , close N of: (d) above
Move
B;Fl.Y.3s,
f from:
13° 22´·71N., 100° 31´·90E.
to: 13° 22´·17N., 100° 31´·90E.

4191 JAPAN - Honshū - NM Block.


Source: Japanese Notice 43/462/23

Chart JP 1162A [ previous update 1583/23 ] WGS84 DATUM


Insert the accompanying block, centred on: 36° 48´ 06"N., 137° 04´ 01"E.

4192 JAPAN - Seto Naikai - Buoyage.


Source: Japanese Notice 43/465/23

Chart JP 129 [ previous update 3252/23 ] WGS84 DATUM


Replace
Cb(G Lt) with Jb(G Lt) 33° 47´ 28·6"N., 131° 00´ 58·5"E.

2.29
Wk46/23
II

4193 JAPAN - Kyūshū - Superbuoy.


Source: Japanese Notice 43/466/23

Chart JP 187 [ previous update 2087/23 ] WGS84 DATUM


Insert
ê{ 31° 37´·3N., 129° 29´·2E.

Chart JP 213 [ previous update 2957/23 ] WGS84 DATUM


Insert
êfMo(U)
¿ 8s 31° 37´·32N., 129° 29´·17E.

Chart JP 1222 [ previous update 2976/22 ] WGS84 DATUM


Insert
êfMo(U)
¿ 8s 31° 37´·32N., 129° 29´·17E.

Chart 3237 [ previous update 1451/23 ] WGS84 DATUM


Insert
PfMo(U)8s 31° 37´·3N., 129° 29´·2E.

4177 RUSSIA - Pacific Ocean Coast - Depths.


Source: ENC RU5MRW60

Chart 2161 (Panel E, Portovyy Punkt Shakhtërsk) [ previous update 5054/22 ] WGS84 DATUM
Insert depth, 34 (a) 49° 09´·74N., 142° 03´·22E.
Delete depth, 08, close SW of: (a) above
former 0m contour, joining: 49° 09´·73N., 142° 03´·30E.
49° 09´·78N., 142° 03´·28E.

4186 KOREA - West Coast - Buoyage.


Source: Korean Notice 31/571/23 and ENC KR3F2J00

Chart 1258 [ previous update 3900/23 ] WGS84 DATUM


Insert
¸fFl(5)Y.20s ODAS A 37° 22´·72N., 125° 06´·00E.

¸fFl(5)Y.20s ODAS B 37° 05´·70N., 125° 07´·65E.

¸fFl(5)Y.20s ODAS C 37° 08´·90N., 124° 45´·52E.

4202 KOREA - East Coast - Light.


Source: Korean Notice 33/607/23

Chart 896 (INT 5355) [ previous update New Edition 22/06/2023 ] WGS84 DATUM
Delete
¶{ 35° 15´·81N., 129° 14´·38E.

2.30
Wk46/23
II

4118 MALAYSIA - Sabah - Legends. Light.


Source: Malaysian Notice M1 159/22, UKHO and ENC MY3C0864

Chart 1338 [ previous update 3528/23 ] WGS84 DATUM


Delete
¶ Fl(2)15s10M T. Kubong and associated circular white arc 5° 23´·5N., 115° 15´·1E.

Chart 1844 [ previous update 3676/22 ] WGS84 DATUM


Amend legend to, Victoria Bay Port Limit, centred on: 5° 08´·52N., 115° 07´·58E.
5° 16´·71N., 115° 05´·34E.
5° 12´·34N., 115° 17´·24E.

Chart 2109 [ previous update 3528/23 ] WGS84 DATUM


Amend legend to, Victoria Bay Port Limit, centred on: 5° 12´·78N., 115° 04´·20E.
Delete
¶ Fl(2)15s10M T. Kubong and associated circular white arc 5° 23´·54N., 115° 15´·07E.

Chart 2111 [ previous update 3676/22 ] WGS84 DATUM


Amend legend to, Victoria Bay Port Limit, centred on: 5° 16´·45N., 115° 05´·30E.
Delete
¶ Fl(2)15s10M Tanjung Kubong and associated circular
white arc 5° 23´·57N., 115° 15´·08E.

Chart 3483 (INT 551) [ previous update 3234/23 ] WGS84 DATUM


Delete
¶ Fl(2)10M T.Kubong 5° 23´·6N., 115° 14´·9E.

Chart 4508 (INT 508) [ previous update 3719/23 ] WGS84 DATUM


Delete
¶{ 5° 23´·4N., 115° 14´·9E.

4211 INDONESIA - Sulawesi - Lights.


Source: ENC ID300319

Chart 2472 [ previous update 3344/23 ] WGS84 DATUM


Delete
¶ Fl.R & Fl.G.10M 3° 32´·4S., 120° 26´·3E.

Chart 2954 [ previous update 3344/23 ] WGS84 DATUM


Delete
¶ Fl.R.4s8m10M 3° 32´·6S., 120° 25´·3E.

¶ Fl.G.3s7m10M 3° 32´·4S., 120° 26´·3E.

2.31
Wk46/23
II

4115 SOUTH PACIFIC OCEAN - Polynésie Française - Restricted area. Reported anchorage.
Source: French Notices 40/228/19 and 21/228/23

Chart 1436 (Panel B, Port De Papeete) [ previous update 4995/22 ] IGN 1951-1954 DATUM
Insert limit of restricted area, ÇÅÇ, joining: 17° 31´·600S., 149° 33´·067W.
17° 31´·549S., 149° 33´·071W.
17° 31´·308S., 149° 33´·204W.
17° 31´·099S., 149° 33´·393W.
17° 31´·053S., 149° 33´·345W.
17° 31´·053S., 149° 33´·289W.
17° 31´·155S., 149° 33´·161W.
17° 31´·084S., 149° 33´·077W.
17° 31´·203S., 149° 32´·933W.
17° 31´·367S., 149° 32´·761W.
17° 31´·505S., 149° 32´·692W.
Delete
½ 17° 31´·380S., 149° 32´·847W.

Chart 1436 (Panel A, Approaches to Port De Papeete) [ previous update 4995/22 ] IGN 1951-1954 DATUM
Insert limit of restricted area, ÇÅÇ, joining: 17° 31´·60S., 149° 33´·06W.
17° 31´·55S., 149° 33´·07W.
17° 31´·31S., 149° 33´·20W.
17° 31´·10S., 149° 33´·39W.
17° 31´·03S., 149° 33´·32W.
17° 31´·15S., 149° 33´·16W.
17° 31´·08S., 149° 33´·07W.
17° 31´·20S., 149° 32´·93W.
17° 31´·37S., 149° 32´·76W.
17° 31´·50S., 149° 32´·69W.
Delete
½ 17° 31´·38S., 149° 32´·84W.

4117 CANADA - British Columbia - Depth. Wreck.


Source: Canadian Notices 6/3441-3442/23

Chart 4954 [ previous update 2125/23 ] NAD83 DATUM


Insert
15,Wk 48° 46´·09N., 123° 11´·64W.
depth, 09, and extend 2m contour NE to enclose 48° 46´·36N., 123° 14´·51W.

Chart 4955 [ previous update 2494/23 ] NAD83 DATUM


Insert
15,Wk 48° 46´·09N., 123° 11´·64W.
depth, 09, and extend 2m contour NE to enclose 48° 46´·36N., 123° 14´·51W.

2.32
Wk46/23
II

4131 UNITED STATES OF AMERICA - West Coast - Fog signal.


Source: US Coast Guard District 13 LNM 32/18521/23

Chart 2839 (Panel A) [ previous update 3648/23 ] NAD83 DATUM


Delete fog signal, Gong, at buoy 46° 11´·59N., 123° 53´·13W.

4163 CANADA - British Columbia - Lights.


Source: Canadian Notices 8/3605/23 and 8/3744/23
Note: Radar beacon remains unchanged.

Chart 4923 [ previous update 1564/23 ] NAD27 DATUM


Amend light to, Fl R 10s81ft16M 50° 58´·5N., 127° 43´·6W.
Replace
ã{¿ Fl 50 ft 9M, with, ã{ Fl 42ft 9M 50° 54´·3N., 127° 59´·0W.

Chart 4942 [ previous update 2334/23 ] NAD83 DATUM


Amend light to, Fl R 10s25m16M 50° 58´·53N., 127° 43´·70W.
Replace
ã{¿ Fl 14m9M, with, ã{ Fl 13m9M 50° 54´·29N., 127° 59´·14W.

4180 CANADA - British Columbia - Light.


Source: Canadian Notice 6/3495/23

Chart 4965 [ previous update 1201/23 ] NAD83 DATUM


Insert
ã{ Fl Y (Priv) 49° 17´ 34·3"N., 122° 52´ 02·8"W.

4123 CHILE - Northern Coasts - Wreck. Depth.


Source: Chilean Notice 8/48/23

Chart 4237 [ previous update 3583/23 ] SIRGAS DATUM


Insert
´Masts (a) 29° 57´·12S., 71° 19´·60W.
Delete depth, 69, close W of: (a) above

4125* GUATEMALA - West Coast - Buoy.


Source: mv Maersk Glacier

Chart 1946 (Panel B, Quetzal) [ previous update New Edition 08/12/2022 ] WGS84 DATUM
Delete
G;Q.Y
f ’F’ 13° 55´·684N., 90° 47´·436W.

2.33
Wk46/23
II

4128 ECUADOR - Buoyage. Wrecks.


Source: ENC EC510401

Chart 2799 (Panel A, Manta) [ previous update New Edition 24/03/2022 ] WGS84 DATUM
Delete
GoFl(2)4s
Y ’Don Victor’
(a) 0° 56´·335S., 80° 42´·965W.

®, close SE of: (a) above

GYFl(2)5s
o ’Danny Mary’
(b) 0° 56´·209S., 80° 43´·164W.

®, close SW of: (b) above

4116 ARGENTINA - Data collection buoys.


Source: Argentine Notice 6/75(T)/23

Chart 3330 [ previous update 456/23 ] WGS84 DATUM


Insert
P ODAS (2 buoys) 41° 11´·0S., 63° 46´·8W.

PODAS 41° 12´·1S., 62° 17´·9W.

4120 ARGENTINA - Buoyage.


Source: Argentine Notice 8/111/23

Chart 1325 [ previous update New Edition 26/08/2021 ] WGS84 DATUM


Insert
I[Fb l(4)G.16s Km 151·4 33° 52´·19S., 59° 16´·65W.
Delete former I[F b l(4)G.16s Km 151·4 33° 52´·73S., 59° 15´·92W.

4122 BRAZIL - South Coast - Depths.


Source: Brazilian Notice 13/S 114(P)/23

Chart 431 [ previous update 595/23 ] WGS84 DATUM


Insert depth, 133 22° 56´·90S., 43° 50´·51W.
depth, 139 22° 56´·64S., 43° 49´·93W.

2.34
Wk46/23
II

4129 BRAZIL - South Coast - Depths.


Source: Brazilian Notice 15/S 129(P)/23

Chart 433 (Panel, Approaches to Angra dos Reis and Tebig Oil Terminal) [ previous update 3541/22 ] WGS84 DATUM
Insert depth, 109 (a) 23° 02´·55S., 44° 14´·78W.
Delete depth, 126, close SW of: (a) above
Insert depth, 119 (b) 23° 02´·13S., 44° 14´·85W.
Delete depth, 138, close S of: (b) above
Insert depth, 112 (c) 23° 01´·69S., 44° 14´·81W.
Delete depth, 125, close NE of: (c) above
Insert depth, 98, enclosed by 10m contour (d) 23° 01´·28S., 44° 14´·63W.
Delete depth, 109, close NW of: (d) above
Insert depth, 61 (e) 23° 00´·95S., 44° 14´·43W.
Delete depth, 98, close SW of: (e) above
depth, 78, close NE of: (e) above

4156 BRAZIL - East Coast - Depths.


Source: ENC BR501105

Chart 540 [ previous update 2341/22 ] WGS84 DATUM


Insert depth, 12, enclosed by 2m contour, with seabed type, R (a) 12° 44´·98S., 38° 39´·21W.
Delete depth, 52, close SE of: (a) above

4204 ARGENTINA - Foul.


Source: Argentine Navigation Warning 8/40/23

Chart 3331 (Panel A, Puerto Madryn) [ previous update 3665/22 ] WGS84 DATUM
Insert
« 42° 44´·50S., 65° 01´·20W.

4119 CUBA - South Coast - Light.


Source: Cuban Notice 8/170/23

Chart 2846 [ previous update 930/23 ] WGS84 DATUM


Amend light to, Fl.5s58m18M 21° 51´·5N., 80° 12´·5W.

Chart 2996 [ previous update 2024/23 ] WGS84 DATUM


Amend light to, Fl.18M 21° 51´·5N., 80° 12´·5W.

2.35
Wk46/23
II

4133 UNITED STATES OF AMERICA - Gulf of Mexico - Radar beacon.


Source: US Coast Guard District 7 LNM 34/11415/23

Chart 3852 [ previous update New Chart 03/11/2022 ] NAD83 DATUM


Delete radar beacon, Racon(T), at light-buoy 27° 35´·3N., 83° 00´·7W.

Chart 3853 [ previous update 3745/23 ] NAD83 DATUM


Delete radar beacon, Racon(T), at light-buoy 27° 35´·3N., 83° 00´·7W.

4148 COLOMBIA - Caribbean Sea Coast - Buoy.


Source: ENC CO400624

Chart 1278 [ previous update 4366/22 ] WGS84 DATUM


Delete
GmQ 8° 40´·79N., 76° 55´·59W.

4167 VENEZUELA - Light.


Source: Venezuelan Notice 15/23

Chart 517 [ previous update 3626/23 ] WGS84 DATUM


Insert
¶ Fl.10s35M 8° 33´·4N., 59° 59´·7W.

Chart 1045 [ previous update 733/23 ] WGS84 DATUM


Insert
¶ Fl.10s35M 8° 33´·4N., 59° 59´·7W.

4187 WEST INDIES - Leeward Islands - Obstruction. Buoy.


Source: ENC NL6SM211

Chart 2079 (Panel D, Groot Baai) [ previous update 2061/23 ] WGS84 DATUM
Insert
15%-Obstn 18° 00´·255N., 63° 02´·396W.
Replace
GfFl.5s, with Gf 18° 00´·885N., 63° 03´·255W.

4132 CANADA - Gulf of Saint Lawrence - Buoy.


Source: Canadian Notice 8/4486/23

Chart 4768 [ previous update 1304/23 ] NAD83 DATUM


Move
Jw Mo(A) TJ, from: 47° 42´·56N., 64° 39´·51W.
to: 47° 42´·51N., 64° 39´·45W.

2.36
Wk46/23
II

4134 UNITED STATES OF AMERICA - East Coast - Buoyage.


Source: US Coast Guard District 1 LNM 34/13218/23

Chart 2456 [ previous update 3634/23 ] NAD83 DATUM


Insert
GfFl.Y.20s 41° 19´·79N., 70° 54´·64W.
41° 09´·56N., 70° 38´·32W.

Chart 2890 [ previous update 2921/23 ] NAD83 DATUM


Insert
GfFl.Y.20s 41° 19´·79N., 70° 54´·64W.

4135 UNITED STATES OF AMERICA - East Coast - Obstructions. Depths.


Source: OCS

Chart 2850 [ previous update 3563/23 ] NAD83 DATUM


Insert
26,Obstn 39° 07´·47N., 76° 18´·94W.

27,Obstn 39° 07´·03N., 76° 18´·18W.

25,Obstn 39° 03´·35N., 76° 19´·51W.

28,Obstn 39° 02´·84N., 76° 22´·29W.

14,Obstn 39° 04´·44N., 76° 23´·92W.

Chart 2921 (Panel 2) [ previous update 3715/23 ] NAD83 DATUM


Insert
25,Obstn 39° 03´·35N., 76° 19´·51W.

28,Obstn (a) 39° 02´·84N., 76° 22´·29W.


Delete depth, 34, close E of: (a) above
Insert
14,Obstn (b) 39° 04´·44N., 76° 23´·92W.
Delete depth, 16, close SE of: (b) above

Chart 2921 (Panel 1) [ previous update 3715/23 ] NAD83 DATUM


Insert
5+Obstn 38° 46´·60N., 76° 20´·73W.

6+Obstn 38° 43´·66N., 76° 21´·93W.

4+Obstn 38° 43´·51N., 76° 21´·44W.

6+Obstn (a) 38° 42´·20N., 76° 22´·34W.


Delete depth, 12, close NE of: (a) above

4171 UNITED STATES OF AMERICA - East Coast - Depths.


Source: ENC US5NYCBH

Chart 3459 [ previous update 1099/23 ] NAD83 DATUM


Insert depth, 11, and extend 18ft contour E to enclose (a) 40° 32´·49N., 73° 56´·69W.
Delete depth, 15, close NW of: (a) above

2.37
Wk46/23
II

4181 UNITED STATES OF AMERICA - East Coast - Light-beacons. Leading lines.


Source: ENC US5SC14M

Chart 2809 [ previous update 2356/23 ] NAD83 DATUM


Insert
Tw§ Iso.R.6s.37ft & 2Fl.6s.35ft4M (a) 32° 48´·58N., 79° 54´·54W.

Tw§ Q.R.21ft 32° 48´·62N., 79° 54´·62W.


leading line, pecked line for 560m then firm line for 1340m,
extending in direction 300·9°, from: (b) (a) above
legend, 120·9°, seaward end of: (b) above
Delete
Tw§ Q.R.23ft 32° 48´·65N., 79° 54´·55W.

Tw§ Iso.R.6s37ft (c) 32° 48´·60N., 79° 54´·43W.


leading line, pecked line and firm line, and associated legend,
118·6°, extending in direction 298·6°, from: (c) above

2.38
Wk46/23
II

4152(P)/23 SCOTLAND - East Coast - Leading lights. Lights. Buoyage. Dredged area.
Restricted area.
Source: Aberdeen Harbour and Northern Lighthouse Board
1. New leading lights, lights, buoyage and dredged areas have been established at Aberdeen South Harbour.
2. The rear leading light, F.5M (visible 222° - 242°), has been established in position 57° 07´·715N., 2° 03´·180W.
3. The front leading light, Dir WRG 2s, has been established in position 57° 07´·750N., 2° 03´·104W. , with sectors as
follows:

Iso G 222° - 228° (6°)


Al WG 228° - 231° (3°)
Iso W 231° - 233° (2°)
Al WR 233° - 236° (3°)
Iso R 236° - 242° (6°)
4. Lights have been established in the following positions:

Characteristic Position
Fl(2)R.6s 57° 07´·934N., 2° 02´·492W.
Fl.R.2s 57° 07´·818N., 2° 02´·747W.
Fl.G.2s 57° 07´·930N., 2° 02´·920W.
Fl.G.4s 57° 07´·909N., 2° 03´·121W.
Fl.G.4s 57° 07´·914N., 2° 03´·155W.
Fl.R.4s 57° 07´·938N., 2° 03´·555W.
5. The following light-buoys have been established:

Characteristic Designation Buoy Type Position


Fl(2)G.8s No 1 Green conical buoy 57° 08´·124N., 2° 02´·428W.
Fl.R.2s No 2 Red spar buoy 57° 07´·803N., 2° 02´·971W.
Fl.R.2s No 4 Red spar buoy 57° 07´·829N., 2° 03´·131W.
Fl.R.2s No 6 Red spar buoy 57° 07´·855N., 2° 03´·298W.
Fl.R.2s No 8 Red spar buoy 57° 07´·889N., 2° 03´·418W.
6. The Harbour has been dredged to between 9m and 10·5m.
7. The Entry Restricted area, within an area bounded by the following positions, has been removed:

57° 08´·280N., 2° 02´·810W.


57° 08´·280N., 2° 02´·150W.
57° 07´·630N., 2° 02´·150W.
57° 07´·630N., 2° 03´·040W.
8. Mariners are advised to navigate with caution in the area.
9. These changes will be included in the next New Edition of Chart 1446 to be published early 2024.
10. Charts 210, 5617_4 and 5617_16 will be updated by Notice to Mariners.
(ETRS89 DATUM)

Chart affected - 1446 (INT 1542)

4154(T)/23 ENGLAND - South Coast - Beacon. Buoy.


Source: Poole Harbour Commissioners Notice 25/23
1. The unlit beacon in position 50° 42´·258N., 1° 59´·869W. is reported as submerged. It is marked by a yellow buoy.
2. Mariners are advised to navigate with caution in the area.
(ETRS89 DATUM)

Charts affected - 2611 (INT 1726) - 5601_11

2.39
Wk46/23
II

4161(T)/23 ISLE OF MAN - Buoy.


Source: Isle of Man Government Notice 08/23
1. A yellow wave data collection buoy, Fl(5)Y.20s, with X shape topmark, has been established in position
54° 19´·20N., 4° 05´·40W.
2. Mariners are advised to navigate with caution in the area.
(ETRS89 DATUM)

Charts affected - 1320 - 1346 - 1826 (INT 1607) - 2094 - 5613_2 - 5613_21

4162(T)/23 SCOTLAND - West Coast - Light. Works.


Source: Northern Lighthouse Board Notice 07/2023
1. The range of the light in position 56° 58´·15N., 6° 40´·84W. has been temporarily reduced to 12 miles due to the ongoing
refurbishment works of the Hyskeir lighthouse.
2. Mariners are advised to navigate with caution in the area.
(ETRS89 DATUM)

Charts affected - 1127 (INT 1065) - 1795 (INT 1626) - 1796 (INT 1627) - 2635 (INT 1061) - 5616_12 - 5616_13 -
5616_14 - 5616_27

4164(P)/23 ENGLAND - South Coast - Works. Jetty. Pontoons. Mooring buoy. Hulk. Light.
Source: Dart Harbour and Navigation Authority
1. There are ongoing works at Sandquay to upgrade the Admiralty jetty and pontoons, in an area bounded by the following
positions:

50° 21´·618N., 3° 34´·811W.


50° 21´·538N., 3° 34´·707W.
50° 21´·576N., 3° 34´·645W.
50° 21´·619N., 3° 34´·704W.
50° 21´·683N., 3° 34´·805W.
50° 21´·659N., 3° 34´·848W.
2. The mooring buoy in position 50° 21´·609N., 3° 34´·723W. has been removed.
3. The Hulk, HMS Hindostan, in position 50° 21´·595N., 3° 34´·705W. has been temporarily removed.
4. The light, 2F.R(vert), in position 50° 21´·659N., 3° 34´·819W. has been removed and will be replaced when the new
pontoons have been established.
5. Mariners are advised to navigate with caution in the area.
6. Charts will be updated when works are complete.
(ETRS89 DATUM)

Charts affected - 2253 (INT 1723) - 5602_9

4216(T)/23 WALES - South Coast - Works. Berth. Jetty. Lights.


Source: Port of Milford Haven
1. Works are taking place at Valero Terminal Berth 2 Jetty: 51° 41´·89N., 5° 01´·73W.
2. The jetty will be closed to commercial tanker traffic for the duration of the works.

2.40
Wk46/23
II
4216(T)/23 WALES - South Coast - Works. Berth. Jetty. Lights. (continued)
3. Fixed green lights marking jetty are extinguished until works are complete.
4. Mariners are advised to navigate with caution in the area.
(ETRS89 DATUM)

Charts affected - 3274 (INT 1650) - 3275 (INT 1651) - 5620_12 - 5620_13

4221(T)/23 SCOTLAND - West Coast - Current meter. Buoy.


Source: Bakkafrost Scotland
1. A current meter has been established on the seabed in position 56° 26´·56N., 6° 14´·80W. It is expected to be in place until
late December 2023.
2. The current meter is marked by an unlit yellow buoy.
3. Mariners are advised to navigate with caution in the area.
(ETRS89 DATUM)

Charts affected - 2171 - 2652 - 2771 - 5611_11 - 5611_21

4149(P)/23 FINLAND - West Coast - Fairways. Swept areas. Buoyage.


Source: Finnish Notice 22/162/23
1. Significant changes to fairways and navigational marks have taken place in the approaches to Ajos between positions:

65° 39´·24N., 24° 30´·47E.


65° 20´·18N., 23° 56´·58E.
2. For the latest information regarding swept depth areas and changes to associated buoyage within the port and approaches,
mariners are advised to consult the local port authorities and to navigate with caution in the area.
3. These and other changes will be included in the next New Editions of Charts 3800 and 3864.
(WGS84 DATUM)

Charts affected - 3800 (INT 1152) - 3864 (INT 1150)

4160(T)/23 SWEDEN - East Coast - Works. Jetty.


Source: Swedish Notice 985/18046(T)/23
1. Jetty works are taking place on jetty 5 in the vicinity of position 59° 43´·39N., 19° 04´·00E.
2. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Charts affected - 887 (INT 1775) - 888 (INT 1776)

2.41
Wk46/23
II

4170(T)/23 SWEDEN - East Coast - Restricted area. Works. Buoyage.


Source: Swedish Notice 976/17858(T)/23
1. A restricted area has been established bounded by the following positions:

*59° 18´·949N., 18° 06´·883E.


*59° 19´·051N., 18° 06´·877E.
*59° 19´·053N., 18° 06´·988E.
*59° 18´·959N., 18° 06´·996E.
2. The area is closed to shipping due to diving operations works.
3. *The area is marked by special purpose buoys.
4. Mariners are advised to keep well clear and navigate with caution.
5. *Former Notice 3056(T)/23 is cancelled.
*Indicates new or revised entry
(WGS84 DATUM)

Charts affected - 811 (INT 1239) - 820 (INT 1238)

4172(T)/23 SWEDEN - East Coast - Bridge. Buoyage. Fairway. Vertical clearances. Works.
Source: Swedish Notices 974/17810(T)/23 and 985/17912/23
1. Partial restrictions are in force at Skurubron bridge, in position 59° 18’ .84N. , 18° 13’ .30E. , as follows:

Date Restrictions
August 14th – November 12th 2023 Fairway width is reduced by half – refer to the existing
buoyage
August 14th – November 17th 2023 Vertical clearance reduced to 27·5m
November 18th 2023 – November 18th 2025 Vertical clearance reduced to 29·0m
2. *Screens will be installed to limit the spread of sediment, marked by lit and unlit special purpose buoys, in the following
positions:

59° 18´·83N., 18° 13´·28E.


59° 18´·83N., 18° 13´·27E.
59° 18´·82N., 18° 13´·28E.
and
59° 18´·83N., 18° 13´·32E.
59° 18´·83N., 18° 13´·32E.
59° 18´·82N., 18° 13´·33E.
3. *Former Notice 2874(T)/23 is cancelled.
*Indicates new or revised entry
(WGS84 DATUM)

Chart affected - 820 (INT 1238)

2.42
Wk46/23
II

4151(T)/23 NETHERLANDS - Works. Lights. Leading lights. Fairway.


Source: Netherlands Notice 42/325(T)/23
1. Due to maintenance works the sector lights and leading lights in the Westerschelde main fairway will be alternately
extinguished between the following positions:

Location Position
Braakmanhaven 51° 21´·71N., 3° 45´·56E.
Netherlands-Belgium Border 51° 22´·43N., 4° 13´·06E.
2. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Charts affected - 120 (INT 1479) - 128 (INT 1478)

4104(T)/23 PORTUGAL - West Coast - Buoy.


Source: Portuguese Notice 7/191(T)/23
1. The light on the Aveiro light-buoy in position 40° 37´·86N., 8° 46´·98W. has been amended to QW.
(WGS84 DATUM)

Chart affected - 3227 (INT 1872)

4127(P)/23 PORTUGAL - West Coast - Harbour limit. Depths. Drying patches. Alongside depths. Reclamation
area. Anchorage area. Obstruction.
Source: *ENCs PT526308, PT526309 and Portuguese Notice 7/188/23
1. The limit of Setubal Harbour has been amended and now joins the following positions:

38° 29´·164N., 8° 54´·303W.


38° 26´·794N., 8° 54´·303W.
38° 26´·794N., 8° 57´·881W.
38° 26´·915N., 8° 58´·251W.
38° 27´·223N., 8° 58´·456W.
38° 27´·810N., 8° 57´·933W.
38° 29´·280N., 8° 56´·094W.
2. Depths less than charted exist within the approaches and port of Setubal. The most significant are as follows:

Depth Position
7·4m 38° 26´·893N., 8° 58´·274W.
11·4m 38° 28´·715N., 8° 56´·398W.
11·8m 38° 30´·053N., 8° 55´·240W.
9·4m 38° 29´·676N., 8° 55´·274W.
3. Drying banks in the area SW of Ponta do Adoxe 38° 29´·615N., 8° 54´·309W. have changed significantly.
4. Alongside depths within the port have changed. The most significant are as follows:

Depth Position
4·8m 38° 31´·086N., 8° 53´·970W.
8·7m 38° 31´·148N., 8° 52´·911W.
9·7m 38° 31´·126N., 8° 52´·817W.
11·4m 38° 30´·922N., 8° 52´·507W.
*8·1m 38° 30´·474N., 8° 51´·131W.

2.43
Wk46/23
II
4127(P)/23 PORTUGAL - West Coast - Harbour limit. Depths. Drying patches. Alongside depths. Reclamation
area. Anchorage area. Obstruction. (continued)
5. A reclamation area has been established adjacent to the RoRo ferry terminal, joining the following positions:

38° 30´·603N., 8° 51´·289W.


38° 30´·447N., 8° 51´·418W.
38° 30´·612N., 8° 51´·767W.
6. * An obstruction, 9·3m, exists in position 38° 29´·969N., 8° 50´·681W.
7. The limits of the Tróia B anchorage area have been extended and now join the following positions:

38° 27´·600N., 8° 51´·000W.


38° 28´·600N., 8° 51´·000W.
38° 27´·420N., 8° 48´·250W.
38° 27´·080N., 8° 48´·250W.
38° 27´·270N., 8° 49´·200W.
38° 27´·140N., 8° 50´·000W.
8. These and other changes will be included in the next New Editions of Charts 3259 and 3260.
9. *Former Notice 2879(P)/23 is cancelled.
*Indicates new or revised entry.
(WGS84 DATUM)

Charts affected - 3259 (INT 1880) - 3260 (INT 1881)

4168(T)/23 PORTUGAL - West Coast - Works. Bridge. Buoyage.


Source: Portuguese Notice 7/190(T)/23
1. Works are in progress at the Engenheiro Edgar Cardoso bridge.
2. The following lateral light-buoys have been established to mark the channel for navigation:

Characteristic Designation Buoy Type Position


VQ(3)G.5s2M ML-1 Starboard 40° 08´·695N., 8° 50´·558W.
VQ(3)R.5s2M ML-2 Port 40° 08´·717N., 8° 50´·557W.
VQ(3)G.5s2M ML-3 Starboard 40° 08´·693N., 8° 50´·473W.
VQ(3)R.5s2M ML-4 Port 40° 08´·716N., 8° 50´·472W.
3. Mariners are advised to use the marked channel and to navigate with caution in the area.
(WGS84 DATUM)

Chart affected - 3228

4107(T)/23 NORTH ATLANTIC OCEAN - Arquipélago dos Açores - Buoy.


Source: Portuguese Notice 7/202(T)/23
1. An ODAS buoy, Fl.Y.3s, has been deployed in position 36° 56´·38N., 25° 08´·96W.
(WGS84 DATUM)

Chart affected - 1959

2.44
Wk46/23
II

4108(T)/23 NORTH ATLANTIC OCEAN - Arquipélago dos Açores - Buoy.


Source: Portuguese Notice 7/203(T)/23
1. An ODAS light-buoy, Fl(5)Y.20s1M, St.George cross topmark, has been deployed until further notice in position
37° 43´·86N., 25° 39´·847W.
(WGS84 DATUM)

Chart affected - 1895

4157(T)/23 ROMANIA - Restricted area.


Source: Romanian Notice 8/72(T)/23
1. A circular restricted area, entry prohibited, radius 1M, centred on position: 44° 08´·61N., 28° 57´·00E. , has been
established until further notice.
2. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Charts affected - 2230 - 2232 - 2282

4212(T)/23 SPAIN - Mediterranean Sea Coast - Works. Buoyage. Restricted area.


Source: Spanish Notice 35/328(T)/23
1. Works are in progress to regenerate the beaches south of Valencia.
2. East cardinal light-buoys, VQ(3)5s, marking the extent of the works have been established in the following positions:

39° 24´·480N., 0° 18´·240W.


39° 21´·06N., 0° 17´·21W.
3. A special light-buoy, Fl(4)Y.11s, will mark the end of the discharge pipeline and will move as works progress.
4. An extraction area, entry prohibited, has been established joining the following positions:

39° 19´·0N., 0° 10´·6W.


39° 13´·6N., 0° 07´·1W.
39° 16´·0N., 0° 04´·3W.
39° 20´·9N., 0° 07´·8W.
5. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Charts affected - 518 (INT 3172) - 562 (INT 3173) - 1701

4218(P)/23 ITALY - East Coast - Depths. Unsurveyed areas. Waiting area.


Source: ENC IT500191
1. Extensive changes to depths have been identified within and in the approaches to the port of Brindisi.
2. Depths less than charted exist within the port. The most significant are as follows:

Depth Position
4·6m 40° 38´·887N., 17° 59´·209E.
11·5m 40° 38´·828N., 17° 57´·660E.
9·7m 40° 38´·810N., 17° 57´·610E.
6·8m 40° 38´·738N., 17° 57´·285E.

2.45
Wk46/23
II
4218(P)/23 ITALY - East Coast - Depths. Unsurveyed areas. Waiting area. (continued)
3. The charted unsurveyed areas, joining the following positions, have now been surveyed:

40° 38´·805N., 17° 58´·521E.


40° 38´·834N., 17° 58´·673E.
40° 39´·059N., 17° 58´·599E.
40° 39´·046N., 17° 58´·508E.
40° 39´·049N., 17° 58´·489E.
40° 39´·057N., 17° 58´·471E.
40° 39´·068N., 17° 58´·460E.
40° 39´·094N., 17° 58´·444E.
40° 39´·109N., 17° 58´·428E.
40° 39´·115N., 17° 58´·413E.
40° 39´·053N., 17° 58´·101E.
40° 38´·986N., 17° 58´·125E.
40° 38´·991N., 17° 58´·145E.
and

40° 38´·366N., 17° 57´·114E.


40° 38´·365N., 17° 57´·105E.
40° 38´·370N., 17° 57´·089E.
40° 38´·380N., 17° 57´·083E.
40° 38´·465N., 17° 57´·074E.
40° 38´·471N., 17° 57´·075E.
40° 38´·479N., 17° 57´·083E.
40° 38´·482N., 17° 57´·094E.
and

40° 38´·575N., 17° 57´·086E.


40° 38´·573N., 17° 57´·069E.
40° 38´·574N., 17° 57´·062E.
40° 38´·577N., 17° 57´·054E.
40° 38´·582N., 17° 57´·049E.
40° 38´·588N., 17° 57´·048E.
40° 38´·601N., 17° 57´·051E.
40° 38´·606N., 17° 57´·055E.
40° 38´·609N., 17° 57´·062E.
40° 38´·612N., 17° 57´·071E.
40° 38´·611N., 17° 57´·078E.
4. An unsurveyed area exists covering the extent of the quay between berths 25 and 26, joining the following positions:

40° 38´·730N., 17° 58´·209E.


40° 38´·988N., 17° 58´·123E.
40° 38´·993N., 17° 58´·144E.
5. A Waiting Area, radius 50m, has been established centred on position 40° 39´·200N., 17° 57´·699E.
6. Mariners are advised to navigate with caution in the area and consult the local port authority for the latest information.
7. These and other changes will be included in the next New Edition of Chart 1545.
(WGS84 DATUM)

Chart affected - 1545

2.46
Wk46/23
II

4105(T)/23 ANGOLA - Platform.


Source: Portuguese Notice 7/205(T)/23
1. A lit platform, DWS, has been established in position 8° 44´·517S., 13° 14´·267E.
2. All vessels must keep a safe distance and approach with extreme caution.
(WGS84 DATUM)

Chart affected - 303 (INT 2551)

4112(T)/23 SENEGAL - Wreck. Buoy.


Source: French Notice 32/13(T)/23
1. A dangerous wreck, marked by an emergency wreck marking light-buoy, exists in approximate position
14° 01´·91N., 16° 50´·29W.
2. Mariners are advised to navigate with caution in the area.
(UNDETERMINED DATUM)

Charts affected - 607 - 1663 (INT 1953) - 1664 (INT 1954)

4159(T)/23 SAUDI ARABIA - Red Sea Coast - Buoy.


Source: Port of NEOM
1. A Yellow special purpose buoy, X-Shaped Topmark, Fl(5)Y.20s, has been deployed, until further notice, in position
27° 33´·700N., 35° 31´·700E.
2. Mariners are advised to navigate with caution in the area and consult the local port authorities for the latest information.
(WGS84 DATUM)

Chart affected - 12 (INT 7142)

2.47
Wk46/23
II

4103(P)/23 INDIAN OCEAN - Works. Submarine cables.


Source: Alcatel Submarine Networks and UKHO
1. Cable installation works are planned between November 2020 and November 2021 to install the 2-AFRICA-GERA
telecommunications cable joining the following positions for water less than 200m deep:

Segment Approximate positions


Cape Town 33° 41´·70S., 18° 26´·30E.
33° 42´·35S., 18° 24´·52E.
33° 42´·65S., 18° 24´·30E.
33° 43´·61S., 18° 19´·90E.
33° 44´·44S., 18° 19´·27E.
33° 48´·73S., 18° 00´·80E.
33° 52´·55S., 17° 58´·79E.
33° 54´·24S., 17° 53´·98E.
Port Elizabeth 33° 59´·21S., 25° 40´·44E.
33° 59´·24S., 25° 44´·78E.
34° 09´·57S., 26° 28´·06E.
34° 10´·20S., 26° 41´·54E.
Durban 30° 02´·42S., 30° 53´·93E.
30° 05´·10S., 30° 58´·37E.
30° 06´·10S., 30° 59´·48E.
30° 07´·00S., 31° 00´·08E.
Maputo 25° 56´·82S., 32° 37´·10E.
25° 57´·13S., 32° 38´·07E.
25° 56´·34S., 32° 40´·09E.
25° 55´·53S., 32° 40´·28E.
25° 54´·58S., 32° 41´·38E.
25° 54´·45S., 32° 45´·27E.
25° 54´·04S., 32° 47´·37E.
25° 50´·27S., 32° 55´·75E.

25° 50´·26S., 32° 57´·21E.


25° 52´·45S., 33° 03´·88E.
25° 54´·20S., 33° 07´·15E.
Nacala 14° 27´·19S., 40° 40´·77E.
14° 26´·94S., 40° 40´·79E.
14° 26´·14S., 40° 40´·60E.
14° 25´·41S., 40° 40´·93E.
14° 24´·64S., 40° 41´·92E.
Madagascar 15° 38´·7S., 46° 19´·5E.
15° 36´·8S., 46° 20´·0E.
15° 21´·5S., 46° 18´·4E.
Dar es Salaam 6° 41´·10S., 39° 13´·47E.
6° 41´·18S., 39° 14´·66E.
6° 41´·53S., 39° 14´·86E.
6° 42´·28S., 39° 15´·54E.
6° 42´·85S., 39° 15´·78E.
6° 43´·07S., 39° 16´·12E.
6° 43´·00S., 39° 17´·25E.
6° 41´·15S., 39° 20´·88E.
6° 40´·69S., 39° 22´·63E.
Mombassa 4° 03´·02S., 39° 42´·43E.
4° 04´·16S., 39° 42´·73E.
4° 04´·83S., 39° 43´·55E.
4° 05´·06S., 39° 44´·72E.
and

2.48
Wk46/23
II
4103(P)/23 INDIAN OCEAN - Works. Submarine cables. (continued)

3° 58´·47S., 39° 45´·05E.


3° 58´·16S., 39° 46´·43E.
3° 57´·99S., 39° 48´·25E.
Muqdisho 2° 00´·6N., 45° 18´·3E.
1° 56´·7N., 45° 22´·0E.
Seychelles 4° 40´·0S., 55° 29´·9E.
4° 39´·7S., 55° 30´·2E.
4° 39´·5S., 55° 30´·8E.
4° 39´·0S., 55° 32´·4E.
4° 38´·1S., 55° 33´·2E.
4° 32´·2S., 55° 34´·6E.
4° 29´·2S., 55° 34´·2E.
4° 26´·7S., 55° 31´·8E.
4° 24´·8S., 55° 30´·3E.
4° 14´·7S., 55° 28´·1E.
4° 12´·5S., 55° 28´·3E.
4° 06´·1S., 55° 30´·7E.
4° 02´·5S., 55° 30´·3E.
3° 58´·0S., 55° 28´·0E.
3° 46´·6S., 55° 26´·7E.
3° 42´·5S., 55° 27´·5E.
Djibouti 11° 34´·47N., 43° 09´·76E.
11° 35´·42N., 43° 11´·35E.
11° 36´·18N., 43° 11´·88E.

11° 38´·86N., 43° 16´·61E.


11° 40´·23N., 43° 17´·86E.
11° 43´·70N., 43° 18´·19E.
11° 45´·53N., 43° 19´·46E.
Bab el Mandeb 14° 17´·7N., 42° 25´·0E.
14° 16´·3N., 42° 45´·1E.
14° 04´·7N., 42° 54´·3E.
13° 54´·7N., 42° 56´·4E.
13° 38´·8N., 42° 57´·0E.
13° 28´·6N., 42° 55´·7E.
13° 20´·4N., 43° 00´·7E.
13° 18´·9N., 43° 03´·7E.
13° 15´·6N., 43° 07´·2E.
13° 00´·8N., 43° 16´·6E.
12° 50´·9N., 43° 21´·4E.
12° 44´·8N., 43° 21´·6E.
12° 41´·2N., 43° 17´·9E.
12° 38´·9N., 43° 18´·5E.
12° 37´·0N., 43° 17´·7E.
and
12° 43´·2N., 43° 15´·7E.
13° 03´·2N., 43° 08´·2E.
13° 13´·7N., 43° 00´·2E.
13° 18´·9N., 42° 55´·2E.
13° 23´·2N., 42° 48´·4E.

2.49
Wk46/23
II
4103(P)/23 INDIAN OCEAN - Works. Submarine cables. (continued)

13° 26´·9N., 42° 41´·7E.


13° 33´·8N., 42° 38´·5E.
13° 38´·7N., 42° 36´·6E.
13° 45´·4N., 42° 28´·7E.
13° 51´·2N., 42° 25´·2E.
and
14° 30´·6N., 42° 09´·5E.
14° 39´·8N., 41° 59´·0E.
15° 13´·7N., 41° 34´·8E.
15° 36´·1N., 41° 27´·9E.
15° 49´·8N., 41° 17´·4E.
Yanu’ al Bahr 24° 04´·84N., 38° 01´·42E.
24° 04´·35N., 38° 01´·14E.

Port Said (Bur Sa’id) 31° 16´·391N., 32° 18´·344E.


31° 17´·999N., 32° 17´·445E.
31° 21´·038N., 32° 16´·207E.
31° 28´·066N., 32° 13´·276E.
31° 28´·189N., 32° 13´·209E.
31° 28´·292N., 32° 13´·114E.
31° 28´·929N., 32° 12´·049E.
31° 29´·494N., 32° 10´·291E.
31° 29´·583N., 32° 10´·132E.
31° 29´·699N., 32° 10´·000E.
31° 29´·857N., 32° 09´·894E.
31° 30´·945N., 32° 09´·353E.
31° 31´·062N., 32° 09´·259E.
31° 31´·157N., 32° 09´·146E.
31° 31´·226N., 32° 09´·011E.
31° 31´·266N., 32° 08´·860E.
31° 31´·296N., 32° 07´·935E.

31° 31´·335N., 32° 07´·751E.


31° 31´·400N., 32° 07´·578E.
31° 31´·490N., 32° 07´·420E.
31° 31´·603N., 32° 07´·283E.
31° 33´·152N., 32° 05´·997E.
31° 33´·262N., 32° 05´·857E.
31° 33´·344N., 32° 05´·693E.
31° 33´·395N., 32° 05´·513E.
31° 33´·467N., 32° 04´·760E.
31° 33´·522N., 32° 04´·581E.
31° 33´·611N., 32° 04´·423E.
31° 35´·655N., 32° 02´·167E.
31° 35´·743N., 32° 02´·008E.
31° 35´·798N., 32° 01´·829E.
31° 35´·817N., 32° 01´·641E.
31° 35´·706N., 32° 00´·373E.
31° 35´·718N., 32° 00´·184E.
31° 35´·760N., 32° 00´·001E.
31° 35´·830N., 31° 59´·829E.
31° 35´·925N., 31° 59´·675E.
31° 36´·042N., 31° 59´·544E.
31° 36´·178N., 31° 59´·440E.
31° 47´·917N., 31° 54´·042E.
31° 48´·592N., 31° 53´·515E.

2.50
Wk46/23
II
4103(P)/23 INDIAN OCEAN - Works. Submarine cables. (continued)

31° 49´·172N., 31° 52´·850E.


31° 52´·408N., 31° 47´·383E.
31° 59´·517N., 31° 38´·659E.
32° 02´·840N., 31° 37´·569E.
Sicily 36° 18´·8N., 15° 20´·0E.
36° 19´·0N., 15° 12´·2E.
36° 21´·5N., 14° 53´·8E.
36° 29´·2N., 14° 26´·6E.
36° 30´·2N., 14° 24´·7E.
and
36° 51´·9N., 12° 34´·1E.
36° 53´·4N., 12° 32´·8E.
36° 56´·1N., 12° 31´·1E.
36° 56´·5N., 12° 30´·3E.
37° 03´·3N., 12° 25´·2E.
37° 04´·3N., 12° 24´·7E.
37° 05´·4N., 12° 24´·6E.
37° 13´·1N., 12° 25´·5E.
37° 21´·2N., 12° 23´·2E.
37° 22´·6N., 12° 22´·4E.
37° 24´·0N., 12° 21´·2E.
37° 27´·5N., 12° 16´·5E.
37° 37´·1N., 12° 00´·9E.
37° 45´·5N., 11° 45´·8E.

Marseille 43° 19´·801N., 5° 20´·940E.


43° 19´·661N., 5° 20´·684E.
43° 18´·195N., 5° 17´·901E.
43° 17´·396N., 5° 16´·515E.
43° 12´·178N., 5° 12´·079E.
43° 05´·696N., 5° 06´·770E.
43° 04´·125N., 5° 06´·547E.
and
42° 59´·316N., 4° 59´·920E.
43° 01´·333N., 4° 59´·575E.

43° 03´·762N., 5° 00´·182E.


43° 04´·622N., 5° 00´·692E.
43° 12´·101N., 5° 11´·515E.
43° 17´·576N., 5° 16´·260E.
43° 18´·421N., 5° 17´·646E.
43° 19´·156N., 5° 19´·286E.
43° 19´·669N., 5° 20´·678E.
43° 19´·804N., 5° 20´·945E.
Barcelona 41° 23´·413N., 2° 12´·140E.
41° 22´·485N., 2° 13´·982E.
41° 22´·410N., 2° 14´·085E.
41° 16´·912N., 2° 19´·456E.
2. Mariners are advised to navigate with caution in the area.
3. Charts will be updated when full details are available.

2.51
Wk46/23
II
4103(P)/23 INDIAN OCEAN - Works. Submarine cables. (continued)
4 *Former Notice 4226(P)/22 is cancelled.
5. *NOTE: The Genova (Genoa) and Gulf of Suez sections have been updated by Notice to Mariners and removed from this
Notice. The content of the remainder of this Notice is unchanged.
*Indicates new or revised entry
(WGS84 DATUM)

Charts affected - 6 - 143 (INT 7005) - 151 (INT 3196) - 153 (INT 3195) - 157 (INT 7006) - 158 (INT 7008) - 159 (INT
7010) - 167 (INT 305) - 171 (INT 7122) - 240 (INT 3549) - 264 (INT 7115) - 265 (INT 7114) - 327 (INT 7145) - 452
(INT 7117) - 453 (INT 7116) - 616 - 644 (INT 7581) - 646 - 666 (INT 7702) - 671 - 674 (INT 7691) - 716 (INT 7060) -
717 (INT 7061) - 721 - 722 (INT 7742) - 740 (INT 7740) - 742 (INT 7741) - 964 - 1180 (INT 3185) - 1196 (INT 3184)
- 1704 - 1705 - 1925 - 1926 (INT 7119) - 2116 - 2122 - 2123 - 2124 - 2573 (INT 3500) - 2574 (INT 3502) - 2578 (INT
3550) - 2926 (INT 7660) - 2930 (INT 7580) - 2949 (INT 7056) - 2964 (INT 758) - 2968 (INT 7000) - 3310 (INT 7690) -
3361 (INT 7700) - 3795 - 3797 - 3877 (INT 7055) - 3878 (INT 7054) - 4146 - 4148 (INT 2681) - 4150 - 4151 (INT
2670) - 4152 (INT 2680) - 4156 (INT 7530) - 4157 (INT 7531) - 4169 (INT 7563) - 4171 (INT 7560) - 4177 (INT 2053)
- 4178 (INT 7050) - 4179 (INT 7051) - 4180 (INT 7052)

4136(P)/23 INDIA - West Coast - Coastline. Wrecks. Works. Bridge. Channel limits. Precautionary area.
Anchorage area. Berth. Dredged depths. Depths.
Source: ENCs IN62001U, IN52076N and IN52015B
1. Extensive changes to charted detail have taken place in the Port of Mumbai and its approaches, including numerous changes
to coastline, wrecks and navigational aids. The most significant are as follows:
2. Works are in progress to construct the Mumbai Trans Harbour Link bridge along the following approximate positions:

18° 59´·903N., 72° 51´·610E.


19° 00´·006N., 72° 52´·060E.
18° 59´·955N., 72° 52´·463E.
18° 59´·277N., 72° 53´·908E.
18° 59´·206N., 72° 54´·400E.
18° 59´·528N., 72° 57´·743E.
18° 59´·464N., 72° 58´·324E.
18° 59´·239N., 72° 58´·906E.
18° 58´·216N., 73° 00´·318E.
3. Channel limits have changed and now join the following positions:

18° 55´·430N., 72° 51´·290E.


18° 54´·728N., 72° 51´·767E.
4. The channel limits in the vicinity of position 18° 55´·732N., 72° 52´·997E. , have been widened SE by approximately 50-
150m.
5. The precautionary area in the vicinity of position 18° 55´·071N., 72° 52´·122E. , has been widened SE by approximately
60m.
6. A circular limit of anchorage area, maintained to 12·0m, radius 450m, has been established at anchor berth J3, in position
18° 55´·760N., 72° 52´·350E.
7. A new third chemical berth is being constructed, centred on position 18° 58´·92N., 72° 55´·31E.
8. Maintained depth areas have been amended as follows:

Position Former maintained depth New maintained depth


18° 58´·56N., 72° 54´·94E. 13·0m 14·0m
18° 58´·23N., 72° 54´·94E. 9·0m 10·5m
18° 56´·27N., 72° 53´·69E. 14·2m 19·0m
18° 56´·45N., 72° 53´·95E. 14·2m 14·0m
9. Dredged depth areas have been amended as follows:

Position Former dredged depth New dredged depth


18° 56´·41N., 72° 55´·81E. 13·1m (2016) 14·4m
18° 56´·32N., 72° 56´·13E. 16·5m (2017) 16·2m

2.52
Wk46/23
II
4136(P)/23 INDIA - West Coast - Coastline. Wrecks. Works. Bridge. Channel limits. Precautionary area.
Anchorage area. Berth. Dredged depths. Depths. (continued)
10. A dangerous wreck exists in approximate position 18° 53´·71N., 72° 51´·80E.
11. The dangerous wreck in position 18° 55´·918N., 72° 52´·321E. has been removed.
12. Shoal depths exist in the following positions:

Depth Position
5·3m 18° 55´·805N., 72° 50´·415E.
4·9m 18° 55´·860N., 72° 50´·481E.
5·3m 18° 52´·02N., 72° 52´·00E.
6·3m 18° 52´·75N., 72° 51´·50E.
6·5m 18° 54´·27N., 72° 51´·07E.
6·9m 18° 53´·91N., 72° 50´·87E.
2·7m 18° 57´·100N., 72° 51´·356E.
1·2m 18° 57´·436N., 72° 51´·436E.
6m 18° 56´·037N., 72° 52´·841E.
5·1m 18° 53´·16N., 72° 51´·92E.
13. Mariners are advised to navigate with caution in the area and consult the local port authorities for the latest information.
14. These and other changes will be included in New Editions of Charts IN2001, IN2015 and IN2076 to be published late 2023.
15. Charts IN211, IN255 and IN2016 will be updated by Notice to Mariners.
16. Former Notice 1802(P)/20 is cancelled.
(WGS84 DATUM)

Charts affected - IN 2001 - IN 2015 (INT 7337) - IN 2076 (INT 7338)

4179(P)/23 INDIA - West Coast - Works. Maritime limit. Buoyage. Mooring buoys. Wreck. Depths.
Source: ENC IN62031A, ENC IN62025A and ENC IN62033B
1. Construction and pipe laying works are in progress, by crane vessel Sapura 2000, in an area bounded by the following
positions:

22° 30´·44N., 69° 50´·08E.


22° 29´·27N., 69° 51´·53E.
22° 28´·90N., 69° 51´·19E.
22° 30´·07N., 69° 49´·74E.
2. A turning circle, radius 200m, has been established, centred on position 22° 29´·587N., 69° 50´·855E.
3. The following light-buoys have been established:

Light Characteristic Designation Buoy Type Position


Q NCM North Cardinal 22° 29´·528N., 69° 50´·964E.
Q(9)15s WCM West Cardinal 22° 29´·649N., 69° 50´·950E.
Q(6)+LFl.15s SCM South Cardinal 22° 29´·686N., 69° 50´·840E.
4. The West cardinal buoy, Q(9)15s, in position 22° 29´·633N., 69° 50´·843E., has been removed.
5. Changes to mooring buoys have taken place within Sikka Creek.
6. A wreck, depth 0·9m, exists within position 22° 30´·203N., 69° 50´·454E.
7. Depths less than charted exist within Sikka Creek. The most significant are as follows:

Depth Position
2·7m 22° 27´·377N., 69° 47´·575E.
7·8m 22° 30´·017N., 69° 49´·896E.
9·3m 22° 29´·656N., 69° 50´·565E.
8. Mariners are advised to navigate with caution in the area.

2.53
Wk46/23
II
4179(P)/23 INDIA - West Coast - Works. Maritime limit. Buoyage. Mooring buoys. Wreck. Depths. (continued)
9. Charts will be updated when full details are available.
10. Former Notice 3115(P)/19 is cancelled.
(WGS84 DATUM)

Charts affected - IN 203 (INT 7319) - IN 2033 (INT 7341) - IN 2083 (INT 7339)

4224(T)/23 INDIAN OCEAN - La Réunion - Moorings. Scientific instruments. Buoy.


Source: French Notices 38/13(T)-14(T)/23
1. Moorings equipped with scientific instruments have been established in the following positions:

20° 55´·55S., 55° 18´·64E.


20° 55´·73S., 55° 16´·89E.
20° 56´·69S., 55° 16´·77E.
21° 00´·16S., 55° 15´·07E.
21° 00´·47S., 55° 15´·32E.
21° 00´·81S., 55° 10´·52E.
20° 59´·75S., 55° 13´·57E.
21° 00´·66S., 55° 13´·36E.
21° 00´·68S., 55° 14´·00E.
21° 02´·58S., 55° 12´·38E.
21° 09´·27S., 55° 16´·13E.
2. A mooring, equipped with a camera and marked by an orange buoy, has been established in Baie de Saint-Paul, in position
20° 59´·98S., 55° 16´·39E.
3. Mariners are requested not to anchor near these positions and to navigate with caution in these areas.
(WGS84 DATUM)

Chart affected - 1495 (INT 7736)

4176(P)/23 CHINA - Bo Hai - Channel. Depths. Groyne.


Source: Chinese Charts 11781, 11783 and 11784
1. The North Outer Channel in the approaches to Huanghua Gang has become deeper between positions
38° 33´·70N., 118° 19´·19E. and 38° 23´·36N., 117° 56´·20E.
2. Depths less than charted exist within Huanghua Gang and Approaches. The most significant are as follows:

Depth Position
13·8m 38° 23´·07N., 118° 00´·46E.
13·9m 38° 20´·52N., 117° 55´·22E.
12·1m 38° 19´·10N., 117° 52´·79E.
13·3m 38° 19´·67N., 117° 52´·17E.
1·9m 38° 23´·10N., 117° 56´·04E.
1·8m 38° 22´·93N., 117° 54´·82E.
3. Depths less than charted exist within the following anchorages:

Depth Anchorage Position


11·3m No 2 38° 28´·12N., 118° 17´·26E.
10·5m No 4 38° 31´·23N., 118° 10´·72E.
7·9m No 1 38° 25´·20N., 118° 10´·01E.

2.54
Wk46/23
II
4176(P)/23 CHINA - Bo Hai - Channel. Depths. Groyne. (continued)
4. Depths less than charted exist within the Haigang Gangqu Channel for 30,000t ships. The most significant are as
follows:

Depth Position
7·8m 38° 21´·67N., 118° 15´·25E.
7·5m 38° 21´·22N., 118° 13´·98E.
7·2m 38° 20´·86N., 118° 12´·98E.
7·3m 38° 20´·34N., 118° 11´·47E.
5. A new groyne has been established, joining the following positions:

38° 24´·56N., 118° 00´·23E.


38° 25´·02N., 118° 00´·56E.
38° 27´·15N., 118° 05´·27E.
6. Mariners are advised to navigate with caution in the area.
7. These and other changes will be included in the next New Edition of Charts 2644 and 2650 to be published early 2024.
(CGCS 2000 DATUM)

Charts affected - 2644 - 2650

4185(P)/23 CHINA - Bo Hai - Alongside depths. Depths.


Source: Chinese Chart 11743
1. Alongside depths within Jingtang Gangqu have changed. The most significant are as follows:

Depth Posit ion


10m 39° 12´·365N., 119° 00´·482E.
17·6m 39° 12´·591N., 119° 01´·356E.
9·2m 39° 12´·424N., 119° 00´·532E.
14·5m 39° 12´·412N., 119° 01´·165E.
2. Depths less than charted exist in the following positions:

Depth Position
15·7m 39° 11´·416N., 119° 01´·133E.
18·4m 39° 11´·990N., 119° 01´·618E.
10·5m 39° 12´·299N., 119° 00´·399E.
13·8m 39° 11´·985N., 119° 00´·861E.
19·6m 39° 12´·970N., 119° 02´·554E.
3. Depths are up to 2m deeper than charted in the Inner Fairway (39° 13´·282N., 119° 03´·225E. ).
4. Mariners are advised to navigate with caution in the area and consult the local port authorities for the latest information.
5. These changes will be included in the next New Edition of Chart 2642.
6. Chart 2641 will be updated by Notice to Mariners.
(CGCS 2000 DATUM)

Chart affected - 2642

2.55
Wk46/23
II

4222(P)/23 VIETNAM - Works. Bridge. Piles.


Source: VMS-South Notice 197/23
1. Works are in progress to construct Phuoc An Bridge between the following positions:

10° 37´·88N., 106° 59´·99E.


10° 37´·96N., 106° 59´·72E.
2. Piles have been established in the following positions:

10° 37´·95N., 106° 59´·75E.


10° 37´·91N., 106° 59´·88E.
3. Mariners are advised to navigate with caution in the area and consult the local port authorities for the latest information.
4. Chart 1059 will be updated when full details are available.
(WGS84 DATUM)

Chart affected - 1059

4226(T)/23 CHINA - South Coast - Buoy. Virtual aid to navigation.


Source: Chinese Notices 36/1325(T)-1326(T)/23
1. The west cardinal light buoy, VQ(9)10s No 3, has been replaced by a virtual aid to navigation (V-AIS), west cardinal
topmark, in position: 22° 36´·318N., 113° 41´·952E.
2. Mariners are advised to navigate with caution in the area.
(CGCS 2000 DATUM)

Charts affected - 343 - 349

4194(T)/23 JAPAN - Honshū - Depths.


Source: Japanese Notice 43/5451(T)/23
1. Depths less than charted exist in the following positions:

Depth Position
7·9m 37° 56´ 03·9"N., 139° 03´ 51·7"E.
8·6m 37° 56´ 01·8"N., 139° 03´ 53·6"E.
9m 37° 55´ 56·9"N., 139° 03´ 55·8"E.
8·7m 37° 55´ 54·9"N., 139° 03´ 57·3"E.
7m 37° 55´ 54·4"N., 139° 04´ 01·8"E.
6·9m 37° 55´ 56·2"N., 139° 04´ 02·9"E.
6·9m 37° 55´ 58·3"N., 139° 04´ 03·1"E.
(WGS84 DATUM)

Chart affected - JP 1155A

4195(T)/23 JAPAN - Honshū - Depth.


Source: Japanese Notice 43/5453(T)/23
1. A depth of 4·8m exists in position 40° 32´ 06·1"N., 141° 31´ 52·1"E.
(WGS84 DATUM)

Chart affected - JP 65

2.56
Wk46/23
II

4196(T)/23 JAPAN - Honshū - Obstruction.


Source: Japanese Notice 43/5454(T)/23
1. An underwater obstruction, depth 6·9m, exists in position 38° 19´ 12·5"N., 141° 02´ 37·7"E.
(WGS84 DATUM)

Chart affected - JP 64A

4197(T)/23 JAPAN - Honshū - Works. Submarine cable.


Source: Japanese Notice 43/5455(T)/23
1. Submarine cable repair works are taking place, from 6 November to 30 November 2023, within an area bounded by the
following positions:

34° 50´·3N., 140° 16´·9E.


34° 52´·4N., 140° 19´·9E.
34° 50´·7N., 140° 22´·4E.
34° 48´·2N., 140° 25´·2E.
34° 46´·6N., 140° 25´·8E.
34° 45´·0N., 140° 26´·2E.
34° 43´·6N., 140° 23´·3E.
34° 44´·9N., 140° 22´·2E.
34° 46´·6N., 140° 21´·9E.
34° 47´·9N., 140° 21´·2E.
34° 49´·0N., 140° 19´·6E.
34° 49´·5N., 140° 17´·9E.
(WGS84 DATUM)

Chart affected - JP 87

4198(T)/23 JAPAN - Honshū - Obstruction.


Source: Japanese Notice 43/5456(T)/23
1. An underwater obstruction, consisting of an anchor chain, exists in the vicinity of position 35° 33´ 08"N., 140° 02´ 06"E.
(WGS84 DATUM)

Charts affected - JP 90 - JP 1061 - JP 1086

4199(T)/23 JAPAN - Seto Naikai - Works.


Source: Japanese Notice 43/5457(T)/23
1. Breakwater construction works are taking place, until 20 December 2024, within an area bounded by the following
positions:

34° 40´ 59"N., 135° 11´ 51"E.


34° 40´ 40"N., 135° 11´ 53"E.
34° 40´ 39"N., 135° 11´ 36"E.
34° 40´ 46"N., 135° 11´ 35"E.
(WGS84 DATUM)

Charts affected - JP 101A - JP 101B

2.57
Wk46/23
II

4200(T)/23 JAPAN - Kyūshū - Wind turbine.


Source: Japanese Notice 43/5458(T)/23
1. A floating wind turbine, Fl(2) Y, in position 32° 40´·31N., 128° 57´·46E., has been temporarily removed until late January
2024.
(WGS84 DATUM)

Chart affected - JP 213

4219(T)/23 KOREA - East Coast - Buoy.


Source: Korean Notice 36/689(T)/23
1. A yellow ODAS buoy has been deployed, until further notice, in position: 37° 14´·33N., 129° 27´·33E.
2. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Charts affected - 882 - 2347 - 3480

4124(P)/23 SOUTH PACIFIC OCEAN - Polynésie Française - Depths.


Source: French Notice 32/16(P)/23
1. Depths less than charted exist between Pointe Tatatua and Pointe Rapae. The most significant are as follows:

Depth Position
5·5m 17° 51´·75S., 149° 08´·10W.
9·1m 17° 51´·49S., 149° 07´·82W.
3·9m 17° 50´·96S., 149° 07´·66W.
10·9m 17° 51´·00S., 149° 07´·56W.
3·6m 17° 50´·56S., 149° 07´·39W.
3·2m 17° 48´·13S., 149° 07´·35W.
6·3m 17° 47´·94S., 149° 07´·60W.
2·1m 17° 47´·78S., 149° 07´·22W.
10m 17° 46´·26S., 149° 07´·94W.
2. Mariners are advised to navigate with caution in the area.
3. Chart 1382 will be updated when full details are available.
(WGS84 DATUM)

Chart affected - 1382

4153(T)/23 COLOMBIA - Pacific Ocean Coast - Virtual aid to navigation.


Source: Colombian Notice 281/23
1. A virtual aid to navigation (V-AIS), south cardinal topmark, has been established in position 3° 53´·813N., 77° 04´·880W.
2. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Chart affected - 2319

2.58
Wk46/23
II

4217(P)/23 BRAZIL - East Coast - Depths. Obstructions.


Source: Brazilian Notice 16/ E 139(P)/23
1. Depths less than charted exist within Porto de Suape, in the following positions:

Depth Position
4·8m 8° 23´·377S., 34° 57´·583W.
9·8m 8° 22´·935S., 34° 58´·574W.
9·9m 8° 22´·886S., 34° 58´·772W.
2. A least depth of 10m exists within an area bounded by the following positions:

8° 23´·022S., 34° 58´·286W.


8° 23´·113S., 34° 58´·343W.
8° 23´·004S., 34° 58´·518W.
8° 22´·890S., 34° 58´·515W.
8° 22´·898S., 34° 58´·335W.
8° 22´·869S., 34° 58´·223W.
8° 22´·965S., 34° 58´·117W.
3. A least depth of 13·1m exists within an area bounded by the following positions:

8° 23´·591S., 34° 57´·640W.


8° 23´·653S., 34° 57´·703W.
8° 23´·415S., 34° 58´·211W.
8° 23´·111S., 34° 58´·328W.
8° 23´·036S., 34° 58´·110W.
8° 23´·370S., 34° 58´·120W.
4. Obstructions exist in areas bounded by the following positions:

8° 23´·259S., 34° 57´·935W.


8° 23´·291S., 34° 57´·928W.
8° 23´·205S., 34° 58´·037W.
8° 22´·895S., 34° 58´·108W.
8° 22´·873S., 34° 58´·043W.
8° 22´·894S., 34° 58´·037W.
5. Mariners are advised to navigate with caution in the area and consult the local authorities for the latest information.
(WGS84 DATUM)

Chart affected - 961

2.59
Wk46/23
To accompany Notice to Mariners 4141/23

On Chart 1552

DEPTHS
Depths within the Fleetwood channel, Wyre
Dock and Fish Dock are liable to frequent
change owing to siltation. For the latest
information, consult the Port Authority (Tel.
+44(0)1253 872323).

Wk46/23
To accompany Notice to Mariners 4182/23

On Chart 1545

RESTRICTED AREA
(40°38´·890N 17°57´·620E)
For details of the restrictions and prohibitions
within this area, see ADMIRALTY Sailing
Directions.

Wk46/23
To accompany Notice to Mariners 4102/23. Image Size (mm) 68.5 by 62.4

Wk46/23
To accompany Notice to Mariners 4109/23. Image Size (mm) 140.8 by 143.1

Wk46/23
To accompany Notice to Mariners 4109/23. Image Size (mm) 58.2 by 53.2

Wk46/23
To accompany Notice to Mariners 4138/23. Image Size (mm) 46.3 by 90.6

Wk46/23
To accompany Notice to Mariners 4138/23. Image Size (mm) 225.4 by 105.7

Wk46/23
To accompany Notice to Mariners 4155/23. Image Size (mm) 39.2 by 49.9

Wk46/23
To accompany Notice to Mariners 4158/23. Image Size (mm) 165.2 by 87

Wk46/23
To accompany Notice to Mariners 4174/23. Image Size (mm) 35.4 by 46.4

Wk46/23
To accompany Notice to Mariners 4182/23. Image Size (mm) 202.1 by 173.2

Wk46/23
To accompany Notice to Mariners 4191/23. Image Size (mm) 67.7 by 82

Wk46/23
To accompany Notice to Mariners 4209/23. Image Size (mm) 139.6 by 71.6

Wk46/23
To accompany Notice to Mariners 4213/23. Image Size (mm) 77.2 by 92

Wk46/23
To accompany Notice to Mariners 4214/23. Image Size (mm) 204 by 172.4

Wk46/23
III

NAVIGATIONAL WARNINGS

See The Mariner’s Handbook (2020 Edition). Only the most convenient ADMIRALTY Chart is quoted. All warnings issued
within the previous 42 days are broadcast via Enhanced Group Call (EGC) and/or NAVTEX.
The complete texts of all in-force NAVAREA I warnings, including those which are no longer being broadcast, are
available from https://msi.admiralty.co.uk/RadioNavigationalWarnings. Additionally, a quarterly cumulative list of
the complete text of all in-force NAVAREA I Warnings is included in Section III of the Weekly NM Bulletin in Weeks
1, 13, 26 and 39 each year.
Alternatively, these may be requested by e-mail from NAVAREA I Co-ordinator at: navwarnings@ukho.gov.uk
The RNW web page also contains a link to the IHO website which allows direct access to all the other NAVAREA Co-
ordinators around the world who have made their NAVAREA warnings available on the web.
----------------------------------------------------------------------------------------------------------------------------------------------------------
Weekly Edition 46 published on the UKHO website 06 Nov 23.
----------------------------------------------------------------------------------------------------------------------------------------------------------
Navarea I (NE Atlantic) Weekly Edition 46
The following NAVAREA I warnings were in force at 060500 UTC Nov 23.

2023 series: 094, 144, 166, 178, 207, 211.

Summary of Navarea I warnings issued since Weekly Edition 45:

206 Cancelled.

207 1. Navarea I warnings in force at 031000 UTC Nov 23. 2. Cancel 204/23.

208 Cancelled. Cancel 206/23.

209 Cancelled.

210 Cancelled. Cancel 209/23.

211 1. RIGLIST. Correct at 060500 UTC Nov 23.

Southern North Sea: 51N to 55N


52-24.4N 003-45.4E Swift 10 ACP P12-SW
52-40.8N 003-48.3E JB-115 ACP HWA
53-01.1N 001-47.6E Valaris 72 ACP Hewett Gas Field
53-09.5N 002-44.1E Haeva (ex Paragon HZ1)
53-14.0N 003-14.5E 590021 ACP Allseas Test
53-17.0N 004-12.5E Seafox 4 ACP L13-FC-1
53-24.2N 004-36.9E Valaris 123
53-25.3N 004-06.4E Prospector 1
NEW 53-32.3N 004-12.1E Seajacks Hydra ACP L7-PQC
53-45.7N 003-52.1E Noble Resolute
54-02.5N 000-23.5E Valaris 121
54-04.4N 000-54.9E Erda ACP Ravenspurn North Gas Field
54-05.0N 000-49.5E Valaris 247 ACP Ravenspurn South Gas Field
54-10.1N 005-26.1E Well Safe Protector ACP G14-B

North Sea: 55N to 60N, East of 5W


55-28.5N 005-06.3E Noble Reacher (ex Maersk) ACP Dan Oil Field
55-32.2N 005-01.9E Shelf Drilling Winner (ex Noble Sam Turner) ACP Halfdan Oil Field
56-05.8N 004-13.3E Noble Resolve (ex Maersk) ACP Syd Arne Gas Field
56-19.5N 003-21.2E Noble Invincible ACP Valhall Oil Field
56-25.1N 002-54.1E Linus
NEW 56-25.3N 003-12.5E West Elara ACP Eldfisk Oil Field
56-35.0N 002-28.5E Valaris 120
56-50.9N 001-35.7E Ocean Endeavor
56-54.0N 002-22.8E Valaris 122
56-54.6N 000-08.2W Valaris Norway
57-09.1N 001-40.5E Valaris 248 (ex Gorilla VI)
57-14.0N 001-37.6E Noble Innovator
57-48.9N 004-32.0E Maersk Inspirer ACP YME Oil Field
57-50.7N 000-54.7W COSL Innovator
NEW 57-54.2N 000-01.9E Well Safe Guardian
57-57.7N 000-55.0W Shelf Drilling Fortress ACP Golden Eagle
57-58.7N 000-31.8E Paul B Loyd Jr
58-19.8N 001-42.6W COSL Pioneer

3.1
Wk46/23
III

58-20.8N 000-06.8E Ocean Patriot


58-34.3N 001-41.8E Noble Lloyd Noble ACP Gina Krog
58-34.8N 001-15.7E Well Safe Defender
58-46.1N 002-45.6E Deepsea Atlantic
58-46.2N 001-29.4E Stena Don
59-03.3N 002-14.6E Scarabeo 8
59-08.5N 002-24.4E Deepsea Aberdeen
59-12.0N 002-24.5E West Phoenix
59-35.1N 002-05.1E Deepsea Nordkapp

Norwegian Sea: 60N to 65N, East of 5W


60-01.5N 002-41.1E Deepsea Stavanger
60-24.8N 004-03.2W Ocean Greatwhite
60-30.3N 002-00.8E Askepott ACP Martin Linge
61-04.6N 001-59.3E Askeladden
61-05.0N 003-30.8E Transocean Spitsbergen
61-20.4N 001-59.9E COSL Promoter
61-26.0N 002-35.2E Transocean Enabler
61-32.5N 003-58.5E Deepsea Yantai
64-55.3N 006-44.3E Transocean Norge

South and West Coasts of the British Isles


53-32.1N 003-34.5W Irish Sea Pioneer ACP Douglas Oil Field
53-43.3N 003-32.2W Ensco 92

NOTES:
A. Rigs are protected by a 500 metre safety zone.
B. ACP - Adjacent to Charted Platform.
C. For Rigs located North of 65N, East of 5W, refer to Navarea XIX Warnings or visit www.navarea-xix.no

2. Cancel 205/23.

3.2
Wk46/23
IV

[46/23]
UPDATES TO ADMIRALTY SAILING DIRECTIONS

NP1 Africa Pilot Volume 1 (2020 Edition) 2 Rada Sur (280620N 152380W) is reserved
for vessels not carrying dangerous cargo; an
outfall pipeline, marked by light buoys
Islas Canarias -- Isla de Fuerteventura -- (special), is laid through the anchorage from a
North--east coast -- Puerto de Corralejo — position close E of the Cathedral (280602N
Harbour 152488W).
Vessels should anchor in accordance with the
90 pilot’s instructions; the anchorage zones are under
radar surveillance by Port Control.
After Paragraph 3.45 Insert: 3 Caution. When anchoring off Las Palmas, it should
be borne in mind that depths decrease rapidly at
Puerto de Corralejo relatively short distances towards the island. The
3.45a bottom is uneven and rocky, and ships should not
1 Description. Puerto de Corralejo (284439N steam to the anchoring position with too much cable
135173W) is a small multipurpose harbour situated walked out. In view of the depths, it is necessary to
on the NE coast of Isla de Fuerteventura and is lower the anchor to the bottom when all way is off the
protected by a breakwater extending ESE from the SE ship. Several ships have lost their anchors when
side of Punta de Corralejo. The commercial berths are anchoring off Puerto de La Luz.
situated along the outer part of breakwater while a Spanish Notice 17/23; Derrotero 10 (2022)
marina lies at its root. [NP1--No 112--Wk 46/23]
2 There is a regular ferry service to Puerto de Playa
Blanca (3.28). Islas Canarias -- Isla de Gran Canaria --
Local knowledge is recommended. Puerto de La Luz — Basins and berths
Useful marks:
98
Light (green round tower, 5 m in height) (284441N
135165W). Paragraph 3.100 including headings and existing Section
3 Alongside berths. There are about 500 m of IV Notice Week 23/23 Replace by:
berthing space on the inner side of the breakwater
with RoRo facilities. Basins and berths
Anchorages and moorings
Spanish Notice 21/184/23; Derrotero 10 3.99a
[NP1--No 111--Wk 46/23] 1 Fondeadero Interior (280760N 152480W) is
reserved for vessels not carrying dangerous cargo.
Islas Canarias -- Isla de Gran Canaria -- Darsena de Africa
East coast -- Puerto de Salinetas — 3.99b
Harbour; marine farms 1 Dique Nelson Mandela (280940N 152390W) is
1000 m in length and has several general--purpose
94 berths on its W face. Depths are generally in excess
of 18 m. Several RoRo berths are situated at the head
After Paragraph 3.62 1 line 5 Insert: of the harbour.
Marine farms, marked by light buoys (special), are Puerto Exterior
situated in the approaches to the port. 3.100
1 Dique Reina Sofia (280842N 152444W). The
Spanish Notice 26/251/23 [NP1--No 114--Wk 46/23] W face consists of five berths, ranging from 120 m to
760 m in length, used by vessels with draughts up to
22 m for bunkering, bulk cargo, repairs and lay--up.
Islas Canarias -- Isla de Gran Canaria -- Reparaciones Navales Repnaval (280950N
Puerto de La Luz — 152445W), slipways and repair facilities (3.101) at
Arrival information; outer anchorages
the root of Dique Reina Sofia.
2 Astilleros Astican (280910N 152461W).
96--97
Between Reparaciones Navales and the container
Paragraph 3.91 1--3 including existing Section IV Notice terminal at Muelle de Gran Canaria, close SW, lies
Week 23/23 Replace by: another ship repair yard with extensive facilities
(3.101).
1 Designated anchorages have been established as Muelle de Gran Canaria (280894N 152485W)
follows: is 518 m in length with depths alongside of 9 to 11 m;
Rada Norte consists of two areas situated N and S of container and RoRo vessels.
the entrance channel (280880N 152370W) to 3 Muelle Virgen del Pino (280873N 152480W) is
Darsena de Africa; it is reserved for vessels 505 m in length with a depth alongside of 10 to 12 m;
carrying dangerous cargoes. container and RoRo vessels.

Wk46/23 4.1
IV

Muelle Elder (280852N 152482W), used for the NP22 Bay of Biscay Pilot (2019 Edition)
handling of liquids and solids in bulk, is 435 m in
length and accommodates vessels with a maximum
draught of 119 m; RoRo facilities. Spain -- North coast -- Ensenada de Saustán —
4 Muelle de los Cambulloneros (280830N Anchorage; marine farms
152483W) is 806 m in length with a depth alongside
232
of about 13 m; RoRo vessels, general cargo and
bunkering. Paragraph 9.92 1 lines 6--10 Replace by:
Muelle Cristobal Colón (280798N 152471W)
has a berthing face of 642 m and can accommodate ...WNW may be obtained as follows:
vessels with a maximum draught of 16 m. Between Punta Isabalz and Punta Planchaganía,
1¾ miles NW, clear of charted marine farms.
NNW of Punta Mococoburúa (432018N
Puerto Interior
22736W), about 3 cables offshore.
3.100a
1 Muelle León y Castillo (280817N 152505W), UKHO [NP22--No 73--Wk 46/23]
1829 m in length with depths of 10 to 16 m alongside,
consists of five berths capable of accommodating
vessels carrying RoRo, container and grain cargoes.
NP28 Dover Strait Pilot (2020 Edition)
2 Muelle Benito Pérez Galdós (280880N
152512W), 248 m long with a depth alongside of
about 8 m and handling general cargo and grain, lies Belgium -- Gent -- Terneuzen Canal -- Doornzele
between the roots of Muelle León y Castillo and — Vertical clearance
Muelle Grande, 1½ cables W.
Muelle Grande (280866N 152524W) consists of 186
three berths of 100 to 615 m in length with depths of
Paragraph 7.195 1 line 4 For 47 m Read 46 m
8 to 12 m alongside; vessels carrying fish, general
and grain cargoes are accommodated there.
3 Muelle de Santa Catalina (280842N 152545W) Belgian Notice 6/103/23 [NP28--No 75--Wk 46/23]
is the main cruise terminal; passengers and crew from
vessels at anchor are landed here.
Netherlands -- Westerschelde --
Muelle del Arsenal (2808251N 1525538W) lies Terneuzen to Antwerp -- Schaar van Waarde —
S of Muelle de Santa Catalina; there are depths of Buoyage
about 7 m alongside its E face which extends about
500 m. The naval base is situated on the W side of 191
Muelle del Arsenal.
Paragraph 7.223 1 lines 6--10 Replace by:
...it is closed to all shipping. The combined channels are
Spanish Notice 17/23; Derrotero 10 (2022)
marked by buoys (port hand; numbers prefixed SvV).
[NP1--No 113--Wk 46/23]
Netherlands Notice 8/56/23 [NP28--No 74--Wk 46/23]

Belgium -- Antwerp —
Limiting conditions; vertical clearances; cables
NP9 Antarctic Pilot (2019 Edition)
193

Paragraph 7.239 1 lines 5--8 Replace by:


Antarctic Peninsula -- Bransfield Strait -- Overhead power cables (511772N 41800E),
Deception Island — Directions; depth with a safe vertical clearance of 984 m, also span the
river W of the entrance to Boudewijnsluis and Van
Cauwelaertsluis.
230 An overhead cable (511480N 42026E) with a
safe vertical clearance of 666 m spans the river E of
Paragraph 4.80 4 including existing Section IV Notice Krankeloonpolder.
Week 28/19 Replace by:
ENC BE5ANTWN (32.006) [NP28--No 76--Wk 46/23]
4 SSE of a shoal (620550S 565250W), with a
depth of 46 m (25 fm), and a report that less Belgium -- Antwerp -- Waaslandkanaal —
water may be possible in this vicinity, thence: Vertical clearance; cable
NNW of a pinnacle (630700S 595732W),
existence doubtful, with a depth of 24 m (13 fm), 195
thence: Paragraph 7.250 3 line 8 For 64 m Read 631 m

UKHO [NP9--No 17--Wk 46/23] ENC BE5ANTWN (32.006) [NP28--No 77--Wk 46/23]

4.2 Wk46/23
IV

NP32A China Sea Pilot Volume 3 (2022 Edition) Paragraph 4.41 1 Replace by

1 Ongoing development of No 1 and No 2 Harbours


Philippines — National regulations; will continue in phases. Works are expected to be
marine nature reserve completed in 2026.
See Port Authority website (4.29) for the latest
7 information.
After Paragraph 1.61 1 Insert:
UKHO [NP32A--No 67--Wk 46/23]
Marine nature reserve
1.61a
Taiwan -- South--west coast -- Kaohsiung —
1 Batanes Protected Seascape and Landscape Directions for entering harbour
Marine Reserve (203888N 1215170E) has been
established around the Batan Islands (204000N
85
1215000E) (3.32). It is reported that this marine
reserve bans commercial fishing within the area.
Paragraph 4.45 3 Replace by
Contact local authorities for further information.
3 NNW of the head of the breakwater of No 3
Filipino Notice 11/56/22 [NP32A--No 64--Wk 46/23] Harbour, from where a light (red conical
concrete tower, 20 m in height) (223262N
Philippines -- Luzon Strait -- Batan Islands — 1201718E) is exhibited.
Marine nature reserve The track then leads SSE into No 3 Harbour, for
which the chart is the best guide, or continues ENE to
67 a position on the following leading line.

After Paragraph 3.7 1 Insert: UKHO [NP32A--No 68--Wk 46/23]

Marine nature reserve


3.7a
1 Batanes Protected Seascape and Landscape NP32B China Sea Pilot Volume 4 (2022 Edition)
Marine Reserve (203888N 1215170E) has been
established around the Batan Islands (204000N
1215000E) (3.32). See 1.61a for further information. China -- Yellow Sea -- Haizhou Wan -- Lanshan —
Directions for entering harbour
Filipino Notice 11/56/22 [NP32A--No 65--Wk 46/23]
60
Philippines -- Luzon Strait -- Batan Islands —
Marine nature reserve Paragraph 2.72 4 Replace by:

71 4 Alternatively, from a position about 15 miles ENE


of Dashan Dao (above), the track leads generally W
After Paragraph 3.29 1 Insert: to a position in the vicinity of No 301 Light Buoy
(starboard hand) (350621N 1195424E), at the
Marine nature reserve start of the Lanshan Gangqu Deep--Water Channel.
3.29a
1 See 3.7a. Paragraph 2.73 4--6 Replace by:

4 Lanshan Gangqu Deep--Water Channel. From a


Filipino Notice 11/56/22 [NP32A--No 66--Wk 46/23]
position in the vicinity of No 301 Light Buoy
(starboard hand) (350621N 1195424E) the
Taiwan -- South--west coast -- Kaohsiung — channel, marked by light buoys (lateral) leads
Traffic regulations; general layout; development generally W to the Crude Oil Terminal (2.76).
5 Lanqiao Approach Channel to North Basin. From
83 a position in the Lanshan Gangqu Deep--Water
Channel, NW of No 366 Light Buoy (port hand)
Paragraph 4.38 6 lines 5--7 Delete
(350566N 1192686E), the track leads WNW
through a channel, marked by light buoys (lateral),
Paragraph 4.40 1 Replace by into the North Basin.
1 The harbour is aligned NW/SE. No 1 Harbour, the 6 Approach to the bulk terminal. From a position in
older and shallower port area lies to the NW, while the vicinity of No 355 Light Buoy (starboard hand)
No 2 Harbour to the SE contains the deeper berths of (350634N 1193097E), within the Lanshan Gangqu
the larger container and oil terminals. No 3 Harbour, to Deep--Water Channel, a channel marked by light
the S, contains bulk and container terminals. A fishing buoys (lateral) leads WNW to the bulk terminal (2.78).
industry harbour is situated near the centre of the
port. Mooring buoy berths lie in No 1 Harbour. UKHO [NP32B--No 42--Wk 46/23]

Wk46/23 4.3
IV

NP33 Philippine Islands Pilot (2021 Edition) NP39 South Indian Ocean Pilot (2020 Edition)

Seychelles -- Mahé -- Port Victoria — Anchorages


Philippines -- Palawan -- East coast --
South Verde Island to Puerto Princesa — 241
Directions; buoy
Paragraph 10.137 1 Replace by:
85 1 There are eighteen numbered anchorage berths,
with maximum permissible draughts (reported 2012),
Paragraph 3.132 4 lines 7--9 Replace by:
as follows:
...Bancaobancaon Point (94338N 1184612E) (3.147). Anchorage Maximum Location
number draught
Filipino Notice 9/38/22 [NP33--No 39--Wk 46/23]
1 -- 8 * No restriction ** Centred 5 miles NE of
the port
Philippines -- Palawan -- East coast -- 9 -- 11 To be decided Centred 1 mile NW of
Puerto Princesa — Arrival information; pilotage by Harbour Sainte Anne
Master
86
12 800 m Centred 1 mile NW of
Paragraph 3.142 1 lines 1--4 Replace by: Sainte Anne

1 Pilotage is compulsory. There are three pilot 13 450 m Outer Harbour


boarding positions for all foreign vessels: 14 500 m Outer Harbour
Pilot station (inbound) (94349N 1184336E). 15 -- 16 800 m Outer Harbour
Pilot station (inbound) (944.47N 1184348E).
Pilot station (outbound) (94423N 1184329E). 17 -- 18 800 m Cerf Passage
* Nos 1 and 2 are designated dangerous cargo
Filipino Notice 9/38/22 [NP33--No 40--Wk 46/23] anchorages.
** Harbour Master allocates berth after receipt of
vessel arrival/departure information.
Philippines -- Palawan -- East coast --
Puerto Princesa — Directions for entering Corr. Port Victoria 01/08/2022 [NP39--No 10--Wk 46/23]
harbour; buoy

86 NP45 Mediterranean Pilot Volume 1


(2021 Edition)
Paragraph 3.147 2 lines 1--3 Replace by:
2 Entry. From a position S of Bancaobancaon Point, Spain -- East coast -- Ensenada de Altea —
Wrecks
the track leads WNW through the TSS to the pilot
boarding position (3.142), passing: 111

Filipino Notice 9/38/22 [NP33--No 41--Wk 46/23] Paragraph 2.188 2 line 1 Replace by:
2 Wrecks and obstructions. Numerous wrecks and
obstructions lie within the bay; their position are best
Philippines -- Palawan -- East coast -- seen on chart.
Puerto Princesa — Directions for entering
harbour; buoy UKHO [NP45--No 111--Wk 46/23]
87
Spain -- East coast --
Valencia to Cabo de Oropesa —
Paragraph 3.147 5 line 7 Replace by: Directions; ODAS superbuoy
...thence: 123
Filipino Notice 9/38/22 [NP33--No 42--Wk 46/23] Paragraph 3.56 3 including existing Section IV Notice
Week 04/23 Replace by:

Philippines -- Palawan -- East coast -- 3 SE of Cabo Canet (394030N 01223W),


Puerto Princesa to Rasa Island — Directions; between the mouths of Río Palancia; a light
buoy (394047N 01246W) (3.55) is exhibited
2½ cables NW from the cape. Shifting
88 sandbanks form off the mouth of the river
during freshets. Canet de Berenguer marina
Paragraph 3.162 1 lines 5--7 Replace by: (394038N 01208W) lies close N of the
point. And:
...Point (94338N 1184612E) (3.147), the track leads Clear of an ODAS superbuoy (special) (393120N
SE, passing: 01214E), thence:
Filipino Notice 9/38/22 [NP33--No 43--Wk 46/23] Spanish Notice 15/122/23 [NP45--No 112--Wk 46/23]

4.4 Wk46/23
IV

Spain – East coast – Spain -- Islas Baleares -- Ibiza — Anchorages


Cabo d’Oltrera to Cabo Creus —
Directions; buoy
160

148 Paragraph 4.35 1 including heading Replace by:

Paragraph 3.227 1 Replace by:


Spare
1 From a position ESE of Cabo d’Oltrera the track 4.35
leads generally NNE for about 16 miles, passing:
ESE of Golfo de Roses (421125N 30986E) Spanish Notice 21/190/23 [NP45--No 115--Wk 46/23]
(3.229), and:
Clear of an ODAS light buoy (special) (420900N
32677E), thence:
Spain -- Islas Baleares -- Isla de Formentera --
Ensenada de Tramontana — Anchorage;
Spanish Notice 21/187/23 [NP45--No 116--Wk 46/23] submarine cables

168
Spain -- Islas Baleares -- Ibiza —
Marine nature reserves Paragraph 4.76 3 line 4 Replace by:

...sand and weed, remaining clear of the artificial reef and


155 submarine cables.
Paragraph 4.8 1 Replace by:
Spanish Notice 27/263/23; ENC ES400479 (5.011)
1 Islas Bledas y los islotes Vedrá y Vedranell [NP45--No 117--Wk 46/23]
Marine Reserve (385206N 11235E) encompasses
the waters around the two islands. Anchoring and
fishing are prohibited. For further details on restrictions NP46 Mediterranean Pilot Volume 2
see 1.29 and contact the local authorities.
(2022 Edition)
Los Freus Marine Reserve has been established
enclosing a large area between the S end of Isla de
Ibiza and the N part of Isla Formentera. On the W
side it extends from Punta Jondal (Punta Yondal) Italy -- West coast -- Golfo di Salerno -- Amalfi —
(385134N 11922E) SSE and SSW to Punta Anchorage
Gabina (384310N 12282E), following the general
line of the coast. On the E side, it extends from a 352
position close N of Isla Sal Rosa (385230N
12438E), to include Islote Malvins del Sur, Islote Paragraph 13.21 4 lines 3--5 Replace by:
Malvins del Norte (4.65) and Islotes Los Dados (4.64),
then SW to a position 4 cables ESE of Islote La A (403741N 143668E).
Esponja (4.65), then SE and SW, passing close E of B (403756N 143698E).
Isla Espardell, to the coast close S of Punta Prima C (403772N 143729E).
(384367N 12836E). Other vessels may obtain anchorage elsewhere, as
indicated by the Maritime Authority.
Spanish Notice 21/190/23 [NP45--No 113--Wk 46/23]
Italian Notices 17/17.8; 17.14/23
[NP46--No 33--Wk 46/23]
Spain -- Islas Baleares -- Canal de Ibiza —
Directions; landmarks
NP67 West Coasts of Spain and Portugal Pilot
156 (2021 Edition)
Paragraph 4.12 2 Replace by:

2 Islote Vedrá (385203N 11185E), is reddish in Spain -- North--west coast -- Ría de Arousa --
colour and has a pronounced cone at its W Isla Rua — Directions; buoy
end and two similar cones at its E end. The
islet is steep--to in most places. A light (white 92
truncated conical tower, 3 m in height)
(385178N 11133E), stands on the W Paragraph 4.57 7 Replace by:
extremity of the islet. Islote Galera and other
above--water rocks lie close off the NE side of 7 ESE of Isla Rua (423296N 85638W) (4.56),
the islet. Islote Vedranell lies close E. and:

Spanish Notice 21/190/23 [NP45--No 114--Wk 46/23] UKHO [NP67--No 42--Wk 46/23]

Wk46/23 4.5
IV

Spain -- West coast -- Puerto de Marín —


Arrival information --
outer anchorages; submarine pipelines

101
Paragraph 4.102 1 Replace by:
1 Outer anchorages. There are eight anchor berths
located SW of Isla Tambo, as follows:
FP1 (422418N 84320W); depth 18 m, mud.
FP2 (422400N 84354W); depth 21 m, mud,
stone.
After Paragraph 4.102 2 line 6 Insert:
Caution. Attention is drawn to the charted
submarine pipelines laid between the vicinity of Isla
Tambo and the port.

Spanish Notice 19/163/23 [NP67--No 41--Wk 46/23]

4.6 Wk46/23
V

UPDATES TO ADMIRALTY LIST OF LIGHTS AND FOG SIGNALS

NP74, Vol A Edition 2023. Weekly Edition No. 46, Dated 16 November 2023.
Last Updates: Weekly Edition No. 45, dated 09 November 2023.

A0918·8 - Outer Harbour. Marina. 51 07·14 N 2 F G(Vert) .. . . Beacon ..


Breakwater 1 19·29 E
*

A1258·05 - Port 2000. Dolphin. W 49 27·84 N Fl R 4s .. 3 Metal post ..


FR, L1, 10390 0 07·22 E
* * * * * * * *

NORTH COAST. BAIE DE SEINE. EMBOUCHURE DE LA SEINE. LE HAVRE


A1258·1 Remove from list; deleted

A1758 - Les Perdrix 48 47·75 N Dir WG 6s 5 W 6 Green tower fl 0·2, ec 1·4, fl 0·2, ec 4·2.
FR, L1, 22060 3 05·79 W G 3 11 Fl(2) G165°-197°(32°).
Fl(2) W197°-202·5°(5·5°).
Fl(2) G202·5°-040°(197·5°)
* *

A2657·6 - Transporter Bridge. N 54 35·10 N 2 F G(vert) .. 1 .. 2m apart. Bridge floodlit


Landing 1 13·63 W
(GB:THPA)
*

EAST COAST. MAINLAND ISLAND


A3766 - Sumburgh Head 59 51·23 N Fl(3)W 30s 91 23 White tower (fl 0·4, ec 2·1) x 2, fl 0·4, ec 24·6.
(GB:N) 1 16·50 W 17 Range 12M and Elevation 90m (T)
2023
-- .. AIS .. .. .. MMSI No 992351304
*

A4140·3 - Corpach. Marina. SW 56 50·51 N Fl G 6s 2 2 Metal post ..


Breakwater 5 07·62 W
* * * * * * * *

A4140·5 - Corpach. Marina Entrance. 56 50·53 N Fl G 4s 2 1 Metal post ..


S 5 07·63 W
* * * * * * * *

WEST COAST. FIRTH OF CLYDE. LARGS CHANNEL. GREAT CUMBRAE ISLAND


A4348 - Millport. Eileans. W End 55 44·89 N QG 5 2 Post TE 2023
4 55·59 W
*

A4350 - Millport. Ldg Lts 333°. 55 45·03 N FR 7 5 Column TE 2023


Front. Pier. Head 4 55·85 W 6
*

A4352 - Millport. Ldg Lts 333°. 55 45·10 N FR 9 5 Column TE 2023


Rear. 137m from front 4 55·91 W 7
*

5.1 Wk46/23
V

NP74, Vol A Edition 2023 continued.

WEST COAST. FIRTH OF CLYDE. GARELOCH


A4421 - Beacon No 8N. Dir Lt 080° 55 59·09 N Dir WRG 4 W16 Yellow × on yellow F G075°-077·5°(2·5°).
4 44·20 W R13 pile structure with Al WG077·5°-079·5°(2°).
G13 platform F W079·5°-080·5°(1°).
Al WR080·5°-082·5°(2°).
F R082·5°-085°(2·5°).
In line 080° with A4421·2.
TE; Temporarily discontinued (T)
2023
- - Dir Lt 138° .. Dir WRG 4 W16 . . F G132°-134°(2°).
R13 Al WG134°-137°(3°).
G13 F W137°-139°(2°).
Al WR139°-142°(3°).
TE; Temporarily discontinued (T)
2023
- - Passing light .. Fl Y 3s 6 3 .. ..
*

A4422 - Ldg Lts 356° Front. 56 00·06 N Dir WRG 5 W16 Green % on green Al WG353°-355°(2°).
Beacon No 7N 4 45·36 W R13 pile structure F W355°-357°(2°).
(GB:MODN) G13 Al WR357°-000°(3°).
F R000°-002°(2°).
TE; Temporarily discontinued (T)
2023
- Dir Lt 115°. Beacon No 7N . . Dir WRG 5 W16 . . Al WG111°-114°(3°).
R13 F W114°-116°(2°).
G13 Al WR116°-119°(3°).
F R119°-121°(2°).
TE; Temporarily discontinued (T)
2023
- Passing light. Beacon No .. Oc G 6s 6 3 .. ..
7N
*

A5186 - Inner Harbour. Dredged 53 18·77 N 2 F R(vert) 6 5 Mast TE; Top Light Extinguished (T)
Channel. Public Quay. NE 4 37·50 W 2023
End. Turkeyshore Corner
* *

NP75, Vol B Edition 2023. Weekly Edition No. 46, Dated 16 November 2023.
Last Updates: Weekly Edition No. 45, dated 09 November 2023.

B0630 - Europlatform. Goeree 51 55·50 N Mo(U)W 15s .. .. .. Helicopter Platform


NL, HP2, 0984 3 40·10 E
--- .. Horn 30s .. .. .. ..
* * * * * * * *

B1848·745 - Munk S. No 8 55 28·10 N Fl(3)Y 10s 10 5 Wind turbine (fl 1, ec 1) x 2, fl 1, ec 5.


DK, , 152E 7 48·30 E Y270°-170°(260°).
TE 2023
--- .. Racon .. .. .. ALRS Vol 2 Station 55830
*

B2446 - Entrance to Dramsfjorden. 59 33·80 N Oc(2)WRG 8s 5 W5·2 Post R184·5°-194·8°(10·3°),


NO, , 026300 Kroksberget. W Side 10 24·51 E R3·6 3 W194·8°-206·8°(12°),
G3·3 G206·8°-359·4°(152·6°),
W359·4°-007·9°(8·5°),
R007·9°-010·9°(3°)
* * *

5.2 Wk46/23
V

NP75, Vol B Edition 2023 continued.

B2449 - Svelvikstrømmen. 59 35·06 N Oc WRG 4s 5 W5·5 Tripod R000·5°-024·7°(24·2°),


NO, , 026900 Bjørneskjær. Ldg Lts 10 26·01 E R3·8 6 W024·7°-085·7°(61°),
156°30′. Front G3·5 G085·7°-155·9°(70·2°),
W155·9°-157·1°(1·2°),
R157·1°-172·6°(15·5°),
W172·6°-176·6°(4°),
G176·6°-222·4°(45·8°)
* * *

B2449·95 - Svelvikstrømmen. 59 35·76 N Iso R 6s 4 2·7 Column Floodlit


NO, , 027010 Svelvikrenna. SW 10 25·33 E 15
* * *

B2449·96 - Svelvikstrømmen. 59 35·80 N Iso G 6s 4 2·7 Column Floodlit


NO, , 027020 Svelvikrenna. SE 10 25·48 E 12
* * *

OSLOFJORDEN
B2474 - Holmestrandfjorden. 59 28·87 N Oc WRG 6s 4 W5·6 Column G101·9°-147°(45·1°),
NO, , 030400 Mulodden 10 20·97 E R3·9 3 R147°-150·9°(3·9°),
G3·5 W150·9°-155·4°(4·5°),
G155·4°-188·6°(33·2°),
W188·6°-191·7°(3·1°),
R191·7°-276°(84·3°),
W276°-287°(11°),
G287°-304·8°(17·8°)
*

OSLOFJORDEN. HOLMESTRAND. MULVIKA


B2474·5 - Hagemann S 59 28·88 N FR 3 0·5 Post ..
NO, , 030402 10 19·91 E
* * *

B2474·6 - Hagemann N 59 28·89 N FG 3 0·5 Post ..


NO, , 030401 10 19·91 E
* * *

B2475·5 - Holmestrand. N 59 29·55 N FG 2 0·5 Post ..


NO, , 030501 Breakwater. Head 10 19·29 E
* * *

B2475·8 - Holmestrand. Breakwater 59 29·50 N FR 3 0·5 Post ..


NO, , 030502 10 19·29 E
* * *

B2476 - Horten. Inner Harbour. Ldg 59 26·17 N Fl R 3s 6 1·4 Post ..


NO, , 031012 Lts 187·7°. Front 10 28·98 E 9
* * *

B2476·1 - Horten. Inner Harbour. Ldg 59 25·81 N Iso R 4s 16 1 Tripod ..


NO, , 031014 Lts 187·7°. Rear. 670m from 10 28·88 E 14
front
* * *

B2476·2 - Vealøsgapet 59 26·69 N QG 6 1·5 Post ..


NO, , 031001 10 29·05 E 10
* * * *

B2477 - Diriksbåen 59 26·19 N Fl G 3s 4 1 Post ..


NO, , 031003 10 28·48 E
* * * *

B2483·1 - Stubrekk. Oil Pier. Ldg Lts 59 20·48 N FR .. .. .. Private


NO, , 0315CP 309·3°. Rear. 1·3M from 10 28·96 E
front
* *

5.3 Wk46/23
V

NP75, Vol B Edition 2023 continued.

B2488 - Narverød 59 15·13 N Oc WRG 6s 8 W2·7 Post G212·1°-272·2°(60·1°),


NO, , 032200 10 28·69 E R1·7 5 W272·2°-274·6°(2·4°),
G1·6 R274·6°-353·7°(79·1°),
W353·7°-358·1°(4·4°),
G358·1°-009·5°(11·4°)
* * *

B2490 - N Head. Ldg Lts 117·4°. 59 15·10 N FR 7 1·3 Post ..


NO, , 039000 Front 10 27·01 E 7
* * * *

B2490·1 - N Head. Ldg Lts 117·4°. 59 15·08 N FR 11 1·3 Post ..


NO, , 039100 Rear. 75m from front 10 27·09 E 7
* * * *

B2544 - Munkerekka 59 15·06 N Oc WRG 6s 1 W 3 Post G331·8°-358·1°(26·3°),


NO, , 038200 10 22·89 E R1·9 3 W358·1°-003°(4·9°),
G1·7 R003°-177·8°(174·8°),
W177·8°-183·4°(5·6°),
G183·4°-194·8°(11·4°)
* * *

B2546 - Smørberg 59 15·97 N Oc(3)WRG 10s 6 W5·3 Post R223°-292·2°(69·2°),


NO, , 038300 10 22·65 E R3·6 3 W292·2°-357·3°(65·1°),
G3·4 G357·3°-002°(4·7°)
* *

TØNSBERG. TØNSBERG HAVN


B2554 - Bridge 59 15·65 N FR 2 1 Post 1 each side of Bridge. Only shown
NO, , 039300 10 24·94 E 3 when Bridge is closed
* * *

B2564 - Ldg Lts 094·2°. Rear. 183m 59 16·22 N FR 26 1 Post R049·3°-139·3°(90°)


NO, , 039800 from front. Slottsfjellet 10 24·21 E 4
* *

B2681·6 - Kreppasundet 58 54·35 N Iso R 4s .. .. .. Floodlit.


NO, , 052164 9 32·65 E (P) 2023
* * * * * * * *

B2681·7 - Gumøy 58 54·38 N Iso G 2s .. .. .. Floodlit.


NO, , 052163 9 32·84 E (P) 2023
* * * * * * * *

B2681·8 - Lille Fluer 58 54·54 N Iso R 4s .. .. .. Floodlit.


NO, , 052162 9 33·58 E (P) 2023
* * * * * * * *

B2681·9 - Store Fluer 58 54·56 N Iso G 2s .. .. .. Floodlit.


NO, , 052161 9 33·76 E (P) 2023
* * * * * * * *

B2682 - Store Fluer 58 54·57 N Oc WRG 6s 3 W5·9 . . G069·8°-070·2°(0·4°),


NO, , 051100 9 33·77 E R4·2 3 R070·2°-234·2°(164°),
G3·9 W234·2°-247·5°(13·3°),
G247·5°-248·3°(0·8°).
To be removed (P) 2023
*

B2682·1 - Fluer 58 54·60 N Iso R 2s .. .. .. Floodlit.


NO, , 052158 9 33·78 E (P) 2023
* * * * * * * *

5.4 Wk46/23
V

NP75, Vol B Edition 2023 continued.

B2682·6 - Fossingfjord. Risøy. E 58 54·97 N Iso WRG 4s 3 W5·8 Post G127·6°-135·4°(7·8°),


NO, , 051200 Point 9 31·91 E R4·1 3 W135·4°-146°(10·6°),
G3·8 R146°-271·2°(125·2°),
W271·2°-280·4°(9·2°),
G280·4°-287·4°(7°).
Sectors to be amended (P) 2023
* *

LANGÅRDSUND
B2684 - Kreppa. SW Side 58 54·33 N Iso G 4s .. .. .. Floodlit.
NO, , 051165 9 32·52 E (P) 2023
* * * * * * *

B2684·1 - Dyna 58 54·25 N Iso G 2s .. .. .. Floodlit.


NO, , 052167 9 32·26 E (P) 2023
* * * * * * * *

B2684·2 - Langårdsund 58 54·14 N Iso R 2s .. .. .. Floodlit.


NO, , 052166 9 31·77 E (P) 2023
* * * * * * * *

B2684·3 - Langøy 58 54·05 N Iso R 4s .. .. .. Floodlit.


NO, , 052168 9 31·29 E (P) 2023
* * * * * * * *

B2686 - Sundgårdsholmen. N Side 58 54·03 N Oc WRG 6s 3 W5·9 Post G056·5°-060·8°(4·3°),


NO, , 051900 9 31·27 E R4·2 3 R060·8°-250·8°(190°),
G3·9 W250·8°-253·9°(3·1°),
G253·9°-259·9°(6°).
To be removed (P) 2023
*

B2686·1 - Sundgårdsholmen 58 54·03 N Iso G 4s .. .. .. Floodlit.


NO, , 052169 9 31·27 E (P) 2023
* * * * * * * *

B2686·2 - Bråtebåen 58 53·72 N Iso G 2s .. .. .. Floodlit.


NO, , 052171 9 30·22 E (P) 2023
* * * * * * * *

B2686·4 - Malmtangen 58 53·65 N Iso R 4s .. .. .. Floodlit


NO, , 052174 9 29·95 E
* * * * * * * *

B2686·5 - Rydingen 58 53·54 N Iso G 2s .. .. .. Floodlit.


NO, , 052175 9 29·60 E (P) 2023
* * * * * * * *

B2686·6 - Kalvetangen 58 53·49 N Iso R 2s .. .. .. Floodlit.


NO, , 052176 9 29·35 E (P) 2023
* * * * * * * *

B2686·7 - Bjerkehue 58 53·41 N Iso R 4s .. .. .. Floodlit.


NO, , 052178 9 28·92 E (P) 2023
* * * * * * * *

B2686·8 - Haugland W 58 53·22 N Iso G 4s .. .. .. Floodlit.


NO, , 052179 9 28·32 E (P) 2023
* * * * * * * *

B2688 - Svaneflekken 58 53·71 N Iso R 3s .. .. .. Floodlit.


NO, , 052172 9 30·14 E (P) 2023
* * * * * *

5.5 Wk46/23
V

NP75, Vol B Edition 2023 continued.

B2690·7 - Mefjordskjærbåen 58 52·74 N Iso G 4s 6 5·5 Beacon Floodlit


NO, , 052127 9 31·03 E
* *

B2700·9 - Postmyr 58 50·63 N F WRG .. .. .. G341·7°-345·7°(4°),


NO, , 053210 9 28·01 E WG345·7°-346·2°(0·5°),
W346·2°-347·2°(1°),
WR347·2°-347·7°(0·5°),
R347·7°-351·7°(4°).
(P) 2023
* * * * * * * *

B2715·7 - Stangbåen 58 48·89 N Iso G 2s .. .. .. Floodlit.


NO, , 053001 9 28·90 E (P) 2023
* * * * * * * *

B2717 Vestre Fjordbåen 58 49·17 N Iso G 4s .. .. .. Floodlit.


NO, , 053003 9 28·77 E (P) 2023
* * * * * * * *

B2718 Stangskjæret 58 49·24 N Iso R 4s .. .. .. Floodlit.


NO, , 053004 9 28·54 E (P) 2023
* * * * * * * *

B2751·8 - Borøytangen 58 35·82 N Iso R 2s 4 2·5 Post Floodlit


NO, , 057132 9 02·30 E 8
* * * * * * * *

B2757·5 - Risholmgrunnen 58 34·44 N Iso G 2s 4 2·6 Post Floodlit


NO, , 058343 9 01·76 E 7
* * * * * * * *

B2762·2 - Buskjærsteinen 58 33·63 N Iso G 4s 4 2·7 Post Floodlit


NO, , 058345 9 00·74 E 8
* * * * * * * *

B2872·5 - Bergsøya 58 14·23 N F WRG 8 W 3 Post F G003·6°-005·7°(2·1°).


NO, , 068200 8 24·78 E R 3 6 Al GW005·7°-006·7°(1°).
G 3 F W006·7°-010·8°(4·1°).
Al RW010·8°-011·8°(1°).
F R011·8°-013·9°(2·1°)
* * * *

B2874·5 - Svertinggrunnen. N 58 13·68 N Iso G 2s 9 3·4 Post Floodlit


NO, , 067237 8 26·35 E 13
* * * * *

B2875 - Indre Malmegrunnen 58 13·43 N Oc WRG 6s 12 R4·8 Post R023·7°-038°(14·3°),


NO, , 068100 8 25·49 E G4·8 16 G038°-132·7°(94·7°),
W6·2 W132·7°-133·4°(0·7°),
R133·4°-255·6°(122·2°),
G255·6°-260·5°(4·9°),
W260·5°-269·2°(8·7°),
R269·2°-291·1°(21·9°),
G291·1°-303·2°(12·1°),
W303·2°-349·8°(46·6°),
R349·8°-009°(19·2°),
G009°-023·7°(14·7°).
Floodlit
*

B2877·05 - Langøya. Sandsgapet. E 58 14·26 N Iso G 2s 6 1·1 Post Floodlit


NO, , 068105 8 23·87 E
* * * *

5.6 Wk46/23
V

NP75, Vol B Edition 2023 continued.

ÅNA-SIRA
B3144 - Løyodden. Egdeholmen 58 16·54 N Fl WRG 5s 51 W6·3 Post R308·9°-312·9°(4°),
NO, , 090100 6 22·97 E R4·5 3 W312·9°-078·4°(125·5°),
G4·2 G078·4°-089·6°(11·2°),
W089·6°-099·4°(9·8°),
R099·4°-193·2°(93·8°)
* * *

B3149 Dyngetoppen 58 18·44 N QW 19 5·5 Post Floodlit


NO, , 091601 6 18·43 E 10
*

B3152 - Austre Kvalen 58 18·63 N Oc WRG 6s 14 W7·1 Post G026·7°-079·6°(52·9°),


NO, , 091400 6 19·70 E R6·1 3 W079·6°-083·4°(3·8°),
G6·1 R083·4°-145·7°(62·3°),
G145·7°-202·3°(56·6°),
W202·3°-208·5°(6·2°),
R208·5°-225·9°(17·4°)
* * *

REKEFJORD
B3154 - Vambelsundet. 58 18·94 N Fl R 3s 17 4·2 Column fl 0·3
NO, , 091700 Langholmen SE 6 17·23 E 12
* *

B3159 - Ldg Lts 358·1°. Front 58 20·27 N FR 17 4·3 Post R355·7°-000·7°(5°)


NO, , 092700 6 15·45 E 6
* * * * * *

B3159·1 - Ldg Lts 358·1°. Rear 58 20·31 N FR 23 4·3 Post R355·7°-000·7°(5°)


NO, , 092600 6 15·45 E 4
* * * * *

B3160 - Alterodden 58 19·56 N Oc WRG 6s 7 W3·9 Post G337·1°-342·4°(5·3°),


NO, , 092100 6 15·54 E R3·3 4 W342·4°-344·9°(2·5°),
G3·3 R344·9°-347·3°(2·4°),
G347·3°-000·8°(13·5°),
W000·8°-002·6°(1·8°),
R002·6°-176·4°(173·8°),
G176·4°-193·6°(17·2°)
* *

B3162 - Teineberget 58 19·57 N FR 10 4·2 Post Floodlit


NO, , 092202 6 15·46 E 7
* * *

B3172 Svåholman 58 22·47 N Fl W 3s 21 6 Cairn ..


NO, , 092900 6 02·56 E 14
*

B3220 Håtangen 58 40·17 N Oc WRG 6s 9 W9·6 Post G099·8°-109·9°(10·1°),


NO, , 099400 5 32·52 E R8·5 9 W109·9°-149·3°(39·4°),
G8·5 R149·3°-163·2°(13·9°)
* * * * * * *

B3220·1 Obrestad 58 39·48 N FFl W 30s 38 7·6 Tower W343·9°-180·5°(196·6°)


NO, , 099000 5 33·26 E 16
- .. Racon .. .. .. ALRS Vol 2 Station 64930
*

5.7 Wk46/23
V

NP75, Vol B Edition 2023 continued.

B3232 Ausa. N Point. 58 53·41 N Iso WRG 4s 17 W7·8 Column W010°-014·1°(4·1°),


NO, , 100200 Kolnesholmane 5 32·65 E R6·8 13 R014·1°-017·7°(3·6°),
G6·8 G017·7°-024·5°(6·8°),
W024·5°-038·5°(14°),
R038·5°-051·9°(13·4°),
G051·9°-062°(10·1°),
W062°-064·7°(2·7°),
R064·7°-117·3°(52·6°),
G117·3°-166·2°(48·9°),
W166·2°-170·7°(4·5°),
R170·7°-176·6°(5·9°),
G176·6°-180·8°(4·2°),
W180·8°-184·5°(3·7°),
R184·5°-355·3°(170·8°),
G355·3°-010°(14·7°).
Reported difficult to identify due to
ambient lighting
*

B3272 - Tjuvholmen 58 58·91 N Oc(2)WRG 8s 2 W2·8 Post G112·8°-133°(20·2°),


NO, , 106700 5 43·27 E R1·8 8 W133°-137·9°(4·9°),
G1·6 R137·9°-281·1°(143·2°),
G281·1°-312·1°(31°),
R312·1°-318·6°(6·5°),
W318·6°-351·4°(32·8°),
R351·4°-112·8°(121·4°).
Sectors to be amended (P) 2023
*

B3277 - Grasholmen 58 58·50 N Oc WRG 6s 6 W2·7 Post R213·4°-242·2°(28·8°),


NO, , 107650 5 44·85 E R1·7 3 W242·2°-267·6°(25·4°),
G1·6 G267·6°-277·9°(10·3°),
W277·9°-283·9°(6°),
R283·9°-008°(84·1°),
W008°-083·8°(75·8°).
To be removed (P) 2023
*

B3304 - Idsefjord. Knibringen 59 00·35 N Oc(2)WRG 8s 6 W6·5 Post R222·2°-270·3°(48·1°),


NO, , 109700 5 54·49 E R4·6 3 W270·3°-276·9°(6·6°),
G4·3 G276·9°-071·5°(154·6°),
W071·5°-074·8°(3·3°),
R074·8°-123·5°(48·7°).
Sectors to be amended (P) 2023
*

RYFYLKEFJORDANE
B3308 - Kløvningen 59 01·57 N Oc(2)WRG 8s 13 W6·5 Post R049·3°-064·2°(14·9°),
NO, , 110000 5 46·50 E R4·6 3 W064·2°-078·3°(14·1°),
G4·3 G078·3°-190·4°(112·1°),
R190·4°-206·9°(16·5°),
W206·9°-208·5°(1·6°),
G208·5°-254·2°(45·7°),
W254·2°-284·4°(30·2°),
R284·4°-294·7°(10·3°),
W294·7°-301·7°(7°),
G301·7°-315·2°(13·5°).
Sectors to be amended (P) 2023
*

B3309 - Åmoy. Fuglaneset 59 02·90 N Oc WRG 6s 3 W11 Tripod R127·9°-130·1°(2·2°),


NO, , 110600 5 46·59 E R8·7 6 W130·1°-134·3°(4·2°),
G8·3 G134·3°-190°(55·7°),
W190°-192·5°(2·5°),
R192·5°-221·8°(29·3°),
G221·8°-228·9°(7·1°),
W228·9°-233·1°(4·2°),
R233·1°-339·3°(106·2°),
W339·3°-347·3°(8°),
G347·3°-351·2°(3·9°).
Sectors to be amended (P) 2023
*

5.8 Wk46/23
V

NP75, Vol B Edition 2023 continued.

RYFYLKEFJORDANE
B3318 - Kvernanes 59 03·76 N Oc WRG 6s 4 W3·1 Tripod W215·2°-265·2°(50°),
NO, , 111800 5 54·38 E R 2 9 G265·2°-345·6°(80·4°),
G1·8 R345·6°-018·7°(33·1°),
W018·7°-086°(67·3°),
R086°-104·2°(18·2°).
Sectors to be amended (P) 2023
*

NP76, Vol C Edition 2023. Weekly Edition No. 46, Dated 16 November 2023.
Last Updates: Weekly Edition No. 45, dated 09 November 2023.

C0061·8 - Aså Havn. Ldg Lts 258·1°. 57 08·62 N FW 3 2 White % on building ..


DK, , 1442B Front 10 25·63 E
*

C0061·81 - Aså Havn. Ldg Lts 258·1°. 57 08·61 N FW 8 2 White + on metal ..


DK, , 1442A Rear 10 25·52 E mast
*

C0062 - Aså Havn. W Mole. Head 57 08·63 N FG 4 1 Mast ..


DK, , 1440 10 25·72 E 4
*

C0064 - Aså Havn. S Mole. Head 57 08·62 N FR 4 1 Mast ..


DK, , 1441 10 25·74 E 4
*

C0632 - Donsöhuvud 57 35·67 N Fl WRG 3s 5 W 6 White lantern G180°-191·3°(11·3°),


11 49·00 E R 5 W191·3°-194·8°(3·5°),
G 5 R194·8°-315°(120·2°),
G315°-022°(67°), W022°-025°(3°),
R025°-045°(20°)
* *

C1800·05 - Orehoved Havn 54 57·35 N Oc WRG 5s 9 W5·7 Round metal tower W183·8°-185·5°(1·7°),
DK, , 5387 11 51·32 E R5·3 9 R185·5°-189°(3·5°),
G5·3 G179°-183·8°(4·8°)
* * *

C6012 - Härnöklubb 62 35·98 N Fl(4)WG 12s . . W10 . . W210°-040°(190°), G190°-210°(20°)


18 03·28 E G 9
* * *

C6025 - Sälstenarna 62 28·49 N Q WRG 10 W 6 White tower, black G121·8°-139·7°(17·9°),


17 28·51 E R 4 top W139·7°-270·1°(130·4°),
G 3 8 R270·1°-284·6°(14·5°),
G284·6°-299·6°(15°),
W299·6°-321·2°(21·6°),
R321·2°-350°(28·8°) Bearing 350° is
the approximate S Shoreline Limit
*

EASTERN PART
C6681 - Gåsholm 59 19·28 N Fl(2)WRG 3s 8 W 7 White U on white G080°-126·5°(46·5°) Bearing 080° is
17 31·68 E R 6 mast, red band the approximate WSW Shoreline
G 6 Limit, W126·5°-136°(9·5°),
R136°-199°(63°), G199°-307°(108°),
W307°-319·5°(12·5°),
R319·5°-355°(35·5°) Bearing 355° is
the approximate S Shoreline Limit
* * *

5.9 Wk46/23
V

NP76, Vol C Edition 2023 continued.

C6682 - Kurön 59 20·06 N Iso WRG 3s 9 W12 White tower, red G134°-154·3°(20·3°),
17 29·34 E R 9 band W154·3°-157°(2·7°),
G 7 8 R157°-199·8°(42·8°),
G199·8°-277°(77·2°),
W277°-300·4°(23·4°),
R300·4°-014°(73·6°).
Unreliable; works are in progress
on lights between Södertälje and
Köping, refer to 3881(P)/21 (T) 2023
* *

C6684·6 - Oknö Hälludde 59 31·37 N Iso WRG 3s 3 W 6 White hut, red band G101°-111·2°(10·2°),
17 06·98 E R 5 W111·2°-147·7°(36·5°),
G 5 R147·7°-220·3°(72·6°),
G220·3°-286·2°(65·9°),
W286·2°-306°(19·8°),
R306°-316°(10°)
* * *

C6688·2 - Aggarösundet. 59 30·96 N Fl(2)WRG 3s 4 W 6 White tower, green G272°-281·8°(9·8°),


Snesarboudde 16 44·91 E R 5 band W281·8°-290°(8·2°),
G 6 R290°-300·2°(10·2°),
G074·7°-084·7°(10°),
W084·7°-086·4°(1·7°),
R086·4°-096·4°(10°)
* * *

C6694 - Kalvö Hampetorp. Bogen 59 27·10 N Iso WRG 3s 6 W 6 White tower G070·5°-101·3°(30·8°),
16 09·54 E R 5 R101·3°-201°(99·7°),
G 5 G201°-236·1°(35·1°),
W236·1°-238·4°(2·3°),
R238·4°-070·5°(192·1°).
Unreliable; works are in progress
on lights between Södertälje and
Köping, refer to 3881(P)/21 (T) 2023
* * *

NP77, Vol D Edition 2023. Weekly Edition No. 46, Dated 16 November 2023.
Last Updates: Weekly Edition No. 45, dated 09 November 2023.

D1095·14 - Banc de Guérande. 47 08·84 N Fl Y 2·5s .. 5 Wind turbine ..


Offshore Wind Farm 2 41·93 W
--- .. AIS .. .. .. MMSI No 992271061
* * * * * * * *

D1095·46 - Banc de Guérande. 47 08·92 N Fl Y 2·5s .. 5 Wind turbine ..


Offshore Wind Farm 2 30·01 W
--- .. AIS .. .. .. MMSI No 992271058
* * * * * * * *

D1526·7 - Puerto de Zierbena. W 43 21·31 N QG 12 1 Tower on green TE 2023


ES, I, 00660 Bridge. E Side 3 04·77 W framework
3
*

D1526·72 - Puerto de Zierbena. W 43 21·29 N QR 12 1 Tower on red TE 2023


ES, I, 00661 Bridge. W Side 3 04·74 W framework
3
*

5.10 Wk46/23
V

NP77, Vol D Edition 2023 continued.

D1750·5 - Puerto de Finisterre. 42 54·47 N Fl(4)G 11s 3 1 Green and white (fl 0·5, ec 1·5) x 3, fl 0·5, ec 4·5
ES, I, 03915·5 Beaching Ramp. Head 9 15·69 W column
5
* * * * * * * *

D1798·5 - Bajo Petones de Centoleiras 42 30·53 N Q R 1s .. 5 Red and white ..


ES, I, 04137 9 00·49 W column
6
*

D2349·9101 - Lock. Traffic Signal. 37 19·13 N 3 F R(vert) .. 1 Grey post Lock closed
ES, I, 09991·19 Downstream 6 00·41 W 3
---- .. 3 F G(vert) .. .. .. Lock open
* *

D2349·929 - Lock. Traffic Signal. 37 19·09 N 3 F R(vert) .. 1 Green % on white & Lock closed
ES, I, 09991·11 Upstream 6 00·46 W on wall
---- .. 3 F G(vert) .. .. .. Lock open
*

D2349·9325 - Lock. Traffic Signal. 37 19·16 N 3 F R(vert) .. 1 Grey post Lock closed
ES, I, 09991·13 Upstream 6 00·25 W 3
---- .. 3 F G(vert) .. .. .. Lock open
* *

D2349·9335 - Lock. Traffic Signal. 37 19·21 N 3 F R(vert) .. 1 Grey post Lock closed
ES, I, 09991·18 Downstream 6 00·21 W 3
---- .. 3 F G(vert) .. .. .. Lock open
* *

D2626 El Cabiño 26 25·49 N Fl(3)W 12s 36 9 White round tower, (fl 0·4, ec 2·6) x 2, fl 0·4, ec 5·6.
MA, , 19850 14 10·90 W black bands TE 2023
ES, I, 13860 32
FR, L2, 19180 - Emergency light .. Fl(3)W 12s .. .. .. ..
*

D2780·77 - Puerto del Carmen. (La 28 55·28 N Fl(4)R 11s 5 1 Red post (fl 0·5, ec 1·5) x 3, fl 0·5, ec 4·5
ES, I, 12115·5 Tiñosa). Entrance Channel. 13 40·50 W
Third Post
* * * * * * * *

D2780·78 - Puerto del Carmen. (La 28 55·28 N Fl(3)R 9s 5 1 Red post (fl 0·5, ec 1·5) x 2, fl 0·5, ec 4·5
ES, I, 12115·4 Tiñosa). Entrance Channel. 13 40·55 W
Second Post
* * * * * * * *

D2780·79 - Puerto del Carmen. (La 28 55·27 N Fl(2)R 7s 5 3 Red post fl 0·5, ec 1·5, fl 0·5, ec 4·5
ES, I, 12115·3 Tiñosa). Entrance Channel. 13 40·59 W
First Post
* * * * * * * *

D2780·8 - Puerto del Carmen. (La 28 55·24 N Fl(2)G 7s 7 5 Green truncated fl 0·5, ec 1·5, fl 0·5, ec 4·5
ES, I, 12115·1 Tiñosa). Breakwater. Head 13 40·59 W pyramidal tower
3
* * *

BAHÍA DE ANGRA DE CINTRA


D2975 - N Side. Punta de las 23 04·90 N Iso W 2s 16 12 White tower ..
ES, I, 13980 Raimas 16 12·50 W
FR, L2, 19680
* * * * * * *

5.11 Wk46/23
V

NP78, Vol E Edition 2023. Weekly Edition No. 46, Dated 16 November 2023.
Last Updates: Weekly Edition No. 45, dated 09 November 2023.

E0016·4 Puerto Deportivo 36 17·24 N Fl(3)G 10s 3 1 Green % on green (fl 0·5, ec 1·5) x 2, fl 0·5, ec 5·5
ES, II, 20844 Sotogrande. Embarcadero 5 16·23 W and white column
Capitanía
*

E0031 Puerto José Banús. Benabolá 36 29·05 N Fl(3)R 10s 7 3 Red & on stone tower (fl 0·5, ec 1·5) x 2, fl 0·5, ec 5·5
ES, II, 21040 Breakwater. W Head 4 57·21 W 4
* *

E0032 Puerto José Banús. E 36 28·98 N Fl(3)G 12s 13 5 Green % on stone (fl 0·5, ec 1·5) x 2, fl 0·5, ec 7·5
ES, II, 21060 Breakwater. Head 4 57·29 W tower
9
--- .. Siren 60s .. .. .. bl 5
*

E0087·1 Isla de Alborán. Harbour 35 56·29 N Fl G 2s 9 3 Green 4-sided tower fl 0·5.


ES, II, 22128 Breakwater. Head 3 02·00 W 8 Destroyed (T) 2023
*

E0160·9 - Inner Dock Access. 38 20·32 N Fl(4)G 10s .. 1 Green and white post (fl 0·5, ec 1) x 3, fl 0·5, ec 5.
ES, II, 24600·6 Entrance. Island. N Side 0 28·94 W G070°-240°(170°)
*

E0175 Puerto Blanco. Marina. E 38 38·11 N Fl R 5s 7 3 Red truncated conical fl 0·5.


ES, II, 25030 Breakwater. Head 0 02·15 E tower TE 2023
6
*

E0175·1 Puerto Blanco. Semi 38 38·10 N Fl G 5s 3 1 Green post fl 0·5.


ES, II, 25035 Submerged Pier 0 02·10 E TE 2023
*

E0374·14 - Sant Carles de la Rápita. 40 37·02 N Fl R 5s 2 1 Red and white fl 0·5


ES, II, 27896·2 Dársena Este. Dique de 0 36·15 E column
Levante. W Side. Corner 1
*

E0374·15 - Sant Carles de la Rápita. 40 36·97 N Q R 1s 2 1 Red and white ..


ES, II, 27896 Dársena Este. Dique de 0 36·14 E column
Levante. W Side. Corner 1
------ .. AIS .. .. .. MMSI No 992241152
*

E0396·522 - Fuel Pier. Head 41 12·81 N Fl Y 2s 4 1 Yellow × on yellow fl 0·5


ES, II, 29405 1 44·02 E post
3
* * *

E0497 - Port-Vendres. Point de la 42 31·15 N QW 12 8 Red structure, white ..


FR, L1, 49300 Redoute Béar. Ldg Lts 3 06·85 E shelter with grey base
198·5°. Front 6
*

E0497·1 - Port-Vendres. Point de la 42 31·04 N Dir Q W 23 10 White tower, red top, Intens 196°-199°(3°).
FR, L1, 49301 Redoute Béar. Ldg Lts 3 06·81 E red and white Sync with front
198·5°. Rear. 200m from chequered stripe
front 11
*

E0498·5 - Port-Vendres. Fort du Fanal 42 31·26 N Fl(2)G 6s 9 4 White tower, dark Sync with E0504
FR, L1, 49380 3 06·85 E green top
9
* * *

5.12 Wk46/23
V

NP78, Vol E Edition 2023 continued.

E0506 - Port-Vendres. Anse Gerbal. 42 31·21 N Fl(3)G 12s 4 2 White pylon, green ..
FR, L1, 49400 La Criée. Wharf 3 06·79 E top
2
* * *

E0508 - Port-Vendres. Pointe des 42 31·18 N Fl(4)G 15s 4 2 White column, dark ..
FR, L1, 49420 Pilotes. Quarantine light 3 06·69 E green top
3
* * *

E0509 - Port-Vendres. Pointe de la 42 31·09 N Fl(4)R 15s 3 2 Red lantern on post signal station at 40m at SSW
FR, L1, 49440 Presqu'ile 3 06·56 E 2
* * * *

E0876 - Cap Pertusato 41 22·05 N Fl(2)W 10s 100 25 White square tower, fl 0·1, ec 2·4, fl 0·1, ec 7·4.
FR, L1, 66060 9 11·07 E black top and corners W239°-113°(234°).
19 Range 16M (T) 2023
*

VELEBITSKI KANAL
E2919 - Zečevo 44 59·75 N Fl W 4s 16 3 White column fl 0·5
HR, , 286·5 14 50·16 E 4
* * * * * * * *

E3195·5 - Bay of Dugovača. Drage. 43 53·43 N Fl W 3s 5 1 White column ..


HR, , 434·6 Pier head 15 32·01 E 4
* * * * * * * *

E6380 - Île Kuriat 35 48·02 N Fl WR 5s 30 W18 White square tower, fl 1.


TN, , 3700 11 02·02 E R14 red top, white W053°-348°(295°), R348°-053°(65°)
dwelling
26
*

E6387·3 - El Kantaoui. Pleasure 35 53·50 N Fl R 5s 9 6 Red tower fl 1


TN, , 2510 Harbour. S Breakwater. Head 10 36·00 E 6
FR, L2, 04660
*

E6409·21 - Tunis Canal. No 21 36 48·72 N Fl G 4s 3 2 Beacon ..


TN, , 1560 10 17·08 E
*

E6426 - Port de Commerce. Jetée 37 16·70 N Fl G 4s 15 8 Green conical tower fl 1


TN, , 0420 Nord. Head 9 53·43 E 8
*

E6550 Jijel. N Jetty. Main Light 36 49·64 N Oc(2+1)WR 12 W12 Yellow square tower ec 1, lt 1, ec 1, lt 3, ec 1, lt 5.
DZ, , 3403 5 46·82 E 12s R 9 8 R096°-101°(5°), W101°-096°(355°).
Obscured by the heights of Picouleau
when bearing less than 094°
* *

E6552 Jijel. S Jetty. Head 36 49·44 N Fl R 4s 7 7 Red round column ..


DZ, , 3401 5 46·76 E 3
* *

BAIE D'ALGER. PORT D'ALGER


E6602 - Jetée Kheireddine. Head 36 46·62 N Fl(2)W 3s 23 14 White round tower W154°-055°(261°).
DZ, , 2500 3 04·68 E 17 TE 2023
--- .. Horn Mo(N) .. .. .. bl 3, si 3, bl 1, si 23
30s
*

5.13 Wk46/23
V

NP78, Vol E Edition 2023 continued.

E6645·3 Beni Haoua Port. Main Jetty 36 32·17 N Fl(2)R 8s .. .. .. fl 0·5, ec 1·5, fl 0·5, ec 5·5.
DZ, , 2106 1 34·98 E TE 2023
*

E6658 Cap Ivi (Ras Ouillis) 36 06·78 N Fl W 5s 118 28 Yellow 8-sided tower fl 0·4.
DZ, , 1800 0 13·60 E on red dwelling W064°-047°(343°).
18 Obscured 047°-064°(17°).
F W (T) 2023
*

E6708 Ras Falcon 35 46·24 N Fl(4)W 25s 104 29 White 8-sided stone (fl 0·2, ec 2·9) x 3, fl 0·2, ec 15·5.
DZ, , 1400 0 48·04 W tower, with building F R on Radio Masts 5·2M to the S.
FR, L2, 10220 27 TE 2023
*

E6722 Port de Ghazaouet. N Jetty. 35 06·32 N Oc R 4s 17 9 Red round metal ec 1.


DZ, , 1105 Head 1 52·22 W column TE 2023
15
*

E6754 Islas Chafarinas. Isla Isabel 35 11·01 N Fl W 7s 52 8 White round tower fl 1.


ES, II, 73100 II. NW Head 2 25·86 W and cupola with Obscured 045°-080°(35°) by Isla
(ES) brown dwelling Congreso.
18 TE 2023
*

PORT NADOR
E6757·6 - Dique Principal. Head 35 17·05 N Q(2)R 6s 9 8 Red post ..
ES, II, 72990 2 55·09 W 6
* * * *

E6757·65 - Mole 2. NE Corner 35 16·76 N VQ(4)Y .. 2 .. ..


ES, II, 72992 2 55·06 W
* *

E6757·8 - Mole 1. NE Corner 35 16·61 N Q Y 1s .. 1 Grey post ..


ES, II, 72995 2 55·29 W 1
* * *

NP79, Vol F Edition 2023. Weekly Edition No. 46, Dated 16 November 2023.
Last Updates: Weekly Edition No. 45, dated 09 November 2023.

F0532 - North Channel Beacon 18 57·13 N Oc R 4s 6 8 White beacon, red ec 2.


72 51·11 E bands R070°-320°(250°)
8
*

F1300 Rondo 6 04·40 N Fl(2)W 20s 193 40 White framework ..


ID, , 11 95 07·08 E tower
40
* *

SELAT BENGKALIS
F1411 Remove from list; deleted

SELAT BENGKALIS
F1411·2 Remove from list; deleted

5.14 Wk46/23
V

NP79, Vol F Edition 2023 continued.

SELAT BENGKALIS
F1411·4 Remove from list; deleted

NP80. Vol G Edition 2023. Weekly Edition No. 46, Dated 16 November 2023.
Last Updates: Weekly Edition No. 45, dated 09 November 2023.

G0202 Olinda. Morro do Serapião 8 00·67 S Fl(2)W 35s 89 46 White truncated fl 1, ec 7·5, fl 1, ec 25·5.
BR, DH2, 1272 34 50·83 W conical concrete TE 2023
tower, black bands
42
*

G3047·24 - 2EPS 2 13·86 S Dir WRG 4s 9 12 Yellow, metal lattice Iso R017°-021·5°(4·5°).
EC, , 1173·2 79 57·51 W beacon Iso W021·5°-022·5°(1°).
3 Iso G022·5°-027°(4·5°).
TE 2023
*

PUGET SOUND
G4943·8 Remove from list; deleted

NP82, Vol J Edition 2023. Weekly Edition No. 46, Dated 16 November 2023.
Last Updates: Weekly Edition No. 45, dated 09 November 2023.

J0435·2 - Vineyard Wind 1. AS42 41 02·28 N QY 21 . . Wind turbine Wind Farm under construction. This
US, I, US600·19 70 22·41 W Wind Farm will consist of 62 Wind
Turbines and 1 Platform, some
marked by Red Air Obstruction lights
and Fog Signals.
(P) 2023
* * * * * * * *

J0435·3 - Vineyard Wind 1. AU39 41 00·23 N Fl Y 6s 21 . . Wind turbine Wind Farm under construction. This
US, I, 600·01 70 26·34 W Wind Farm will consist of 62 Wind
Turbines and 1 Platform, some
marked by Red Air Obstruction lights
and Fog Signals.
(P) 2023
*

J1309·1 - Cherry Island Range. Ldg 39 45·72 N FR 37 . . Framework tower Vis 1·5° each side of rangeline.
US, II, 2980 Lts 017°. Rear. 0·717M from 75 29·38 W Shown 24 hours
front
* *

DELAWARE RIVER
J1320·6 Remove from list; deleted

J1631 - No 8 37 30·84 N QR 5 4 Red % on pile ..


US, II, 14745 76 18·93 W
* * * * * * * *

5.15 Wk46/23
V

NP82, Vol J Edition 2023 continued.

J1748 - Little Annemessex River. 37 57·80 N Fl W 4s 5 6 Black and white ..


US, II, 22815 Entrance. N Side. Janes 75 55·11 W chequered , on
Island framework tower,
round base
* * * *

J2326 - Shad Battery Channel. Ldg 39 20·31 N Fl W 2·5s 10 . . Yellow monopile and Vis 4° each side of rangeline.
US, II, 8910 Lts 237°. Front 76 11·44 W platform with white Rear J2316·1. Shown 24 hours
US, II, 8912 hut on top
---- .. By day Fl W 10 .. .. Vis 1·5° each side of rangeline
2·5s
- - - - Passing light .. Fl W 4s 9 4 .. Located on Channel Side of Platform
*

J2822·1 - Mud River. Aquaculture. A 31 31·53 N QY 6 3 .. Numerous lights Q Y and Fl Y


US, III, 36654·1 81 14·76 W marking aquaculture exist within Mud
River. Private
* * * * * * * *

NP83, Vol K Edition 2023. Weekly Edition No. 46, Dated 16 November 2023.
Last Updates: Weekly Edition No. 45, dated 09 November 2023.

K2869·905 - 27 20·87 S Fl Y 3s .. .. .. ..
153 11·32 E
* * * * * * * *

MORETON BAY. BRISBANE RIVER


K2871 Remove from list; deleted

MORETON BAY. BRISBANE RIVER


K2871·1 Remove from list; deleted

K2871·26 - Lytton Rocks Reach. No 5F 27 24·74 S Fl R 4s .. . . Red & on red pile ..


153 08·87 E
- - - Ldg Lts 199·5°. Front .. Q Bu .. .. .. ..
----- .. By day Q W .. .. .. ..
* * * * * * * *

K2871·261 - Lytton Rocks Reach. No 27 24·84 S Fl Y 4s .. . . Black pile ..


5R 153 08·83 E
- - - Ldg Lts 199·5°. Rear. .. Iso Bu 2s .. .. .. ..
200m from front
------ .. By day Iso W .. .. .. ..
2s
* * * * * * * *

K2871·36 - Lytton Reach. No 6F 27 25·22 S QR .. . . Red & on red beacon ..


153 08·51 E
- - - Ldg Lts 066·5°. Front .. Q Bu .. .. .. ..
----- .. By day Q W .. .. .. ..
* * * * * * * *

K2871·361 - Lytton Reach. No 6R 27 25·19 S Fl Y 4s .. . . Black pile ..


153 08·58 E
- - - Ldg Lts 066·5°. Rear. .. Iso Bu 2s .. .. .. ..
120m from front
------ .. By day Iso W .. .. .. ..
2s
* * * * * * * *

5.16 Wk46/23
V

NP83, Vol K Edition 2023 continued.

MORETON BAY. BRISBANE RIVER


K2871·7 Remove from list; deleted

MORETON BAY. BRISBANE RIVER


K2871·71 Remove from list; deleted

K3034·1 - Ldg Lts 261·5°. Rear. 200m 21 06·40 S F Bu .. .. .. ..


from front 149 13·43 E
---- .. By day F W .. .. .. ..
* *

K3460·211 - Napa Napa 9 27·17 S Q(6)+LFl W 5 1 " on black beacon, ..


147 07·15 E 15s yellow top
*

PASSE DE LA SARCELLE
K4799·4 - Îlot Ndié. Dir Lt 203° 22 31·23 S Dir WRG 6s 6 W11 White metal tower fl 1, ec 1, fl 1, ec 3.
FR, L2, 45540 (FR) 167 11·85 E R 8 8 Fl(2)G 6s 196·5°-199·5°(3°).
G 8 Fl(2)W 6s 199·5°-206·5°(7°).
Fl(2)R 6s 206·5°-209·5°(3°)
- - Auxiliary light .. Oc(2)R 6s 7 3 .. ec 1, lt 1, ec 1, lt 3
* *

K4966·502 - Passe Havae 17 51·60 S Fl R 2·5s 5 5 Red & on red beacon fl 0·5.
FR, L2, 61120 (FR) 149 15·24 W 6 Destroyed (T) 2023
*

ÎLES DU VENT. ÎLE DE MOOREA


K4968 - Baie de Cook (Paopao). 17 29·27 S Iso R 4s 8 4 White pylon TE 2023
FR, L2, 62220 Passe Avaroa Ldg Lts 149 49·12 W 8
149·7°. Front
(FR)
*

K4971·3 - Port D'Uturoa. Pointe du 16 43·58 S Fl(2)G 6s 5 5 Green % on green TE 2023


FR, L2, 64720 Roi Tamatoa. Eastward 151 26·26 W beacon
(FR) 6
*

K4975 - Pointe Puhiai. SE 16 41·06 S Iso G 4s 4 3 Green % on green Unreliable (T) 2023
FR, L2, 63760 (FR) 151 27·02 W beacon
6
*

K4975·7 - Baie Haamene 16 38·35 S Oc G 4s 3 3 Green % on green ec 1.


FR, L2, 63880 (FR) 151 28·23 W beacon Unreliable (T) 2023
5
*

NP84, Vol L Edition 2023. Weekly Edition No. 46, Dated 16 November 2023.
Last Updates: Weekly Edition No. 44, dated 02 November 2023.

L0316·1 Remove from list; deleted

L0316·12 Remove from list; deleted

L0486 - Måløysundet. V-løp. NW 61 55·79 N FR 8 3·4 Post R 159·00°-274°.


NO, , 286734 5 07·26 E 16 Floodlit
* *

5.17 Wk46/23
V

NP84, Vol L Edition 2023 continued.

L0486·4 - Måløysundet. V-løp. NE 61 55·78 N FG 6 4·2 Post G080°-212°(132°).


NO, , 286733 5 07·37 E 10 Floodlit
* *

L0486·5 - Måløysundet. V-løp. SE 61 55·72 N FG 7 4·2 Post G087°-204°(117°).


NO, , 286731 5 07·35 E 12 Floodlit
* *

L0486·6 - Måløysundet. V løp, 2 61 55·75 N FR 42 6·7 Bridge R187·5°-192·5°(5°)


NO, , 286737 5 07·31 E
* * *

L0486·601 - Måløysundet. V løp, 1 61 55·76 N FR 43 6·7 Bridge R187·5°-192·5°(5°)


NO, , 286738 5 07·31 E
*

L2299·1 - Brattbakken Ø 65 54·59 N Iso G 2s 5 3·4 Post Floodlit


NO, , 652405 12 01·60 E 9
* * * * * * * *

L2299·4 - Sandværoddflu 65 54·80 N Iso G 2s 5 3·4 Post Floodlit


NO, , 652407 12 01·52 E 9
* * * * * *

L2300 - Sandværoddtaren 65 54·82 N Iso WRG 6s 3 W6·8 Post G092·6°-109·9°(17·3°),


NO, , 652500 12 01·42 E R5·4 11 W109·9°-111·3°(1·4°),
G5·4 R111·3°-153·5°(42·2°),
G153·5°-201·7°(48·2°),
W201·7°-214°(12·3°),
R214°-347·9°(133·9°),
G347·9°-355·9°(8°).
To be removed (P) 2023
*

L2300·1 - Sandværodden 65 54·84 N Iso WRG 6s .. .. .. G087·5°-110°(22·5°),


NO, , 652600 12 01·43 E W110°-111°(1°), R111°-153°(42°),
G153°-201·5°(48·5°),
W201·5°-213·5°(12°),
R213·5°-350°(136·5°),
G350°-356°(6°).
(P) 2023
* * * * * * * *

L2813 Vesthallen 68 13·95 N Fl G 2s 10 3·6 Post ..


NO, , 741001 14 57·47 E 10
* * * * * * * *

L2818·5 - Petterholmen 68 19·95 N Iso R 2s .. . . Post Floodlit.


NO, , 741202 15 00·06 E (P) 2023
* * * * * * * *

L2818·8 - Skipholmen 68 20·39 N Iso R 2s .. . . Post Floodlit.


NO, , 741204 15 01·11 E (P) 2023
* * * * * * * *

L2819 - Ulvøy. E Point 68 21·61 N Fl R 3s 6 2 Post fl 0·3.


NO, , 741206 15 02·55 E Floodlit.
Iso R 2s (P) 2023
* *

L2819·5 - Øyneset 68 21·98 N Iso R 2s .. . . Post Floodlit.


NO, , 741208 15 02·70 E (P) 2023
* * * * * * * *

5.18 Wk46/23
V

NP84, Vol L Edition 2023 continued.

L2820·9 - Hysbergan 68 23·03 N Iso R 2s .. . . Post Floodlit.


NO, , 741506 15 04·34 E (P) 2023
* * * * * * * *

L2821·4 - Svineset 68 23·16 N Iso G 2s .. . . Post Floodlit.


NO, , 741507 15 05·34 E (P) 2023
* * * * * * * *

L2823 - Fallet. N Side 68 24·26 N Iso R 2s .. . . Post Floodlit.


NO, , 741518 15 06·40 E (P) 2023
* * * * * * * *

L2823·5 - Raftstranda 68 24·43 N Iso G 2s .. . . Post Floodlit.


NO, , 741513 15 07·20 E (P) 2023
* * * * * * * *

L2824 - Vasneset. Raftsund 68 24·94 N Oc WRG 6s 3 W8·7 Tripod G197·9°-199·2°(1·3°),


NO, , 741800 15 07·81 E R7·1 6 W199·2°-202·9°(3·7°),
G7·1 R202·9°-018·5°(175·6°),
G018·5°-030·6°(12·1°),
W030·6°-032·6°(2°),
R032·6°-039·3°(6·7°).
Floodlit.
To be re-established in new
adjusted position. Sectors and
character unchanged (P) 2023
*

L2826 - E Side. Trangstrømmen 68 24·84 N QG 5 3·3 Post Floodlit.


NO, , 741515 15 08·02 E 3 Iso G 2s (P) 2023
* *

L2827·5 - Olsanes 68 25·44 N Iso R 2s .. . . Post Floodlit.


NO, , 741524 15 08·10 E (P) 2023
* * * * * * * *

L2827·8 - Nordholmtangen 68 25·77 N Q(6)W LFl 15s .. . . Post Floodlit.


NO, , 741540 15 09·14 E (P) 2023
* * * * * * * *

L2828 - Nordholmgrunnen 68 25·83 N Iso G 6s 5 4·1 Pile structure Iso G 2s (P) 2023
NO, , 742201 15 08·98 E 8
*

L2829 - Nilsneset 68 26·45 N Iso R 2s .. . . Post Floodlit.


NO, , 741526 15 09·74 E (P) 2023
* * * * * * * *

HANØY
L2831 - Gunnarsjåen 68 28·04 N Iso G 2s 6 3·6 Post Floodlit
NO, , 741521 15 12·31 E 7
* * * * * * * *

RAFTSUNDET
L2832 - Seiholmen 68 28·35 N QG 6 1·9 Post Iso G 2s (P) 2023
NO, , 742700 15 12·38 E
*

HANØY
L2833 - Kjuklingen 68 28·17 N QR 6 2·7 Cairn Floodlit.
NO, , 741528 15 11·87 E 7 Iso R 2s (P) 2023
* *

5.19 Wk46/23
V

NP84, Vol L Edition 2023 continued.

L3111 - Skagskallen 68 34·72 N Fl R 3s .. . . Post Floodlit.


NO, , 790002 15 03·58 E (P) 2023
* * * * * * * *

L3112 - Hadsel. Bridge 68 34·38 N Oc WRG 6s 6 W4·1 Bridge pillar G264·5°-271·1°(6·6°),


NO, , 790400 14 59·74 E R3·1 2 W271·1°-288·6°(17·5°),
G3·1 R288·6°-330·8°(42·2°),
G330·8°-099·1°(128·3°),
W099·1°-100·8°(1·7°),
R100·8°-113·9°(13·1°).
Floodlit (P) 2023
--- .. Racon .. .. .. ALRS Vol 2 Station 66020
*

L3412 - Bukkskinn. Ldg Lts 047·4°. 69 21·19 N Oc WRG 6s 3 W3·9 Post ec 1.


NO, , 842200 Front 18 06·09 E R2·9 G027·5°-035°(7·5°),
G2·9 W035°-050·9°(15·9°),
R050·9°-163·2°(112·3°),
G163·2°-168·8°(5·6°),
W168·8°-171·3°(2·5°),
R171·3°-193·9°(22·6°)
* *

L3412·1 - Bukkskinn. Ldg Lts 047·4°. 69 21·42 N Oc(2)W 8s 43 14 Post Intens on leading line only.
NO, , 842100 Rear. 558m from front 18 06·80 E 3 W045°-051°(6°)
* *

L3792 Lauksundet. Hylla. Arnøy. N 70 14·20 N Fl WRG 5s 19 W6·2 Tripod fl 0·7.


NO, , 913000 Side 20 42·16 E R4·4 6 G080·7°-086·5°(5·8°),
G4·1 W086·5°-210·1°(123·6°),
R210·1°-220·5°(10·4°),
W220·5°-277·8°(57·3°),
G277·8°-280·2°(2·4°).
Sectors to be amended (P) 2023
*

LOPPEHAVET
L3796 - Brynnilen. NW Side 70 13·70 N Fl(2)WRG 10s 43 W7·7 Post fl 0·7, ec 1·5, fl 0·7, ec 7·1.
NO, , 913400 21 10·92 E R5·7 4 G021·1°-025·4°(4·3°),
G5·3 W025·4°-184°(158·6°),
R184°-199·5°(15·5°),
W199·5°-229·7°(30·2°),
G229·7°-231·9°(2·2°).
Sectors to be amended (P) 2023
*

L3800 - Loppekalven. SE Point 70 18·12 N Fl WRG 5s 10 W9·1 Pile fl 0·7.


NO, , 913800 21 23·38 E R6·9 3 R214·7°-219·6°(4·9°),
G6·5 W219·6°-237·9°(18·3°),
G237·9°-257·2°(19·3°),
W257·2°-052·5°(155·3°),
R052·5°-055·5°(3°).
Sectors to be amended (P) 2023
*

L3809 - Pannarodden 70 14·06 N Oc(2)WRG 8s 13 W6·6 Post on concrete base G128·7°-140·8°(12·1°),


NO, , 914800 21 43·23 E R5·2 3 W140·8°-148°(7·2°),
G5·2 R148°-197·4°(49·4°),
W197·4°-210·5°(13·1°),
G210·5°-295·2°(84·7°),
W295·2°-308·9°(13·7°),
R308·9°-338·1°(29·2°).
Sectors to be amended (P) 2023
*

5.20 Wk46/23
V

NP84, Vol L Edition 2023 continued.

ULSFJORDEN
L3810 - Gammalværneset 70 19·45 N Fl(2)WRG 10s 13 W5·4 Concrete column R119·8°-130·8°(11°),
NO, , 915200 22 00·44 E R3·8 8 W130·8°-247·2°(116·4°),
G3·5 R247·2°-259·3°(12·1°),
W259·3°-282·7°(23·4°),
G282·7°-318·7°(36°),
R318·7°-354·2°(35·5°).
Sectors to be amended (P) 2023
*

L3812 Nuvsfjorden. Nuvsvåg 70 16·58 N Oc WRG 6s 15 W3·1 Post R006·7°-009·3°(2·6°),


NO, , 915800 22 06·61 E R 2 3 W009·3°-011·3°(2°),
G1·8 G011·3°-173·5°(162·2°),
W173·5°-202·1°(28·6°),
R202·1°-250°(47·9°).
Sectors to be amended (P) 2023
*

NP85, Vol M Edition 2023. Weekly Edition No. 46, Dated 16 November 2023.
Last Updates: Weekly Edition No. 45, dated 09 November 2023.

M4183 Gyeongnyeolbi. Yeoldo. 36 40·92 N Mo(U)W 10s .. 12 Yellow round steel ..


KR, 410, 3288·1 Seokdo 125 38·00 E post
KR, 410, 4666 --- .. AIS .. .. .. MMSI No 994401058
KR, 410, 4159 --- .. Racon .. .. .. ALRS Vol 2 Station 82481
KR, 410, 4398·1 --- .. Horn 50s .. .. .. bl 5
* * * * * * * *

M4210·24 Hanagwoldo Island. 35 11·30 N Q(6)+LFl W 10 8 " on black round ..


KR, 410, 3136·3 Lighthouse 126 07·27 E 15s concrete tower,
yellow top
14
* * * * * * * *

M4216·79 Byeongpungdo 34 59·54 N Fl(2)W 10s 9 8 # on black round ..


KR, 410, 3134·4 126 12·52 E concrete tower, red
band
13
* * * * * * * *

M4281·63 Eoduri 34 24·47 N Q(3)W 10s 10 7 * on black round ..


KR, 410, 2566·9 126 57·08 E concrete tower,
yellow band
12
* * * * * * * *

M4297·5 Geogeumdo. Monyeodo 34 25·86 N Fl(2)W 5s 16 7 Black # on black ..


KR, 410, 2526·7 127 13·12 E round concrete tower,
red band
19
* *

M4321·595 Pungyeongyeo 34 49·95 N Fl R 4s 10 8 % on red round ..


KR, 410, 2296·7 127 58·65 E concrete tower
10
* * * * * * * *

M4397·6 Jeongja Hang. Detached 35 36·98 N Fl G 4s 17 7 White round concrete . .


KR, 410, 1353·2 Breakwater 129 27·38 E tower
11
*

5.21 Wk46/23
V

NP86, Vol N Edition 2023. Weekly Edition No. 46, Dated 16 November 2023.
Last Updates: Weekly Edition No. 45, dated 09 November 2023.

N5974·5 Al 'Arīsh. E Breakwater. 31 09·21 N Fl(3)R 5s 10 8 Red tower Destroyed (T) 2023
Head 33 49·91 E
*

NP88, Vol Q Edition 2023. Weekly Edition No. 46, Dated 16 November 2023.
Last Updates: Weekly Edition No. 45, dated 09 November 2023.

Q1051·031 Merak. Tanjung Gerem. 5 58·06 S Lit .. . . Yellow × on yellow ..


Depot Pertimina 105 59·58 E post
(ID)
* * * * * * * *

Q1051·051 Merak. Tanjung Gerem. 5 58·15 S Fl Y .. . . Yellow × on yellow ..


Depot Pertimina 105 59·54 E post
(ID)
* * * * * * * *

Q1051·052 Merak. Tanjung Gerem. 5 58·29 S Fl Y .. . . Yellow × on yellow ..


Depot Pertimina 105 59·49 E post
(ID)
* * * * * * * *

Q1051·053 Merak. Tanjung Gerem. 5 58·31 S Fl Y .. . . Yellow × on yellow ..


Depot Pertimina 105 59·48 E post
(ID)
* * * * * * * *

Q1541·7 Remove from list; deleted

Q1541·8 Remove from list; deleted

DENIAL BAY. THEVENARD


Q1838 - Wharf. Head 32 08·96 S QW 6 5 Red metal column W020°-170°(150°).
133 38·36 E TE; F W 2M, sector removed (T)
2022
*

Q1841 - W Side. Jetty. Head 32 06·18 S Fl W 4s .. 5 .. fl 0·5


133 35·03 E
* * *

5.22 Wk46/23
VI

ONGOING MAINTENANCE PROCESS IN ADMIRALTY RADIO SIGNALS VOLUMES


In order to guarantee the safety of Mariners at sea, avoid any unsafe and unnecessary duplication/updating of information
appearing in different paper and digital ADMIRALTY Radio Signals Volumes, the information will now be centralised into the most
relevant ADMIRALTY Radio Signals Volume.

For more information, a reference to the location of any required information will also be added to each ADMIRALTY
Radio Signals Volume. VI

UPDATES TO ADMIRALTY LIST OF RADIO SIGNALS


Weekly Edition No. 46 dated 16 November 2023

The ADMIRALTY List of Radio Signals diagrams included in the paper version of the weekly Notice to Mariners (Section
VI) are printed in black and white. If required, a colour version of these diagrams can be downloaded from
www.admiralty.co.uk/maritime-safety-information. To obtain the colour versions select View and download NMs – select
Weekly – select Year – select Week – go to Selected Week Content – select File (for example:
NP286(3)–WK01–14–PAGE149_Week01_2023.pdf)

VOLUME 1, NP281(1), Fourth Edition, 2023


Published Wk 42/23
(Last Updates: Weekly Edition No. 45 dated 09 November 2023)

MARITIME RADIO STATIONS

PAGE 102, FRANCE.


PRE-ARRIVAL QUARANTINE REPORTING.
Delete entry and replace by:

PRE-ARRIVAL QUARANTINE REPORTING


ARS (Regional Health Agency) / Ministry of Environment, Energy and Sea
Telephone: +33 1 40566000 (ARS (Regional Health Agency))
+33 1 40812122 (Minstry of Environment, Energy and Sea)
Email: arsXX-alerte@ars.sante.fr (To contact the ARS of the port of
destination directly by email replace the XX with the department
number to which the port of call is attached, see the map
on the website.)
Website: www.ars.sante.fr/portail.0.html (ARS (Regional Health Agency))
www.developpement-durable.gouv.fr/-Mer-et-littoral,2045-.html
(Ministry of Environment, Energy and Sea)

PORTS: All ports

PROCEDURE: The Maritime Health Declaration is not obligatory in normal circumstances, except in the case of illness or cases of epidemic on board the vessel.
This declaration must be sent to the Harbour Master's office, 24 hours before arrival at the port or from the last port if the transit time is less than 24 hours. On arrival
at the harbour the authorities will confirm the presence of illness.
REMARKS: Additional communication facilities available - see Maritime Radio Stations section.

NOTE: Copies of the Maritime Declaration of Health form and radio quarantine reporting codes are listed at the end of the Maritime Radio Stations section.

SHOM Publication 92 (RSDRA2023000272628) 46/23

PAGE 215, MOROCCO.


MARITIME TELEMEDICAL ASSISTANCE SERVICE (TMAS).
Delete entry and replace by:

MARITIME TELEMEDICAL ASSISTANCE SERVICE (TMAS)


Usual name of centre Maritime Telemedical Assistance Service via Agadir, Casablanca, Safi & Tanger Radio
Communications Agadir Radio HF 13080 (Ch1202), Casablanca Radio MF 2635, Safi Radio VHF Ch10, Tanger Radio VHF Ch10
Consultation Languages Unspecified Language
Remarks:
Medical options are completely free via Moroccan Coastal Radio Stations.
The term "RadioMedico" should be used at the beginning of the call.
Calls should be made on VHF Ch 16 or 2182 kHz depending on the station called.

Wk46/23
SHOM Publication 92 (RSDRA2023000272628) 46/23 6.1
The ADMIRALTY List of Radio Signals diagrams included in the paper version of the weekly Notice to Mariners (Section
VI) are printed in black and white. If required, a colour version of these diagrams can be downloaded from
www.admiralty.co.uk/maritime-safety-information. To obtain the colour versions select View and download NMs – select
Weekly – select Year – select Week – go to Selected Week Content – select File (for example:
NP286(3)–WK01–14–PAGE149_Week01_2023.pdf) VI

VOLUME 1, NP281(1), Fourth Edition, 2023


Published Wk 42/23
(Last Updates: Weekly Edition No. 45 dated 09 November 2023)

MARITIME RADIO STATIONS

PAGE 102, FRANCE.


PRE-ARRIVAL QUARANTINE REPORTING.
Delete entry and replace by:

PRE-ARRIVAL QUARANTINE REPORTING


ARS (Regional Health Agency) / Ministry of Environment, Energy and Sea
Telephone: +33 1 40566000 (ARS (Regional Health Agency))
+33 1 40812122 (Minstry of Environment, Energy and Sea)
Email: arsXX-alerte@ars.sante.fr (To contact the ARS of the port of
destination directly by email replace the XX with the department
number to which the port of call is attached, see the map
on the website.)
Website: www.ars.sante.fr/portail.0.html (ARS (Regional Health Agency))
www.developpement-durable.gouv.fr/-Mer-et-littoral,2045-.html
(Ministry of Environment, Energy and Sea)

PORTS: All ports

PROCEDURE: The Maritime Health Declaration is not obligatory in normal circumstances, except in the case of illness or cases of epidemic on board the vessel.
This declaration must be sent to the Harbour Master's office, 24 hours before arrival at the port or from the last port if the transit time is less than 24 hours. On arrival
at the harbour the authorities will confirm the presence of illness.
REMARKS: Additional communication facilities available - see Maritime Radio Stations section.

NOTE: Copies of the Maritime Declaration of Health form and radio quarantine reporting codes are listed at the end of the Maritime Radio Stations section.

SHOM Publication 92 (RSDRA2023000272628) 46/23

PAGE 215, MOROCCO.


MARITIME TELEMEDICAL ASSISTANCE SERVICE (TMAS).
Delete entry and replace by:

MARITIME TELEMEDICAL ASSISTANCE SERVICE (TMAS)


Usual name of centre Maritime Telemedical Assistance Service via Agadir, Casablanca, Safi & Tanger Radio
Communications Agadir Radio HF 13080 (Ch1202), Casablanca Radio MF 2635, Safi Radio VHF Ch10, Tanger Radio VHF Ch10
Consultation Languages Unspecified Language
Remarks:
Medical options are completely free via Moroccan Coastal Radio Stations.
The term "RadioMedico" should be used at the beginning of the call.
Calls should be made on VHF Ch 16 or 2182 kHz depending on the station called.

SHOM Publication 92 (RSDRA2023000272628) 46/23

6.1

Wk46/23
6.2
VI
VI

VOLUME 2, NP282(1), Fourth Edition, 2023


Published Wk 12/23
(Last Updates: Weekly Edition No. 45 dated 09 November 2023)

RADAR BEACONS

PAGE 36, ITALY.


69950 Marsala ODAS Lt Buoy.
Delete entry

Italian Notice 21/10/23 (RSDRA2023000285401) 46/23

AUTOMATIC IDENTIFICATION SYSTEM (AIS)

PAGE 124, ITALY.


Marsala ODAS Lt Buoy.
Delete entry

Italian Notice 21/10/23 (RSDRA2023000285401) 46/23

PAGE 206, UNITED KINGDOM, below Bahama Lt Buoy.


Insert:

Banff Central Special Mark Lt Buoy 57°00′·02N 1°18′·48E 992351337 Real 21

Banff East Cardinal Lt Buoy 57°00′·82N 1°20′·01E 992351339 Real 21

Banff West Cardinal Lt Buoy 56°59′·81N 1°17′·33E 992351338 Real 21

(former update 42/23)


CNRL correspondence (RSDRA2023000282652) 46/23

VOLUME 2, NP282(2), Fourth Edition, 2023


Published Wk 12/23
(Last Updates: Weekly Edition No. 45 dated 09 November 2023)

RADAR BEACONS

PAGE 42, KOREA, SOUTH, below 82480 Gyeongnyeolbido Lt.


Insert:

Taen-Manipo Offshore Wind Farm


36°40′·92N 125°38′·00E 3 & 10 10 D 82481
Platform

Korean Notice 40/752/23 (RSDRA2023000279275) 46/23

AUTOMATIC IDENTIFICATION SYSTEM (AIS)

PAGE 100, ARGENTINA.


Buenos Aires Huergo Channel Arlapa II Buoy No Km 7.2.
Delete entry

UKHO 46/23

PAGE 100, ARGENTINA, below Buenos Aires Huergo Channel Arlapa II Lt Buoy No Km 7.2.
Insert:

Buenos Aires Huergo Channel


34°36′·12S 58°17′·21W Real
Arlapa II North Lt Buoy No Km 7.2

UKHO 46/23

Wk46/23 6.2
6.3
VI
VI

PAGE 100, ARGENTINA.


Buenos Aires Huergo Channel Arlapa II Lt Buoy No Km 7.2.
Delete entry and replace by:

Buenos Aires Huergo Channel


34°36′·18S 58°17′·22W 997011067 Real
Arlapa II South Lt Buoy No Km 7.2

UKHO 46/23

PAGE 202, CHINA, below SQY 05108 Wreck.


Insert:

Starboard Lateral Buoy No W1 27°57′·39N 121°10′·33E 999412406 Broadcasts every 3 minutes Real

(former update 20/23)


Chinese Notice 40/1456/23 (RSDRA2023000273164) 46/23

PAGE 208, CHINA, below Wenwei Zhou Lt.


Insert:

Wenzhou Virtual Mark 2 27°49′·79N 121°18′·73E 994136544 Broadcasts every 3 minutes Virtual

Wenzhou Virtual Mark 4 27°51′·23N 121°17′·08E 994136536 Broadcasts every 3 minutes Virtual

Wenzhou Virtual Mark 6 27°52′·57N 121°15′·53E 994136529 Broadcasts every 3 minutes Virtual

Wenzhou Virtual Mark 8 27°53′·91N 121°13′·98E 994136530 Broadcasts every 3 minutes Virtual

Wenzhou Virtual Mark 10 27°55′·11N 121°12′·60E 994136540 Broadcasts every 3 minutes Virtual

Chinese Bulletin 40/23 (RSDRA2023000273164) 46/23


Chinese Notice 40/1458/23 (RSDRA2023000273164) 46/23

PAGE 208, CHINA.


Wenzhou Wan Lt Buoy M1.
Delete entry

Chinese Notice 40/1457/23 (RSDRA2023000273164) 46/23

PAGE 208, CHINA, below Wenzhou Wan Lt Buoy M1.


Insert:

Wenzhou Wan Lt Buoy Z0 27°55′·58N 121°11′·52E 999412403 Broadcasts every 3 minutes Real

Chinese Notice 40/1457/23 (RSDRA2023000273164) 46/23

PAGE 208, CHINA.


Wenzhou Wan Lt Buoy Z1.
Delete entry

Chinese Notice 40/1457/23 (RSDRA2023000273164) 46/23

PAGE 226, CHINA.


YZ 717 Wreck.
Delete entry

Chinese Bulletin 40/23 (RSDRA2023000273164) 46/23

PAGE 226, CHINA.


ZF 566 Wreck.
Delete entry

Chinese Notice 40/1460/23 (RSDRA2023000273164) 46/23

6.3 Wk46/23
6.4
VI
VI

VOLUME 6, NP286(2), Fourth Edition, 2023 VOLUME 6, NP286(3), Fourth Edition, 2023
Published Wk 24/23 Published Wk 27/23

–––––––––––––––––– ––––––––––––––––––
(Last Updates: Weekly Edition No. 44 dated 02 November 2023) (Last Updates: Weekly Edition No. 44 dated 02 November 2023)

PAGE 15, DENMARK, AALBORG, Limfjorden, Road Bridge section. PAGE 181, ITALY, GIARDINI NAXOS, Sicilia, Pilots, PROCEDURE
Delete and replace by: section.
Delete and replace by:
Road Bridge
PROCEDURE:
LOCATION: 57°03′·27N 9°55′·17E
(1) Pilotage is compulsory for vessels over 500 gt and/or for vessels over 45m LOA.
CONTACT DETAILS: (2) Pilot boards by arrangement approximately 1.5 n miles from the port.
(3) Pilotage is exempt for the following:
Bridge (a) Military vessels
VHF Channel: Ch 16; 12 13 (b) Fishing vessels
Telephone: +45 98 120035 (c) Local traffic vessels
HOURS: 1 May-30 Sep: 0500-2100 LT (d) Vessels carrying out work in the port
1 Oct-30 Apr: 0600-1900 LT (e) Tugs
With the exception of the following periods of time:
Mon-Thur: 0640-0710, 0740-0810, 1530-1630 LT Italian Notice 21/25/23, (RSDRA2023000285401), 46/23
Fri: 0640-0710, 0740-0810, 1430-1530 LT
PROCEDURE:
––––––––––––––––––––––––––––––
(1) Vessels over 53m LOA may only pass the bridge under the guidance of a Pilot.
(2) Pilot boards in the following positions: VOLUME 6, NP286(4), Fourth Edition, 2023
(a) Bridge passage from the E: 57°03′·12N 9°56′·76E (Aalborg E)
Published Wk 36/23
(b) Bridge passage from the W: 57°03′·70N 9°53′·10E (Aalborg W)
NOTES: ––––––––––––––––––
(1) Vessels over 30m LOA that wish to open the bridge must contact the bridge watch (Last Updates: Weekly Edition No. 45 dated 09 November 2023)
no later than 30 minutes before expected passage. Passage is confirmed no later than
15 before sailing. If the bridge is not open 5 minutes before the time of passage (point PAGE 356, SHIP REPORTING SYSTEMS, INFORMATION FUSION
of no return), the vessel must interrupt the planned bridge passage and contact the CENTRE - VOLUNTARY COMMUNITY REPORTING AREA, Reporting
bridge watch. System, AREA section.
(2) Vessels less than 30m LOA that wish to open the bridge can contact the bridge Delete and replace by:
watch, or indicate this by giving the following signal at least 600m from the bridge:
(a) During the day: International flag N, or in its absence the national flag hoisted
at half-mast as well as one long blast from whistle or fog horn AREA:
(b) At night: A white light from the bow as well as a long and short blast from the The Voluntary Reporting Area comprises the sea area bounded by lines joining the
whistle or fog horn following positions:
(3) Outside these times, commercial vessels can demand the bridge to be opened if an (1) 24°00′·00N 68°10′·00E.
agreement has been reached, within the following time frames: (2) 24°00′·00N 116°00′·00E.
(a) 1 May-30 Sep: 0500-2015 LT (3) 46°00′·00N 116°00′·00E.
(b) 1 Oct-30 Apr: 0600-1815 LT (4) 46°00′·00N 162°30′·00E.
(5) 17°45′·00S 162°30′·00E.
(Former update 35/23) (6) 17°45′·00S 68°10′·00E.

Danish Notice 40/961/23, (RSDRA2023000278998), 46/23


Information Fusion Centre, (RSDRA2023000278398), 46/23

PAGE 22, DENMARK, ESBJERG, below Port section.


PAGE 357, SHIP REPORTING SYSTEMS, INFORMATION FUSION
Insert new section:
CENTRE - VOLUNTARY COMMUNITY REPORTING AREA, diagram
INFORMATION FUSION CENTRE - VOLUNTARY COMMUNITY
Tugs REPORTING AREA.
Delete diagram and replace by diagram INFORMATION FUSION CENTRE
PROCEDURE: - VOLUNTARY COMMUNITY REPORTING AREA on page 6.8
Tugs are available.
Information Fusion Centre, (RSDRA2023000278398), 46/23
Danish Bulletin 39/23 & Danish Harbour Pilot website,
(RSDRA2023000279046 & RSDRA2023000248540), 46/23
––––––––––––––––––––––––––––––
––––––––––––––––––––––––––––––

1
Wk46/23
6.5
VI
VI

VOLUME 6, NP286(5), Fourth Edition, 2023 VOLUME 6, NP286(6), Fourth Edition, 2023
Published Wk 43/23 Published Wk 03/23

–––––––––––––––––– ––––––––––––––––––
(Last Updates: Weekly Edition No. 44 dated 02 November 2023) (Last Updates: Weekly Edition No. 43 dated 26 October 2023)

PAGE 99, CANADA (Pacific Coast), above FRASER RIVER, British PAGE 56, CHINA, GULEI, Pilots section.
Columbia. Delete and replace by:
Insert new entry:
Pilots
ESQUIMALT, British Columbia 48°26′N 123°27′W For details see DONGSHAN.
UNCTAD LOCODE: CA ESQ

Port UKHO, 46/23

CONTACT DETAILS:
King’s Harbour Master (KHM), Esquimalt PAGE 376, SHIP REPORTING SYSTEMS, INFORMATION FUSION
Call: King’s Harbour Master (KHM) CENTRE - VOLUNTARY COMMUNITY REPORTING AREA, Reporting
VHF Channel: Ch 10 System, AREA section.
Telephone: +1 250 3632160 Delete and replace by:
Website: www.canada.ca/en/navy/corporate/esquimalt-harbour.html
PROCEDURE:
AREA:
(1) All vessels, prior to entering, moving within, or departing Esquimalt Harbour shall
The Voluntary Reporting Area comprises the sea area bounded by lines joining the
contact the King’s Harbour Master (KHM) Operations, on VHF Ch 10, or by telephone.
following positions:
Vessels are to give as much advance notice as is practicable.
(1) 24°00′·00N 68°10′·00E.
(2) The following information shall be conveyed in the clearance request:
(2) 24°00′·00N 116°00′·00E.
(a) Vessel’s name
(3) 46°00′·00N 116°00′·00E.
(b) Port of registry, if applicable
(4) 46°00′·00N 162°30′·00E.
(c) ETA
(5) 17°45′·00S 162°30′·00E.
(d) ETD
(6) 17°45′·00S 68°10′·00E.
(e) Length, breadth, and draught of the vessel
(f) The presence of any dangerous goods on-board
(g) Harbour destination Information Fusion Centre, (RSDRA2023000278398), 46/23
(3) No vessel that has explosives (Class 1 as indicated in the Transportation of
Dangerous Goods Act) on-board shall enter, move, or depart within the limits of
Esquimalt Harbour unless authorized by a harbour official. PAGE 377, SHIP REPORTING SYSTEMS, INFORMATION FUSION
(4) Vessels requesting clearance from a harbour official, to enter Esquimalt Harbour CENTRE - VOLUNTARY COMMUNITY REPORTING AREA, diagram
and berth at a private facility or the PSPC EGD, shall first obtain permission from the INFORMATION FUSION CENTRE - VOLUNTARY COMMUNITY
owner or official of the facility in question. REPORTING AREA.
(5) Commercial vessels intending to anchor at Royal Roads shall, via their Shipping Delete diagram and replace by diagram INFORMATION FUSION CENTRE
Agent, first obtain permission and an anchorage position, from a harbour official, - VOLUNTARY COMMUNITY REPORTING AREA on page 6.9
by contacting the King’s Harbour Master (KHM) Operations, on VHF Ch 10, or by
telephone. The required procedure to request anchorage at a Royal Roads anchorage Information Fusion Centre, (RSDRA2023000278398), 46/23
is available at the port website. The completion and return of the form is to be
administered at least 1h prior to arrival at the anchoring position.
––––––––––––––––––––––––––––––
Canadian Notice 9/3461/23 & Esquimalt Harbour Practices and Procedures,
(RSDRA2023000255477 & RSDRA2023000280670), 46/23

––––––––––––––––––––––––––––––

2
Wk46/23
6.6
VI
VI

VOLUME 6, NP286(8), Fourth Edition, 2023


Published Wk 13/23

––––––––––––––––––
(Last Updates: Weekly Edition No. 45 dated 09 November 2023)

PAGE 42, EQUATORIAL GUINEA, BATA.


Delete entry and replace by:

BATA 1°49′N 9°44′E


UNCTAD LOCODE: GQ BSG

Pilots
AREA:
The pilotage zone extends to the E of the meridian 9° 43′·00 E and between the
parallels 1° 48′·00 N and 1° 53′·00 N.

CONTACT DETAILS:
VHF Channel: Ch 16
Telephone: +240 275752
HOURS: 0600-1700 LT
PROCEDURE:
Pilot boards in the following positions:
(1) 1°50′·15N 9°43′·75E
(2) 1°48′·80N 9°43′·72E
Port
CONTACT DETAILS:
Port Authority
VHF Channel: Ch 16
Telephone: +240 275752
Administration des ports de Guinée équatoriale (APGE)
Telephone: +240 333041012
+240 333093313
Fax: +240 091184
+240 097071
E-mail: puertosdeguineaecuatorial@yahoo.com
eha.potosco@yahoo.com
HOURS: 0600-1700 LT
PROCEDURE:
Berthing instructions are provided on VHF Ch 16 by the Port Authority.

French Notice 42/2.4.3/23, (RSDRA2023000279079), 46/23

PAGE 44, EQUATORIAL GUINEA, PUERTO MACÍAS NGUEMA.


Delete entry.

French Notice 42/2.4.3/23, (RSDRA2023000279079), 46/23

––––––––––––––––––––––––––––––

3
Wk46/23
6.7
65° 70° 75° 80° 85° 90° 95° 100° 105° 110° 115° 120° 125° 130° 135° 140° 145° 150° 155° 160° 165°

45° 45°

INFORMATION FUSION CENTRE


VOLUNTARY COMMUNITY REPORTING AREA
40° 40°
Reporting Points

35° 35°

30° 30°

25° 25°

20° 20°
VI

6.8
15° 15°

10° 10°

5° 5°

0° 0°

5° 5°

10° 10°

15° 15°

Wk46/23
20° 70° 75° 80° 85° 90° 95° 100° 105° 110° 115° 120° 125° 130° 135° 140° 145° 150° 155° 160° 165°
V6(6)IFC V001 24/10/23
65° 70° 75° 80° 85° 90° 95° 100° 105° 110° 115° 120° 125° 130° 135° 140° 145° 150° 155° 160° 165°

45° 45°

Wk46/23
INFORMATION FUSION CENTRE
VOLUNTARY COMMUNITY REPORTING AREA
40° 40°
Reporting Points

35° 35°

30° 30°

25° 25°

20° 20°
VI

6.9
15° 15°

10° 10°

5° 5°

0° 0°

5° 5°

10° 10°

15° 15°

20° 70° 75° 80° 85° 90° 95° 100° 105° 110° 115° 120° 125° 130° 135° 140° 145° 150° 155° 160° 165°
V6(6)IFC V001 24/10/23
VII

UPDATES TO MISCELLANEOUS ADMIRALTY NAUTICAL PUBLICATIONS

There are no updates to miscellaneous Nautical Publications this week

UKRAINE NAVIGATIONAL INFORMATION

Owing to insufficient information, it is not always possible to ensure that ADMIRALTY Nautical
Publications are completely up-- to-- date for new dangers or changes to aids to navigation.

Mariners are therefore advised to exercise particular caution when navigating in Ukrainian waters.

7.1
Wk46/23
VIII

ADMIRALTY DIGITAL SERVICES


1. ENC / ECDIS and AVCS

a) ENCs temporarily withdrawn from AVCS


A list of ENCs that have been temporarily withdrawn from AVCS for safety reasons can be found in the README file and on the
AVCS Updates page, accessed from admiralty.co.uk/avcs.

b) ENC Readme.txt file


The README.TXT file located within the ENC_ROOT folder of AVCS Exchange sets contains important safety related information
relating to the use of ENCs in ECDIS. The file is also available on the AVCS Support page, accessed from admiralty.co.uk/avcs.

This file should be consulted each week to ensure that all related issues are taken into consideration. The file header indicates the last
time that the README file was updated and the date that it was issued.

c) Temporary information in ENCs

Mariners should take temporary information into account when planning and executing a passage with ENCs and most ENC producers
now include temporary information in their ENCs. It is usually compiled as normal ENC updates, sometimes with the start and end dates
attributed or described as ‘Temporary’ in the pick report.

The latest confirmed status of T&P NM information in the ENCs that are available in ADMIRALTY services is shown in the ENC-
T&P-NM-Status.pdf file at: admiralty.co.uk/ENC-TP-NMs. Note that T&P NMs are compiled for paper charts and may not align with
any temporary information that is compiled into ENCs.

ADMIRALTY Information Overlay (AIO) includes ADMIRALTY T&P NMs for paper charts where the ENC Producer has not
confirmed that they include temporary information in their ENCs.

Further guidance can be found in the AIO User Guide on the AVCS Support page, accessed from admiralty.co.uk/avcs.

d) Important notice for users of AVCS and ARCS Online Updating Services (AVCS OUS and ARCS OUS)

The email service for AVCS OUS was withdrawn at the end of February 2019 due to technology infrastructure changes at UKHO.

The ARCS Online Updating Service was withdrawn in July 2019.

2. ADMIRALTY Products Supporting Digital Navigation

i. ADMIRALTY ENC and ECDIS Maintenance Record (NP133C). This publication is designed to hold paper records on ENC
and ECDIS maintenance to assist information management and support inspections. Please note that V2.0 is the current
edition.

ii. ADMIRALTY Guide to ENC Symbols Used in ECDIS (NP5012). A companion to the ADMIRALTY Guide to Symbols and
Abbreviations Used on Paper Charts, NP5011. The 2nd edition of NP5012 includes the changes highlighted in the new S-52
standards and the new presentation library 4.0.

iii. ADMIRALTY Guide to the Practical Use of ENCs (NP231). Supports ECDIS training on the interpretation and use of ENC
data.

iv. ADMIRALTY Guide to ECDIS Implementation, Policy and Procedures (NP232). Provides clear guidance for any individual
or organisation responsible for the introduction of ECDIS, in particular those involved in the development of detailed ECDIS
operating procedures.

8.1
Wk 46/23
VIII

3. ADMIRALTY Digital Publications (ADP)

ADMIRALTY Sailing Directions: Removal of AIS and Racons


In 2018, the UKHO began the process of removing AIS and Racon information from ADMIRALTY Sailing Directions, as this is held in
greater detail within ADMIRALTY Radio Signals publications. During this transition, AIS and Racon information will be removed
from new editions of each Sailing Direction volume, and AIS and Racon information present in existing Sailing Direction volumes will
no longer be updated. For accurate, up-to-date information on AIS and Racons, refer to ADMIRALTY Radio Signals publications.

ADP V23 is available on the ADP Weekly Update DVD.


V19 and V23 are supported by the UKHO and are the only versions that allow users to receive tidal updates as they are made available.
Users of older versions of ADP should upgrade to a supported version at their earliest convenience.

ADMIRALTY TotalTide (ATT): German Tidal Stations predicted on LAT


The TotalTide application computes predictions for all German tidal stations based on Lowest Astronomical Tide (LAT).
Mariners using charts which refer to Mean Low Water Springs (MLWS) in German waters, must deduct 0.5m from all predicted tidal
heights for these ports before applying them to the depths on those charts to determine the correct predicted depth of water. This advice
will also be contained in the ‘Notes’ tab on the Prediction Windows in TotalTide for each German tidal station.

For information: Please note the UKHO will not be supporting V18 from 1st July 2023.

The ADP software and the Data updates can still be downloaded from weekly ADP Update and Software DVDs.

To get access to the ADP Update and Software DVD, please contact your ADMIRALTY Distributor.

For information: Ensure that Activation Key Requests and Update Data Requests for ADP are sent to ADPMailGateway@ukho.gov.uk

4. ADMIRALTY e-Nautical Publications (AENP)

There is currently an e-Reader 1.3 enabling users to read Digital copies of our Sailing Directions paper publications.

A new e-Reader 1.4 was released to the Channel on 01/10/2020. This version 1.4 has got the same functionalities as the current version
1.3 but is more performant and user-friendly. While the current 1.3 version can be used on Windows 7 and 8.1 Operating Systems (OS),
the e-Reader 1.4 can only be used on Windows 8.1 and 10 OS, to follow the Microsoft guidelines of withdrawing support for Windows
7 OS.

To enable users to activate this new application, users might need to delete one e-Reader application from their Fleet Manager Licences
if the maximum 3 allowed has been reached.

Both the e-Readers 1.3 and 1.4 are supported at the UKHO.

The e-Reader 1.4 software and the Data updates can be downloaded from weekly ADP Update and Software DVDs.

To get access to the AENP Update and Software DVD, please contact your ADMIRALTY Distributor.

8.2
Wk 46/23
VIII

5. Status of ADMIRALTY Digital Services

Update status table

Product Last issue date/Week Reissue Date/Week


i. ADMIRALTY Vector Chart Service (AVCS) Base .zip download 13 July 2023 - 28
ii. ADMIRALTY Information Overlay (AIO) Base CD 31 March 2022 - 13
iii. ADMIRALTY Raster Chart Service (ARCS) Regional disc 1 09 November 2023 - 45
ADMIRALTY Raster Chart Service (ARCS) Regional disc 2 16 February 2023 - 07 14 December 2023 - 50
ADMIRALTY Raster Chart Service (ARCS) Regional disc 3 25 May 2023 - 21 23 November 2023 - 47
ADMIRALTY Raster Chart Service (ARCS) Regional disc 4 06 July 2023 - 27
ADMIRALTY Raster Chart Service (ARCS) Regional disc 5 21 September - 38
ADMIRALTY Raster Chart Service (ARCS) Regional disc 6 03 August 2023 - 31 01 February 2023 - 05
ADMIRALTY Raster Chart Service (ARCS) Regional disc 7 23 March 2023 - 12 15 February 2023 - 07
ADMIRALTY Raster Chart Service (ARCS) Regional disc 8 05 October - 40
ADMIRALTY Raster Chart Service (ARCS) Regional disc 9 22 June 2023 - 25
ADMIRALTY Raster Chart Service (ARCS) Regional disc 10 02 February 2023 - 05 18 January 2024 - 03
17 August 2023 - 33
ADMIRALTY Raster Chart Service (ARCS) Regional disc 11
Small-scale Planning Charts

ADMIRALTY Vector Chart Service (AVCS) DVDs and ADMIRALTY Information Overlay (AIO) CDs are issued
weekly and contain all base and update data available at the time of issue.

6. Supported ADMIRALTY Software Versions

Product Supported Versions


ADP V19, V23
ADMIRALTY e-Reader 1.3, 1.4
NavPac and Compact Data 4.2

If you are using an unsupported version, contact your Chart Distributor to upgrade to the latest version as soon as possible.

8.3
Wk 46/23
HYDROGRAPHIC NOTE FOR PORT
H.102A
INFORMATION (V7.0 Jan 2013)
(To accompany Form H.102)

Reporting Port Information affecting ADMIRALTY Products

NAME OF PORT

APPROXIMATE POSITION Latitude Longitude

GENERAL REMARKS
Principal activities and trade.
Latest population figures and date.

Number of ships or tonnage handled per


year.

Maximum size of vessel handled.

Copy of Port Handbook (if available).

ANCHORAGES
Designation, depths, holding ground,
shelter afforded.

PILOTAGE
Authority for requests.

Embark position.

Regulations.

DIRECTIONS
Entry and berthing information.

Tidal streams.

Navigational aids.

TUGS
Number available.

WHARVES
Names, numbers or positions & lengths.

Depths alongside.

CARGO HANDLING
Containers, lighters, Ro-Ro etc.

REPAIRS
Hull, machinery and underwater.

Shipyards.

Docking or slipping facilities.


(Give size of vessels handled or
dimensions)

Divers.
HYDROGRAPHIC NOTE FOR PORT
H.102A
INFORMATION (V7.0 Jan 2013)
(To accompany Form H.102)

RESCUE AND DISTRESS


Salvage, Lifeboat, Coastguard, etc.

SUPPLIES
Fuel.
(with type, quantities and methods of
delivery)

Fresh water.
(with method of delivery and rate of
supply)

Provisions.

SERVICES
Medical.

Ship Sanitation.

Garbage and slops.

Ship chandlery, tank cleaning, compass


adjustment, hull painting.

COMMUNICATIONS
Nearest airport or airfield.

Port radio and information service. (with


frequencies and hours of operating)

PORT AUTHORITY
Designation, address, telephone, e-mail
address and website.

VIEWS
Photographs (where permitted) of the
approaches, leading marks, the entrance
to the harbour etc.

ADDITIONAL DETAILS

NOTES:

1. Form H.I02A lists the information required for ADMIRALTY Sailing Directions and has been designed to help the
sender and the recipient. The sections should be used as an aide-memoir, being used or followed closely,
whenever appropriate. Where there is insufficient space on the form an additional sheet should be used.

2. Reports which cannot be confirmed or are lacking in certain details should not be withheld. Shortcomings
should be stressed and any firm expectation of being able to check the information on a succeeding voyage should
be mentioned.
HYDROGRAPHIC NOTE FOR
GNSS OBSERVATIONS AGAINST CORRESPONDING BRITISH ADMIRALTY H.102B
(V7.0 Jan 2014)
CHART POSITIONS
(To accompany Form H.102)

Chart/ENC in use
(SEE NOTE 3a) Latitude/Longitude of position read Latitude/Longitude of position read from Additional
Time/Date of
Edition Date & from Chart/ECDIS GNSS Receiver (on WGS84) Information/Remarks
Observation Number /
NM / ENC (SEE NOTE 3b) (SEE NOTE 3c) (SEE NOTE 3d)
ENC
update status
HYDROGRAPHIC NOTE FOR
GNSS OBSERVATIONS AGAINST CORRESPONDING BRITISH ADMIRALTY H.102B
(V7.0 Jan 2014)
CHART POSITIONS
(To accompany Form H.102)

NOTES:
1. This form is designed to assist in the reporting of observed differences between WGS84 datum and the geodetic datum of British
ADMIRALTY Charts by mariners, including yachtsmen and should be submitted as an accompaniment to Form H.102 (full instructions
for the rendering of data are on Form H.102). Where there is insufficient space on the form an additional sheet should be used.

2. Objective of GNSS Data Collection

The UK Hydrographic Office would appreciate the reporting of Global Navigation Satellite Systems (GNSS) positions, referenced to WGS84 datum, at
identifiable locations or features on British ADMIRALTY Charts. Such observations could be used to calculate positional shifts between WGS84 datum and the
geodetic datum for those British ADMIRALTY Charts which it has not yet been possible to compute the appropriate shifts. These would be incorporated in future
new editions or new charts and promulgated by Preliminary Notices to Mariners in the interim.

It is unrealistic to expect that a series of reported WGS84 positions relating to a given chart will enable it to be referenced to that datum with the accuracy
required for geodetic purposes. Nevertheless, this provides adequate accuracy for general navigation, considering the practical limits to the precision of 0.2mm
(probably the best possible under ideal conditions – vessel alongside, good light, sharp dividers etc), this represents 10 metres on the ground at a chart scale of
1:50.000.

It is clear that users prefer to have some indication of the magnitude and direction of the positional shift, together with an assessment of its likely accuracy,
rather than be informed that a definitive answer cannot be formulated. Consequently, where a WGS84 version has not yet been produced, many charts now
carry approximate shifts relating WGS84 datum to the geodetic datum of the chart. Further observations may enable these values to be refined with greater
confidence.

3. Details required

a. It is essential that the chart number, edition date and its correctional state (latest NM) are stated. For ENCs, please state the ENC name and latest
update applied.

b. Position (to 2 decimal places of a minute) of observation point, using chart graticule or, if ungraduated, relative position by bearing/distance from
prominent charted features (navigation lights, trig. points, church spires etc.).

c. Position (to 2 decimal places of a minute) of observation point, using GNSS Receiver. Confirm that GNSS positions are referenced to WGS84 datum.

d. Include GNSS receiver model and aerial type (if known). Also of interest: values of PDOP, HDOP or GDOP displayed (indications of theoretical
quality of position fixing depending upon the distribution of satellites overhead) and any other comments.
HYDROGRAPHIC NOTE ± H.102 INSTRUCTIONS (V9.0 Dec 2017)
1. Mariners are requested to notify the United Kingdom Hydrographic Office (UKHO) when new or suspected dangers to
navigation are discovered, changes observed in aids to navigation, or corrections to publications are seen to be necessary.
Mariners can also report any ENC display issues experienced. The Mariner's Handbook (NP100) Chapter 4 gives general
instructions. The provisions of international and national laws should be complied with when forwarding such reports.
2. Accurate position or knowledge of positional error is of great importance. Where latitude and longitude have been used to
specifically position the details of a report, a full description of the method used to obtain the position should be given. Where
possible the position should be fixed by GPS or Astronomical Observations. A full description of the method, equipment,
time, estimated error and datum (where applicable) used should be given. Where the position has been recorded from a
smart phone or tablet, this is to be specifically mentioned. When position is defined by sextant angles or bearings (true or
magnetic to be specified), more than two should be used to provide a redundancy check. Where position is derived from
Electronic Position Fixing (e.g. LORAN C) or distances observed by radar, the raw readings of the system in use should be
quoted wherever possible. Where position is derived after the event, from other observations and / or Dead Reckoning, the
methodology of deriving the position should be included.
3. Paper Charts: A cutting from the largest scale chart is often the best medium for forwarding details, the alterations and
additions being shown thereon in red. When requested, a new copy will be sent in replacement of a chart that has been
used to forward information, or when extensive observations have involved defacement of the observer's chart. If it is
preferred to show the amendments on a tracing of the largest scale chart (rather than on the chart itself) these should be in
red as above, but adequate details from the chart must be traced in black ink to enable the amendments to be fitted correctly.
4. ENCs: A screen shot of the largest scale usage band ENC with the alterations and additions being shown thereon in red.
If it is to report an issue with the display of an ENC, a screen shot of the affected ENC should be sent along with details of
the ECDIS make, model or age and version in use at the time.
5. When soundings are obtained The Mariner's Handbook (NP100) should where possible be consulted. It is important to
ensure that full details of the method of collection are included with the report. This should include but not limited to:
(a) Make, model and type of echo sounder used.
(b) Whether the echo sounder is set to register depths below the surface or below the keel; in the latter case the vessel's
draught should be given.
(c) Time, date and time zone should be given in order that corrections for the height of the tide may be made where
necessary, or a statement made as to what corrections for tide have already been made.
(d) Where larger amounts of bathymetric data have been gathered, only those areas where a significant difference to
the current chart or ENC should be specifically mentioned on the H102. The full data set may also be sent in, with
an additional note added to this effect. If no significant differences are noted, the bathymetric data may still be of
use, and sent in accordingly. Where full data sets are included, a note as to the data owner and their willingness for
the data to be incorporated into charts and ENCs included.
6. FRU (FKR 6RXQGHUV WKDW XVH HOHFWURQLF µUDQJH JDWLQJ¶ FDUH VKRXOG be taken that the correct range scale and
appropriate gate width are in use. Older electro-mechanical echo sounders frequently record signals from echoes
received back after one or more rotations of the stylus have been completed. Thus, with a set whose maximum range is
500m, an echo recorded at 50m may be from depths of 50m, 550m or even 1050m. Soundings recorded beyond the set's
nominal range can usually be recognised by the following:
(a) the trace being weaker than normal for the depth recorded;
(b) the trace passing through the transmission line;
(c) the feathery nature of the trace.
As a check that apparently shoal soundings are not due to echoes received beyond the set's nominal range,
soundings should be continued until reasonable agreement with charted soundings is reached. However,
soundings received after one or more rotations of the stylus can still be useful and should be submitted if they
show significant differences from charted depths.
7. Reports which cannot be confirmed or are lacking in certain details should not be withheld. Shortcomings should
be stressed and any firm expectation of being able to check the information on a succeeding voyage should be mentioned.
8. Reports of shoal soundings, uncharted dangers and aids to navigation out of order should, at the mariner's discretion, also
be made by radio to the nearest coast radio station. The draught of modern tankers is such that any uncharted depth under
30 metres or 15 fathoms may be of sufficient importance to justify a radio message.
9. Changes to Port Information should be forwarded on Form H.102A and any GPS/Chart Datum observations should be
forwarded on Form H.102B together with Form H.102. Where there is insufficient space on the forms additional sheets
should be used.
10. Reports on ocean currents, magnetic variations and other marine observations should be made in accordance with
The Mariner's Handbook (NP100) Chapter 4 with forms also available at admiralty.co.uk/MSI.
Note. - An acknowledgement or receipt will be sent and the information then used to the best advantage which may mean
immediate action or inclusion in a revision in due course; for these purposes, the UKHO may make reproductions of any
material supplied. When a Notice to Mariners is issued, the sender's ship or name is quoted as authority unless (as
sometimes happens) the information is also received from other authorities or the sender states that they do not want to
be named by using the appropriate tick box on the form. An explanation of the use made of contributions from all parts of
the world would be too great a task and a further communication should only be expected when the information is of
outstanding value or has unusual features.
Hydrographic Note ± H.102
Reporting information affecting ADMIRALTY Maritime Products & Services

For emergency information affecting safety of life at sea forward to: navwarnings@ukho.gov.uk
Or alternatively contact T: +44 (0)1823 353448 (direct line) +44 (0)7989 398345 (mobile) F: +44 (0)1823 322352
For new information affecting all ADMIRALTY Charts and Publications forward to: sdr@ukho.gov.uk
This form H.102 and instructions are available online: admiralty.co.uk/msi

Date Ref. number


Name of ship or sender IMO number
Address and general locality

E-mail / Tel / Fax of sender

Subject

Position
Latitude Longitude
(see Instruction 2)

GPS Datum Accuracy

ADMIRALTY Charts affected Edition

Latest Weekly Edition of


Notices to Mariners (NMs) held
Replacement copy of chart number IS / IS NOT required
(see Instruction 3)
ENCs affected

Latest update disk applied Week:

Make, model and or age of ECDIS if


applicable
Publications affected
(e-NP / DP number, edition number)
Date of latest supplement/update,
page & Light List number etc.
Details of anomaly / observation:

Name of observer / reporter

H.102A submitted Yes No H.102B submitted Yes No

Tick box if not willing to be named as source of this information

Alternatively use our H-Note App located here:


admiralty.co.uk/H-note

You might also like